BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79566_g1_i1 len=2423 path=[1:0-2422]

Length=2423
                                                                      Score     E

gb|EYU39420.1|  hypothetical protein MIMGU_mgv1a002450mg                878   0.0      
ref|XP_007043321.1|  YELLOW STRIPE like 7                               872   0.0      
ref|XP_004148573.1|  PREDICTED: probable metal-nicotianamine tran...    870   0.0      
ref|XP_004163304.1|  PREDICTED: probable metal-nicotianamine tran...    863   0.0      
ref|XP_008461864.1|  PREDICTED: probable metal-nicotianamine tran...    855   0.0      
ref|XP_006484586.1|  PREDICTED: probable metal-nicotianamine tran...    851   0.0      
ref|XP_008340452.1|  PREDICTED: probable metal-nicotianamine tran...    851   0.0      
ref|XP_008360015.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    851   0.0      
ref|XP_006437555.1|  hypothetical protein CICLE_v10030879mg             850   0.0      
ref|XP_007225160.1|  hypothetical protein PRUPE_ppa002368mg             849   0.0      
emb|CDP16865.1|  unnamed protein product                                849   0.0      
gb|KDO52778.1|  hypothetical protein CISIN_1g044922mg                   849   0.0      
ref|XP_009768859.1|  PREDICTED: probable metal-nicotianamine tran...    846   0.0      
gb|KHG05118.1|  putative metal-nicotianamine transporter YSL7 -li...    848   0.0      
gb|EYU27872.1|  hypothetical protein MIMGU_mgv1a019282mg                847   0.0      
ref|XP_008221041.1|  PREDICTED: probable metal-nicotianamine tran...    847   0.0      
ref|XP_009593227.1|  PREDICTED: probable metal-nicotianamine tran...    844   0.0      
ref|XP_009351712.1|  PREDICTED: probable metal-nicotianamine tran...    845   0.0      
ref|XP_002306389.2|  hypothetical protein POPTR_0005s09670g             843   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011022272.1|  PREDICTED: probable metal-nicotianamine tran...    843   0.0      
ref|XP_002532101.1|  oligopeptide transporter, putative                 836   0.0      Ricinus communis
ref|XP_006484556.1|  PREDICTED: probable metal-nicotianamine tran...    833   0.0      
ref|XP_006437556.1|  hypothetical protein CICLE_v10030844mg             834   0.0      
ref|XP_009758111.1|  PREDICTED: probable metal-nicotianamine tran...    831   0.0      
gb|KCW65044.1|  hypothetical protein EUGRSUZ_G02568                     828   0.0      
ref|XP_010068802.1|  PREDICTED: probable metal-nicotianamine tran...    828   0.0      
ref|XP_006350378.1|  PREDICTED: probable metal-nicotianamine tran...    823   0.0      
ref|XP_004231467.1|  PREDICTED: probable metal-nicotianamine tran...    820   0.0      
ref|XP_010650300.1|  PREDICTED: probable metal-nicotianamine tran...    822   0.0      
ref|XP_006359441.1|  PREDICTED: probable metal-nicotianamine tran...    817   0.0      
ref|XP_003556608.1|  PREDICTED: probable metal-nicotianamine tran...    816   0.0      
ref|XP_004298615.1|  PREDICTED: probable metal-nicotianamine tran...    815   0.0      
ref|XP_003556609.1|  PREDICTED: probable metal-nicotianamine tran...    794   0.0      
ref|XP_007153094.1|  hypothetical protein PHAVU_003G006500g             783   0.0      
ref|XP_010101178.1|  putative metal-nicotianamine transporter YSL7      779   0.0      
gb|KDP43290.1|  hypothetical protein JCGZ_24211                         776   0.0      
ref|XP_010253872.1|  PREDICTED: probable metal-nicotianamine tran...    778   0.0      
ref|XP_010245475.1|  PREDICTED: probable metal-nicotianamine tran...    772   0.0      
ref|XP_004289490.1|  PREDICTED: probable metal-nicotianamine tran...    772   0.0      
emb|CAN62811.1|  hypothetical protein VITISV_041555                     767   0.0      Vitis vinifera
gb|EPS73705.1|  hypothetical protein M569_01043                         735   0.0      
ref|XP_011035386.1|  PREDICTED: probable metal-nicotianamine tran...    727   0.0      
ref|XP_006372622.1|  iron transporter-related family protein            725   0.0      
ref|XP_006372354.1|  hypothetical protein POPTR_0017s00810g             724   0.0      
ref|XP_010940334.1|  PREDICTED: probable metal-nicotianamine tran...    724   0.0      
ref|XP_003548294.1|  PREDICTED: probable metal-nicotianamine tran...    723   0.0      
ref|XP_004233770.1|  PREDICTED: probable metal-nicotianamine tran...    723   0.0      
ref|XP_008801345.1|  PREDICTED: probable metal-nicotianamine tran...    724   0.0      
ref|XP_010943908.1|  PREDICTED: probable metal-nicotianamine tran...    723   0.0      
ref|NP_176750.1|  putative metal-nicotianamine transporter YSL7         721   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343309.1|  PREDICTED: probable metal-nicotianamine tran...    721   0.0      
ref|XP_002510093.1|  oligopeptide transporter, putative                 721   0.0      Ricinus communis
ref|XP_008676713.1|  PREDICTED: uncharacterized protein LOC100272...    721   0.0      
dbj|BAE44205.1|  hypothetical protein                                   721   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648859.1|  PREDICTED: probable metal-nicotianamine tran...    719   0.0      
sp|Q6H7J6.1|YSL14_ORYSJ  RecName: Full=Probable metal-nicotianami...    720   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001152285.1|  yellow stripe-like transporter 14A                 719   0.0      Zea mays [maize]
ref|XP_006363210.1|  PREDICTED: probable metal-nicotianamine tran...    718   0.0      
ref|XP_007029356.1|  YELLOW STRIPE like 5                               718   0.0      
gb|ACD77012.1|  metal transporter protein                               717   0.0      Brassica juncea [brown mustard]
ref|XP_011072072.1|  PREDICTED: probable metal-nicotianamine tran...    717   0.0      
ref|XP_009105166.1|  PREDICTED: probable metal-nicotianamine tran...    717   0.0      
ref|XP_006372621.1|  hypothetical protein POPTR_0017s03320g             717   0.0      
ref|XP_010528609.1|  PREDICTED: probable metal-nicotianamine tran...    716   0.0      
ref|XP_010069525.1|  PREDICTED: probable metal-nicotianamine tran...    717   0.0      
gb|KDP45817.1|  hypothetical protein JCGZ_17424                         716   0.0      
ref|XP_010933277.1|  PREDICTED: probable metal-nicotianamine tran...    717   0.0      
gb|AET00398.2|  OPT family oligopeptide transporter                     714   0.0      
ref|XP_007152542.1|  hypothetical protein PHAVU_004G138900g             715   0.0      
ref|XP_004234495.1|  PREDICTED: probable metal-nicotianamine tran...    714   0.0      
ref|XP_003617439.1|  Yellow stripe-like protein 2.8                     714   0.0      
ref|XP_004953195.1|  PREDICTED: probable metal-nicotianamine tran...    715   0.0      
emb|CDY39272.1|  BnaC06g27190D                                          714   0.0      
ref|XP_008805741.1|  PREDICTED: probable metal-nicotianamine tran...    713   0.0      
ref|XP_002446809.1|  hypothetical protein SORBIDRAFT_06g023010          715   0.0      Sorghum bicolor [broomcorn]
ref|XP_002525883.1|  oligopeptide transporter, putative                 714   0.0      Ricinus communis
gb|EYU25678.1|  hypothetical protein MIMGU_mgv1a002252mg                713   0.0      
sp|Q5JQD7.2|YSL12_ORYSJ  RecName: Full=Probable metal-nicotianami...    713   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KDP41617.1|  hypothetical protein JCGZ_16024                         712   0.0      
gb|ABB76761.1|  YSL transporter 1                                       712   0.0      Noccaea caerulescens
ref|XP_003533289.1|  PREDICTED: probable metal-nicotianamine tran...    712   0.0      
ref|XP_004976283.1|  PREDICTED: probable metal-nicotianamine tran...    712   0.0      
ref|XP_009798435.1|  PREDICTED: probable metal-nicotianamine tran...    711   0.0      
ref|XP_009593058.1|  PREDICTED: probable metal-nicotianamine tran...    711   0.0      
ref|XP_003620154.1|  Yellow stripe-like protein 2.1                     711   0.0      
ref|XP_003575422.1|  PREDICTED: probable metal-nicotianamine tran...    710   0.0      
ref|XP_002452492.1|  hypothetical protein SORBIDRAFT_04g026840          711   0.0      Sorghum bicolor [broomcorn]
ref|XP_009794095.1|  PREDICTED: probable metal-nicotianamine tran...    709   0.0      
gb|KDP27275.1|  hypothetical protein JCGZ_21006                         709   0.0      
ref|XP_004515282.1|  PREDICTED: probable metal-nicotianamine tran...    709   0.0      
gb|KEH34580.1|  OPT family oligopeptide transporter                     708   0.0      
ref|XP_006391519.1|  hypothetical protein EUTSA_v10018216mg             708   0.0      
ref|XP_002520094.1|  oligopeptide transporter, putative                 707   0.0      Ricinus communis
ref|XP_008645969.1|  PREDICTED: probable metal-nicotianamine tran...    708   0.0      
ref|XP_010666835.1|  PREDICTED: probable metal-nicotianamine tran...    707   0.0      
ref|XP_009615007.1|  PREDICTED: probable metal-nicotianamine tran...    707   0.0      
ref|XP_004500424.1|  PREDICTED: probable metal-nicotianamine tran...    705   0.0      
ref|XP_011046072.1|  PREDICTED: probable metal-nicotianamine tran...    706   0.0      
ref|XP_010940749.1|  PREDICTED: probable metal-nicotianamine tran...    704   0.0      
ref|XP_011046074.1|  PREDICTED: probable metal-nicotianamine tran...    704   0.0      
ref|XP_008240337.1|  PREDICTED: probable metal-nicotianamine tran...    706   0.0      
ref|XP_006653608.1|  PREDICTED: probable metal-nicotianamine tran...    703   0.0      
gb|EMT06635.1|  Putative metal-nicotianamine transporter YSL14          704   0.0      
ref|XP_009383038.1|  PREDICTED: probable metal-nicotianamine tran...    703   0.0      
ref|XP_007210334.1|  hypothetical protein PRUPE_ppa002002mg             704   0.0      
ref|XP_002886962.1|  hypothetical protein ARALYDRAFT_475677             702   0.0      
dbj|BAJ92335.1|  predicted protein                                      703   0.0      
dbj|BAJ89062.1|  predicted protein                                      702   0.0      
dbj|BAE91892.1|  hypothetical protein                                   702   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009413131.1|  PREDICTED: probable metal-nicotianamine tran...    701   0.0      
ref|XP_011046073.1|  PREDICTED: probable metal-nicotianamine tran...    702   0.0      
ref|XP_011046070.1|  PREDICTED: probable metal-nicotianamine tran...    702   0.0      
ref|XP_006493428.1|  PREDICTED: probable metal-nicotianamine tran...    701   0.0      
ref|XP_006441429.1|  hypothetical protein CICLE_v10019091mg             701   0.0      
ref|XP_002883075.1|  hypothetical protein ARALYDRAFT_479246             701   0.0      
ref|NP_566584.1|  putative metal-nicotianamine transporter YSL5         701   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001054241.1|  Os04g0674600                                       700   0.0      Oryza sativa Japonica Group [Japonica rice]
sp|Q0J932.2|YSL10_ORYSJ  RecName: Full=Probable metal-nicotianami...    699   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY86805.1|  hypothetical protein OsI_08181                          702   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_003580167.1|  PREDICTED: probable metal-nicotianamine tran...    700   0.0      
gb|EPS65244.1|  hypothetical protein M569_09533                         696   0.0      
ref|XP_009384580.1|  PREDICTED: probable metal-nicotianamine tran...    699   0.0      
gb|KDO46150.1|  hypothetical protein CISIN_1g005295mg                   699   0.0      
gb|KFK41018.1|  hypothetical protein AALP_AA2G074700                    698   0.0      
ref|XP_010487657.1|  PREDICTED: probable metal-nicotianamine tran...    699   0.0      
emb|CDY46890.1|  BnaA01g27900D                                          699   0.0      
ref|XP_004976284.1|  PREDICTED: probable metal-nicotianamine tran...    699   0.0      
ref|XP_010551587.1|  PREDICTED: probable metal-nicotianamine tran...    698   0.0      
ref|NP_564525.1|  metal-nicotianamine transporter YSL8                  699   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CBG76262.1|  OO_Ba0005L10-OO_Ba0081K17.13                           698   0.0      Oryza officinalis
ref|XP_009392235.1|  PREDICTED: probable metal-nicotianamine tran...    697   0.0      
ref|XP_009113863.1|  PREDICTED: probable metal-nicotianamine tran...    699   0.0      
ref|XP_010112419.1|  putative metal-nicotianamine transporter YSL7      698   0.0      
ref|XP_010037026.1|  PREDICTED: probable metal-nicotianamine tran...    698   0.0      
ref|XP_010465820.1|  PREDICTED: probable metal-nicotianamine tran...    697   0.0      
gb|AAL09744.1|  AT3g17650/MKP6_20                                       697   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505667.1|  PREDICTED: probable metal-nicotianamine tran...    697   0.0      
ref|XP_006393421.1|  hypothetical protein EUTSA_v10011269mg             697   0.0      
ref|XP_006297072.1|  hypothetical protein CARUB_v10013074mg             697   0.0      
emb|CAH67887.1|  OSIGBa0153E02-OSIGBa0093I20.16                         697   0.0      Oryza sativa [red rice]
gb|KCW57904.1|  hypothetical protein EUGRSUZ_H00651                     696   0.0      
ref|XP_009420946.1|  PREDICTED: probable metal-nicotianamine tran...    696   0.0      
ref|XP_002891428.1|  hypothetical protein ARALYDRAFT_473974             697   0.0      
sp|Q7X660.1|YSL11_ORYSJ  RecName: Full=Probable metal-nicotianami...    697   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001185468.1|  yellow stripe-like transporter 12                  697   0.0      
ref|XP_002446810.1|  hypothetical protein SORBIDRAFT_06g023020          697   0.0      Sorghum bicolor [broomcorn]
ref|XP_006300806.1|  hypothetical protein CARUB_v10019889mg             696   0.0      
ref|XP_010025985.1|  PREDICTED: probable metal-nicotianamine tran...    701   0.0      
gb|KFK36098.1|  hypothetical protein AALP_AA4G077100                    696   0.0      
ref|XP_006306886.1|  hypothetical protein CARUB_v10008440mg             696   0.0      
ref|XP_007211297.1|  hypothetical protein PRUPE_ppa001999mg             696   0.0      
ref|XP_002279707.1|  PREDICTED: probable metal-nicotianamine tran...    696   0.0      Vitis vinifera
gb|AAS00697.1|  metal-nicotianamine transporter YSL8                    696   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008436975.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    694   0.0      
ref|XP_002266657.1|  PREDICTED: probable metal-nicotianamine tran...    695   0.0      Vitis vinifera
dbj|BAE91891.1|  hypothetical protein                                   695   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002277292.1|  PREDICTED: probable metal-nicotianamine tran...    695   0.0      Vitis vinifera
gb|EMT14396.1|  Putative metal-nicotianamine transporter YSL13          695   0.0      
ref|XP_006653609.1|  PREDICTED: probable metal-nicotianamine tran...    693   0.0      
ref|XP_002269403.1|  PREDICTED: probable metal-nicotianamine tran...    694   0.0      Vitis vinifera
ref|XP_004138807.1|  PREDICTED: probable metal-nicotianamine tran...    694   0.0      
gb|ABB76762.1|  YSL transporter 2                                       694   0.0      Noccaea caerulescens
ref|XP_010511122.1|  PREDICTED: probable metal-nicotianamine tran...    693   0.0      
ref|XP_010037024.1|  PREDICTED: probable metal-nicotianamine tran...    694   0.0      
ref|XP_004158540.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    694   0.0      
ref|XP_010551578.1|  PREDICTED: probable metal-nicotianamine tran...    693   0.0      
ref|XP_006406708.1|  hypothetical protein EUTSA_v10020160mg             694   0.0      
ref|XP_002305689.1|  hypothetical protein POPTR_0004s06790g             692   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002269277.1|  PREDICTED: probable metal-nicotianamine tran...    692   0.0      Vitis vinifera
emb|CAE03239.2|  OSJNBa0018M05.14                                       692   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KGN64213.1|  hypothetical protein Csa_1G043160                       692   0.0      
ref|XP_006653020.1|  PREDICTED: probable metal-nicotianamine tran...    692   0.0      
ref|XP_006372353.1|  hypothetical protein POPTR_0017s00810g             691   0.0      
ref|XP_010037025.1|  PREDICTED: probable metal-nicotianamine tran...    692   0.0      
gb|KFK39092.1|  hypothetical protein AALP_AA3G199800                    692   0.0      
ref|XP_004137637.1|  PREDICTED: probable metal-nicotianamine tran...    692   0.0      
ref|XP_011046075.1|  PREDICTED: probable metal-nicotianamine tran...    691   0.0      
ref|NP_001276131.1|  uncharacterized protein LOC100809484               690   0.0      
ref|XP_011035385.1|  PREDICTED: probable metal-nicotianamine tran...    690   0.0      
emb|CDY46051.1|  BnaC01g34980D                                          699   0.0      
emb|CAN72423.1|  hypothetical protein VITISV_014262                     689   0.0      Vitis vinifera
ref|XP_010470452.1|  PREDICTED: probable metal-nicotianamine tran...    689   0.0      
emb|CDY68937.1|  BnaCnng61140D                                          691   0.0      
ref|XP_004299460.1|  PREDICTED: probable metal-nicotianamine tran...    690   0.0      
ref|XP_004165464.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    689   0.0      
ref|XP_009107360.1|  PREDICTED: probable metal-nicotianamine tran...    690   0.0      
gb|EMT24510.1|  Putative metal-nicotianamine transporter YSL13          690   0.0      
ref|NP_001185810.1|  yellow stripe-like transporter 11                  689   0.0      
ref|XP_010675190.1|  PREDICTED: probable metal-nicotianamine tran...    687   0.0      
gb|AEQ28190.1|  yellow stripe-like protein 5                            689   0.0      
gb|KEH34582.1|  OPT family oligopeptide transporter                     687   0.0      
ref|XP_008393519.1|  PREDICTED: probable metal-nicotianamine tran...    687   0.0      
ref|XP_011097988.1|  PREDICTED: probable metal-nicotianamine tran...    686   0.0      
emb|CAJ86097.1|  H0103C06.1                                             685   0.0      Oryza sativa [red rice]
ref|XP_003581442.1|  PREDICTED: probable metal-nicotianamine tran...    686   0.0      
ref|XP_010549024.1|  PREDICTED: probable metal-nicotianamine tran...    684   0.0      
ref|XP_008779403.1|  PREDICTED: probable metal-nicotianamine tran...    684   0.0      
gb|EEE57430.1|  hypothetical protein OsJ_07631                          684   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009135543.1|  PREDICTED: probable metal-nicotianamine tran...    684   0.0      
ref|XP_010461657.1|  PREDICTED: probable metal-nicotianamine tran...    682   0.0      
ref|XP_010479258.1|  PREDICTED: probable metal-nicotianamine tran...    682   0.0      
sp|Q7XKF4.2|YSL13_ORYSJ  RecName: Full=Probable metal-nicotianami...    680   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT24509.1|  Putative metal-nicotianamine transporter YSL12          679   0.0      
emb|CAH67885.1|  OSIGBa0153E02-OSIGBa0093I20.14                         679   0.0      Oryza sativa [red rice]
emb|CDO98563.1|  unnamed protein product                                674   0.0      
gb|EEC78242.1|  hypothetical protein OsI_17899                          676   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMS55053.1|  putative metal-nicotianamine transporter YSL10          677   0.0      
emb|CAN70906.1|  hypothetical protein VITISV_043868                     676   0.0      Vitis vinifera
ref|XP_002449540.1|  hypothetical protein SORBIDRAFT_05g018520          677   0.0      Sorghum bicolor [broomcorn]
ref|XP_010039025.1|  PREDICTED: probable metal-nicotianamine tran...    676   0.0      
ref|XP_003581443.2|  PREDICTED: probable metal-nicotianamine tran...    672   0.0      
gb|KDO52777.1|  hypothetical protein CISIN_1g036864mg                   668   0.0      
ref|XP_004978145.1|  PREDICTED: probable metal-nicotianamine tran...    673   0.0      
gb|AAD49762.2|AC007932_10  F11A17.8                                     676   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHG02257.1|  putative metal-nicotianamine transporter YSL5 -li...    671   0.0      
ref|XP_008669136.1|  PREDICTED: probable metal-nicotianamine tran...    671   0.0      
ref|XP_004978143.1|  PREDICTED: probable metal-nicotianamine tran...    671   0.0      
emb|CAI44637.1|  OSJNBb0065J09.17                                       668   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007146944.1|  hypothetical protein PHAVU_006G083800g             668   0.0      
gb|KHM99726.1|  Putative metal-nicotianamine transporter YSL7           664   0.0      
ref|XP_011072202.1|  PREDICTED: probable metal-nicotianamine tran...    667   0.0      
ref|XP_002448760.1|  hypothetical protein SORBIDRAFT_06g032720          659   0.0      Sorghum bicolor [broomcorn]
ref|XP_008669135.1|  PREDICTED: probable metal-nicotianamine tran...    655   0.0      
gb|EMT17260.1|  Putative metal-nicotianamine transporter YSL11          652   0.0      
ref|XP_004978146.1|  PREDICTED: probable metal-nicotianamine tran...    649   0.0      
emb|CDX82356.1|  BnaA03g34650D                                          646   0.0      
ref|XP_007153095.1|  hypothetical protein PHAVU_003G006500g             643   0.0      
gb|EAZ31384.1|  hypothetical protein OsJ_15512                          646   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFW58894.1|  hypothetical protein ZEAMMB73_605066                    644   0.0      
ref|XP_009402082.1|  PREDICTED: probable metal-nicotianamine tran...    642   0.0      
gb|AFW59877.1|  hypothetical protein ZEAMMB73_955581                    640   0.0      
ref|XP_010032362.1|  PREDICTED: probable metal-nicotianamine tran...    639   0.0      
dbj|BAE91888.1|  hypothetical protein                                   634   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045678.1|  Os02g0116400                                       633   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAD07718.1|  putative iron-phytosiderophore transporter prote...    633   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007153093.1|  hypothetical protein PHAVU_003G006400g             627   0.0      
ref|XP_002446812.1|  hypothetical protein SORBIDRAFT_06g023040          635   0.0      Sorghum bicolor [broomcorn]
ref|XP_008680017.1|  PREDICTED: probable metal-nicotianamine tran...    629   0.0      
gb|EMS54492.1|  putative metal-nicotianamine transporter YSL14          621   0.0      
ref|XP_008663726.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    625   0.0      
gb|EAY84201.1|  hypothetical protein OsI_05581                          619   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004954766.1|  PREDICTED: probable metal-nicotianamine tran...    617   0.0      
ref|XP_003573299.1|  PREDICTED: probable metal-nicotianamine tran...    618   0.0      
ref|XP_002453180.1|  hypothetical protein SORBIDRAFT_04g001180          617   0.0      Sorghum bicolor [broomcorn]
ref|XP_004158539.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    615   0.0      
gb|AGT16058.1|  metal-nicotianamine transporter                         615   0.0      
ref|NP_001053350.1|  Os04g0524500                                       612   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004138639.1|  PREDICTED: probable metal-nicotianamine tran...    613   0.0      
dbj|BAK06445.1|  predicted protein                                      612   0.0      
gb|KCW83950.1|  hypothetical protein EUGRSUZ_B00835                     609   0.0      
ref|XP_001759545.1|  predicted protein                                  608   0.0      
ref|XP_008663393.1|  PREDICTED: probable metal-nicotianamine tran...    603   0.0      
ref|XP_006844631.1|  hypothetical protein AMTR_s00016p00228960          604   0.0      
ref|XP_010112394.1|  putative metal-nicotianamine transporter YSL6      603   0.0      
gb|KGN63126.1|  hypothetical protein Csa_2G404780                       603   0.0      
ref|XP_009405479.1|  PREDICTED: probable metal-nicotianamine tran...    601   0.0      
gb|EMT14346.1|  Putative metal-nicotianamine transporter YSL8           601   0.0      
ref|XP_011098915.1|  PREDICTED: probable metal-nicotianamine tran...    600   0.0      
ref|XP_009346777.1|  PREDICTED: probable metal-nicotianamine tran...    599   0.0      
ref|XP_006372356.1|  hypothetical protein POPTR_0017s00820g             597   0.0      
ref|XP_004975420.1|  PREDICTED: probable metal-nicotianamine tran...    599   0.0      
ref|XP_004231762.1|  PREDICTED: probable metal-nicotianamine tran...    598   0.0      
ref|XP_011098916.1|  PREDICTED: probable metal-nicotianamine tran...    597   0.0      
ref|XP_009346778.1|  PREDICTED: probable metal-nicotianamine tran...    597   0.0      
gb|EYU31834.1|  hypothetical protein MIMGU_mgv1a002047mg                598   0.0      
ref|XP_006648230.1|  PREDICTED: probable metal-nicotianamine tran...    594   0.0      
ref|XP_009613490.1|  PREDICTED: probable metal-nicotianamine tran...    595   0.0      
ref|XP_008379097.1|  PREDICTED: probable metal-nicotianamine tran...    595   0.0      
ref|XP_009757311.1|  PREDICTED: probable metal-nicotianamine tran...    595   0.0      
ref|XP_006365484.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    598   0.0      
ref|XP_002446811.1|  hypothetical protein SORBIDRAFT_06g023030          597   0.0      Sorghum bicolor [broomcorn]
ref|XP_009415879.1|  PREDICTED: probable metal-nicotianamine tran...    597   0.0      
ref|XP_003579626.1|  PREDICTED: probable metal-nicotianamine tran...    594   0.0      
ref|NP_001131175.1|  hypothetical protein                               594   0.0      Zea mays [maize]
ref|XP_010249085.1|  PREDICTED: probable metal-nicotianamine tran...    594   0.0      
gb|EAZ30539.1|  hypothetical protein OsJ_14587                          593   0.0      Oryza sativa Japonica Group [Japonica rice]
sp|Q7XRV2.1|YSL6_ORYSJ  RecName: Full=Probable metal-nicotianamin...    593   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAH66436.1|  OSIGBa0132D06.2                                        593   0.0      Oryza sativa [red rice]
dbj|BAE91886.1|  hypothetical protein                                   593   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053351.1|  Os04g0524600                                       589   0.0      
ref|XP_010913001.1|  PREDICTED: probable metal-nicotianamine tran...    593   0.0      
gb|EEC77667.1|  hypothetical protein OsI_16700                          589   0.0      
ref|XP_006338712.1|  PREDICTED: probable metal-nicotianamine tran...    593   0.0      
gb|AEQ28191.1|  yellow stripe-like protein 6                            593   0.0      
ref|XP_004514626.1|  PREDICTED: probable metal-nicotianamine tran...    592   0.0      
ref|XP_003622146.1|  Yellow stripe-like protein 1.1                     589   0.0      
ref|XP_008450132.1|  PREDICTED: probable metal-nicotianamine tran...    589   0.0      
ref|XP_007031922.1|  YELLOW STRIPE like 6                               589   0.0      
ref|NP_566806.1|  putative metal-nicotianamine transporter YSL6         588   0.0      
emb|CDY00170.1|  BnaC09g01310D                                          588   0.0      
ref|XP_002446309.1|  hypothetical protein SORBIDRAFT_06g013960          588   0.0      
gb|KFK33623.1|  hypothetical protein AALP_AA5G037700                    587   0.0      
ref|XP_004148009.1|  PREDICTED: probable metal-nicotianamine tran...    587   0.0      
emb|CDP18194.1|  unnamed protein product                                588   0.0      
gb|AAM53283.1|  unknown protein                                         587   0.0      
ref|XP_010514385.1|  PREDICTED: probable metal-nicotianamine tran...    587   0.0      
gb|ACE77055.2|  yellow stripe-like protein 6.1                          587   0.0      
ref|XP_010425438.1|  PREDICTED: probable metal-nicotianamine tran...    587   0.0      
ref|XP_001751943.1|  predicted protein                                  587   0.0      
ref|XP_010556294.1|  PREDICTED: probable metal-nicotianamine tran...    587   0.0      
ref|XP_009111552.1|  PREDICTED: probable metal-nicotianamine tran...    587   0.0      
gb|AAM64930.1|  unknown                                                 587   0.0      
ref|XP_006290684.1|  hypothetical protein CARUB_v10016778mg             587   0.0      
ref|XP_010502660.1|  PREDICTED: probable metal-nicotianamine tran...    586   0.0      
ref|XP_002877011.1|  hypothetical protein ARALYDRAFT_904909             586   0.0      
ref|XP_008231092.1|  PREDICTED: probable metal-nicotianamine tran...    586   0.0      
gb|ACL83357.2|  yellow stripe-like protein 6.4                          586   0.0      
ref|XP_009344228.1|  PREDICTED: probable metal-nicotianamine tran...    585   0.0      
gb|KDP41791.1|  hypothetical protein JCGZ_26809                         585   0.0      
ref|XP_008362099.1|  PREDICTED: probable metal-nicotianamine tran...    585   0.0      
ref|XP_006395492.1|  hypothetical protein EUTSA_v10003758mg             585   0.0      
ref|XP_004306307.1|  PREDICTED: probable metal-nicotianamine tran...    585   0.0      
ref|XP_002298639.1|  oligopeptide transporter OPT family protein        584   0.0      
gb|KDO63888.1|  hypothetical protein CISIN_1g005868mg                   584   0.0      
ref|XP_003549112.1|  PREDICTED: probable metal-nicotianamine tran...    584   0.0      
ref|XP_010028979.1|  PREDICTED: probable metal-nicotianamine tran...    583   0.0      
ref|XP_011000961.1|  PREDICTED: probable metal-nicotianamine tran...    583   0.0      
ref|XP_009344229.1|  PREDICTED: probable metal-nicotianamine tran...    583   0.0      
ref|XP_004146239.1|  PREDICTED: metal-nicotianamine transporter Y...    583   0.0      
ref|XP_003553947.1|  PREDICTED: probable metal-nicotianamine tran...    583   0.0      
ref|XP_006447029.1|  hypothetical protein CICLE_v10014497mg             583   0.0      
ref|XP_004165023.1|  PREDICTED: metal-nicotianamine transporter Y...    582   0.0      
ref|XP_010679992.1|  PREDICTED: probable metal-nicotianamine tran...    582   0.0      
ref|XP_007215002.1|  hypothetical protein PRUPE_ppa002401mg             582   0.0      
ref|XP_007161672.1|  hypothetical protein PHAVU_001G088900g             582   0.0      
gb|KGN57644.1|  hypothetical protein Csa_3G238100                       579   0.0      
ref|XP_002274166.1|  PREDICTED: metal-nicotianamine transporter YSL3    579   0.0      
gb|EMT18807.1|  Putative metal-nicotianamine transporter YSL12          579   0.0      
ref|XP_006604157.1|  PREDICTED: probable metal-nicotianamine tran...    578   0.0      
ref|XP_006653335.1|  PREDICTED: probable metal-nicotianamine tran...    596   0.0      
gb|EMS52213.1|  putative metal-nicotianamine transporter YSL13          575   0.0      
emb|CAN77891.1|  hypothetical protein VITISV_016271                     577   0.0      
ref|XP_003579625.1|  PREDICTED: probable metal-nicotianamine tran...    577   0.0      
ref|XP_002981992.1|  hypothetical protein SELMODRAFT_179245             578   0.0      
ref|XP_008456005.1|  PREDICTED: metal-nicotianamine transporter Y...    577   0.0      
ref|XP_002986072.1|  hypothetical protein SELMODRAFT_123451             577   0.0      
emb|CDY20064.1|  BnaA09g01870D                                          585   0.0      
ref|XP_006384094.1|  hypothetical protein POPTR_0004s06780g             570   0.0      
ref|XP_006405407.1|  hypothetical protein EUTSA_v10027673mg             574   0.0      
ref|XP_006487168.1|  PREDICTED: probable metal-nicotianamine tran...    573   0.0      
ref|XP_006423237.1|  hypothetical protein CICLE_v10027961mg             572   0.0      
ref|XP_010501891.1|  PREDICTED: probable metal-nicotianamine tran...    569   0.0      
ref|XP_006491948.1|  PREDICTED: metal-nicotianamine transporter Y...    570   0.0      
ref|XP_006441190.1|  hypothetical protein CICLE_v10019170mg             570   0.0      
ref|XP_006372355.1|  hypothetical protein POPTR_0017s00810g             565   0.0      
ref|XP_009588595.1|  PREDICTED: metal-nicotianamine transporter Y...    569   0.0      
ref|XP_002864249.1|  predicted protein                                  568   0.0      
ref|XP_002870660.1|  hypothetical protein ARALYDRAFT_493877             567   0.0      
ref|XP_009588601.1|  PREDICTED: metal-nicotianamine transporter Y...    567   0.0      
ref|XP_006281523.1|  hypothetical protein CARUB_v10027623mg             567   0.0      
ref|XP_006286072.1|  hypothetical protein CARUB_v10007605mg             567   0.0      
ref|XP_009398090.1|  PREDICTED: probable metal-nicotianamine tran...    565   0.0      
ref|XP_010919337.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    565   0.0      
ref|XP_007220212.1|  hypothetical protein PRUPE_ppa002475mg             565   0.0      
ref|XP_008381368.1|  PREDICTED: metal-nicotianamine transporter Y...    565   0.0      
gb|EMT26359.1|  Putative metal-nicotianamine transporter YSL6           565   0.0      
gb|EYU19676.1|  hypothetical protein MIMGU_mgv1a002464mg                564   0.0      
ref|XP_008234683.1|  PREDICTED: metal-nicotianamine transporter YSL3    564   0.0      
emb|CDP05015.1|  unnamed protein product                                564   0.0      
ref|XP_004172903.1|  PREDICTED: metal-nicotianamine transporter Y...    563   0.0      
gb|KDO53476.1|  hypothetical protein CISIN_1g047730mg                   563   0.0      
ref|NP_198916.2|  putative metal-nicotianamine transporter YSL4         563   0.0      
ref|XP_008444004.1|  PREDICTED: metal-nicotianamine transporter Y...    565   0.0      
ref|XP_004150025.1|  PREDICTED: metal-nicotianamine transporter Y...    563   0.0      
ref|XP_006471126.1|  PREDICTED: metal-nicotianamine transporter Y...    563   0.0      
ref|XP_008456006.1|  PREDICTED: metal-nicotianamine transporter Y...    562   0.0      
ref|XP_006431856.1|  hypothetical protein CICLE_v10003961mg             562   0.0      
dbj|BAF48331.1|  putative yellow stripe-like protein                    562   0.0      
ref|XP_010441262.1|  PREDICTED: probable metal-nicotianamine tran...    561   0.0      
ref|XP_008376798.1|  PREDICTED: metal-nicotianamine transporter YSL3    561   0.0      
ref|XP_010267463.1|  PREDICTED: metal-nicotianamine transporter Y...    561   0.0      
ref|XP_009763789.1|  PREDICTED: metal-nicotianamine transporter Y...    561   0.0      
gb|KDP30688.1|  hypothetical protein JCGZ_16395                         561   0.0      
gb|KEH26876.1|  OPT family oligopeptide transporter                     556   0.0      
ref|XP_002993573.1|  hypothetical protein SELMODRAFT_137276             560   0.0      
ref|XP_010436039.1|  PREDICTED: probable metal-nicotianamine tran...    561   0.0      
ref|XP_007039161.1|  YELLOW STRIPE like 3 isoform 2                     560   0.0      
ref|XP_010450578.1|  PREDICTED: probable metal-nicotianamine tran...    560   0.0      
ref|XP_006581667.1|  PREDICTED: metal-nicotianamine transporter Y...    560   0.0      
gb|ADE76428.1|  unknown                                                 558   0.0      
gb|KDP22031.1|  hypothetical protein JCGZ_03001                         555   0.0      
gb|AEQ28192.1|  yellow stripe-like protein 3                            559   0.0      
gb|ABB76763.1|  YSL transporter 3                                       559   0.0      
ref|XP_008803948.1|  PREDICTED: probable metal-nicotianamine tran...    559   0.0      
ref|NP_200167.2|  metal-nicotianamine transporter YSL3                  559   0.0      
gb|ABD04075.1|  YSL transporter 3                                       559   0.0      
ref|XP_007136481.1|  hypothetical protein PHAVU_009G048800g             559   0.0      
ref|XP_002992748.1|  hypothetical protein SELMODRAFT_269976             558   0.0      
ref|XP_010442922.1|  PREDICTED: metal-nicotianamine transporter Y...    559   0.0      
ref|XP_002274559.2|  PREDICTED: probable metal-nicotianamine tran...    559   0.0      
ref|XP_010537055.1|  PREDICTED: metal-nicotianamine transporter Y...    559   0.0      
ref|XP_009351940.1|  PREDICTED: metal-nicotianamine transporter Y...    558   0.0      
ref|XP_009765494.1|  PREDICTED: metal-nicotianamine transporter Y...    558   0.0      
gb|AFU82908.1|  yellow stripe-like transporter 3.1                      558   0.0      
ref|XP_009361313.1|  PREDICTED: metal-nicotianamine transporter YSL2    558   0.0      
ref|XP_010482755.1|  PREDICTED: metal-nicotianamine transporter Y...    558   0.0      
gb|EYU25660.1|  hypothetical protein MIMGU_mgv1a003894mg                553   0.0      
ref|XP_009765519.1|  PREDICTED: metal-nicotianamine transporter Y...    557   0.0      
ref|XP_006578879.1|  PREDICTED: metal-nicotianamine transporter Y...    557   0.0      
gb|AAS00695.1|  metal-nicotianamine transporter YSL6                    557   0.0      
ref|XP_002515673.1|  oligopeptide transporter, putative                 557   0.0      
ref|XP_003523338.2|  PREDICTED: metal-nicotianamine transporter Y...    557   0.0      
ref|XP_010252366.1|  PREDICTED: metal-nicotianamine transporter YSL2    557   0.0      
dbj|BAB09702.1|  unnamed protein product                                556   0.0      
gb|KHG05098.1|  Metal-nicotianamine transporter YSL3 -like protein      556   0.0      
ref|XP_010537056.1|  PREDICTED: metal-nicotianamine transporter Y...    556   0.0      
gb|KFK28976.1|  hypothetical protein AALP_AA7G072600                    556   0.0      
gb|KHN19530.1|  Metal-nicotianamine transporter YSL3                    556   0.0      
ref|XP_006844634.1|  hypothetical protein AMTR_s00016p00229620          556   0.0      
ref|XP_009794096.1|  PREDICTED: probable metal-nicotianamine tran...    551   0.0      
ref|XP_010671364.1|  PREDICTED: metal-nicotianamine transporter Y...    555   0.0      
gb|KHG22766.1|  putative metal-nicotianamine transporter YSL6 -li...    552   0.0      
ref|XP_009615008.1|  PREDICTED: probable metal-nicotianamine tran...    549   0.0      
ref|XP_002872112.1|  hypothetical protein ARALYDRAFT_489303             553   0.0      
ref|XP_003551122.2|  PREDICTED: metal-nicotianamine transporter Y...    553   0.0      
ref|XP_006441189.1|  hypothetical protein CICLE_v10019170mg             552   0.0      
ref|XP_009415880.1|  PREDICTED: probable metal-nicotianamine tran...    552   0.0      
ref|XP_006491954.1|  PREDICTED: metal-nicotianamine transporter Y...    552   0.0      
gb|KDO46151.1|  hypothetical protein CISIN_1g005295mg                   548   0.0      
ref|XP_006283265.1|  hypothetical protein CARUB_v10004301mg             552   0.0      
emb|CDY35455.1|  BnaC03g62050D                                          552   0.0      
gb|AES72566.2|  OPT family oligopeptide transporter                     552   0.0      
ref|XP_002869737.1|  hypothetical protein ARALYDRAFT_492451             552   0.0      
ref|NP_567694.2|  metal-nicotianamine transporter YSL1                  552   0.0      
ref|XP_010035301.1|  PREDICTED: metal-nicotianamine transporter Y...    551   0.0      
ref|XP_006601048.1|  PREDICTED: metal-nicotianamine transporter Y...    552   0.0      
ref|XP_004309105.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    558   0.0      
gb|AAK62460.1|AF387015_1  putative protein                              551   0.0      
ref|XP_010445905.1|  PREDICTED: metal-nicotianamine transporter Y...    551   0.0      
ref|XP_006287225.1|  hypothetical protein CARUB_v10000403mg             551   0.0      
ref|XP_010433812.1|  PREDICTED: metal-nicotianamine transporter Y...    551   0.0      
ref|XP_006394695.1|  hypothetical protein EUTSA_v10003781mg             550   0.0      
ref|XP_010415119.1|  PREDICTED: probable metal-nicotianamine tran...    546   0.0      
ref|XP_010439083.1|  PREDICTED: metal-nicotianamine transporter YSL1    550   0.0      
ref|XP_003602315.1|  YSL transporter                                    556   0.0      
gb|KCW48661.1|  hypothetical protein EUGRSUZ_K02316                     546   0.0      
ref|XP_010034897.1|  PREDICTED: metal-nicotianamine transporter Y...    550   0.0      
ref|XP_010448607.1|  PREDICTED: metal-nicotianamine transporter Y...    550   0.0      
ref|NP_197826.2|  metal-nicotianamine transporter YSL2                  550   0.0      
gb|AAS00691.1|  metal-nicotianamine transporter YSL1                    550   0.0      
ref|XP_002318472.2|  hypothetical protein POPTR_0012s03180g             548   0.0      
ref|XP_009109308.1|  PREDICTED: metal-nicotianamine transporter Y...    548   0.0      
ref|NP_001168540.1|  hypothetical protein                               548   0.0      
ref|XP_008668329.1|  PREDICTED: hypothetical protein isoform X2         549   0.0      
ref|XP_006593837.1|  PREDICTED: metal-nicotianamine transporter Y...    548   0.0      
emb|CDY03488.1|  BnaC01g15940D                                          548   0.0      
ref|XP_004495506.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    548   0.0      
ref|XP_006413472.1|  hypothetical protein EUTSA_v10024600mg             548   0.0      
ref|XP_011043724.1|  PREDICTED: metal-nicotianamine transporter Y...    547   0.0      
ref|NP_001053449.2|  Os04g0542200                                       546   0.0      
gb|KGN65329.1|  hypothetical protein Csa_1G329900                       545   0.0      
sp|Q7XUJ2.2|YSL9_ORYSJ  RecName: Full=Probable metal-nicotianamin...    547   0.0      
ref|XP_006401691.1|  hypothetical protein EUTSA_v10012886mg             547   0.0      
ref|XP_009137708.1|  PREDICTED: metal-nicotianamine transporter Y...    547   0.0      
ref|XP_010658081.1|  PREDICTED: YS1-like protein-like isoform X1        546   1e-180   
emb|CAH67443.1|  H0501D11.7                                             547   1e-180   
emb|CDX76329.1|  BnaA08g10710D                                          546   1e-180   
emb|CDY24797.1|  BnaA08g15130D                                          546   1e-180   
emb|CAN77515.1|  hypothetical protein VITISV_013366                     546   1e-180   
ref|XP_007039160.1|  YELLOW STRIPE like 3 isoform 1                     546   2e-180   
ref|XP_009137713.1|  PREDICTED: metal-nicotianamine transporter Y...    546   2e-180   
emb|CBI34579.3|  unnamed protein product                                546   2e-180   
emb|CDX96232.1|  BnaC02g14190D                                          546   2e-180   
ref|XP_007039403.1|  YELLOW STRIPE like 1 isoform 1                     545   2e-180   
ref|XP_009150965.1|  PREDICTED: metal-nicotianamine transporter YSL2    545   2e-180   
gb|EMT12341.1|  Putative metal-nicotianamine transporter YSL6           545   3e-180   
ref|XP_004960104.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    541   5e-180   
ref|XP_010493593.1|  PREDICTED: metal-nicotianamine transporter Y...    545   5e-180   
ref|XP_006593833.1|  PREDICTED: metal-nicotianamine transporter Y...    545   6e-180   
ref|XP_007161580.1|  hypothetical protein PHAVU_001G081600g             544   9e-180   
emb|CDY14371.1|  BnaA10g06840D                                          544   1e-179   
ref|XP_006593836.1|  PREDICTED: metal-nicotianamine transporter Y...    543   2e-179   
ref|NP_001268107.1|  YS1-like protein-like                              543   2e-179   
ref|XP_010493592.1|  PREDICTED: metal-nicotianamine transporter Y...    543   2e-179   
ref|XP_011082339.1|  PREDICTED: metal-nicotianamine transporter Y...    543   2e-179   
ref|XP_003556858.1|  PREDICTED: metal-nicotianamine transporter Y...    543   3e-179   
gb|EYU45295.1|  hypothetical protein MIMGU_mgv1a002502mg                543   3e-179   
emb|CDY20248.1|  BnaC09g29910D                                          543   3e-179   
ref|XP_011082340.1|  PREDICTED: metal-nicotianamine transporter Y...    543   3e-179   
ref|XP_011082337.1|  PREDICTED: metal-nicotianamine transporter Y...    543   3e-179   
ref|XP_009763790.1|  PREDICTED: metal-nicotianamine transporter Y...    542   4e-179   
ref|XP_007151963.1|  hypothetical protein PHAVU_004G090100g             542   7e-179   
ref|XP_009119903.1|  PREDICTED: metal-nicotianamine transporter YSL3    541   1e-178   
gb|KFK27715.1|  hypothetical protein AALP_AA8G420300                    541   1e-178   
ref|XP_010318047.1|  PREDICTED: metal-nicotianamine transporter Y...    541   1e-178   
emb|CDY66980.1|  BnaCnng53010D                                          536   2e-178   
dbj|BAB09731.1|  EspB-like protein                                      540   3e-178   
ref|XP_010454748.1|  PREDICTED: metal-nicotianamine transporter Y...    540   3e-178   
ref|XP_009397635.1|  PREDICTED: probable metal-nicotianamine tran...    540   6e-178   
gb|KEH35475.1|  OPT family oligopeptide transporter                     539   7e-178   
ref|XP_006606419.1|  PREDICTED: metal-nicotianamine transporter Y...    539   8e-178   
gb|KHN04996.1|  Metal-nicotianamine transporter YSL1                    538   1e-177   
ref|XP_011075924.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    538   2e-177   
gb|EMT09335.1|  Putative metal-nicotianamine transporter YSL6           537   2e-177   
ref|XP_003556427.1|  PREDICTED: metal-nicotianamine transporter Y...    538   2e-177   
ref|XP_006653627.1|  PREDICTED: probable metal-nicotianamine tran...    536   3e-177   
gb|KEH16132.1|  OPT family oligopeptide transporter                     537   5e-177   
ref|XP_010671369.1|  PREDICTED: metal-nicotianamine transporter Y...    536   5e-177   
ref|XP_004976408.1|  PREDICTED: probable metal-nicotianamine tran...    536   6e-177   
ref|XP_004976407.1|  PREDICTED: probable metal-nicotianamine tran...    537   7e-177   



>gb|EYU39420.1| hypothetical protein MIMGU_mgv1a002450mg [Erythranthe guttata]
Length=673

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/670 (72%), Positives = 567/670 (85%), Gaps = 13/670 (2%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S E+ FE+  +PSW+NQ+TIRAM TS++LSA+FN IVCKLNL+TGVIPSLNVAAGLLG
Sbjct  13    VASLEKAFEETAVPSWQNQITIRAMVTSVLLSAVFNVIVCKLNLSTGVIPSLNVAAGLLG  72

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             FA++K +T L+ K G LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMSP  AAQA
Sbjct  73    FAMVKGYTVLIQKCGYLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPITAAQA  132

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
             E+GN P NVK LSIGWM+ FL+ VSFVGLFSIVPLRK+MIL+YKLTYPSGTATAYLINSF
Sbjct  133   ETGNTPINVKQLSIGWMMTFLFTVSFVGLFSIVPLRKVMILRYKLTYPSGTATAYLINSF  192

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA+LAK+QV  LFK F  SFL+  FQWFF+A DGCGFSSFPTFGL AY QRFYFDF
Sbjct  193   HTPKGARLAKKQVWVLFKSFVGSFLWACFQWFFSAADGCGFSSFPTFGLAAYKQRFYFDF  252

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP MVNVSLLIGAI+SWG++WP+I +K+G WY   L +SSL GIQGY+VF
Sbjct  253   SATYVGVGMICPYMVNVSLLIGAILSWGVLWPVIESKKGDWYSAKLPASSLHGIQGYRVF  312

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             LAIAMMLGDGLF+  YM++VT  SFM+++  ++        + DE       ++ ++D +
Sbjct  313   LAIAMMLGDGLFHVVYMVIVTLRSFMQQKSQKE--------LIDE-----STEIGNYDEK  359

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             +R   FLKD IPN VA+ GY+ LA ++I  +P IF  LKWY + VAYA+APILAFCNAYG
Sbjct  360   KRMEYFLKDQIPNTVAIAGYVVLAGISIAVIPQIFHQLKWYQVLVAYAIAPILAFCNAYG  419

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLASNYGKIAIL+FSSWVG D GGVLAGLASCGVMMSIVST SDLMQDFKTGYL
Sbjct  420   CGLTDWSLASNYGKIAILVFSSWVGLDQGGVLAGLASCGVMMSIVSTASDLMQDFKTGYL  479

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVD  680
             TL+S  +MFFSQV GTA+GC L+PLVFW+F+KAY +GD   +YPAPYA +YR IALLGV+
Sbjct  480   TLSSARSMFFSQVFGTAIGCVLSPLVFWVFFKAYSVGDPEGSYPAPYALMYRGIALLGVE  539

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NCL L I FF A++ +N+ +EV++KYETKYR+YRFIP+PMCMAIPFYLG YFA
Sbjct  540   GFSSLPKNCLKLVIIFFFASVVMNLVTEVMKKYETKYRIYRFIPSPMCMAIPFYLGAYFA  599

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMC+GSLILFVW+ KNK+ AKDFGPAVASGLICG+SLWGIPAA+ ALAGV+APICMKFL
Sbjct  600   IDMCIGSLILFVWQRKNKKSAKDFGPAVASGLICGDSLWGIPAAVFALAGVQAPICMKFL  659

Query  319   SAAANAKLES  290
             SA+AN KL++
Sbjct  660   SASANNKLDA  669



>ref|XP_007043321.1| YELLOW STRIPE like 7 [Theobroma cacao]
 gb|EOX99152.1| YELLOW STRIPE like 7 [Theobroma cacao]
Length=694

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/665 (73%), Positives = 560/665 (84%), Gaps = 6/665 (1%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F   ++PSW NQ+T+RA+ TSL+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA++
Sbjct  30    EDAFRNTQVPSWTNQITLRAVVTSLLLSLVFNFIVCKLNLTTGVIPSLNVAAGLLGFAIV  89

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K+WT  L K G LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMSP +A Q +SGN
Sbjct  90    KAWTTTLAKVGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPLVAGQGDSGN  149

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P NVK LSIGWM+ FL+VVSFVGLFSIVPLRK+MILKYKLTYPSGTATAYLINSFHTP 
Sbjct  150   TPENVKKLSIGWMMGFLFVVSFVGLFSIVPLRKIMILKYKLTYPSGTATAYLINSFHTPK  209

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+QV  LFK F FSFLF  FQWF+ A DGCGFS+FPTFGL+A+ +RFYFDFSSTY
Sbjct  210   GAKLAKKQVVYLFKSFVFSFLFAFFQWFYTAVDGCGFSNFPTFGLQAFNKRFYFDFSSTY  269

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVNVSLLIGAIISWGI+WP+I +K+GIWY  NLS SSL GIQGY+VF+AIA
Sbjct  270   VGVGMICPYMVNVSLLIGAIISWGIMWPMIESKKGIWYSANLSPSSLHGIQGYRVFIAIA  329

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             MMLGDGL++  +M++ T  S + +  S+ +   +    D      + AQ+ ++D +RRT 
Sbjct  330   MMLGDGLYHVLFMLIKTIHSLIAKNFSKDSSVVTPDVTD------QAAQIANYDERRRTE  383

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IPN VA+GGYI LA ++IIAVPFIF  LKWYHI VAYA+AP+LAFCNAYGCGLT
Sbjct  384   YFLKDQIPNKVAMGGYIVLAVISIIAVPFIFHQLKWYHILVAYAIAPVLAFCNAYGCGLT  443

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLASNYGK+AI+IFSSWVG ++GGV+AGLASCGVMMSIVST SDLMQDFKTGYLTL+S
Sbjct  444   DWSLASNYGKLAIIIFSSWVGLEHGGVIAGLASCGVMMSIVSTASDLMQDFKTGYLTLSS  503

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MFFSQV GTAMGC LTPLVFW FY AYP+GD N  YPAPY  +YR IALLGVDG  S
Sbjct  504   PRSMFFSQVLGTAMGCFLTPLVFWFFYNAYPIGDPNGTYPAPYGLLYRGIALLGVDGISS  563

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP NCLNL IGFF+A I IN+  E L++YET+  +YRFIP+PMCMAIPFYLGGYFAIDMC
Sbjct  564   LPKNCLNLVIGFFLAGIFINLLQEFLKRYETRLGIYRFIPSPMCMAIPFYLGGYFAIDMC  623

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             +GSLILF+W  KN+Q+A DF PA+ASGLICG+SLW +PAAILAL  V  PICMKFLSA+ 
Sbjct  624   IGSLILFLWERKNRQRATDFAPAIASGLICGDSLWSVPAAILALLNVNPPICMKFLSASV  683

Query  307   NAKLE  293
             NAK++
Sbjct  684   NAKVD  688



>ref|XP_004148573.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
 gb|KGN58517.1| hypothetical protein Csa_3G654470 [Cucumis sativus]
Length=684

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/667 (73%), Positives = 565/667 (85%), Gaps = 13/667 (2%)
 Frame = -2

Query  2290  TERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  2111
              E  F+ +E+PSW+NQ+T RA+FTS +LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA+
Sbjct  27    VEDAFKNLEVPSWRNQITFRALFTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  2110  IKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESG  1931
             +K +T++L + GL+KQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  IAAQAE G
Sbjct  87    LKGYTSILDQLGLMKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQAEEG  146

Query  1930  NIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  1751
             N+P N+K LS+GWM+ FL+VVSFVGLFSIVPLRKMMI+KYKLTYPSGTATAYLINSFHTP
Sbjct  147   NMPINIKKLSVGWMIGFLFVVSFVGLFSIVPLRKMMIIKYKLTYPSGTATAYLINSFHTP  206

Query  1750  NGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSST  1571
              GAKLAK+QVA LFK F FSF+F  FQWFFAA DGCGFSSFPTFGL+AYA+RFYFDFSST
Sbjct  207   KGAKLAKKQVAVLFKSFCFSFVFALFQWFFAAADGCGFSSFPTFGLQAYAKRFYFDFSST  266

Query  1570  YVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAI  1391
             YVGVGM+CP MVN+SLL+GAIISWGI+WP+I  ++G WY  +LS+SSL GIQGY+VF+AI
Sbjct  267   YVGVGMICPFMVNLSLLLGAIISWGIMWPLIELRKGDWYNASLSASSLHGIQGYRVFIAI  326

Query  1390  AMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRT  1211
             AMMLGDGL++  +M+  T  S  K++    N  +SL             ++ D+D +RR 
Sbjct  327   AMMLGDGLYHVCFMLFQTFYSLSKQKSGSGNADSSL-------------EITDYDARRRM  373

Query  1210  HNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGL  1031
               FLKD IPN VA+ GY+ LAA++IIAVP IF  LKWYH+ VAY +AP+LAFCNAYGCGL
Sbjct  374   EYFLKDQIPNWVALLGYVILAAISIIAVPLIFHQLKWYHVLVAYVIAPVLAFCNAYGCGL  433

Query  1030  TDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLA  851
             TDWSLASNYGK AI+IFSSWVG  NGGV+AGLASCGVMMSIVST SDLMQDFKTGYLTLA
Sbjct  434   TDWSLASNYGKFAIIIFSSWVGLGNGGVIAGLASCGVMMSIVSTASDLMQDFKTGYLTLA  493

Query  850   SPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFG  671
             SP +MFFSQVAGTAMGC L+PLVFW F+KAY +GD   +YPAPY  +YR IALLGV+G  
Sbjct  494   SPRSMFFSQVAGTAMGCVLSPLVFWFFFKAYNIGDPEGSYPAPYGLMYRGIALLGVEGVS  553

Query  670   SLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDM  491
             SLP NCL LAI FFV AI INI  +VL K+ETK+R+YRFIP+PMCMAIPFYLG YFAIDM
Sbjct  554   SLPKNCLTLAICFFVGAIVINIIRDVLHKFETKFRIYRFIPSPMCMAIPFYLGAYFAIDM  613

Query  490   CVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAA  311
             CVGSLILF+W+ KNK +A +F PAVASGLICGESLW +PAAILALAGVKAP+CMKFLS++
Sbjct  614   CVGSLILFIWQRKNKVKAGEFAPAVASGLICGESLWSVPAAILALAGVKAPLCMKFLSSS  673

Query  310   ANAKLES  290
              NAK+++
Sbjct  674   TNAKVDA  680



>ref|XP_004163304.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=691

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/674 (72%), Positives = 565/674 (84%), Gaps = 20/674 (3%)
 Frame = -2

Query  2290  TERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  2111
              E  F+ +E+PSW+NQ+T RA+FTS +LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA+
Sbjct  27    VEDAFKNLEVPSWRNQITFRALFTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  2110  IKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESG  1931
             +K +T++L + GL+KQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  IAAQAE G
Sbjct  87    LKGYTSILDQLGLMKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQAEEG  146

Query  1930  NIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  1751
             N+P N+K LS+GWM+ FL+VVSFVGLFSIVPLRKMMI+KYKLTYPSGTATAYLINSFHTP
Sbjct  147   NMPINIKKLSVGWMIGFLFVVSFVGLFSIVPLRKMMIIKYKLTYPSGTATAYLINSFHTP  206

Query  1750  NGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSST  1571
              GAKLAK+QVA LFK F FSF+F  FQWFFAA DGCGFSSFPTFGL+AYA+RFYFDFSST
Sbjct  207   KGAKLAKKQVAVLFKSFCFSFVFALFQWFFAAADGCGFSSFPTFGLQAYAKRFYFDFSST  266

Query  1570  YVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV----  1403
             YVGVGM+CP MVN+SLL+GAIISWGI+WP+I  ++G WY  +LS+SSL GIQGY+V    
Sbjct  267   YVGVGMICPFMVNLSLLLGAIISWGIMWPLIELRKGDWYNASLSASSLHGIQGYRVPLSL  326

Query  1402  ---FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED  1232
                F+AIAMMLGDGL++  +M+  T  S  K++    N  +SL             ++ D
Sbjct  327   SFCFIAIAMMLGDGLYHVCFMLFQTFYSLSKQKSGSGNADSSL-------------EITD  373

Query  1231  FDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFC  1052
             +D +RR   FLKD IPN VA+ GY+ LAA++IIAVP IF  LKWYH+ VAY +AP+LAFC
Sbjct  374   YDARRRMEYFLKDQIPNWVALLGYVILAAISIIAVPLIFHQLKWYHVLVAYVIAPVLAFC  433

Query  1051  NAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFK  872
             NAYGCGLTDWSLASNYGK AI+IFSSWVG  NGGV+AGLASCGVMMSIVST SDLMQDFK
Sbjct  434   NAYGCGLTDWSLASNYGKFAIIIFSSWVGLGNGGVIAGLASCGVMMSIVSTASDLMQDFK  493

Query  871   TGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiAL  692
             TGYLTLASP +MFFSQVAGTAMGC L+PLVFW F+KAY +GD   +YPAPY  +YR IAL
Sbjct  494   TGYLTLASPRSMFFSQVAGTAMGCVLSPLVFWFFFKAYNIGDPEGSYPAPYGLMYRGIAL  553

Query  691   LGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLG  512
             LGV+G  SLP NCL LAI FFV AI INI  +VL K+ETK+R+YRFIP+PMCMAIPFYLG
Sbjct  554   LGVEGVSSLPKNCLTLAICFFVGAIVINIIRDVLHKFETKFRIYRFIPSPMCMAIPFYLG  613

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
              YFAIDMCVGSLILF+W+ KNK +A +F PAVASGLICGESLW +PAAILALAGVKAP+C
Sbjct  614   AYFAIDMCVGSLILFIWQRKNKVKAGEFAPAVASGLICGESLWSVPAAILALAGVKAPLC  673

Query  331   MKFLSAAANAKLES  290
             MKFLS++ NAK+++
Sbjct  674   MKFLSSSTNAKVDA  687



>ref|XP_008461864.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Cucumis 
melo]
Length=684

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/667 (73%), Positives = 563/667 (84%), Gaps = 13/667 (2%)
 Frame = -2

Query  2290  TERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  2111
              E  F+ +E+PSW+NQ+T RA+FTS VLS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA+
Sbjct  27    VEDAFKNLEVPSWRNQITFRALFTSFVLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  2110  IKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESG  1931
             +K +T++L + GL+KQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  IAAQAE G
Sbjct  87    LKGYTSILEQLGLMKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQAEEG  146

Query  1930  NIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  1751
             N+P N+K LS+GWM+ FL+VVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP
Sbjct  147   NMPINIKKLSVGWMIGFLFVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  206

Query  1750  NGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSST  1571
              GAKLAK+QVA LFK F FSFLF  FQWFFAA DGCGFSSFPTFGL+AYA+RFYFDFSST
Sbjct  207   KGAKLAKKQVAVLFKSFCFSFLFAMFQWFFAAADGCGFSSFPTFGLQAYAKRFYFDFSST  266

Query  1570  YVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAI  1391
             YVGVGM+CP MVN+SLL+GAIISWGI+WP+I  ++G WY  +LS+SSL GIQGY+VF+AI
Sbjct  267   YVGVGMICPFMVNLSLLLGAIISWGIMWPLIELRKGDWYSASLSASSLHGIQGYRVFIAI  326

Query  1390  AMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRT  1211
             AMMLGDGL++  +M+  T  S  K++    N  +              +++ D+D +RR 
Sbjct  327   AMMLGDGLYHVCFMLSQTFYSLSKQKSGCGNADSL-------------SEINDYDARRRI  373

Query  1210  HNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGL  1031
               FLKD IPN VA+ GY+ LAA++II VP IF  LKWYH+ VAYA+AP+LAFCNAYGCGL
Sbjct  374   EYFLKDQIPNWVALLGYVILAAISIITVPLIFHQLKWYHVLVAYAIAPVLAFCNAYGCGL  433

Query  1030  TDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLA  851
             TDWSLASNYGK AI+IFSSWVG  NGGV+AGLASCGVMMSIVST SDLMQDFKTGYLTLA
Sbjct  434   TDWSLASNYGKFAIIIFSSWVGLGNGGVIAGLASCGVMMSIVSTASDLMQDFKTGYLTLA  493

Query  850   SPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFG  671
             SP +MFFSQVAGTAMGC L+PLVFW F+KAY +GD   +YPAPY  +YR IALLGV+G  
Sbjct  494   SPRSMFFSQVAGTAMGCVLSPLVFWFFFKAYNVGDPEGSYPAPYGLMYRGIALLGVEGVS  553

Query  670   SLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDM  491
             +LP NCL LAI FFV AI INI  ++L + ETKYR+YRFIP+PMCMAIPFYLG YFAIDM
Sbjct  554   TLPKNCLTLAICFFVGAIVINIIRDILHRCETKYRIYRFIPSPMCMAIPFYLGAYFAIDM  613

Query  490   CVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAA  311
             CVGSLILF+W+ KNK +A +F PAVASGLICGESLW +PAAILALAGVKAP+CMKFLS++
Sbjct  614   CVGSLILFIWQRKNKVKAGEFAPAVASGLICGESLWSVPAAILALAGVKAPLCMKFLSSS  673

Query  310   ANAKLES  290
              NAK+++
Sbjct  674   TNAKVDA  680



>ref|XP_006484586.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Citrus sinensis]
Length=684

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/665 (71%), Positives = 547/665 (82%), Gaps = 14/665 (2%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F+ VE+PSW+ Q+T RAM TSL+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA++
Sbjct  28    EDAFKDVEVPSWRKQITFRAMVTSLLLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAIV  87

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K+WT+LL K G+LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  +AA A+SGN
Sbjct  88    KAWTSLLEKFGVLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSTRVAALADSGN  147

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P NVK LS+GWM  FL+ VSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP 
Sbjct  148   TPANVKQLSLGWMFGFLFAVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPK  207

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLA +QVA L K F  SF +  FQWFFA  DGCGFSSFPTFGLKAY Q+FYFDFSSTY
Sbjct  208   GAKLAVKQVAVLLKSFCVSFAWAFFQWFFAVADGCGFSSFPTFGLKAYKQKFYFDFSSTY  267

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVN+SL+IGAI+SWGI+WP+I   +G WY  +L  SSL G+QGY+VF+AIA
Sbjct  268   VGVGMICPYMVNISLMIGAILSWGIMWPLIEKNKGSWYSADLPDSSLHGLQGYRVFIAIA  327

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             MMLGDG ++   M++ T  S      +E         V D+       Q+ ++D  +R  
Sbjct  328   MMLGDGFYHVILMLIKTFGSLANAWGAE---------VADQ-----NTQITNYDELQRKE  373

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IPN  A+ GYI LAA++I+ VP IF  LKWYHI VAY +AP+LAFCNAYGCGLT
Sbjct  374   YFLKDQIPNWAALLGYIFLAAISIVVVPIIFHQLKWYHILVAYVIAPVLAFCNAYGCGLT  433

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLASNYGK+AI++FS+WVG D GGV+AGLASCGVMMSIV+T SDLMQDFKTGYLTL+S
Sbjct  434   DWSLASNYGKLAIILFSAWVGLDTGGVIAGLASCGVMMSIVATASDLMQDFKTGYLTLSS  493

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MF SQV GTA+GC +TPLVFWIFYKAYPLGD   ++PAPY  +YR IALLGV G GS
Sbjct  494   PRSMFLSQVIGTALGCFITPLVFWIFYKAYPLGDPEGSFPAPYGQLYRGIALLGVQGLGS  553

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP +C+ LAIGFFVAAIAIN   E L + ETKY++YRFIP+PMCMAIPFYLGGYFAIDMC
Sbjct  554   LPKHCVELAIGFFVAAIAINTIQEALLRRETKYKIYRFIPSPMCMAIPFYLGGYFAIDMC  613

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             VGSLILF+WR KN+  A +F PAVASGLICG+SLWGIPAA+L+LAGV APICMKFLSA+A
Sbjct  614   VGSLILFLWRMKNRTSADNFSPAVASGLICGDSLWGIPAAVLSLAGVNAPICMKFLSASA  673

Query  307   NAKLE  293
             N K++
Sbjct  674   NNKVD  678



>ref|XP_008340452.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Malus 
domestica]
Length=705

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/671 (73%), Positives = 567/671 (85%), Gaps = 3/671 (0%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             + E  F+   +P W  Q+T+R+M TS +LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA
Sbjct  31    NVEEAFKATAVPPWTKQITVRSMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFA  90

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             V+K +TA++ K G LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  IAAQ + 
Sbjct  91    VVKGYTAMIDKCGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQGDL  150

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             GN P N+K L +GWM+ FL+ VSFVGLFSI+PLRKMMILKYKLTYPSGTATAYLINSFHT
Sbjct  151   GNTPINIKKLDVGWMIGFLFAVSFVGLFSIMPLRKMMILKYKLTYPSGTATAYLINSFHT  210

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QVA LFK F FSF F  FQWFFAA DGCGFSSFPTFGLKA+A +FYFDFS+
Sbjct  211   PKGAKLAKKQVAVLFKSFCFSFAFAFFQWFFAAADGCGFSSFPTFGLKAFANKFYFDFSA  270

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CPIMVNVSLL+GAIISWGI+WP+I TK+GIWY  NLS+SSL GIQGY+VF+A
Sbjct  271   TYVGVGMICPIMVNVSLLVGAIISWGIMWPLIETKKGIWYSANLSASSLHGIQGYRVFIA  330

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVD-DEFNKGKGAQL--EDFDG  1223
             IAMMLGDGLF+  YM+ +T  S   +R  +K   +S  PV+ D    G  +++   ++D 
Sbjct  331   IAMMLGDGLFHVVYMLFMTTKSLATQRSEKKLESSSSPPVNLDSVEAGGSSEVVSANYDE  390

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRR   FLKD IP+ VA  GYI LAA++I  VP IFP LKWYH+ VAY +AP+LAFCNAY
Sbjct  391   QRRIEYFLKDQIPSWVAFSGYIVLAAISISVVPLIFPQLKWYHVLVAYLIAPVLAFCNAY  450

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLASNYGK AI+IFS+WVG D+GGV+AGLASCGVMMSIV+T SDLMQDFKTGY
Sbjct  451   GCGLTDWSLASNYGKFAIIIFSAWVGLDHGGVIAGLASCGVMMSIVATASDLMQDFKTGY  510

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGV  683
             LTL+SP +MFFSQV GTAMGC ++PLVFW+FYKAYPLGD +  YPAPY  +YR IALLGV
Sbjct  511   LTLSSPRSMFFSQVFGTAMGCVMSPLVFWVFYKAYPLGDPDGPYPAPYGLMYRGIALLGV  570

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G GSLP NC+ LA+ FF AA+AINI  E+L++YETKYR+YRFIP+PMCMAIPFYLG YF
Sbjct  571   EGVGSLPKNCVVLAVSFFAAAVAINIIIELLQRYETKYRIYRFIPSPMCMAIPFYLGSYF  630

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLIL +WR KN+Q+A DFGPAVASGLICG+SLWG+PAAILA+A VKAPICMKF
Sbjct  631   AIDMCVGSLILVLWRRKNRQKADDFGPAVASGLICGDSLWGVPAAILAIASVKAPICMKF  690

Query  322   LSAAANAKLES  290
             LSA+AN K++S
Sbjct  691   LSASANNKVDS  701



>ref|XP_008360015.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7 [Malus domestica]
Length=705

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/673 (71%), Positives = 560/673 (83%), Gaps = 2/673 (0%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             K  + E  F+   +P W  Q+T+R+M TS +LS +FNFIVCKLNLTTGVIPSLNVAAGLL
Sbjct  29    KKVNVEEAFKYTAVPPWTKQITVRSMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLL  88

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GFAV+K +TA++ K G LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  IAAQ
Sbjct  89    GFAVVKGYTAMIDKCGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQ  148

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
              + GN P N+K L +GWM+ FL+ VSFVGLFSI+PLRKMMI+KYKLTYPSGTATAYLINS
Sbjct  149   GDEGNTPINIKKLDVGWMIGFLFAVSFVGLFSIMPLRKMMIMKYKLTYPSGTATAYLINS  208

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QVA LFK F F+F+F  FQWFFAA DGCGFSSFPTFGLKAYA +FYFD
Sbjct  209   FHTPKGAKLAKKQVAVLFKTFCFTFVFAFFQWFFAAADGCGFSSFPTFGLKAYAHKFYFD  268

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FSSTYVGVGM+CPIMVNVSLL+GAIISWGI+WP+I TK+GIWY  NLS+SSL GIQGY+V
Sbjct  269   FSSTYVGVGMICPIMVNVSLLVGAIISWGIMWPLIETKKGIWYNANLSASSLHGIQGYRV  328

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQL--EDF  1229
             F+AIAMMLGDGLF+  YM+ +T  S M  R  +K   +S     D    G  +++   D+
Sbjct  329   FIAIAMMLGDGLFHVIYMLFMTTKSLMXHRSEKKLETSSPSVNHDSVEAGGSSEVXSADY  388

Query  1228  DGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCN  1049
               +RR   FLKD IP+ VA  GYI LAA++I  VP IFP LKWYH+ VAY +AP+LAFCN
Sbjct  389   GEERRIEYFLKDQIPSWVAFSGYIVLAAISIGVVPLIFPQLKWYHVLVAYLIAPVLAFCN  448

Query  1048  AYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKT  869
             AYGCGLTDWSLASNYGK AI+IFSSWVG D GGV+AGLASCGV MSIVST SDLMQDFKT
Sbjct  449   AYGCGLTDWSLASNYGKFAIIIFSSWVGLDRGGVIAGLASCGVTMSIVSTASDLMQDFKT  508

Query  868   GYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALL  689
             GYLTL+SP +MFFSQV GTAMGC ++PL+FW FYKAY +G+ +  YPAPY  +YR IALL
Sbjct  509   GYLTLSSPRSMFFSQVFGTAMGCVMSPLIFWFFYKAYSIGNPDGPYPAPYGLMYRGIALL  568

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+G GSLP N + LA+ FF AA+A+NI SE+L++YETKYR++RFIPNPMCMAIPFYLG 
Sbjct  569   GVEGVGSLPKNXVTLAVSFFAAAVAMNIISELLQRYETKYRIHRFIPNPMCMAIPFYLGS  628

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDMCVGSLIL++WR KN+Q+A D+GPAVASGLICGESLWG+PAAIL+LA VK PICM
Sbjct  629   YFAIDMCVGSLILYLWRSKNRQKANDYGPAVASGLICGESLWGVPAAILSLASVKPPICM  688

Query  328   KFLSAAANAKLES  290
             KFLSA+ N K++S
Sbjct  689   KFLSASVNKKVDS  701



>ref|XP_006437555.1| hypothetical protein CICLE_v10030879mg [Citrus clementina]
 gb|ESR50795.1| hypothetical protein CICLE_v10030879mg [Citrus clementina]
Length=684

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/665 (71%), Positives = 547/665 (82%), Gaps = 14/665 (2%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F+ VE+PSW+ Q+T RAM TSL+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA++
Sbjct  28    EDAFKDVEVPSWRKQITFRAMVTSLLLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAIV  87

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K+WT+LL K G+LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  +AA A+SGN
Sbjct  88    KAWTSLLEKFGVLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSTRVAALADSGN  147

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P NVK LS+GWM  FL+ VSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP 
Sbjct  148   TPANVKQLSLGWMFGFLFAVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPK  207

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLA +QVA L K F  SF +  FQWFFA  DGCGFSSFPTFGLKAY Q+FYFDFSSTY
Sbjct  208   GAKLAVKQVAVLLKSFCVSFAWAFFQWFFAVADGCGFSSFPTFGLKAYKQKFYFDFSSTY  267

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVN+SL+IGAI+SWGI+WP+I   +G WY  +L  SSL G+QGY+VF+AIA
Sbjct  268   VGVGMICPYMVNISLMIGAILSWGIMWPLIEKNKGSWYSADLPDSSLHGLQGYRVFIAIA  327

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             MMLGDG ++   M++ T  S      +E         V D+       Q+ ++D  +R  
Sbjct  328   MMLGDGFYHVILMLIKTFGSLANAWGAE---------VADQ-----NTQITNYDELQRKE  373

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IPN  A+ GYI LAA++I+ VP IF  LKWYHI VAY +AP+LAFCNAYGCGLT
Sbjct  374   YFLKDQIPNWAALLGYIFLAAISIVVVPIIFHQLKWYHILVAYVIAPVLAFCNAYGCGLT  433

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLASNYGK+AI++FS+WVG D GGV++GLASCGVMMSIV+T SDLMQDFKTGYLTL+S
Sbjct  434   DWSLASNYGKLAIILFSAWVGLDTGGVISGLASCGVMMSIVATASDLMQDFKTGYLTLSS  493

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MF SQV GTA+GC +TPLVFWIFYKAYPLGD   ++PAPY  +YR IALLGV G GS
Sbjct  494   PRSMFLSQVIGTALGCFITPLVFWIFYKAYPLGDPEGSFPAPYGQLYRGIALLGVQGLGS  553

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP +C+ LAIGFFVAAIAIN   E L + ETKY++YRFIP+PMCMAIPFYLGGYFAIDMC
Sbjct  554   LPKHCVELAIGFFVAAIAINTIQEALLRRETKYKIYRFIPSPMCMAIPFYLGGYFAIDMC  613

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             VGSLILF+WR KN+  A +F PAVASGLICG+SLWGIPAA+L+LAGV APICMKFLSA+A
Sbjct  614   VGSLILFLWRMKNRTSADNFSPAVASGLICGDSLWGIPAAVLSLAGVNAPICMKFLSASA  673

Query  307   NAKLE  293
             N K++
Sbjct  674   NNKVD  678



>ref|XP_007225160.1| hypothetical protein PRUPE_ppa002368mg [Prunus persica]
 gb|EMJ26359.1| hypothetical protein PRUPE_ppa002368mg [Prunus persica]
Length=680

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/670 (72%), Positives = 563/670 (84%), Gaps = 4/670 (1%)
 Frame = -2

Query  2290  TERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  2111
              E  F+   +P W  Q+T+RAM TS +LS +FNFIVCKLNLTTGVIPSLNVAAGL+GFAV
Sbjct  8     VEEAFKTTPVPPWTKQITVRAMVTSFLLSIVFNFIVCKLNLTTGVIPSLNVAAGLMGFAV  67

Query  2110  IKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESG  1931
             +K +TA++ K GLLKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMSP IAAQ + G
Sbjct  68    VKGYTAMIEKCGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYILGMSPKIAAQGDEG  127

Query  1930  NIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  1751
             N P N+K L +GWM+ FL+ VSFVGLFSI+ LRKMMI+KYKLTYPSGTATAYLINSFHTP
Sbjct  128   NTPINIKHLDLGWMIGFLFAVSFVGLFSIMALRKMMIIKYKLTYPSGTATAYLINSFHTP  187

Query  1750  NGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSST  1571
              GAKLAK+QV+ LFK F FSF+F  FQWFFA  DGCGFSSFPTFGLKA+A +FYFDFSST
Sbjct  188   KGAKLAKKQVSVLFKSFCFSFVFAFFQWFFATADGCGFSSFPTFGLKAFAHKFYFDFSST  247

Query  1570  YVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAI  1391
             YVGVGM+CP MVN+SLL+G+IISWGI+WP+I  K+GIWY  NLS+SSL GIQGY+VF+AI
Sbjct  248   YVGVGMICPFMVNISLLVGSIISWGIMWPLIEQKKGIWYSANLSASSLHGIQGYRVFIAI  307

Query  1390  AMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVD--DEFNKGKGAQLE-DFDGQ  1220
             AMMLGDGLF+  YM+ +T  S +   +SEK   +S  P    D    G    +  ++D +
Sbjct  308   AMMLGDGLFHVVYMLCLTTKS-LATHKSEKKLDSSSSPSTNPDGLEAGSSEVVSANYDEE  366

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR   FLKD IPN VA+ GY+ALAA++IIAVPFIFP LKWYH+ VAY +AP+LAFCNAYG
Sbjct  367   RRMEYFLKDQIPNWVALVGYVALAAISIIAVPFIFPQLKWYHVLVAYLIAPVLAFCNAYG  426

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGL+DWSLASNYGK AI+IFS+WVG D GGV+AGLA+CGVMMSIVST SDLMQDFKTGYL
Sbjct  427   CGLSDWSLASNYGKFAIIIFSAWVGLDRGGVIAGLAACGVMMSIVSTASDLMQDFKTGYL  486

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVD  680
             TL+SP +MF SQV GTAMGC ++PLVFW FYKAYP+GD   AYPAPY  +YR IALLGV+
Sbjct  487   TLSSPRSMFVSQVFGTAMGCVMSPLVFWFFYKAYPIGDPGGAYPAPYGLMYRGIALLGVE  546

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             G  SLP NC+ LA+ FF AAIAINI SE+L++YETKYR+YRFIP+PMCMAIPFYLG YFA
Sbjct  547   GVSSLPKNCVTLAVSFFAAAIAINIISELLQRYETKYRIYRFIPSPMCMAIPFYLGSYFA  606

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMCVGSLILF+W+ KNKQ+A DF PAVASGLICG+SLWG+PAAILA+ GVKAPICMKFL
Sbjct  607   IDMCVGSLILFLWQRKNKQKADDFAPAVASGLICGDSLWGVPAAILAIVGVKAPICMKFL  666

Query  319   SAAANAKLES  290
             SA+ N K++S
Sbjct  667   SASVNNKVDS  676



>emb|CDP16865.1| unnamed protein product [Coffea canephora]
Length=688

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/663 (71%), Positives = 542/663 (82%), Gaps = 3/663 (0%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+VF+ +E+P W+ Q+T R++FTS VLS +FN +VCKLNLTTGVIPSLNVAAGLLGF 
Sbjct  27    SIEQVFKNIEVPPWRKQITFRSVFTSAVLSFVFNVVVCKLNLTTGVIPSLNVAAGLLGFG  86

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K +T L+ K G+LKQPFTRQENTVIQTCVVASSGIAFSSGTASYML MS  +AAQA+ 
Sbjct  87    FVKFYTTLVQKWGMLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLAMSSRVAAQADV  146

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             GN P NV  L +GW+  FL+ VSF+GLFSIVPLRKMMI+KYKLTYPSGTATA+LINSFHT
Sbjct  147   GNAPINVMKLELGWIYGFLFAVSFIGLFSIVPLRKMMIMKYKLTYPSGTATAFLINSFHT  206

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLA +QV ALF  F  SF F  FQWFFAA DGCGFSSFPTFGL A+ +RFYFDFSS
Sbjct  207   PKGAKLAVKQVRALFYSFGGSFFFAFFQWFFAAGDGCGFSSFPTFGLSAFKKRFYFDFSS  266

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
              YVG GM+CP MVN+SLL+GA++SWGI+WP+I  K+G WY  +L  +SL GIQGY+VFL 
Sbjct  267   VYVGAGMICPYMVNISLLVGAVLSWGIMWPLIEQKKGSWYSADLKPTSLHGIQGYRVFLG  326

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA MLGDGLF+  YM+VVT  SF+ R+RS     +++ P  DE ++   +QL ++D +RR
Sbjct  327   IATMLGDGLFHVVYMVVVTTASFLARKRSGPKDSSTVKP--DEDDESSDSQLANYDEKRR  384

Query  1213  THNFLKDSIPNavavggyialaavaiiav-pfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
                FLKD IPN+ A  GY+ LA +++I V       LKWYHI VAY +AP+LAFCNAYGC
Sbjct  385   REYFLKDQIPNSGAAVGYVVLAVLSMIVVPIIFQGRLKWYHILVAYLIAPVLAFCNAYGC  444

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLASNYGKIAIL+FSSWVG D+GGV+AGLA+CGVMM+IVST SDLMQDFKTGYLT
Sbjct  445   GLTDWSLASNYGKIAILVFSSWVGLDHGGVVAGLAACGVMMNIVSTASDLMQDFKTGYLT  504

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             LASPL MF SQV GTAMGC +TP VFW FYKAYPLGD + AYPAPY  +YR IALLGV+G
Sbjct  505   LASPLTMFLSQVIGTAMGCLMTPAVFWFFYKAYPLGDPDGAYPAPYGLMYRGIALLGVEG  564

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L+I  F AAIA+NI +EVL+  E K+R+YRFIP PMCMAIPFYLGGYFAI
Sbjct  565   FSSLPKNCLKLSIMCFFAAIALNILTEVLKHTEKKWRIYRFIPIPMCMAIPFYLGGYFAI  624

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILFVW W  KQQAK FGPAVASGLICGESLW +PAAILALAGV APICMKF S
Sbjct  625   DMCVGSLILFVWEWNKKQQAKVFGPAVASGLICGESLWSVPAAILALAGVNAPICMKFAS  684

Query  316   AAA  308
             A+A
Sbjct  685   ASA  687



>gb|KDO52778.1| hypothetical protein CISIN_1g044922mg [Citrus sinensis]
Length=684

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/665 (71%), Positives = 546/665 (82%), Gaps = 14/665 (2%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F+ VE+PSW+ Q+T RAM TSL+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA++
Sbjct  28    EDAFKDVEVPSWRKQITFRAMVTSLLLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAIV  87

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K+WT+LL K G+LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  +AA A+SGN
Sbjct  88    KAWTSLLEKFGVLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSTRVAALADSGN  147

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P NVK LS+GWM  FL+ VSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP 
Sbjct  148   TPANVKQLSLGWMFGFLFAVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPK  207

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLA +QVA L K F  SF +  FQWFFA  DGCGFSSFPTFGLKAY Q+FYFDFSSTY
Sbjct  208   GAKLAVKQVAVLLKSFCVSFAWAFFQWFFAVADGCGFSSFPTFGLKAYKQKFYFDFSSTY  267

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVN+SL+IGAI+SWGI+WP+I   +G WY  +L  SSL G+QGY+VF+AIA
Sbjct  268   VGVGMICPYMVNISLMIGAILSWGIMWPLIEKNKGSWYSADLPDSSLHGLQGYRVFIAIA  327

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             MMLGDG ++   M++ T  S      +E         V D+       Q+ ++D  +R  
Sbjct  328   MMLGDGFYHVILMLIKTFGSLANAWGAE---------VADQ-----NTQITNYDELQRKE  373

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IPN  A+ GYI LAA++I+ VP IF  LKWYHI VAY +AP+LAFCNAYGCGLT
Sbjct  374   YFLKDQIPNWAALLGYIFLAAISIVVVPIIFHQLKWYHILVAYVIAPVLAFCNAYGCGLT  433

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLASNYGK+AI++FS+WVG D GGV+AGLASCGVMMSIV+T SDLMQDFKTGYLTL+S
Sbjct  434   DWSLASNYGKLAIILFSAWVGLDTGGVIAGLASCGVMMSIVATASDLMQDFKTGYLTLSS  493

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MF SQV GTA+GC +TPLVFWIFYKAYPLGD   ++PAPY  +YR IALLGV G GS
Sbjct  494   PRSMFLSQVIGTALGCFITPLVFWIFYKAYPLGDPEGSFPAPYGQLYRGIALLGVQGLGS  553

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP +C+ LAIGFFVAAIAIN   E L + ETKY +YRFIP+PMCMAIPFYLGGYFAIDMC
Sbjct  554   LPKHCVELAIGFFVAAIAINTIQEALLRRETKYMIYRFIPSPMCMAIPFYLGGYFAIDMC  613

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             VGSLILF+WR KN+  A +F PAVASGLICG+SLWGIPAA+L+LAGV APICMKFLSA+A
Sbjct  614   VGSLILFLWRMKNRTSADNFSPAVASGLICGDSLWGIPAAVLSLAGVNAPICMKFLSASA  673

Query  307   NAKLE  293
             N K++
Sbjct  674   NNKVD  678



>ref|XP_009768859.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=656

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/657 (73%), Positives = 546/657 (83%), Gaps = 12/657 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             ESTE  F+  E+P WK Q+T+R+M T L+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGF
Sbjct  9     ESTEYAFKDKEVPPWKKQITLRSMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGF  68

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
             A+I+SWTA++ K G LKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSP IAAQA+
Sbjct  69    AMIRSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPFIAAQAD  128

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
             +GN PNN   L I WML FL VVSF GLFSIV LRK+MI+KYKLTYPSGTATAYLIN FH
Sbjct  129   AGNTPNNTMKLDISWMLPFLLVVSFAGLFSIVALRKLMIIKYKLTYPSGTATAYLINCFH  188

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLAK+QV +LFK FSFSF+FG  QW FA +DGCGF S PTFG KAYA+RFYFDFS
Sbjct  189   TPKGAKLAKKQVGSLFKSFSFSFIFGAVQWIFAREDGCGFGSLPTFGFKAYAKRFYFDFS  248

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             STYVGVGMLCP MVNVSLLIGAIISW I+WP+I  K+G WY  +LS+SSL GIQGY+VF+
Sbjct  249   STYVGVGMLCPYMVNVSLLIGAIISWAIMWPMIEAKKGDWYSDHLSASSLHGIQGYRVFI  308

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             AIAMMLGDGLF+F YM+VVT LSF KR+ S            +E   G+ +  ED+D +R
Sbjct  309   AIAMMLGDGLFHFAYMVVVTALSFKKRKSS-----------GEEDYSGEESS-EDYDTKR  356

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             +   FLK+ IP   A+GGY+ +A ++II VP IF  LKWYHI VAY +AP+LAFCN+YG 
Sbjct  357   QNEYFLKEEIPIWAAIGGYVGIAVISIIVVPIIFHSLKWYHILVAYVIAPVLAFCNSYGS  416

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLASNYGKIAIL FS WVG  NGGV+AGLASCG++MSI+ T + LM DFKTGYLT
Sbjct  417   GLTDWSLASNYGKIAILTFSYWVGLQNGGVIAGLASCGLVMSILDTAAGLMGDFKTGYLT  476

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L SP +MFFSQV GTAMGC +TPLVFWIF+ AY LGD   +YPAPYA +YR IALLGV+G
Sbjct  477   LTSPRSMFFSQVIGTAMGCVITPLVFWIFHSAYKLGDPEGSYPAPYALMYRGIALLGVEG  536

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             FGSLP +CL L+I FFV AI INI +++L+K+ETKYR+YRF+P+PMCMAIPFYLGGYFAI
Sbjct  537   FGSLPKHCLRLSIWFFVTAIVINILTQLLKKFETKYRIYRFVPSPMCMAIPFYLGGYFAI  596

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             DMC+GSLILF W   NKQQAKDFGPAVASGLICGESLWGIPA++LALAGVKAP CMK
Sbjct  597   DMCIGSLILFFWEKVNKQQAKDFGPAVASGLICGESLWGIPASVLALAGVKAPFCMK  653



>gb|KHG05118.1| putative metal-nicotianamine transporter YSL7 -like protein [Gossypium 
arboreum]
 gb|KHG05773.1| putative metal-nicotianamine transporter YSL7 -like protein [Gossypium 
arboreum]
Length=700

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/674 (69%), Positives = 561/674 (83%), Gaps = 10/674 (1%)
 Frame = -2

Query  2296  ESTERV-----FEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAA  2132
             +ST++V     F+   +P W  Q+T+RA+ TSLVLS +FNFIVCKLNLTTGVIPSLNVAA
Sbjct  27    QSTDKVLVEAAFKGTPVPPWNKQITVRAVVTSLVLSLVFNFIVCKLNLTTGVIPSLNVAA  86

Query  2131  GLLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTI  1952
             GLLGFAV+K+WT +L K GLLKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMSP +
Sbjct  87    GLLGFAVVKTWTTVLEKLGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPLV  146

Query  1951  AAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYL  1772
             A Q +SGN P NVK LS+GWM+ FL++VSFVGLFSIV LRK+MILKYKLTYPSGTATAYL
Sbjct  147   AGQGDSGNTPENVKRLSLGWMIGFLFIVSFVGLFSIVTLRKIMILKYKLTYPSGTATAYL  206

Query  1771  INSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRF  1592
             INSFHTP GAKLAK+QVA LFK F+ SF++  FQWF+ A DGCGFS+FPTFGL+AY ++F
Sbjct  207   INSFHTPKGAKLAKKQVAVLFKSFAVSFVWAFFQWFYTAVDGCGFSNFPTFGLQAYDKKF  266

Query  1591  YFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQG  1412
             YFDFSSTY+GVGM+CP MVNVS+L+GAI SWGI+WPII  K+G+WY   LS +SL G+QG
Sbjct  267   YFDFSSTYIGVGMICPYMVNVSMLLGAIFSWGILWPIIEGKKGVWYRAELSPTSLHGLQG  326

Query  1411  YKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED  1232
             YKVF+AI+MMLGDGL++  +M++ T  S + +   +K+  + + P     +    ++  D
Sbjct  327   YKVFIAISMMLGDGLYHVLFMLIKTIHSLIVKNSGKKDS-SVVAPGASALD----SETAD  381

Query  1231  FDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFC  1052
             +D  RRT  F+KD IPN VA+ GY+ LA +++I VPFIF  LKWYHI VAYA+APILAFC
Sbjct  382   YDEIRRTEFFMKDQIPNKVALSGYVVLAIISVIVVPFIFHQLKWYHILVAYAIAPILAFC  441

Query  1051  NAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFK  872
             NAYGCGLTDWSLASNYGK+AI+IFSSWVG +NGGV+AGLASCGVMMSIVST SDLMQDFK
Sbjct  442   NAYGCGLTDWSLASNYGKLAIIIFSSWVGLNNGGVVAGLASCGVMMSIVSTASDLMQDFK  501

Query  871   TGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiAL  692
             TGYLTL+SP +MFF+QV GTA+GC ++PLVFW FYKAYP+GD N  YPAPY  +YR IAL
Sbjct  502   TGYLTLSSPRSMFFAQVIGTAIGCIMSPLVFWFFYKAYPIGDPNGTYPAPYGLLYRGIAL  561

Query  691   LGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLG  512
             LGV+G  SLP NCLNL I FF+ A AIN+  E+L++YETK  ++RF+P+PMCMAIPFYLG
Sbjct  562   LGVEGISSLPKNCLNLVIVFFLIAFAINLIKELLQRYETKLGLHRFVPSPMCMAIPFYLG  621

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
             G+F IDMCVGSLILF+W  +NKQQA DF PAVASGLICG+SLWG+PAAIL+L  V  P+C
Sbjct  622   GFFGIDMCVGSLILFLWERRNKQQATDFAPAVASGLICGDSLWGVPAAILSLLNVNPPLC  681

Query  331   MKFLSAAANAKLES  290
             MKFLSAA NAK++S
Sbjct  682   MKFLSAAVNAKVDS  695



>gb|EYU27872.1| hypothetical protein MIMGU_mgv1a019282mg [Erythranthe guttata]
Length=681

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/669 (71%), Positives = 564/669 (84%), Gaps = 15/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE++ +PSW+NQ+TIR++  S++LSA+FN IVCKLNL+TGVIPSLNVAAGLLGFA
Sbjct  24    SLEKEFEEMAVPSWRNQITIRSVVVSVILSAVFNVIVCKLNLSTGVIPSLNVAAGLLGFA  83

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K WT L+ KAG LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMSP  AAQA++
Sbjct  84    MVKGWTVLMEKAGYLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPITAAQADT  143

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             GN P N+K LSIGWM+A+L+ VSF+GLFSIVPLRK+MILKYKLTYPSGTATAYLINSFHT
Sbjct  144   GNNPMNIKQLSIGWMMAYLFTVSFLGLFSIVPLRKVMILKYKLTYPSGTATAYLINSFHT  203

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAK+AK++V  LFK F  SFL+  FQWFF A DGCGFSSFPTFGL A+ +RFYFDFS+
Sbjct  204   PKGAKVAKKKVWVLFKSFVGSFLWACFQWFFNAADGCGFSSFPTFGLGAFNKRFYFDFSA  263

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP MVNVSLLIGAI+SWGI+WPII +K+G WY   L +SSL GIQGY+VFLA
Sbjct  264   TYVGVGMICPYMVNVSLLIGAILSWGILWPIIESKKGDWYSAELPASSLHGIQGYRVFLA  323

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGA-QLEDFDGQR  1217
             IAMMLGDGL++  YM+ VT  SF++ + S               N+G G  Q+ D+D ++
Sbjct  324   IAMMLGDGLYHVVYMLAVTARSFLQHKESA--------------NEGTGVDQITDYDERK  369

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IPN VA+GGY+ LA V+II +P IF  LKWY I VAY +APILAFCNAYGC
Sbjct  370   RTEFFLKDQIPNKVAMGGYVLLAVVSIIVIPLIFHQLKWYQILVAYIIAPILAFCNAYGC  429

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLASNYGKIAIL+FSSWVG D GGVLAGLASCGVMMSIVST SDLMQDFKTGYLT
Sbjct  430   GLTDWSLASNYGKIAILVFSSWVGMDQGGVLAGLASCGVMMSIVSTASDLMQDFKTGYLT  489

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L+SP +MF  QV GTA+GC ++PLVFWIFYKAY +GD   +YPAPYA +YR IALLGV+G
Sbjct  490   LSSPRSMFVGQVLGTALGCFMSPLVFWIFYKAYSVGDPTGSYPAPYALMYRGIALLGVEG  549

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP NC+ L I FF+ A+ INI +E+L++YETKYRVYRF+P+PMCMAIPFYLG YFA+
Sbjct  550   FSTLPKNCMTLVIVFFIGAVVINIATELLKRYETKYRVYRFVPSPMCMAIPFYLGAYFAV  609

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLILF+W  KN+  AK+F PAVASGLICG+SLWGIPAA+LAL+GV+APICMKFLS
Sbjct  610   DMCIGSLILFIWEMKNRNGAKEFAPAVASGLICGDSLWGIPAAVLALSGVQAPICMKFLS  669

Query  316   AAANAKLES  290
             A+AN ++++
Sbjct  670   ASANKRVDA  678



>ref|XP_008221041.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Prunus 
mume]
Length=700

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/668 (72%), Positives = 563/668 (84%), Gaps = 2/668 (0%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F+   +P W  Q+T+RAM TS +LS +FNFIVCKLNLTTGVIPSLNVAAGL+GFAV+
Sbjct  29    EEAFKTTPVPPWTKQITVRAMVTSFLLSIVFNFIVCKLNLTTGVIPSLNVAAGLMGFAVV  88

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K +TA++ K GLLKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMSP IAAQ + GN
Sbjct  89    KGYTAMIEKCGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYILGMSPKIAAQGDEGN  148

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P N+K L +GWM+ FL+ VSFVGLFSI+ LRKMMI+KYKLTYPSGTATAYLINSFHTP 
Sbjct  149   TPINIKHLDVGWMIGFLFAVSFVGLFSIMALRKMMIIKYKLTYPSGTATAYLINSFHTPK  208

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+QV+ LFK F FSF+F  FQWFFA  DGCGFSSFPTFGLKAYA++FYFDFSSTY
Sbjct  209   GAKLAKKQVSVLFKSFCFSFVFAFFQWFFATADGCGFSSFPTFGLKAYARKFYFDFSSTY  268

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVN+SLL+G+IISWGI+WP+I  K+GIWY  NLS+SSL GIQGY+VF+AIA
Sbjct  269   VGVGMICPFMVNISLLVGSIISWGIMWPLIEQKKGIWYSANLSASSLHGIQGYRVFIAIA  328

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEK-NGPASLLPVDDEFNKGKGAQLE-DFDGQRR  1214
             MMLGDGLF+  YM+ +T  S    +  +K +  +S     D    G    +  ++D +RR
Sbjct  329   MMLGDGLFHVVYMLCLTTKSLATHKSEKKLDSYSSPSTNPDGLEAGSSEVVSANYDEERR  388

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IPN VA+ GY+ALAA++IIAVPFIFP LKWYH+ VAY +AP+LAFCNAYGCG
Sbjct  389   MEYFLKDQIPNWVALVGYVALAAISIIAVPFIFPQLKWYHVLVAYLIAPVLAFCNAYGCG  448

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             L+DWSLASNYGK AI+IFS+WVG D GGV+AGLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  449   LSDWSLASNYGKFAIIIFSAWVGLDRGGVIAGLAACGVMMSIVSTASDLMQDFKTGYLTL  508

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGF  674
             +SP +MF SQV GTAMGC ++PLVFW FYKAYP+G+ + AYPAPY  +YR IALLGV+G 
Sbjct  509   SSPRSMFVSQVFGTAMGCVMSPLVFWFFYKAYPIGNPDGAYPAPYGLMYRGIALLGVEGV  568

Query  673   GSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAID  494
              SLP NC+ LA+ FF AAIAINI SE+L++YETKYR+YRFIP+PMCMAIPFYLG YFAID
Sbjct  569   SSLPKNCVTLAVSFFAAAIAINIISELLQRYETKYRIYRFIPSPMCMAIPFYLGSYFAID  628

Query  493   MCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSA  314
             MCVGSLILF+W+ KNKQ+A +F PAVASGLICG+SLWG+PAAILA+ GVKAPICMKFLSA
Sbjct  629   MCVGSLILFLWQRKNKQKADNFAPAVASGLICGDSLWGVPAAILAIVGVKAPICMKFLSA  688

Query  313   AANAKLES  290
             + N K++S
Sbjct  689   SVNNKVDS  696



>ref|XP_009593227.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
tomentosiformis]
Length=658

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/665 (71%), Positives = 550/665 (83%), Gaps = 13/665 (2%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             +V STE  F+  E+P W+ Q+T+RAM T L+LS +FNFIVCKLNLTTGVIPSLNVAAGLL
Sbjct  7     EVLSTEYAFKDKEVPPWEKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLL  66

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GFA+I+SWTA++ K G LKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGM P IAAQ
Sbjct  67    GFAMIRSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMDPFIAAQ  126

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             A++GN PNN K L+IGWML +L VVSF GLFSIV LRKMMI+KYKLTYPSGTATAYLIN 
Sbjct  127   ADAGNTPNNTKKLAIGWMLPYLLVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAYLINC  186

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV +LFK F FSF+FG  QW FA +DGCGF S PTFG +AYA++FYFD
Sbjct  187   FHTPKGAKLAKKQVGSLFKSFGFSFIFGAVQWIFAREDGCGFGSLPTFGFQAYAKKFYFD  246

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FSSTYVGVGMLCP MVNVSLLIGAI+SW I+WP+I  K+G WY   LS++SL GIQGY+V
Sbjct  247   FSSTYVGVGMLCPYMVNVSLLIGAIVSWAIMWPMIEAKKGDWYSAQLSAASLHGIQGYRV  306

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+AI+MMLGDGLF+F YM+VVT LSF  R+  + +  +     ++ F        ED+D 
Sbjct  307   FIAISMMLGDGLFHFAYMLVVTVLSFRNRKSGQADSSS-----EESF--------EDYDK  353

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             +R+   FLKD IPN  A+GGY+ +A ++II VP IF  LKWYHI VAY +APILAFCN+Y
Sbjct  354   KRQNEYFLKDQIPNWAAIGGYVGIAIISIIVVPIIFHSLKWYHILVAYLIAPILAFCNSY  413

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLASNYGKIAIL FS WVG  NGGV+AGLASCG+MMSI+ T + LM DFKTGY
Sbjct  414   GSGLTDWSLASNYGKIAILTFSYWVGLQNGGVIAGLASCGLMMSILDTAAGLMGDFKTGY  473

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGV  683
             LTL SP +MFFSQV GTAMGC +TPLVFWIF  AY LGD   AYPAPYA++YR IALLGV
Sbjct  474   LTLTSPRSMFFSQVIGTAMGCVITPLVFWIFNSAYRLGDPEGAYPAPYASMYRGIALLGV  533

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GFGSLP +CL L++ FFVAAI IN+ +++L+K+ETKY +YRF+P+PMCMAIPFYLGGYF
Sbjct  534   EGFGSLPKHCLRLSVWFFVAAIVINLLTQLLKKFETKYGIYRFVPSPMCMAIPFYLGGYF  593

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W+  NKQQAKDFGPA+ASGLICGESLWGIPA++LALAGVKAP CMK 
Sbjct  594   AIDMCVGSLILFIWQMVNKQQAKDFGPALASGLICGESLWGIPASVLALAGVKAPFCMKV  653

Query  322   LSAAA  308
                 A
Sbjct  654   RHGGA  658



>ref|XP_009351712.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Pyrus 
x bretschneideri]
Length=701

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/671 (72%), Positives = 567/671 (85%), Gaps = 3/671 (0%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             + E  F+   +P W  Q+T+R+M TS +LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA
Sbjct  27    NVEEAFKATAVPPWTKQITVRSMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFA  86

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             V+K +TA++ K G LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  IAAQ + 
Sbjct  87    VVKGYTAMIDKCGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQGDL  146

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             GN   N+K L +GWM+ FL+ VSFVGLFSI+PLRKMMILKYKLTYPSGTATAYLINSFHT
Sbjct  147   GNTLINIKKLDVGWMIGFLFAVSFVGLFSIMPLRKMMILKYKLTYPSGTATAYLINSFHT  206

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLA++QVA LFK F FSF F  FQWFFAA DGCGFS FPTFGLKA+A +FYFDFS+
Sbjct  207   PKGAKLARKQVAVLFKSFCFSFAFAFFQWFFAAADGCGFSRFPTFGLKAFANKFYFDFSA  266

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CPIMVNVSLL+GAIISWGI+WP+I TK+GIWY  NLS+SSL GIQGY++F+A
Sbjct  267   TYVGVGMICPIMVNVSLLVGAIISWGIMWPLIETKKGIWYNANLSASSLHGIQGYRIFIA  326

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVD-DEFNKGKGAQL--EDFDG  1223
             IAMMLGDGLF+  YM+ +T  S   +R  +K   +S  P++ D    G  +++   ++D 
Sbjct  327   IAMMLGDGLFHVVYMLFMTAKSLAAQRSEKKLESSSSPPLNLDSVEAGGSSEVVSANYDE  386

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRR   FLKD IP+ VA  GYIALAA++I  VP IFP LKWYH+ VAY +AP+LAFCNAY
Sbjct  387   QRRIEYFLKDQIPSWVAFSGYIALAAISIGVVPLIFPQLKWYHVLVAYLIAPVLAFCNAY  446

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLASNYGK AI+IFS+WVG D+GGV+AGLASCGVMMSIVST SDLMQDFKTGY
Sbjct  447   GCGLTDWSLASNYGKFAIIIFSAWVGLDHGGVIAGLASCGVMMSIVSTASDLMQDFKTGY  506

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGV  683
             LTL+SP +MFFSQV GTAMGC ++PLVFW+FYKAYP+GD +  YPAPY  +YR IALLGV
Sbjct  507   LTLSSPRSMFFSQVFGTAMGCVMSPLVFWVFYKAYPIGDPDGPYPAPYGLMYRGIALLGV  566

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G GSLP NC+ LA+ FF AA+AINI  E+L++YETKYR+YRFIPNPMCMAIPFYLG YF
Sbjct  567   EGVGSLPKNCVALALSFFAAAVAINIIIELLQRYETKYRIYRFIPNPMCMAIPFYLGSYF  626

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+WR KN+Q+A DFGPAVASGLICG+SLWG+PAAILA+A VKAPICMKF
Sbjct  627   AIDMCVGSLILFLWRRKNRQKADDFGPAVASGLICGDSLWGVPAAILAIASVKAPICMKF  686

Query  322   LSAAANAKLES  290
             LSA+AN K++S
Sbjct  687   LSASANNKVDS  697



>ref|XP_002306389.2| hypothetical protein POPTR_0005s09670g [Populus trichocarpa]
 gb|EEE93385.2| hypothetical protein POPTR_0005s09670g [Populus trichocarpa]
Length=698

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/668 (72%), Positives = 559/668 (84%), Gaps = 13/668 (2%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F+  E+P W  Q+T+RAM TSLVLS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA++
Sbjct  36    EEGFKDTEVPPWAKQITLRAMLTSLVLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAIL  95

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K WT+LL KAG+LKQPFTRQENTV+QTCVVASSGIAFSSGTASY+LGM+P IA Q+E GN
Sbjct  96    KFWTSLLGKAGILKQPFTRQENTVVQTCVVASSGIAFSSGTASYLLGMTPRIANQSEGGN  155

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P N+K L +GWM+ FL+ VSFVGLFSIVPLRK+MILKYKLTYPSGTATAYLINSFHTP 
Sbjct  156   TPANMKELHLGWMIGFLFAVSFVGLFSIVPLRKLMILKYKLTYPSGTATAYLINSFHTPK  215

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+QV+ LFK F+ SFL+ GFQWF+ A DGCGF+SFPTFG +A+A+RFYFDFS+TY
Sbjct  216   GAKLAKKQVSVLFKYFAGSFLWAGFQWFWTAADGCGFASFPTFGPQAFARRFYFDFSATY  275

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVN+SLL+GAI+SWGI+WPII TK+G WY  +   SSL GIQGY+VF+AIA
Sbjct  276   VGVGMICPYMVNISLLLGAILSWGILWPIIETKKGDWYSADEKPSSLHGIQGYRVFMAIA  335

Query  1387  MMLGDGLFNFFYMMVVTGLSFM---KRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
              MLGDGLF+  +M+  T +S +   K++ SE  G       DDE +K     L  +D +R
Sbjct  336   TMLGDGLFHVIFMLSKTTISLIINIKKKGSEVPGYG-----DDENSK-----LVKYDEKR  385

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IPN VA GGYI LA V+IIAVP IFP LKWY I  AY +AP+LAFCNAYGC
Sbjct  386   RTEFFLKDQIPNWVAGGGYILLAIVSIIAVPHIFPQLKWYQILAAYVIAPVLAFCNAYGC  445

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLASNYGK AI+IFS+WVG  NGG++AGLASCGVMMSIVST SDLMQDFKTGYLT
Sbjct  446   GLTDWSLASNYGKFAIIIFSAWVGLPNGGIIAGLASCGVMMSIVSTASDLMQDFKTGYLT  505

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L+SP +MFFSQV GTAMGC LTPLVFW+FY+AYP+G+  SAYPAPY  VYR IA+LG +G
Sbjct  506   LSSPRSMFFSQVIGTAMGCVLTPLVFWVFYQAYPVGEEGSAYPAPYGGVYRGIAMLGTEG  565

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP NC  L+I FF AA+ IN+ +E+LRKYETKYR+YRFIP+PMC+AIPFYLGGYFAI
Sbjct  566   VSSLPKNCFKLSIIFFFAAMIINLVTELLRKYETKYRIYRFIPSPMCLAIPFYLGGYFAI  625

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILF+   +NKQ+A DFGPAVASGLICGESLWGIPAAILAL+GV  P+C+KFL+
Sbjct  626   DMCVGSLILFLLELRNKQKASDFGPAVASGLICGESLWGIPAAILALSGVNPPMCIKFLT  685

Query  316   AAANAKLE  293
             AA N K++
Sbjct  686   AAVNGKVD  693



>ref|XP_011022272.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
 ref|XP_011015703.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
Length=699

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/668 (71%), Positives = 559/668 (84%), Gaps = 13/668 (2%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F+  E+P W  Q+T+RAM TSLVLS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA++
Sbjct  37    EEGFKDTEVPPWAKQITLRAMLTSLVLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAIL  96

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K WT+LL KAG LKQPFTRQENTV+QTCVVASSGIAFSSGTASY+LGM+P IA Q+E GN
Sbjct  97    KFWTSLLGKAGFLKQPFTRQENTVVQTCVVASSGIAFSSGTASYLLGMTPRIANQSEGGN  156

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P N+K L +GWM+ FL+ VSFVGLFSIVPLRK+MILKYKLTYPSGTATAYLINSFHTP 
Sbjct  157   TPANMKELHLGWMIGFLFAVSFVGLFSIVPLRKLMILKYKLTYPSGTATAYLINSFHTPK  216

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+QV+ LFK F+ SFL+ GFQWF+ A DGCGF+SFPTFG +A+A+RFYFDFS+TY
Sbjct  217   GAKLAKKQVSVLFKYFAGSFLWAGFQWFWTAADGCGFASFPTFGPQAFARRFYFDFSATY  276

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVN+SLL+GAI+SWGI+WPII TK+G WY  +   SSL GIQGY+VF+AIA
Sbjct  277   VGVGMICPYMVNISLLLGAILSWGILWPIIETKKGDWYSADEKPSSLHGIQGYRVFMAIA  336

Query  1387  MMLGDGLFNFFYMMVVTGLSFM---KRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
              MLGDGLF+  +M+  T +S +   K++ SE       +P   +F   + ++L  +D +R
Sbjct  337   TMLGDGLFHVIFMLSKTTISLITNIKKKDSE-------VP---DFGDDENSKLVKYDEKR  386

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IPN VA GGYI LA V+IIAVP IFP LKWY I VAY +AP+LAFCNAYGC
Sbjct  387   RTEFFLKDQIPNWVAGGGYILLAIVSIIAVPHIFPQLKWYQILVAYVIAPVLAFCNAYGC  446

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLASNYGK AI+IFS+WVG  NGG++AGLASCGVMMSIVST SDLMQDFKTGYLT
Sbjct  447   GLTDWSLASNYGKFAIIIFSAWVGLPNGGIIAGLASCGVMMSIVSTASDLMQDFKTGYLT  506

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L+SP +MFFSQV GTAMGC LTPLVFW+FY+AYP+G+  SAYPAPY  VYR IA+LG +G
Sbjct  507   LSSPRSMFFSQVIGTAMGCVLTPLVFWVFYQAYPVGEEGSAYPAPYGGVYRGIAMLGTEG  566

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP NC   +I FF+AA+ IN+ +E+LRKYETKYR+YRFIP+PMC+AIPFYLGGYFAI
Sbjct  567   VSSLPKNCFKFSIIFFIAAMVINLVTELLRKYETKYRIYRFIPSPMCLAIPFYLGGYFAI  626

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILF+    NKQ+A DFGPAVASGLICGESLWGIPAAILAL+GV  P+C+KFL+
Sbjct  627   DMCVGSLILFLLELSNKQKASDFGPAVASGLICGESLWGIPAAILALSGVSPPMCIKFLT  686

Query  316   AAANAKLE  293
             AA N K++
Sbjct  687   AAVNDKVD  694



>ref|XP_002532101.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF30280.1| oligopeptide transporter, putative [Ricinus communis]
Length=694

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/672 (69%), Positives = 548/672 (82%), Gaps = 8/672 (1%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             KV   E  F+   +P W  Q+T RA+ TS  LS +FNFIVCKLNLTTGVIPSLNVAAGLL
Sbjct  26    KVVMVEEAFKDTVVPPWTKQITFRAIATSFFLSIVFNFIVCKLNLTTGVIPSLNVAAGLL  85

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF ++K WT LL K G LKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGM P IAAQ
Sbjct  86    GFGILKFWTTLLGKTGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMIPRIAAQ  145

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             ++ GN P NVK LS+GWM+AFL++VSFVGLFSIVPLRK+MILKYKLTYPSGTATAYLINS
Sbjct  146   SDGGNTPANVKHLSLGWMMAFLFIVSFVGLFSIVPLRKLMILKYKLTYPSGTATAYLINS  205

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  LFK F FSF +  FQWFF   DGCGFSSFPTFGL+A  QRF+FD
Sbjct  206   FHTPKGAKLAKKQVGVLFKFFGFSFFWAFFQWFFTGGDGCGFSSFPTFGLQAADQRFFFD  265

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FSSTYVGVGM+CP MVN+SLL+GAI+SWGI+WP+I  K+GIW+P +L  +SL GIQGY++
Sbjct  266   FSSTYVGVGMICPYMVNISLLLGAIVSWGIMWPLIEAKKGIWFPDHLPGNSLHGIQGYRI  325

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+AIA MLGDGL++  YM+  T  S + +  ++++  +S+ P       G+  ++ ++D 
Sbjct  326   FIAIATMLGDGLYHVIYMLAKTLYSLVLQNLNKES--SSITPSAG----GENTEIVNYDE  379

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRR   FLKD IP  VA  GY  LAA++I  VP IF  LKWYH+ VAY +AP+LAFCNAY
Sbjct  380   QRRKEFFLKDQIPTWVAFLGYFGLAAISITTVPLIFHQLKWYHVLVAYLIAPVLAFCNAY  439

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLASNYGK AI+IFS+WVGHD GG++AGLASCGVMMSIVST SDLMQDFKTGY
Sbjct  440   GCGLTDWSLASNYGKFAIIIFSAWVGHD-GGIIAGLASCGVMMSIVSTASDLMQDFKTGY  498

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLG  686
             LTL+S  +MFFSQVAGTAMGC +TPLVFW FYKAYP +G+S + YPAPY  +YR IALLG
Sbjct  499   LTLSSARSMFFSQVAGTAMGCLITPLVFWFFYKAYPTIGESGTTYPAPYGQIYRGIALLG  558

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G  SLP NCL L+I FFV AI +N+  ++L+KYET YRVYRFIP+PMCMAIPFY+GGY
Sbjct  559   VEGISSLPKNCLTLSISFFVGAIVVNLIRDLLQKYETTYRVYRFIPSPMCMAIPFYIGGY  618

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILF+W   NKQ+A DFG AVASGLICG+SLWGIPAAIL+LA +  PICMK
Sbjct  619   FAIDMCVGSLILFIWEKYNKQRATDFGTAVASGLICGDSLWGIPAAILSLANLAPPICMK  678

Query  325   FLSAAANAKLES  290
             FLSAA N +++ 
Sbjct  679   FLSAAQNNRVDQ  690



>ref|XP_006484556.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Citrus sinensis]
Length=669

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/666 (71%), Positives = 554/666 (83%), Gaps = 4/666 (1%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F+ V +P W  Q+T RAM TS VLS IFNFIVCKLNLTTGVIPSLNVAAGLLGFA++
Sbjct  3     EEAFKNVPVPPWTKQITFRAMATSAVLSVIFNFIVCKLNLTTGVIPSLNVAAGLLGFALV  62

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             KSWT LL K GLLKQPFTRQENTVIQTC+VASSGIAFSSGTASYMLGMSP IA+QA+ GN
Sbjct  63    KSWTTLLEKFGLLKQPFTRQENTVIQTCIVASSGIAFSSGTASYMLGMSPKIASQADGGN  122

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P N+K+LSIGWM+AFL+ VSF+GLFSIVPLRK+MILKYKLTYPSGTATAYLINSFHTP 
Sbjct  123   TPANIKSLSIGWMMAFLFAVSFLGLFSIVPLRKVMILKYKLTYPSGTATAYLINSFHTPK  182

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GA+LAK+QVA LF+ F FSF++  FQWF+ A DGCGFSSFPTFGLKA+ Q+F+FDFSSTY
Sbjct  183   GAQLAKKQVAMLFRSFGFSFVWAFFQWFYTAGDGCGFSSFPTFGLKAFKQKFFFDFSSTY  242

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVN+SLLIGA++SWGI+WPII TK+GIWY   LS S+L G+ GY+VF+AIA
Sbjct  243   VGVGMICPYMVNISLLIGAVLSWGIMWPIIETKKGIWYKAELSDSNLHGMNGYRVFIAIA  302

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             MMLGDG+++  YM+V T  S +++  S +   ++   V  E    + +Q+ +FD QRRT 
Sbjct  303   MMLGDGIYHVVYMIVTTSRSLVQQYSSRRKANST---VSSEVGN-ESSQIVNFDDQRRTE  358

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IPN VAV GYI LA VAIIAVPFIF  LKWYHI VA++ APILAFCNAYGCGLT
Sbjct  359   FFLKDQIPNWVAVSGYILLAVVAIIAVPFIFHQLKWYHILVAFSFAPILAFCNAYGCGLT  418

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLASNYGK AI+IFSSWVG ++GG++AGLASCGVMMS VST SDLMQDFKTGYLTL+S
Sbjct  419   DWSLASNYGKFAIIIFSSWVGLEHGGIIAGLASCGVMMSTVSTASDLMQDFKTGYLTLSS  478

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MFFSQV GT +G  L+PLVFW FY AYP+GD    YP+PY  +YR IA+LGV+G  S
Sbjct  479   PRSMFFSQVFGTFLGVVLSPLVFWFFYNAYPIGDPEGTYPSPYGLLYRGIAILGVEGVSS  538

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP +CL LAI FF AAI +NI  EVL+  + K ++YRFIP+PMCMAIPFYLGGYFAIDMC
Sbjct  539   LPKHCLTLAIAFFAAAIVLNIIREVLQHVDAKCKIYRFIPSPMCMAIPFYLGGYFAIDMC  598

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             VGSLILFVW  K+K+ A DF PAVASGLICG+SLW +PAAIL+LA + APICMKFLSAA 
Sbjct  599   VGSLILFVWEMKDKRSAADFAPAVASGLICGDSLWSVPAAILSLANLNAPICMKFLSAAT  658

Query  307   NAKLES  290
             N K+++
Sbjct  659   NNKVDA  664



>ref|XP_006437556.1| hypothetical protein CICLE_v10030844mg [Citrus clementina]
 gb|ESR50796.1| hypothetical protein CICLE_v10030844mg [Citrus clementina]
Length=704

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/666 (71%), Positives = 554/666 (83%), Gaps = 4/666 (1%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F+ V +P W  Q+T RAM TS VLS IFNFIVCKLNLTTGVIPSLNVAAGLLGFA++
Sbjct  38    EEAFKNVPVPPWTKQITFRAMATSAVLSVIFNFIVCKLNLTTGVIPSLNVAAGLLGFALV  97

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             KSWT LL K GLLKQPFTRQENTVIQTC+VASSGIAFSSGTASYMLGMSP IA+QA+ GN
Sbjct  98    KSWTTLLEKFGLLKQPFTRQENTVIQTCIVASSGIAFSSGTASYMLGMSPKIASQADGGN  157

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P N+K+LSIGWM+AFL+ VSF+GLFSIVPLRK+MILKYKLTYPSGTATAYLINSFHTP 
Sbjct  158   TPANIKSLSIGWMMAFLFAVSFLGLFSIVPLRKVMILKYKLTYPSGTATAYLINSFHTPK  217

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GA+LAK+QVA LF+ F FSF++  FQWF+ A DGCGFSSFPTFGLKA+ Q+F+FDFSSTY
Sbjct  218   GAQLAKKQVAMLFRSFGFSFVWAFFQWFYTAGDGCGFSSFPTFGLKAFKQKFFFDFSSTY  277

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVN+SLLIGA++SWGI+WPII TK+GIWY   LS S+L G+ GY+VF+AIA
Sbjct  278   VGVGMICPYMVNISLLIGAVLSWGIMWPIIETKKGIWYKAELSDSNLHGMNGYRVFIAIA  337

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             MMLGDG+++  YM+V T  S +++  S +   ++   V  E    + +Q+ +FD QRRT 
Sbjct  338   MMLGDGIYHVVYMIVTTSRSLVQQYSSRRKANST---VSSEVGN-ESSQIVNFDDQRRTE  393

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IPN VAV GYI LA  AIIAVPFIF  LKWYHI VA++ APILAFCNAYGCGLT
Sbjct  394   FFLKDQIPNWVAVSGYILLAVAAIIAVPFIFHQLKWYHILVAFSFAPILAFCNAYGCGLT  453

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLASNYGK AI+IFSSWVG ++GG++AGLASCGVMMS VST SDLMQDFKTGYLTL+S
Sbjct  454   DWSLASNYGKFAIIIFSSWVGLEHGGIIAGLASCGVMMSTVSTASDLMQDFKTGYLTLSS  513

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MFFSQV GT +G  L+PLVFW FY AYP+GD    YP+PY  +YR IA+LGV+G  S
Sbjct  514   PRSMFFSQVFGTFLGVVLSPLVFWFFYNAYPIGDPEGTYPSPYGLLYRGIAILGVEGVSS  573

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP +CL LAI FF AAI +NI  EVL+  +TK ++YRFIP+PMCMAIPFYLGGYFAIDMC
Sbjct  574   LPKHCLTLAIAFFAAAIVLNIIREVLQHVDTKCKIYRFIPSPMCMAIPFYLGGYFAIDMC  633

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             VGSLILFVW  K+K+ A DF PAVASGLICG+SLW +PAAIL+LA + APICMKFLSAA 
Sbjct  634   VGSLILFVWEMKDKRSAADFAPAVASGLICGDSLWSVPAAILSLANLNAPICMKFLSAAT  693

Query  307   NAKLES  290
             N K+++
Sbjct  694   NNKVDA  699



>ref|XP_009758111.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=659

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/662 (72%), Positives = 548/662 (83%), Gaps = 13/662 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             STE  F+  E+P WK Q+T+RAM T L+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA
Sbjct  11    STEYAFKDKEVPPWKKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFA  70

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             +I+SWTA++ K G LKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSP IAAQA++
Sbjct  71    MIRSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPLIAAQADA  130

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             GN PNN K L+I WML++L VVSF GLFSIV LRKMMI+KYKLTYPSGTATAYLIN FHT
Sbjct  131   GNTPNNTKKLAISWMLSYLLVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAYLINCFHT  190

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV +LFK FSFSF+FG  QW FA +DGCGF S PTFG +AYA++FYFDFSS
Sbjct  191   PKGAKLAKKQVGSLFKSFSFSFIFGAVQWIFAREDGCGFGSLPTFGFQAYAKKFYFDFSS  250

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGMLCP MVNVSLLIGAI+SW I+WP+I  K+G WY   L+++SL GIQGY+VF+A
Sbjct  251   TYVGVGMLCPYMVNVSLLIGAIVSWAIMWPMIEAKKGDWYSAQLTAASLHGIQGYRVFIA  310

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             I+MMLGDGLF+F YM+ VT LSF    R+ K+G         + +       ED+D +R+
Sbjct  311   ISMMLGDGLFHFAYMLAVTVLSF----RNRKSG---------QEDSSGEESSEDYDKKRQ  357

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IPN VA+GGY+ +A ++II VP IF  LKWYHI VAY +APILAFCN+YG G
Sbjct  358   NEYFLKDQIPNWVAIGGYVGIAIISIIVVPIIFHSLKWYHILVAYLIAPILAFCNSYGSG  417

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLASNYGKIAIL FS WVG  NGGV+AGLASCG+MMSI+ T + LM DFKTGYLTL
Sbjct  418   LTDWSLASNYGKIAILTFSYWVGLQNGGVIAGLASCGLMMSILDTAAGLMGDFKTGYLTL  477

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGF  674
              SP +MFFSQ  GTAMGC +TPLVFWIF  AY LGD   AYPAPYAA+YR IALLGV+GF
Sbjct  478   TSPRSMFFSQAIGTAMGCVITPLVFWIFNTAYRLGDPEGAYPAPYAAMYRGIALLGVEGF  537

Query  673   GSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAID  494
             GSLP +CL L++ FFVAAI IN+ +++L+K+ETKY +YRF+P+PMCMAIPFYLGGYFAID
Sbjct  538   GSLPKHCLRLSVWFFVAAIVINLVTQLLKKFETKYGIYRFVPSPMCMAIPFYLGGYFAID  597

Query  493   MCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSA  314
             MCVGSLILF+W+  NKQQAKDFGPA+ASGLICGESLWGIPA++LALAGVKAP CMK    
Sbjct  598   MCVGSLILFIWQMVNKQQAKDFGPALASGLICGESLWGIPASVLALAGVKAPFCMKVRHG  657

Query  313   AA  308
              A
Sbjct  658   GA  659



>gb|KCW65044.1| hypothetical protein EUGRSUZ_G02568 [Eucalyptus grandis]
Length=674

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/667 (70%), Positives = 558/667 (84%), Gaps = 9/667 (1%)
 Frame = -2

Query  2290  TERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  2111
              E  F+  E+P W+ QLT+RA+ + L+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA+
Sbjct  11    VEEAFKDTEVPPWRQQLTVRALVSGLLLSLVFNFIVCKLNLTTGVIPSLNVAAGLLGFAM  70

Query  2110  IKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESG  1931
             +K+W +LL + GLL+QPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  IAAQ++ G
Sbjct  71    VKAWASLLERCGLLRQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSSLIAAQSDGG  130

Query  1930  NIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  1751
             N P NVK LS+GW++AFL+ VSFVGLFSIVPLRK MI+KYKLTYPSGTATA+LINSFHTP
Sbjct  131   NTPVNVKNLSLGWIIAFLFTVSFVGLFSIVPLRKTMIMKYKLTYPSGTATAFLINSFHTP  190

Query  1750  NGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSST  1571
              GAKLAK+QVA LFK F  SF++  FQWFFA  DGCGF SFPTFGL+A+ QRFYFDFS+T
Sbjct  191   KGAKLAKKQVAVLFKTFCLSFVWACFQWFFAVADGCGFVSFPTFGLQAFKQRFYFDFSAT  250

Query  1570  YVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAI  1391
             YVGVGM+CP MVN+SLLIGA++SWGI+WP+I TK+G WY  +LS+SSL GIQGY+VFLAI
Sbjct  251   YVGVGMICPYMVNISLLIGAVLSWGIMWPLIETKKGDWYSADLSASSLHGIQGYRVFLAI  310

Query  1390  AMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRT  1211
             AMMLGDGLF+  +M++ T  S +   + E +   ++ P + +      +   DF+  RRT
Sbjct  311   AMMLGDGLFHVVFMLIKTTSSLIANSKQESS---TIAPYESD------SSSPDFNEDRRT  361

Query  1210  HNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGL  1031
               FLKD IPN VA GGYI LA ++II +PFIFP LK+YH+ VAYA+AP+LAFCNAYGCGL
Sbjct  362   LYFLKDQIPNWVAYGGYIGLAVISIIVIPFIFPQLKFYHLMVAYAIAPLLAFCNAYGCGL  421

Query  1030  TDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLA  851
             TDWSLASNYGK AI+IFS+WVG ++GGV+AGLASCGVMM+IVST SDLMQDFKTGYLTL+
Sbjct  422   TDWSLASNYGKFAIIIFSAWVGLEHGGVIAGLASCGVMMNIVSTASDLMQDFKTGYLTLS  481

Query  850   SPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFG  671
             SP +MFFSQV GTA+ C +TPLVFW FYKAYP+GD   ++PAPY  +YR IALLGV+G  
Sbjct  482   SPRSMFFSQVYGTAISCVMTPLVFWFFYKAYPIGDPTGSFPAPYGLMYRGIALLGVEGVS  541

Query  670   SLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDM  491
             SLP NCL LAI  FV AI +N+  E+L+ +ETK R+YRF+P+ MCMAIPFYLG YFAIDM
Sbjct  542   SLPKNCLALAILCFVVAIVLNLIKELLQHFETKRRIYRFVPSAMCMAIPFYLGSYFAIDM  601

Query  490   CVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAA  311
             CVGSLILF+W   N+Q+AKDFGPAVASGLICG+SLWG+PAAIL+LAGV+APICMKFLSA+
Sbjct  602   CVGSLILFLWERSNRQKAKDFGPAVASGLICGDSLWGVPAAILSLAGVQAPICMKFLSAS  661

Query  310   ANAKLES  290
              N K+++
Sbjct  662   VNQKVDA  668



>ref|XP_010068802.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=697

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/667 (70%), Positives = 558/667 (84%), Gaps = 9/667 (1%)
 Frame = -2

Query  2290  TERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  2111
              E  F+  E+P W+ QLT+RA+ + L+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA+
Sbjct  34    VEEAFKDTEVPPWRQQLTVRALVSGLLLSLVFNFIVCKLNLTTGVIPSLNVAAGLLGFAM  93

Query  2110  IKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESG  1931
             +K+W +LL + GLL+QPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  IAAQ++ G
Sbjct  94    VKAWASLLERCGLLRQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSSLIAAQSDGG  153

Query  1930  NIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  1751
             N P NVK LS+GW++AFL+ VSFVGLFSIVPLRK MI+KYKLTYPSGTATA+LINSFHTP
Sbjct  154   NTPVNVKNLSLGWIIAFLFTVSFVGLFSIVPLRKTMIMKYKLTYPSGTATAFLINSFHTP  213

Query  1750  NGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSST  1571
              GAKLAK+QVA LFK F  SF++  FQWFFA  DGCGF SFPTFGL+A+ QRFYFDFS+T
Sbjct  214   KGAKLAKKQVAVLFKTFCLSFVWACFQWFFAVADGCGFVSFPTFGLQAFKQRFYFDFSAT  273

Query  1570  YVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAI  1391
             YVGVGM+CP MVN+SLLIGA++SWGI+WP+I TK+G WY  +LS+SSL GIQGY+VFLAI
Sbjct  274   YVGVGMICPYMVNISLLIGAVLSWGIMWPLIETKKGDWYSADLSASSLHGIQGYRVFLAI  333

Query  1390  AMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRT  1211
             AMMLGDGLF+  +M++ T  S +   + E +   ++ P + +      +   DF+  RRT
Sbjct  334   AMMLGDGLFHVVFMLIKTTSSLIANSKQESS---TIAPYESD------SSSPDFNEDRRT  384

Query  1210  HNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGL  1031
               FLKD IPN VA GGYI LA ++II +PFIFP LK+YH+ VAYA+AP+LAFCNAYGCGL
Sbjct  385   LYFLKDQIPNWVAYGGYIGLAVISIIVIPFIFPQLKFYHLMVAYAIAPLLAFCNAYGCGL  444

Query  1030  TDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLA  851
             TDWSLASNYGK AI+IFS+WVG ++GGV+AGLASCGVMM+IVST SDLMQDFKTGYLTL+
Sbjct  445   TDWSLASNYGKFAIIIFSAWVGLEHGGVIAGLASCGVMMNIVSTASDLMQDFKTGYLTLS  504

Query  850   SPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFG  671
             SP +MFFSQV GTA+ C +TPLVFW FYKAYP+GD   ++PAPY  +YR IALLGV+G  
Sbjct  505   SPRSMFFSQVYGTAISCVMTPLVFWFFYKAYPIGDPTGSFPAPYGLMYRGIALLGVEGVS  564

Query  670   SLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDM  491
             SLP NCL LAI  FV AI +N+  E+L+ +ETK R+YRF+P+ MCMAIPFYLG YFAIDM
Sbjct  565   SLPKNCLALAILCFVVAIVLNLIKELLQHFETKRRIYRFVPSAMCMAIPFYLGSYFAIDM  624

Query  490   CVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAA  311
             CVGSLILF+W   N+Q+AKDFGPAVASGLICG+SLWG+PAAIL+LAGV+APICMKFLSA+
Sbjct  625   CVGSLILFLWERSNRQKAKDFGPAVASGLICGDSLWGVPAAILSLAGVQAPICMKFLSAS  684

Query  310   ANAKLES  290
              N K+++
Sbjct  685   VNQKVDA  691



>ref|XP_006350378.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=650

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/653 (71%), Positives = 541/653 (83%), Gaps = 16/653 (2%)
 Frame = -2

Query  2284  RVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIK  2105
             + F++  IP+W+ Q+T+RAM T L+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA I+
Sbjct  13    KAFKEEYIPAWQKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAGIR  72

Query  2104  SWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNI  1925
             +WTA++ K G+LKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSP IA+QA++GN 
Sbjct  73    TWTAVIDKFGMLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPYIASQADAGNT  132

Query  1924  PNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNG  1745
             PNN K LSI WML +L+VVSF GLFSIV LRKMMI+KYKLTYPSGTATAYLIN FHTP G
Sbjct  133   PNNTKKLSITWMLPYLFVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAYLINCFHTPKG  192

Query  1744  AKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYV  1565
             AKLAK+QV +LF+ F FSF+FG  QW  A D+GCGF S  TFG +AYA++FYFDFSSTYV
Sbjct  193   AKLAKKQVRSLFQSFGFSFIFGAVQWIVARDEGCGFGSLHTFGSQAYAKKFYFDFSSTYV  252

Query  1564  GVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAM  1385
             GVGMLCP MVN+SLLIGAI+SW I+WP+I  K+G WY   LS++SL GIQGY+VF+AI+M
Sbjct  253   GVGMLCPYMVNISLLIGAIVSWAIMWPMIEEKKGDWYSAQLSATSLHGIQGYRVFIAISM  312

Query  1384  MLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHN  1205
             M+GDGLF+F YM+VVT  SF KR      GP    P +D  ++      +D D + R   
Sbjct  313   MIGDGLFHFAYMLVVTISSFTKR------GP----PQNDYSDE------DDHDKKIRNDY  356

Query  1204  FLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTD  1025
             FLKD IPN  AVGGY  +A ++II VP IF  LKWYH+ VAY +APILAFCN+YG GLTD
Sbjct  357   FLKDQIPNWAAVGGYACIALISIIVVPIIFHSLKWYHVLVAYLIAPILAFCNSYGAGLTD  416

Query  1024  WSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASP  845
             WSLASNYGKIAIL FS WVG +NGGV+AGLASCG+MMSI+ T S LM DFKTGYLTL SP
Sbjct  417   WSLASNYGKIAILTFSYWVGLENGGVIAGLASCGLMMSILDTASGLMGDFKTGYLTLTSP  476

Query  844   LAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGSL  665
              +MFFSQ+ GTAMGC +TPLVFWIF  AY LGD   +YPAPY  +YR IALLGV+GFGSL
Sbjct  477   RSMFFSQLIGTAMGCVITPLVFWIFNSAYKLGDPEGSYPAPYGLMYRGIALLGVEGFGSL  536

Query  664   PTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCV  485
             P +CL +AI FF+AAI IN+ +++L+KYETKY +YRFIP+PMCMAIPFYLGGYFAIDMC+
Sbjct  537   PKHCLRIAIWFFLAAILINLMTQLLQKYETKYGIYRFIPSPMCMAIPFYLGGYFAIDMCL  596

Query  484   GSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             GSLILF W+  NKQ+AKDFGPAVASGLICGESLWGIPA++LALAGVKAPICMK
Sbjct  597   GSLILFAWQMYNKQKAKDFGPAVASGLICGESLWGIPASVLALAGVKAPICMK  649



>ref|XP_004231467.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=653

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/654 (70%), Positives = 536/654 (82%), Gaps = 16/654 (2%)
 Frame = -2

Query  2284  RVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIK  2105
             + F+   IP+W+ Q+T+RAM T L+LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFA I+
Sbjct  14    KAFKDEFIPAWQKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAGIR  73

Query  2104  SWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNI  1925
             +WTA++ K G+LKQPFTRQENTVIQTC+VASSGIAFSSGTASYMLGMSP IA+QA++GN 
Sbjct  74    TWTAVIDKFGMLKQPFTRQENTVIQTCIVASSGIAFSSGTASYMLGMSPYIASQADAGNT  133

Query  1924  PNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNG  1745
             PNN K LSI W+L +L+VVSF GLFSIV LRKMMI+KYKLTYPSGTATAYLIN FHTP G
Sbjct  134   PNNTKKLSITWILPYLFVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAYLINCFHTPKG  193

Query  1744  AKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYV  1565
             AKLAK+QV +LF+ F FSF+FG  QW  A D+GCGF S  TFG +AYA++FYFDFSSTYV
Sbjct  194   AKLAKKQVRSLFQSFGFSFIFGAVQWIVARDEGCGFGSLHTFGSEAYAKKFYFDFSSTYV  253

Query  1564  GVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAM  1385
             GVGMLCP MVN+SLLIGAI+SW I+WP+I  K+G WY   LS++SL GIQGY+VF+AIAM
Sbjct  254   GVGMLCPYMVNISLLIGAIVSWAIMWPMIEEKKGDWYSAKLSATSLHGIQGYRVFIAIAM  313

Query  1384  MLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE-DFDGQRRTH  1208
             MLGDGLF+F YM+VVT  SF KR               D  N   G + E D D + R  
Sbjct  314   MLGDGLFHFAYMLVVTISSFTKR---------------DPQNDYSGEEDEHDLDKKIRND  358

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IPN   +GGY  +A +++I VP IF  LKWYHI VAY +APILAFCN+YG GLT
Sbjct  359   YFLKDQIPNWAVIGGYAGIALISVIVVPIIFHSLKWYHILVAYLVAPILAFCNSYGAGLT  418

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLASNYGKIAIL FS WVG +NGGV+AGLASCG+MMSI+ T S LM DFKTGYLTL S
Sbjct  419   DWSLASNYGKIAILTFSYWVGLENGGVVAGLASCGLMMSILDTASGLMGDFKTGYLTLTS  478

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MFFSQ+ GTAMGC +TPLVFWIF  AY LGD   +YPAPY  +YR IALLGV+GFGS
Sbjct  479   PRSMFFSQLIGTAMGCVITPLVFWIFNSAYKLGDPEGSYPAPYGLMYRGIALLGVEGFGS  538

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP +C+ L+I FF+AAI IN+ +++L+KYETKY +YRFIP+PMCMAIPFYLGGYFAIDMC
Sbjct  539   LPKHCVRLSIWFFLAAILINLMTQLLQKYETKYEIYRFIPSPMCMAIPFYLGGYFAIDMC  598

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             +GSLILF W+  NKQ+AKDFGPAVASGLICGESLWGIPA++LALAGVKAPICMK
Sbjct  599   LGSLILFGWQMYNKQKAKDFGPAVASGLICGESLWGIPASVLALAGVKAPICMK  652



>ref|XP_010650300.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=712

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/670 (68%), Positives = 559/670 (83%), Gaps = 5/670 (1%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             E+ E+VF+ +E+PSW+ Q+TIRAM TS+VLS +FNF++CKL+LTTG+IPS NVAAGLLGF
Sbjct  42    ETVEQVFKNLEVPSWRKQITIRAMVTSIVLSFVFNFVICKLSLTTGIIPSFNVAAGLLGF  101

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
             A +K+W +L+ K GLLKQPFTRQENTVIQTCVVA+SGIAF++GT+SY+L MS  +A QA+
Sbjct  102   AFVKAWVSLIEKFGLLKQPFTRQENTVIQTCVVAASGIAFNNGTSSYLLAMSSIVADQAD  161

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               +IP NVK+LS+GW++ FL  VSFVGLF +VPL +MMI+KYKLTYP+GTATAYLINSFH
Sbjct  162   R-DIPTNVKSLSLGWIIGFLLTVSFVGLFLMVPLTEMMIIKYKLTYPTGTATAYLINSFH  220

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLA QQV+ALFK F FSF F  FQWFF +   CGFSSFPTFGL+AY+ RFYFDFS
Sbjct  221   TPRGAKLAGQQVSALFKSFCFSFAFAFFQWFFRSGSDCGFSSFPTFGLQAYSHRFYFDFS  280

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             STYVGVGM+CP MVNVSLL+G+I+SWGI+WP+I  K GIWY  +L ++SL GIQGY+VFL
Sbjct  281   STYVGVGMICPYMVNVSLLLGSILSWGIMWPLIEKKAGIWYSADLPANSLHGIQGYRVFL  340

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEF-NKGKGAQLEDFDGQ  1220
             AIAMMLGDGL++  Y+MV T ++ +++  S K   A++  ++  F N+   + LE+FD +
Sbjct  341   AIAMMLGDGLYHVAYIMVKTMVNIIQQH-SMKRKEATV--INTHFSNQTLESMLENFDER  397

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR   FLKD IP+ VA+ GYI LA ++I  +P IFP LK YH+ VAY MAPILAFCNAYG
Sbjct  398   RRKEFFLKDQIPSWVAIPGYICLAGLSIGVIPVIFPQLKPYHVLVAYLMAPILAFCNAYG  457

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLASNYGK+AI++FSSWVG +NGGVLAGLASCGV+MSIVST SDLMQDFKTGYL
Sbjct  458   CGLTDWSLASNYGKMAIMVFSSWVGLENGGVLAGLASCGVIMSIVSTASDLMQDFKTGYL  517

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVD  680
             TLASP +MFFSQV GTA+GC  +PL+FW FYKAY +GD   +YPAPY  +YR +ALLGV+
Sbjct  518   TLASPRSMFFSQVFGTAIGCLFSPLIFWFFYKAYSVGDPTGSYPAPYGPMYRGMALLGVE  577

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             G  SLP NCL  AI FFVAA+ IN+ + + ++YET+YR+YRFIP+PMC+AIPFYLGGYF+
Sbjct  578   GVASLPKNCLEFAIWFFVAALLINLITHLFQRYETRYRIYRFIPSPMCIAIPFYLGGYFS  637

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMC+GSLIL  W  KNKQ A DFGPAVASGLICGESLWG+PAA+L+LAG+ APICMKFL
Sbjct  638   IDMCIGSLILLFWGMKNKQMANDFGPAVASGLICGESLWGVPAAMLSLAGLNAPICMKFL  697

Query  319   SAAANAKLES  290
             SA+ N K+++
Sbjct  698   SASTNNKIDA  707



>ref|XP_006359441.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=655

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/660 (70%), Positives = 537/660 (81%), Gaps = 20/660 (3%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             +VESTE  F+   +P W+ Q+ +RAM T L+LS +FNFIVCKLNLTTGVIPSLNVAAGLL
Sbjct  16    RVESTEDAFKDEYVPPWQKQIALRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLL  75

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GFA ++SWT ++ K G+LKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSP IA Q
Sbjct  76    GFAGVRSWTVVIDKFGMLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPYIATQ  135

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             + +GN PNN KTLSI WM  +L+VVSF GLFSIV LRK+MI+KYKLTYPSGTATAYLIN 
Sbjct  136   SGAGNTPNNTKTLSISWMFPYLFVVSFAGLFSIVALRKLMIIKYKLTYPSGTATAYLINC  195

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV +LFK F FSF+FG  QW  A D+GCGF S  TFG +AYA+RFYFD
Sbjct  196   FHTPKGAKLAKKQVGSLFKSFGFSFIFGAVQWLVARDEGCGFGSLHTFGAQAYAKRFYFD  255

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FSSTYVGVGMLCP MVN+SLLIGAI+SWGI+WP+I  K+G+WY  +LS++SL GIQGY+V
Sbjct  256   FSSTYVGVGMLCPYMVNISLLIGAIVSWGIMWPLIEEKKGVWYSADLSATSLHGIQGYRV  315

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+AIAMMLGDG+F+F YM+VVT LSF KR  S K                     ++ D 
Sbjct  316   FIAIAMMLGDGVFHFVYMLVVTVLSFTKRTSSRKE--------------------DEDDN  355

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             + +   FLKD IPN  A  GY  +  V+IIA+P IFP LKWY + VAY +APILAFCN+Y
Sbjct  356   KIQNEYFLKDQIPNWAAAVGYACIVIVSIIAIPIIFPSLKWYQVLVAYLIAPILAFCNSY  415

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLASNYGKIAIL FS WVG +NGGV+AGLASCG+MM IV T S LM DFKTGY
Sbjct  416   GAGLTDWSLASNYGKIAILTFSYWVGLENGGVIAGLASCGLMMCIVDTASGLMGDFKTGY  475

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGV  683
             LTL+SP +MFFSQ+ GTAMGC +TPLVF IF  AY LGD N  YPAPYA +YR IALLGV
Sbjct  476   LTLSSPRSMFFSQLIGTAMGCIITPLVFSIFNTAYTLGDPNGPYPAPYALMYRGIALLGV  535

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF SLPT+CL+L+I FF+AAI IN+ +++L K+ETKYR+YRFIP+PMCMAIPFYLGGYF
Sbjct  536   EGFDSLPTHCLSLSIWFFLAAILINLVTQLLEKFETKYRIYRFIPSPMCMAIPFYLGGYF  595

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMC+GSLILF W+  NKQ+AKDFGPAVASGLICG+SLWGIPA++LALAG KAP CMKF
Sbjct  596   AIDMCLGSLILFGWQMYNKQKAKDFGPAVASGLICGDSLWGIPASVLALAGAKAPFCMKF  655



>ref|XP_003556608.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Glycine max]
 gb|KHM99052.1| Putative metal-nicotianamine transporter YSL7 [Glycine soja]
Length=676

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/666 (69%), Positives = 535/666 (80%), Gaps = 6/666 (1%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F K  +P W  Q+T+R++ TS VLS +F FIVCKLN TTG+IPSLNVAAGLLGFA I
Sbjct  11    EEAFRKTRVPPWTKQITVRSVVTSFVLSVVFIFIVCKLNFTTGIIPSLNVAAGLLGFAAI  70

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K++TALL   GLLKQPFTRQENTVIQT VVASSGIAFSSG  SY+LGMSP IA+Q + GN
Sbjct  71    KAYTALLNNCGLLKQPFTRQENTVIQTFVVASSGIAFSSGMGSYLLGMSPYIASQVDGGN  130

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P N KT+S+GWM  FL+VVSFVGLFSIVPLRK+MILKYKLTYPSGTATA L+NS HTP 
Sbjct  131   TPINTKTISLGWMFGFLFVVSFVGLFSIVPLRKVMILKYKLTYPSGTATALLVNSLHTPK  190

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+QVA LFK F  SF FG FQWFF A DGCGFS+FPTFGL+AY+ RFYFDFSSTY
Sbjct  191   GAKLAKKQVALLFKSFCGSFAFGFFQWFFTAGDGCGFSTFPTFGLEAYSNRFYFDFSSTY  250

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP ++N SLL+GA+ISWGI+WP I  K+GIWY  +L  SSL GIQGY++F AIA
Sbjct  251   VGVGMICPYLINASLLLGAVISWGILWPWIEHKKGIWYSADLPGSSLSGIQGYRIFTAIA  310

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             MMLGDGL++   M++    S + +   +K  P+++   D + N       EDFD QRRT 
Sbjct  311   MMLGDGLYHCIIMLIRVAYSLITQYLKKKV-PSTVNHEDVDQNSS-----EDFDAQRRTE  364

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IP+ VA+ GY  LA ++II V  IFP LKWYH+ + Y +APILAFCNAYGCGLT
Sbjct  365   YFLKDEIPSWVAIIGYSVLAVISIITVSLIFPQLKWYHVLITYLIAPILAFCNAYGCGLT  424

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLASNYGK+AI+IFSSWVG ++GG++AGLASCGVMMSIVST SDLMQDFKTGYLTLAS
Sbjct  425   DWSLASNYGKVAIIIFSSWVGLEHGGLIAGLASCGVMMSIVSTASDLMQDFKTGYLTLAS  484

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MF SQV GTA GC L+PL+FW F KAY LGD   +YPAPY  VYR +ALLG  GF S
Sbjct  485   PRSMFMSQVLGTATGCLLSPLMFWFFNKAYTLGDPQGSYPAPYGEVYRGMALLGAKGFSS  544

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP NCL LAI FF  A+ INI  ++L  YETKYR+YRF+PNPM +AIPFYLGGYFAIDMC
Sbjct  545   LPKNCLELAIIFFFLAVFINIVHDLLEHYETKYRIYRFVPNPMALAIPFYLGGYFAIDMC  604

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             +GSLILF+W  KNKQ+AKD+GPA+ASGLICG+SLW +PAAIL+LAG   PICMKFLS+A 
Sbjct  605   IGSLILFLWEKKNKQKAKDYGPALASGLICGDSLWSVPAAILSLAGANPPICMKFLSSAV  664

Query  307   NAKLES  290
             N K+++
Sbjct  665   NKKVDT  670



>ref|XP_004298615.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Fragaria vesca subsp. vesca]
Length=689

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/669 (67%), Positives = 532/669 (80%), Gaps = 12/669 (2%)
 Frame = -2

Query  2290  TERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  2111
              E  F    +P W  Q+T+RAM TS +LS +FNFIVCKLNLTTGVIPSLNVAAGLLGFAV
Sbjct  24    VEAAFRNQAVPPWTKQITVRAMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  83

Query  2110  IKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESG  1931
             +K +TA+L K GLLKQPFTRQEN VIQTCVVASSGIAFSSGTASY+LGMS  IAAQ +  
Sbjct  84    LKFYTAILTKIGLLKQPFTRQENCVIQTCVVASSGIAFSSGTASYVLGMSGVIAAQGDGA  143

Query  1930  NIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  1751
             N P N+K   +GWM+ FL+ VSF+GLFSI+PLRK+MI+KYKLTYPSGTATAYLINSFHTP
Sbjct  144   NTPLNIKNPHVGWMMGFLFAVSFLGLFSIMPLRKVMIMKYKLTYPSGTATAYLINSFHTP  203

Query  1750  NGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSST  1571
              GAKLAK+QVA LFK F  SFL+  FQWF+ A DGCGF SFPTFGL+A AQRFYFDFSST
Sbjct  204   KGAKLAKKQVAVLFKTFCGSFLWACFQWFYTAADGCGFVSFPTFGLQAKAQRFYFDFSST  263

Query  1570  YVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAI  1391
             YVGVGM+CP +VN+SLL+G+IISWGI+WP+I   +G WY  ++ ++SL GIQGY+VF+AI
Sbjct  264   YVGVGMICPYIVNISLLVGSIISWGIMWPLIEKNKGTWYSADIPATSLHGIQGYRVFIAI  323

Query  1390  AMMLGDGLFNFFYMMVVTGLSFM--KRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             AMMLGDGL++  YM+++T  S     + + +KN       +D E   G     E++D +R
Sbjct  324   AMMLGDGLYHVAYMLIMTSYSLCCSPKTKEDKN-------LDTE--AGTEVLSENYDEER  374

Query  1216  RTHNFLKDSIPN-avavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             R   F KD IPN    V          I    +IF  LKWYHI  AY +AP+LAFCNAYG
Sbjct  375   RNEYFEKDQIPNWLAFVCYVGLAIVAIIFVPIYIFRQLKWYHILTAYMIAPVLAFCNAYG  434

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLASNYGK AI+IFS+WVG   GGV+AGLA+CGVMMS+VST SDLMQDFKTG+L
Sbjct  435   AGLTDWSLASNYGKFAIIIFSAWVGAPKGGVVAGLAACGVMMSVVSTASDLMQDFKTGFL  494

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVD  680
             TL+SP +MFFSQV GTAMGC L+PLVFW FYKAYPLGD +  YPAPYA +YR +ALLGV+
Sbjct  495   TLSSPRSMFFSQVLGTAMGCVLSPLVFWFFYKAYPLGDPDGPYPAPYALMYRGMALLGVE  554

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             G GSLP +C+ LA  FF A+IAIN+ +E+L++YETKY++YRFIP PMCMAIPFYLG YFA
Sbjct  555   GVGSLPKHCVKLAGSFFAASIAINLITELLKRYETKYKLYRFIPIPMCMAIPFYLGSYFA  614

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMC GSLIL++W+ KNKQQA DF PAVASGLICG+SLWG+PAAIL+L  VK PICM+F 
Sbjct  615   IDMCAGSLILYLWQRKNKQQADDFAPAVASGLICGDSLWGVPAAILSLVNVKPPICMRFF  674

Query  319   SAAANAKLE  293
             SA+ANAKLE
Sbjct  675   SASANAKLE  683



>ref|XP_003556609.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Glycine max]
 gb|KHM99051.1| Putative metal-nicotianamine transporter YSL7 [Glycine soja]
Length=676

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/666 (67%), Positives = 534/666 (80%), Gaps = 6/666 (1%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F    +  W  Q+T+R++ TS VLS +F FIVCKLN TTG+IPSLNVAAGLLGFAVI
Sbjct  11    EEAFRNTMMLPWTEQITVRSVVTSFVLSIVFIFIVCKLNFTTGIIPSLNVAAGLLGFAVI  70

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
              ++T LL   G+LK+PFTRQENTVIQT V+A+SGIAFSSG  +Y+LGMSP IA+Q + GN
Sbjct  71    NAYTTLLNNCGILKKPFTRQENTVIQTFVIAASGIAFSSGMGTYLLGMSPYIASQVDGGN  130

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P N KT+S+GWM  FL+VVSFVGLFSIVPLRK+MILKYKLTYPSGTATA L+NS HTP 
Sbjct  131   TPINTKTISLGWMFGFLFVVSFVGLFSIVPLRKVMILKYKLTYPSGTATALLVNSLHTPK  190

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+Q+A LFK F  SF FG FQWFF A D CGFS+FPTFGL+AY++RFYFDFSSTY
Sbjct  191   GAKLAKKQIALLFKSFCGSFAFGFFQWFFTAGDDCGFSTFPTFGLQAYSKRFYFDFSSTY  250

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP ++N SLL+GAI SWGI+WP+I  K+GIWY  +L S SL GIQGY+VF AIA
Sbjct  251   VGVGMICPYIINASLLLGAIFSWGILWPLIELKKGIWYSTDLPSGSLSGIQGYRVFTAIA  310

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             M+LGDGL++   M++    S + +   +K   +++ P D + N       EDFD QRRT 
Sbjct  311   MILGDGLYHCIIMLIRVAYSLITQYL-KKRVSSAVDPEDVDQNSS-----EDFDSQRRTE  364

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IP+ VA+ GY  LA ++II V  IFP LKWYH+ + Y +APILAFCNAYGCGLT
Sbjct  365   YFLKDEIPSWVAIIGYSVLAVISIITVSLIFPQLKWYHVLITYLIAPILAFCNAYGCGLT  424

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLA+NYGK+AI+IFSSWVG ++GG++AGLASCGVMMSIVST SDLMQDFKTGYLTLAS
Sbjct  425   DWSLAANYGKLAIIIFSSWVGLEHGGLIAGLASCGVMMSIVSTASDLMQDFKTGYLTLAS  484

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MF SQV GTA GC ++PL+FW F+KAY LGD   +YPAPY  VYR +ALLG  GF S
Sbjct  485   PRSMFVSQVLGTATGCLVSPLMFWFFHKAYTLGDPQGSYPAPYGEVYRGMALLGAKGFSS  544

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP NCL LAI FF+ A+ INI  ++L +YETKYR++RF+PNPM +AIPFYLGGYFAIDMC
Sbjct  545   LPKNCLELAIIFFLLAVFINIVRDLLERYETKYRLHRFVPNPMALAIPFYLGGYFAIDMC  604

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             +GSLILF+W  KNKQ+AKD+GPA+ASGLICG+SLW +PAAIL+LAG   PICMKFLS A 
Sbjct  605   IGSLILFLWEKKNKQKAKDYGPALASGLICGDSLWSVPAAILSLAGANPPICMKFLSRAM  664

Query  307   NAKLES  290
             N K+++
Sbjct  665   NNKVDT  670



>ref|XP_007153094.1| hypothetical protein PHAVU_003G006500g [Phaseolus vulgaris]
 gb|ESW25088.1| hypothetical protein PHAVU_003G006500g [Phaseolus vulgaris]
Length=674

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/663 (66%), Positives = 526/663 (79%), Gaps = 6/663 (1%)
 Frame = -2

Query  2278  FEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKSW  2099
             F    +P W  Q+T+R++ TS VLS +FNFIVCKLN TTG+IPSLNVAAGLLGFA+IKS+
Sbjct  13    FRNTRVPPWTKQITVRSVVTSFVLSVVFNFIVCKLNFTTGIIPSLNVAAGLLGFALIKSY  72

Query  2098  TALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIPN  1919
             T LL   GLL +PFTRQENTVIQT VVA+SGIAFSSG  SY+LGMSP I AQ   GN P 
Sbjct  73    TTLLSNCGLLGEPFTRQENTVIQTFVVAASGIAFSSGMGSYLLGMSPYIGAQLNGGNTPI  132

Query  1918  NVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGAK  1739
             N K LS+GWM AFL+VVSFVGLFSIVPLRK+MILKYKLTYPSGTATA L+NS HTP GAK
Sbjct  133   NTKGLSLGWMFAFLFVVSFVGLFSIVPLRKLMILKYKLTYPSGTATALLVNSLHTPKGAK  192

Query  1738  LAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGV  1559
             LAK+QVA LFK FS SF+FG FQWFF A D CGFSSFPTFGLKAY++ FYFDFS TYVGV
Sbjct  193   LAKKQVAVLFKSFSGSFVFGFFQWFFTAGDDCGFSSFPTFGLKAYSKMFYFDFSPTYVGV  252

Query  1558  GMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMML  1379
             GM+CP ++N SLL+GA+ISWGI+WP I  K+GIWY  +L +SSL G+QGY++F AIAMML
Sbjct  253   GMICPYVINASLLLGAVISWGILWPWIEHKKGIWYSADLPTSSLNGVQGYRIFTAIAMML  312

Query  1378  GDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNFL  1199
             GDGL++   M++    S + +   +K   ++     D+         +D D Q RT  F 
Sbjct  313   GDGLYHCIIMLLRVAYSLISQYIQKKESSSANHEDADQNTS------DDLDSQLRTEYFS  366

Query  1198  KDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWS  1019
             KD IP+ VA  GYI LA ++II V  IFP LKWYH+ + Y +AP+LAFCNAYGCGLTDWS
Sbjct  367   KDQIPSWVAFSGYIVLAVISIITVSHIFPQLKWYHVLITYLIAPVLAFCNAYGCGLTDWS  426

Query  1018  LASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLA  839
             LASNYGK+AI+IFSSWVG +NGG++AGLASCGVMMSIVST SDLMQDFKTGYLTLASP +
Sbjct  427   LASNYGKVAIIIFSSWVGLENGGIIAGLASCGVMMSIVSTASDLMQDFKTGYLTLASPRS  486

Query  838   MFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGSLPT  659
             MF SQV GT  GC ++PL+FW F+KAY LGD   +YPAPY  VYR +ALLG  GF SLP 
Sbjct  487   MFASQVLGTFTGCLVSPLMFWFFHKAYTLGDPQGSYPAPYGEVYRGMALLGAKGFSSLPQ  546

Query  658   NCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGS  479
             +CL LAI FF +A+ INI  ++L  YET+Y+++RF+PNPM +AIPFYLGGYFAIDMC+GS
Sbjct  547   HCLQLAIIFFFSAMLINIVHDLLLHYETRYKLHRFVPNPMALAIPFYLGGYFAIDMCIGS  606

Query  478   LILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAANAK  299
             LILF+W  +NKQ+A DFGP +ASGLICG+SLW +PAAIL+LAGV  PICMKFLS+A N +
Sbjct  607   LILFLWEKRNKQKANDFGPVLASGLICGDSLWSVPAAILSLAGVNPPICMKFLSSAMNKR  666

Query  298   LES  290
             +++
Sbjct  667   VDT  669



>ref|XP_010101178.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
 gb|EXC45314.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
Length=669

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/676 (64%), Positives = 514/676 (76%), Gaps = 56/676 (8%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F    +P W  Q+T+R+M TSLVLS +FNFIVCKLNLTTGVIPSLNVAAGLLGFAV+
Sbjct  34    EEAFVDTAVPPWTKQITVRSMVTSLVLSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAVV  93

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K +TA+L KAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASY+LGMS  IAAQ E GN
Sbjct  94    KGYTAVLDKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSANIAAQGEEGN  153

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P NVK LS+GWM+ +L+VVSFVGLFSIVPLRKMMI+KYKLTYPSGTATAYLINSFHTP 
Sbjct  154   TPINVKQLSLGWMIGYLFVVSFVGLFSIVPLRKMMIMKYKLTYPSGTATAYLINSFHTPK  213

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK                                             FY+DFS TY
Sbjct  214   GAKLAK---------------------------------------------FYYDFSMTY  228

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP MVN+SLLIGA++SWGI+WP+I  K+G WY   LS SSL GIQGY+VF+AIA
Sbjct  229   VGVGMICPYMVNISLLIGAVLSWGIMWPLIEQKKGDWYSAELSPSSLHGIQGYRVFIAIA  288

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEF-----------NKGKGAQ  1241
             MMLGDG+F+  YM+  TG S +K + ++K+  +      D             +    A 
Sbjct  289   MMLGDGIFHVAYMLCKTGYSLVKHQLNKKSLESPSSTNSDISSTTSTPSSPCASPAARAL  348

Query  1240  LEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPIL  1061
             LE++D +RRT  FLKD IP   A+ GYI LA ++ I VPFIFP L W+H+ VAY MAP+L
Sbjct  349   LENYDEKRRTDYFLKDQIPTWAAIIGYITLAILSTITVPFIFPQLIWHHVLVAYLMAPVL  408

Query  1060  AFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQ  881
             AFCNAYGCGLTDWSLASNYGK AI++FS+WVG DNGG++AGLASCGVMMSIVST SDLMQ
Sbjct  409   AFCNAYGCGLTDWSLASNYGKFAIILFSAWVGLDNGGIVAGLASCGVMMSIVSTASDLMQ  468

Query  880   DFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyra  701
             DFKTGYLTL+SP AMFFSQV GTA+GC ++PLVFW FYKAY +G+  S+YPAPY  +YR 
Sbjct  469   DFKTGYLTLSSPRAMFFSQVIGTAIGCLVSPLVFWFFYKAYNVGEPGSSYPAPYGLMYRG  528

Query  700   iALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPF  521
             IALLGV+G  S P NC +L I FF  A+A+N+  E+L+++ETK+++YRF+P+ MCMAIPF
Sbjct  529   IALLGVEGLSSFPKNCFSLCIAFFAFAVALNLARELLQRFETKHKIYRFVPSAMCMAIPF  588

Query  520   YLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKA  341
             YLGGYFAIDMC+GS ILF WR  N+++A +  PAVASGLICGESLWGIPAAIL+LAGV A
Sbjct  589   YLGGYFAIDMCLGSFILFAWRRLNQRKADELAPAVASGLICGESLWGIPAAILSLAGVNA  648

Query  340   PICMKFLSAAANAKLE  293
             PICMKFLSA+ N K++
Sbjct  649   PICMKFLSASVNNKVD  664



>gb|KDP43290.1| hypothetical protein JCGZ_24211 [Jatropha curcas]
Length=671

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/670 (64%), Positives = 516/670 (77%), Gaps = 34/670 (5%)
 Frame = -2

Query  2290  TERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  2111
              E  ++ +E+P W  Q+T+RAM TS++LS +F FIVCKLNLTTGVIPSLNVAAGLLGF +
Sbjct  29    VEEAYKHIEVPPWTQQVTVRAMVTSIILSLVFTFIVCKLNLTTGVIPSLNVAAGLLGFGM  88

Query  2110  IKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESG  1931
             +K WT LL K G LKQ FTRQENTVIQT VVA+SGIAFSSGTASY+LGMSP +AA++E G
Sbjct  89    LKFWTKLLEKTGFLKQQFTRQENTVIQTFVVAASGIAFSSGTASYILGMSPRMAAESEGG  148

Query  1930  NIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  1751
             N P+NVKTLS+GWM+ F ++VSFVGLFSI+ LRK+MIL  KLTYPSGTATAYLINSFHTP
Sbjct  149   NTPDNVKTLSLGWMIGFNFLVSFVGLFSILALRKIMILDLKLTYPSGTATAYLINSFHTP  208

Query  1750  NGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSST  1571
              GAKLAK+QV                        G  F+SF    L A+ Q FYFDFS+T
Sbjct  209   KGAKLAKKQV------------------------GFLFTSFGGSFLWAFFQWFYFDFSAT  244

Query  1570  YVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAI  1391
             YVGVGM+CP M+NVSLL+GAIISWGI+WP+I  K+G WY  +L  +SL GIQGY+VF+A+
Sbjct  245   YVGVGMICPYMINVSLLVGAIISWGIMWPLIEAKKGDWYRADLPGNSLHGIQGYRVFIAV  304

Query  1390  AMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKG---AQLEDFDGQ  1220
             A MLGDGL++   M+V+    F+ +    K+        D  F    G    ++ ++D Q
Sbjct  305   ATMLGDGLYHVLKMLVIALTDFIPKVAKLKSSK------DTSFVAPSGNDNTEIVNYDEQ  358

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR   FLKD I   +A+ GY+  AA++I+ VP IF  LKWYH+ VAY +AP+LAFCNAYG
Sbjct  359   RRVEFFLKDKISLWIALIGYVVFAAISIVVVPVIFHQLKWYHVLVAYVIAPVLAFCNAYG  418

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLASNYGK AI+IFS+WVGH  GG++AGL +CGVMM+IVST SDLMQD KTGYL
Sbjct  419   CGLTDWSLASNYGKFAIIIFSTWVGH-KGGIIAGLIACGVMMNIVSTASDLMQDLKTGYL  477

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVD  680
             TL+SP AM  SQ+ GTA GC ++PLVFW FYKAY +GD    YPAPY  +YR IA+LGV+
Sbjct  478   TLSSPRAMLISQILGTATGCLMSPLVFWFFYKAYTIGDPQGTYPAPYGLIYRGIAILGVE  537

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             G  SLP NCL L+I FF+AAI IN+  ++L+KYETKYR+YRFIP+PMCMAIPFYLG YFA
Sbjct  538   GLSSLPKNCLALSISFFLAAILINLVQDLLQKYETKYRIYRFIPSPMCMAIPFYLGSYFA  597

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             +DMCVGSLILF+W W+NKQ A DF PA+ASGLICG+SLWGIPAAIL+LAGV  PICMKFL
Sbjct  598   VDMCVGSLILFIWNWRNKQHASDFSPALASGLICGDSLWGIPAAILSLAGVAPPICMKFL  657

Query  319   SAAANAKLES  290
             SAAANA++++
Sbjct  658   SAAANARVDT  667



>ref|XP_010253872.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nelumbo 
nucifera]
Length=710

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/672 (65%), Positives = 532/672 (79%), Gaps = 1/672 (0%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             K  STE+ FE   +PSWK QLT RA   S VLS  F FIV KL+LTTG+IPSLNVAAGLL
Sbjct  35    KEASTEKAFENEIVPSWKEQLTFRAFLASAVLSVAFCFIVMKLSLTTGIIPSLNVAAGLL  94

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  I+ ++  L K GLLKQPF+RQENTVIQT VVA+SGIAFSSG  SY+LGM P IA+Q
Sbjct  95    GFFFIRVYSFALQKFGLLKQPFSRQENTVIQTAVVAASGIAFSSGYGSYILGMMPKIASQ  154

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             AE GN  NN+K LS+GWM  F++ VSFVGLFSIVPLRK+MI+ YKLTYPSGTATA+LINS
Sbjct  155   AEDGNTVNNMKPLSLGWMYGFVFAVSFVGLFSIVPLRKIMIIDYKLTYPSGTATAFLINS  214

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHT  GAKLAK+QV  LF+ FS SFL+  FQWFF + DGCGFSSFPTFGL+A+ +R YFD
Sbjct  215   FHTSKGAKLAKKQVNKLFEWFSMSFLWAFFQWFFTSSDGCGFSSFPTFGLQAFNKRLYFD  274

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VNVSLL+GAI+SW I+WP+I  K+GIWY  ++S SSL+GIQGY+V
Sbjct  275   FSATYVGVGMICPYIVNVSLLVGAILSWLIMWPLIEQKKGIWYAADISGSSLRGIQGYRV  334

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F++IAM+LGDGLF+   M++ TG S M++ +   +     +  D   +     + E +D 
Sbjct  335   FISIAMILGDGLFHVVCMLITTGWSLMRQYKKRDSSSVVAIAGDQPSSDSTHDREESYDD  394

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRR   FLKD IP  VA  GY++L+A++I+AVP IF  +KWYHI V+Y +APILAFCN+Y
Sbjct  395   QRRKDMFLKDQIPMWVAGLGYVSLSAISIVAVPQIFHQIKWYHILVSYIIAPILAFCNSY  454

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLAS YGKIAI I  SWVG   GG++AGL +CGVMMSIVST SDLMQDFKTGY
Sbjct  455   GCGLTDWSLASTYGKIAIFIIGSWVGLHGGGIVAGLVACGVMMSIVSTASDLMQDFKTGY  514

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLG  686
             LTLASP AMF SQV GTA+GC + P VFW +YK+YP LG+ + ++PAPY  +YR IA+LG
Sbjct  515   LTLASPRAMFCSQVMGTALGCLIAPAVFWFYYKSYPTLGEVDGSFPAPYGLMYRGIAILG  574

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G  SLP +C+ L++GFF  AIA+NI + +L KY+ K+R++RF+P  MCMAIPFYLGGY
Sbjct  575   VEGTSSLPRHCVELSVGFFCIAIALNIVTLLLEKYDKKWRLHRFVPRAMCMAIPFYLGGY  634

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMC+GSLIL++WRWKNK  A    PAVASG+ICG+SLWGIPAAIL+LA V  P+CMK
Sbjct  635   FAIDMCIGSLILYLWRWKNKAGADALAPAVASGMICGDSLWGIPAAILSLANVNPPLCMK  694

Query  325   FLSAAANAKLES  290
             FL A+ANAK+++
Sbjct  695   FLPASANAKVDA  706



>ref|XP_010245475.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nelumbo 
nucifera]
Length=680

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/670 (65%), Positives = 532/670 (79%), Gaps = 13/670 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             +++E+ FE   +PSWK+Q+T RA+  S VLS  F FIV KLNLTTG+IPSLNVAAGLLGF
Sbjct  19    QASEKAFENEIVPSWKDQVTFRAILASAVLSVAFCFIVMKLNLTTGIIPSLNVAAGLLGF  78

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               I+ +T +L + GLLKQPFTRQENTVIQT VVA+SGIAFS G  SY+LGM P +AAQA+
Sbjct  79    FFIRVYTWVLERFGLLKQPFTRQENTVIQTAVVAASGIAFSGGYGSYILGMMPKVAAQAQ  138

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
              G   NNVK LS+GW+  FL+ VSFVGLFSIVPLRK+MI+ YKLTYPSGTATA+LINSFH
Sbjct  139   DGATTNNVKHLSLGWLYGFLFAVSFVGLFSIVPLRKIMIIDYKLTYPSGTATAFLINSFH  198

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLAK+QV+ LFK FS SFL+  FQWFF   DGCGFSSFPTFGL+A+ +RFYFDFS
Sbjct  199   TPKGAKLAKKQVSKLFKWFSISFLWSFFQWFFTGGDGCGFSSFPTFGLQAFQKRFYFDFS  258

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TY+GVGM+CP MVN+SLLIGAI+SW I+WP+I  K+GIWY  +LS+SSL+GIQGYKVF 
Sbjct  259   ATYIGVGMICPYMVNISLLIGAILSWLIMWPLIEKKKGIWYASDLSASSLRGIQGYKVFT  318

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             AIAM+LGDGLF+   M++ T  S M + + + +  +S               +  +D QR
Sbjct  319   AIAMILGDGLFHVVLMLITTTRSLMNQYKKQDSQSSS------------NTDVISYDDQR  366

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             R   FLKD IP  +A  GY+AL+ ++IIAVP +F  +KWY I VAY +APILAFCN+YGC
Sbjct  367   RKEIFLKDQIPMWMAGLGYVALSVISIIAVPQVFHQIKWYQIMVAYIIAPILAFCNSYGC  426

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YGKIAI IF SWV H  GG++AGLA+CGVMMSIVST SDLMQDFKTGYLT
Sbjct  427   GLTDWSLASTYGKIAIFIFGSWVSHHKGGIVAGLAACGVMMSIVSTASDLMQDFKTGYLT  486

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVD  680
             LASP AMF SQV GTA+GC + P VFW +YK+YP LG+  S+YPAPYA +YR IA+LGV+
Sbjct  487   LASPRAMFCSQVVGTALGCLIAPSVFWFYYKSYPTLGEVGSSYPAPYALMYRGIAILGVE  546

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             G  SLP +C+ +A+GFF  AIA+N+ + +L ++E K+ ++RFIP+ MCMAIPFY+GGYFA
Sbjct  547   GTSSLPKHCMEMAVGFFFFAIALNLITLLLERFENKWGLHRFIPSVMCMAIPFYIGGYFA  606

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMC+GSLILF+W  KNK  A  F PAVASG+ICG+SLWGIPAAIL+LA   +P+CMKFL
Sbjct  607   IDMCIGSLILFLWERKNKAGANAFAPAVASGMICGDSLWGIPAAILSLANRNSPLCMKFL  666

Query  319   SAAANAKLES  290
             SAA NAK+++
Sbjct  667   SAATNAKVDA  676



>ref|XP_004289490.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Fragaria vesca subsp. vesca]
Length=697

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/676 (64%), Positives = 525/676 (78%), Gaps = 7/676 (1%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             +S E+ FE  E+P W  Q+TIR+M T  +LS +FNFIVCKLNLTTG+IPSLNVAAGLLGF
Sbjct  18    DSIEKAFEDTEVPPWTKQITIRSMVTGFLLSIVFNFIVCKLNLTTGIIPSLNVAAGLLGF  77

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
             A++K +TALL K GLLKQPFTRQENTV+QTCVVASSGIAFSSG  SY+LGMSP +AAQA+
Sbjct  78    ALLKVYTALLQKFGLLKQPFTRQENTVVQTCVVASSGIAFSSGMGSYLLGMSPLVAAQAD  137

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
             +GN   N+K L+I WM  +L++VSFVGLFSI+ LRKMMI+  KLTYPSGTATA+LINSFH
Sbjct  138   AGNTLINIKKLAIPWMTGYLFLVSFVGLFSIIALRKMMIIDRKLTYPSGTATAHLINSFH  197

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             T  GAK+A +QV+ LF     SFL+  FQWFF A+D CGF++FPTFGLKAY QRFYFDFS
Sbjct  198   TRKGAKVAARQVSFLFMFGGGSFLWSFFQWFFNAEDDCGFANFPTFGLKAYKQRFYFDFS  257

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
              TY+G GM+   MVN+S+L+GA+ISWGI+WP+I  ++G WY  +LS+SSL GIQGY+VF+
Sbjct  258   MTYIGCGMITNYMVNISMLVGAVISWGIMWPLIEKQKGNWYGAHLSASSLHGIQGYRVFI  317

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKG---KGAQLE---  1235
             +I M+LGDG+++  Y         ++  RS K     L    +    G      + E   
Sbjct  318   SIGMILGDGVYHVLYHAGYMAFVLIRSLRSNKPEEKKLSSEMELMESGGVPSSTETELMS  377

Query  1234  -DFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILA  1058
              ++D +RRT  F KD  P   +  GYI  AA + I +PF+F  LKWYH+A+ Y +AP+LA
Sbjct  378   ANYDEKRRTDFFHKDEFPTWFSPTGYICCAAASTICLPFLFHQLKWYHVAIGYIIAPVLA  437

Query  1057  FCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQD  878
             FCNAYGCGLTDWSLASNYGK+AILI S+ VG   GGV+AGLAS GV MSIVST SDLMQD
Sbjct  438   FCNAYGCGLTDWSLASNYGKVAILIVSALVGEKEGGVIAGLASGGVTMSIVSTASDLMQD  497

Query  877   FKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyrai  698
             FKTG+LTL+SP +MF SQV GTAMGC ++PL+FW FYKAYP+GD    YPAP+  VYR I
Sbjct  498   FKTGFLTLSSPRSMFLSQVLGTAMGCVMSPLIFWFFYKAYPVGDPKGPYPAPFGQVYRGI  557

Query  697   ALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFY  518
             ALLGV+G GSLP +C  LA+ FF  AIAIN+ +E+L++YETKY++YRF+PN M MAIPFY
Sbjct  558   ALLGVEGIGSLPKHCFALALSFFALAIAINVATELLKRYETKYKIYRFVPNAMAMAIPFY  617

Query  517   LGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAP  338
             LG YF IDMCVGSLILFVW+  NKQQA++ GPAVASGLICGES+WGIPAAIL+L  V+AP
Sbjct  618   LGSYFVIDMCVGSLILFVWKIMNKQQAEELGPAVASGLICGESMWGIPAAILSLVNVRAP  677

Query  337   ICMKFLSAAANAKLES  290
             ICMKFLS   NAK++S
Sbjct  678   ICMKFLSDEDNAKVDS  693



>emb|CAN62811.1| hypothetical protein VITISV_041555 [Vitis vinifera]
Length=692

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/679 (63%), Positives = 528/679 (78%), Gaps = 43/679 (6%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             E+ E+VF+ +E+PSW+ Q+TIRAM TS+VLS +FNF++CKL+LTTG+IPS NVAAGLLGF
Sbjct  42    ETVEQVFKNLEVPSWRKQITIRAMVTSIVLSFVFNFVICKLSLTTGIIPSFNVAAGLLGF  101

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
             A +K+W +L+ K GLLKQPFTRQENTVIQTCVVA+SGIAF++GT+SY+L MS  +A QA+
Sbjct  102   AFVKAWVSLIEKFGLLKQPFTRQENTVIQTCVVAASGIAFNNGTSSYLLAMSSIVADQAD  161

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               +IP NVK+LS+GW++ FL  VSFVGLF +VPL +MMI+KYKLTYP+GTATAYLINSFH
Sbjct  162   R-DIPTNVKSLSLGWIIGFLLTVSFVGLFLMVPLTEMMIIKYKLTYPTGTATAYLINSFH  220

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFP-----TFGLKAYAQRF  1592
             TP GAKLA                              GFS           L   ++  
Sbjct  221   TPRGAKLAG-----------------------------GFSGLEATVGSVVSLHLVSKHT  251

Query  1591  Y----FDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLK  1424
                  FDFSSTYVGVGM+CP MVNVSLL+G+I+SWGI+WP+I  K GIWY  +L ++SL 
Sbjct  252   LIGSTFDFSSTYVGVGMICPYMVNVSLLLGSILSWGIMWPLIEKKAGIWYSADLPANSLH  311

Query  1423  GIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEF-NKGKG  1247
             GIQGY+VFLAIAMMLGDGL++  Y+MV T ++ +++  S K   A++  ++  F N+   
Sbjct  312   GIQGYRVFLAIAMMLGDGLYHVAYIMVKTMVNIIQQH-SMKRKEATV--INTHFSNQTLE  368

Query  1246  AQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAP  1067
             + LE+FD +RR   FLKD IP+ VA+ GYI LA ++I  +P IFP LK YH+ VAY MAP
Sbjct  369   SMLENFDERRRKEFFLKDQIPSWVAIPGYICLAGLSIGVIPVIFPQLKPYHVLVAYLMAP  428

Query  1066  ILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDL  887
             ILAFCNAYGCGLTDWSLASNYGK+AI++FSSWVG +NGGVLAGLASCGV+MSIVST SDL
Sbjct  429   ILAFCNAYGCGLTDWSLASNYGKMAIMVFSSWVGLENGGVLAGLASCGVIMSIVSTASDL  488

Query  886   MQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavy  707
             MQDFKTGYLTLASP +MFFSQV GTA+GC  +PL+FW FYKAY +GD   +YPAPY  +Y
Sbjct  489   MQDFKTGYLTLASPRSMFFSQVFGTAIGCLFSPLIFWFFYKAYSVGDPTGSYPAPYGPMY  548

Query  706   raiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAI  527
             R +ALLGV+G  SLP NCL  AI FFVAA+ IN+ + + ++YET+YR+YRFIP+PMC+AI
Sbjct  549   RGMALLGVEGVASLPKNCLEFAIWFFVAALLINLITHLFQRYETRYRIYRFIPSPMCIAI  608

Query  526   PFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGV  347
             PFYLGGYF+IDMC+GSLIL  W  KNKQ A DFGPAVASGLICGESLWG+PAA+L+LAG+
Sbjct  609   PFYLGGYFSIDMCIGSLILLFWGMKNKQMANDFGPAVASGLICGESLWGVPAAMLSLAGL  668

Query  346   KAPICMKFLSAAANAKLES  290
              APICMKFLSA+ N K+++
Sbjct  669   NAPICMKFLSASTNNKIDA  687



>gb|EPS73705.1| hypothetical protein M569_01043 [Genlisea aurea]
Length=695

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/674 (62%), Positives = 517/674 (77%), Gaps = 16/674 (2%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             ++ES E++FE  E+P W+ QLT+RA+F S +LS +F FIV KLNLTTG+IPSLNV+AGLL
Sbjct  31    EIESVEKIFESKEVPPWQRQLTLRAIFVSFILSILFTFIVMKLNLTTGIIPSLNVSAGLL  90

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  +K+WT  L K+GLL+QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA+Q
Sbjct  91    GFFFVKTWTKFLEKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEVIASQ  150

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +   N P NVK  ++ W++ FL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINS
Sbjct  151   STEANDPKNVKNPNLAWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINS  210

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K FSFSFL+G FQWFF A D CGF SFPTFGLKAY  RFYFD
Sbjct  211   FHTPQGAKLAKKQVRTLGKFFSFSFLWGFFQWFFTAGDNCGFVSFPTFGLKAYQNRFYFD  270

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP ++NVSLL+GAI+SWGI+WP+I  ++G WYP  +SSS+L G+QGY+V
Sbjct  271   FSATYVGVGMICPYLINVSLLVGAILSWGIMWPLIQNRKGDWYPATVSSSNLHGLQGYRV  330

Query  1402  FLAIAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDF  1229
             F+AIAM+LGDGL+NFF ++   + GL    R R        +LPV+ +      A    +
Sbjct  331   FIAIAMILGDGLYNFFKVLGRTILGLYLQVRNRE-----VDILPVNGQ---PPSAAAVSY  382

Query  1228  DGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCN  1049
             + Q RT  FLKD IPN VA+ GY+ +  V+   +P IF PLKWYH+ V Y +AP+LAFCN
Sbjct  383   NDQIRTRLFLKDRIPNWVAIAGYVTIGVVSAATLPHIFHPLKWYHVVVMYIIAPVLAFCN  442

Query  1048  AYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKT  869
             AYGCGLTDWSLAS YGK+AI I  +W G ++GGVLAGLA+CGVMM+IVST SDL QDFKT
Sbjct  443   AYGCGLTDWSLASTYGKLAIFIIGAWAGSNHGGVLAGLAACGVMMNIVSTASDLSQDFKT  502

Query  868   GYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiAL  692
             GY+TLASP +MF SQ+ GTAMGC ++P VFW+FYKA+  LG   S YPAPYA VYR +A+
Sbjct  503   GYMTLASPRSMFVSQIIGTAMGCVISPCVFWLFYKAFHDLGSPTSQYPAPYALVYRNMAI  562

Query  691   LGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLG  512
             LGV+GFG+LP +CL L   FF  AIAIN   ++           RFIP PM MAIPFYLG
Sbjct  563   LGVEGFGALPKHCLTLCYIFFAGAIAINGVRDIAGPKRA-----RFIPLPMAMAIPFYLG  617

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
              YFAIDMC+GSLILF+W   +K +A  FGPAVASGLICG+ +W +P++ILAL GV  PIC
Sbjct  618   AYFAIDMCLGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSSILALVGVNPPIC  677

Query  331   MKFLSAAANAKLES  290
             MKFLS   NAK+++
Sbjct  678   MKFLSRRTNAKVDT  691



>ref|XP_011035386.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Populus 
euphratica]
Length=684

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/671 (63%), Positives = 522/671 (78%), Gaps = 16/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVFE  E+PSW+NQLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  23    SVERVFENQEVPSWRNQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  82

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  + ++GLLKQPFTRQ+NTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+  
Sbjct  83    FIKTWTKFVERSGLLKQPFTRQKNTVIQTCVVASSGIAFSGGFGSYLFGMSEAVAKQSTE  142

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 +  K  S+ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  143   HT--DAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIVDFKLTYPSGTATAYLINSFHT  200

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A DGCGF+SFP+ GLKAY  +F+FDFS+
Sbjct  201   PAGAKLAKRQVKVLGKFFSFSFLWGVFQWFYTAGDGCGFASFPSLGLKAYENQFFFDFSA  260

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVS+L+G IISWG++WP+I TK+G WYP +L +SSL G+QGYKVF+A
Sbjct  261   TYVGVGMICPYIINVSVLLGGIISWGLMWPLIDTKKGDWYPADLKASSLHGLQGYKVFIA  320

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA++LGDGL+NFF ++  T   L F  R R+      S LP+ D  +  + +++  +D Q
Sbjct  321   IALILGDGLYNFFKVLSRTLAALFFQLRVRNA----TSNLPIADR-SSPESSKIS-YDEQ  374

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             +RT  FLKD IP   ++ GY+ +AA++ I +P IF  LKWY+I V Y  AP LAFCNAYG
Sbjct  375   QRTRLFLKDQIPTWFSIAGYVTIAAISTITLPHIFHELKWYYILVIYIFAPTLAFCNAYG  434

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  435   CGLTDWSLASTYGKLAIFVIGAWAGASHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYL  494

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG + S YPAPYA VYR +A+LGV
Sbjct  495   TLSSPRSMFVSQLIGTAMGCIISPSVFWLFFKAFKDLGTTGSQYPAPYATVYRNMAILGV  554

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP NCL L  GFFVAAI IN+  + L K     +  RFIPNPM MAIPFY+G YF
Sbjct  555   EGFSALPKNCLYLCYGFFVAAILINLIKDALGK-----KWARFIPNPMAMAIPFYIGSYF  609

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +K +A  FGPAVASGLICG+ +W +P++IL LAGVK PICMKF
Sbjct  610   AIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSSILVLAGVKPPICMKF  669

Query  322   LSAAANAKLES  290
             LS   N+K+++
Sbjct  670   LSRGTNSKVDA  680



>ref|XP_006372622.1| iron transporter-related family protein [Populus trichocarpa]
 gb|ERP50419.1| iron transporter-related family protein [Populus trichocarpa]
Length=698

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/670 (63%), Positives = 515/670 (77%), Gaps = 14/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+NQLT+RA   S VLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  37    SVERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFF  96

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS T+A Q+  
Sbjct  97    FIKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAKQSTE  156

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +  K  S+ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  157   DS--DAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHT  214

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWF+ A DGCGF  FP+ GLKAY  +F+FDFS+
Sbjct  215   PAGAKLAKKQVKALGKFFSFSFLWGFFQWFYTAGDGCGFVEFPSLGLKAYENKFFFDFSA  274

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I TK+G WY  +L SSSL G+QGYKVF+A
Sbjct  275   TYVGVGMICPYIINISVLLGGILSWGLMWPLIDTKKGDWYSADLKSSSLHGLQGYKVFIA  334

Query  1393  IAMMLGDGLFNFFYMMVVT-GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             IAM+LGDGL+NFF ++  T  + F + +R +  G    LP+              ++ QR
Sbjct  335   IAMILGDGLYNFFKVLSRTLTVLFFQLQRKDATGA---LPIAGR--SSPETSRISYNDQR  389

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP   AV GY+A+AA++   +P IFP LKWY+I V Y  AP LAFCNAYGC
Sbjct  390   RTQLFLKDQIPTWFAVAGYVAIAAISTATLPHIFPELKWYYILVIYIFAPALAFCNAYGC  449

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLT
Sbjct  450   GLTDWSLASTYGKLAIFVIGAWAGASHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYLT  509

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVD  680
             L+SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG   S YPAPYA VYR +A+LGVD
Sbjct  510   LSSPRSMFVSQLIGTAMGCIISPCVFWLFFKAFKDLGTPGSQYPAPYATVYRNMAILGVD  569

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NCL L  GFF AAI IN+  + L K     +  RFIPNPM MAIPFY+G YFA
Sbjct  570   GFSSLPKNCLYLCYGFFGAAILINLIKDALGK-----KWARFIPNPMAMAIPFYIGSYFA  624

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMCVGSLILF+W   +K +A  FGPAVASGLICG+ +W +P+AILAL GVK PICMKFL
Sbjct  625   IDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSAILALVGVKPPICMKFL  684

Query  319   SAAANAKLES  290
             S   NAK+++
Sbjct  685   SRRTNAKVDA  694



>ref|XP_006372354.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
 gb|ERP50151.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
Length=698

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/670 (63%), Positives = 514/670 (77%), Gaps = 14/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+NQLT+RA   S VLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  37    SVERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFF  96

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS T+A Q+  
Sbjct  97    FIKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAEQSTE  156

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +  K  S+ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  157   DS--DAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHT  214

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K  SFSFL+G FQWF+ A DGCGF+ FP+ GLKAY  +F+FDFS+
Sbjct  215   PAGAKLAKKQVIALGKFLSFSFLWGFFQWFYTAGDGCGFAEFPSLGLKAYENKFFFDFSA  274

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I TK+G WY  +L  +SL G+QGYKVF+A
Sbjct  275   TYVGVGMICPYIINISVLLGGILSWGLMWPLIDTKKGDWYSADLKPNSLHGLQGYKVFIA  334

Query  1393  IAMMLGDGLFNFFYMMVVTGLS-FMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             IA++LGDGL+NFF ++  T  + F + +RS+  G   +LP+ D            ++ QR
Sbjct  335   IALILGDGLYNFFKVLSRTLTALFFQLQRSDATG---VLPIADR--SSPETSRISYNDQR  389

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP   AV GY+A+AA++   +P IFP LKWY+I V Y  AP LAFCNAYGC
Sbjct  390   RTQLFLKDQIPTWFAVAGYVAIAAISTATLPHIFPELKWYYILVIYVFAPALAFCNAYGC  449

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YG +AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLT
Sbjct  450   GLTDWSLASTYGTLAIFAIGAWAGASHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYLT  509

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVD  680
             L+SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG   S YPAP A V+R +A+LGVD
Sbjct  510   LSSPRSMFVSQLIGTAMGCVISPCVFWLFFKAFKDLGTPGSQYPAPNATVFRNMAILGVD  569

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NCL L  GFF AAI IN+  + L K     +  RFIPNPM MAIPFY+G YFA
Sbjct  570   GFSSLPKNCLYLCYGFFSAAILINLMKDALGK-----KWARFIPNPMAMAIPFYIGSYFA  624

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMCVGSLILF+W   +K +A  FGPAVASGLICG+ +W +P+AILAL GVK PICMKFL
Sbjct  625   IDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSAILALVGVKPPICMKFL  684

Query  319   SAAANAKLES  290
             S   NAK+++
Sbjct  685   SRGTNAKVDA  694



>ref|XP_010940334.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=709

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/669 (62%), Positives = 514/669 (77%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF++  +P+W+ QLT+RA   S +L  +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  43    SMERVFDEKPVPTWREQLTVRAFAVSALLGVMFSIIVMKLNLTTGIIPSLNVSAGLLGFF  102

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +++W  +L K GLLKQPFTRQENTVIQTCVVA+SGIAFS G  SY+  MS TIA Q   
Sbjct  103   FVRTWARVLEKTGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFAMSDTIAKQTTE  162

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ YKLTYPSGTATA+LINSFHT
Sbjct  163   ENDAQNIKNPKLGWMIGFLFVVSFLGLFSLVPLRKIMIIDYKLTYPSGTATAHLINSFHT  222

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F  SFL+G FQWF+ A D CGF++FPT GL+AY  +FYFDFS+
Sbjct  223   PQGAKLAKKQVRTLGKFFVVSFLWGFFQWFYTAGDDCGFAAFPTLGLQAYEHKFYFDFSA  282

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+S+L+G I+SWGI+WP+I  K+G WYP  LS +SL G+QGY+VF+A
Sbjct  283   TYVGVGMICPYLVNISVLLGGILSWGIMWPLIDAKKGDWYPAGLSPTSLHGLQGYRVFIA  342

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NFF ++  T  +F+ + +S+ N  A+ LP+ D+ +    + +  FD +RR
Sbjct  343   IALILGDGLYNFFKVLGRTISTFISQVKSKGN--AATLPISDDSSPITTSGIS-FDDRRR  399

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FL+D I   +A GGY+ +AAV+I  +P IFP LKWY++ VAY  AP+LAFCNAYGCG
Sbjct  400   TELFLRDQIQKPIAFGGYVVVAAVSIATLPHIFPQLKWYYVLVAYIFAPVLAFCNAYGCG  459

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  460   LTDWSLASTYGKLAIFTIGAWAGASNGGVLAGLAACGVMMSIVSTASDLMQDFKTGYLTL  519

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
              SP +MF SQV GTAMGC + P VFW+F+KA+  +G   S YP+P A VYR +A+LGVDG
Sbjct  520   TSPRSMFVSQVIGTAMGCVIAPSVFWLFFKAFKDIGVPGSEYPSPNALVYRNMAILGVDG  579

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL L   FF AAI IN+  +V+ K     +V RFIP PM MAIPFYLG YFAI
Sbjct  580   FSSLPKHCLTLCYIFFGAAILINLLRDVVGK-----KVARFIPLPMAMAIPFYLGSYFAI  634

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILFVW   +K +A  FGPAVASGLICG+ +W +P ++LAL  VK PICMKFLS
Sbjct  635   DMCVGSLILFVWELIDKAKAATFGPAVASGLICGDGIWTLPQSVLALVQVKPPICMKFLS  694

Query  316   AAANAKLES  290
              + NAK+++
Sbjct  695   RSMNAKVDT  703



>ref|XP_003548294.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Glycine max]
 gb|KHN24500.1| Putative metal-nicotianamine transporter YSL7 [Glycine soja]
Length=702

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/671 (62%), Positives = 512/671 (76%), Gaps = 18/671 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF+ + +PSW+NQLT+RA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  43    SVERVFQHLLVPSWRNQLTVRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  102

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L K+ +L+QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+  
Sbjct  103   FVKTWTKFLEKSNMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEEIAKQSSD  162

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                P++ K   +GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  163   ---PSHFKDPKLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  219

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SF +G FQWF+ A D CGF +FP+ GLKAY  +F+FDF++
Sbjct  220   PQGAKLAKKQVKMLGKFFSLSFFWGFFQWFYTATDQCGFQAFPSLGLKAYENKFFFDFAA  279

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
              YVGVGM+CP ++N+S+L+G IISWGI+WP+I TKEG WY   L   +L GIQGY+VF+A
Sbjct  280   IYVGVGMICPYIINISVLLGGIISWGIMWPLIKTKEGDWYDKGLGEGNLHGIQGYRVFIA  339

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA++LGDGL+NF  ++  T  GL    R +  +N    +LPV D+ +    + L  +D Q
Sbjct  340   IALILGDGLYNFIKVLTHTLWGLYHQIREKQREN----VLPVADQ-DSPSNSHLS-YDDQ  393

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   A+ GY+A+AA++   +P IFP LKWY+I V Y +AP LAFCNAYG
Sbjct  394   RRTQLFLKDQIPTWFAISGYVAIAAISTATLPHIFPELKWYYIIVIYLIAPTLAFCNAYG  453

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGYL
Sbjct  454   CGLTDWSLASTYGKLAIFTIGAWAGSSNGGVLAGLAACGVMMNIVSTASDLMQDFKTGYL  513

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ+ GT MGC ++P VFWIFYKA+P LG S S YPAPYA +YR +A+LGV
Sbjct  514   TLASPRSMFVSQIIGTTMGCIISPCVFWIFYKAFPDLGRSTSEYPAPYAIIYRNMAILGV  573

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
              GFG LP NCL L   FF AA+AIN+  + L K        RFIP PM MAIPFY+G YF
Sbjct  574   QGFGHLPKNCLLLCYIFFAAAVAINLIKDFLGKRG------RFIPLPMAMAIPFYIGPYF  627

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLIL+VW   NK +A  F PAVASGLICG+ +W +PA+ILALAGVK PICMKF
Sbjct  628   AIDMCVGSLILYVWERINKAKADAFAPAVASGLICGDGIWTLPASILALAGVKPPICMKF  687

Query  322   LSAAANAKLES  290
             LS AANA++++
Sbjct  688   LSRAANARVDT  698



>ref|XP_004233770.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=694

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/669 (63%), Positives = 516/669 (77%), Gaps = 10/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW++QLT+RA   S +L  +F FIV KL+LTTG+IPSLNV+AGLLGF 
Sbjct  31    SVERIFESKEVPSWQDQLTLRAFCVSFILGILFTFIVLKLSLTTGIIPSLNVSAGLLGFF  90

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT LL K+G+LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+  MS   A Q+  
Sbjct  91    FIKTWTKLLEKSGVLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFAMSEVAAKQSTE  150

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K  S+GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  151   ANNAFNIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  210

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWFF A D CGF+SFPTFGLKAY  +FYFDFS+
Sbjct  211   PQGAKLAKKQVKALAKFFSFSFLWGFFQWFFTAGDDCGFASFPTFGLKAYENKFYFDFSA  270

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLL+G+I+SWGI+WP+I  ++G W+P + S SSL G+QGYKVF+A
Sbjct  271   TYVGVGMICPYLINISLLLGSILSWGIMWPLIQDRKGHWFPADESPSSLHGLQGYKVFIA  330

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  +   T      + RS+  G  ++LPV    +  + +    FD QRR
Sbjct  331   IAMILGDGLYNFVKVFGRTLYGLYLQFRSKDEG--AVLPVGARPSPPEPSM--SFDDQRR  386

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP  V++ GY+ +A ++ I +P IF  LKWYHI V Y  AP+LAFCNAYGCG
Sbjct  387   TTLFLKDQIPTWVSIVGYVGIAILSTITLPHIFHQLKWYHIIVIYVFAPVLAFCNAYGCG  446

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGY+TL
Sbjct  447   LTDWSLASTYGKLAIFTIGAWAGASHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYMTL  506

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQ+ GTAMGC ++P VFW+FYKA+P LG   SAYPAPYA VYR ++++GV+G
Sbjct  507   ASPRSMFISQIIGTAMGCLISPCVFWLFYKAFPDLGTQGSAYPAPYALVYRNMSIIGVEG  566

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP NCL L   FF+ AI IN   +++ K + KY     IP PM MAIPFYLG YFAI
Sbjct  567   FSALPKNCLILCCIFFIGAIVINGIRDLVGKNKAKY-----IPLPMAMAIPFYLGSYFAI  621

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLILFVW   NK +A  FGPAVASGLICG+ +W +P++ILAL GVK PICMKFLS
Sbjct  622   DMCLGSLILFVWTKINKAKADAFGPAVASGLICGDGIWTLPSSILALVGVKPPICMKFLS  681

Query  316   AAANAKLES  290
               AN +++S
Sbjct  682   RNANTRVDS  690



>ref|XP_008801345.1| PREDICTED: probable metal-nicotianamine transporter YSL12 isoform 
X1 [Phoenix dactylifera]
Length=729

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/672 (63%), Positives = 506/672 (75%), Gaps = 8/672 (1%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             K  S E++F+   +P W+ QLT RAM  S  LS +F+FIV KLNLTTG+IPSLNVAAGLL
Sbjct  59    KTMSIEKLFDGKPLPGWREQLTFRAMVVSFFLSVMFSFIVMKLNLTTGIIPSLNVAAGLL  118

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  IK+W+  L K GLL+Q FTRQENTVIQTCVVA+SG+AFS G  SY+ GMS TIA Q
Sbjct  119   GFFFIKTWSKALEKTGLLRQAFTRQENTVIQTCVVAASGVAFSGGFGSYLFGMSETIAKQ  178

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             A   +   NVK   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LIN 
Sbjct  179   ATEADNAQNVKDPGLGWMIGFLFVVSFLGLFSLVPLRKIMIVDYKLIYPSGTATAFLING  238

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV+ L KCF  SFL+G FQWF+   D CGF+SFPT GLKAY  +F+FD
Sbjct  239   FHTPQGAKLAKKQVSILGKCFVSSFLWGFFQWFYTGGDDCGFASFPTLGLKAYENKFFFD  298

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VN+S+L+G I+SWG++WP+I  K+G WYP ++ SSSL  +QGY+V
Sbjct  299   FSATYVGVGMICPYIVNISVLLGGILSWGVMWPLIGNKKGSWYPADIPSSSLHSLQGYRV  358

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+ IAM+LGDGL+NF  +   T  SF+   RS   G  S LPV D+           FD 
Sbjct  359   FIGIAMILGDGLYNFLKVFSRTMYSFISVVRS--GGSMSTLPVSDDGGSIPTTTTISFDD  416

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRRT  FLKD IP  VA GGYI +A ++I  +P IFP LKWY++ V+Y  AP+LAFCNAY
Sbjct  417   QRRTEIFLKDQIPKPVAYGGYIVIAVISIATLPHIFPQLKWYYVLVSYIFAPMLAFCNAY  476

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLAS YGK+AI I  +W G  +GGVLAGLA+CGVMMSIVST SDLMQDFKTGY
Sbjct  477   GCGLTDWSLASTYGKLAIFIIGAWAGASHGGVLAGLAACGVMMSIVSTASDLMQDFKTGY  536

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             LTLASP AMF SQV GTAMGC + P VFW+FYKA+  LG  +S YPAPYA VYR +A+LG
Sbjct  537   LTLASPRAMFVSQVIGTAMGCVIAPCVFWLFYKAFNDLGLPDSEYPAPYALVYRNMAILG  596

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+GF SLP +CL L   FF AAI IN+    LR +  K ++ RFIP PM MAIPFY+G Y
Sbjct  597   VEGFSSLPKHCLTLCYIFFAAAIVINL----LRDFSGK-KIARFIPLPMAMAIPFYIGSY  651

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILFVW   NK +A  F PAVASGLICG+ +W +P +ILALA VK PICMK
Sbjct  652   FAIDMCVGSLILFVWETVNKAKADAFAPAVASGLICGDGIWTLPQSILALAKVKPPICMK  711

Query  325   FLSAAANAKLES  290
             FLS   N K++ 
Sbjct  712   FLSRKVNVKVDE  723



>ref|XP_010943908.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=731

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/671 (63%), Positives = 505/671 (75%), Gaps = 8/671 (1%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             K  S ERVF+   +PSW+ Q+T RAM  +  LS +F+FIV KLNLTTG+IPSLNVAAGLL
Sbjct  61    KTISIERVFDGKPVPSWREQVTFRAMVVAFFLSVMFSFIVMKLNLTTGIIPSLNVAAGLL  120

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  IK+WT +L K GLL+Q FTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  IA Q
Sbjct  121   GFFFIKTWTKVLEKTGLLQQAFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSERIANQ  180

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             A   +   NVK   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LIN 
Sbjct  181   ATEADNAQNVKDPGLGWMIGFLFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAFLING  240

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K F  SFL+G FQWF+ A D CGF+SFP+ GL+AY  +FYFD
Sbjct  241   FHTPQGAKLAKKQVRTLGKFFVSSFLWGFFQWFYTAGDDCGFASFPSLGLQAYKNKFYFD  300

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VN+S+L+G I+SWG++WP+I  K+G W+P ++  SSL  +QGY+V
Sbjct  301   FSATYVGVGMICPYLVNISVLLGGILSWGVMWPLIGNKKGSWFPADIPLSSLHSLQGYRV  360

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+AIAM+LGDGL+NF  +   T  S +   RS   G  S LPV D+      A    FD 
Sbjct  361   FIAIAMILGDGLYNFLKVFSRTISSLISVVRSR--GSMSTLPVSDDGAPVPTATTISFDD  418

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRRT  FL D IP +VA GGY+A+AA++   +P IFP LKWY++ V+Y  AP LAFCNAY
Sbjct  419   QRRTEMFLNDQIPQSVAYGGYVAIAAISTATLPHIFPQLKWYYVLVSYIFAPALAFCNAY  478

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLAS YGK+AI I  +W G  +GGVLAGLA+CGVMMSIVST SDLMQDFKTGY
Sbjct  479   GCGLTDWSLASTYGKLAIFIIGAWAGASHGGVLAGLAACGVMMSIVSTASDLMQDFKTGY  538

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             LTLASP +MF SQV GTAMGC + P VFW+FYKA+  LG   S YPAPYA VYR +A+LG
Sbjct  539   LTLASPRSMFISQVIGTAMGCVIAPCVFWLFYKAFSDLGMPESEYPAPYALVYRNMAILG  598

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+GF SLP +CL L   FF  AI IN+    LR +  K +V RFIP PM MAIPFY+G Y
Sbjct  599   VEGFSSLPKHCLTLCYIFFAGAIVINL----LRDFSGK-KVARFIPLPMAMAIPFYIGSY  653

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILFVW   NK QA  FGPAVASGLICG+ +W +P +ILALA V  PICMK
Sbjct  654   FAIDMCVGSLILFVWEMVNKAQADAFGPAVASGLICGDGIWTLPQSILALAKVNPPICMK  713

Query  325   FLSAAANAKLE  293
             FLS   NAK++
Sbjct  714   FLSRKVNAKVD  724



>ref|NP_176750.1| putative metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
 sp|Q9SHY2.1|YSL7_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL7; 
AltName: Full=Protein YELLOW STRIPE LIKE 7; Short=AtYSL7 [Arabidopsis 
thaliana]
 gb|AAF23830.1|AC007234_2 F1E22.10 [Arabidopsis thaliana]
 gb|AAO22767.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04062.1| unknown protein [Arabidopsis thaliana]
 gb|AAS00696.1| metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
 gb|AEE34418.1| putative metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
Length=688

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/671 (63%), Positives = 520/671 (77%), Gaps = 15/671 (2%)
 Frame = -2

Query  2293  STERVFEKV-EIPS-WKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE+  EIP  W+ QLT RA+  S +L+ +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  25    SVERIFEESNEIPPPWQKQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLG  84

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +KSWT +L KAG LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  85    FFFVKSWTKILNKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQS  144

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N P N+K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  145   AEANTPLNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  204

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFFA  DGCGF++FPTFGLKAY  +FYFDF
Sbjct  205   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFATGDGCGFANFPTFGLKAYENKFYFDF  264

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLLIGAI+SWG++WP+I  ++G WY  +LSS+SL G+QGY+VF
Sbjct  265   SATYVGVGMICPYLINVSLLIGAILSWGVMWPLIGAQKGKWYAADLSSTSLHGLQGYRVF  324

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF  ++  T     K+ +++      +LP++D  +         +D +
Sbjct  325   IAIAMILGDGLYNFIKVLGRTVFGLYKQFKNK-----DVLPIND--HTSTAPVTISYDDK  377

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+  AV GY+ LA V+II VP IF  LKWYHI + Y +AP+LAFCNAYG
Sbjct  378   RRTELFLKDRIPSWFAVTGYVVLAIVSIITVPHIFHQLKWYHILIMYIIAPVLAFCNAYG  437

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  438   CGLTDWSLASTYGKLAIFTIGAWAGASNGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  497

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G   +AYPAPYA VYR +++LGV
Sbjct  498   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQPGTAYPAPYALVYRNMSILGV  557

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL L   FF AA+ +N   + L       +  RFIP PM MAIPFYLGGYF
Sbjct  558   EGFSALPKHCLMLCYIFFAAAVIVNGIRDALGP-----KWARFIPLPMAMAIPFYLGGYF  612

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMC+GSLILF+WR  NK +A  +  AVASGLICGE +W +P++ILALAGVKAPICMKF
Sbjct  613   TIDMCLGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLPSSILALAGVKAPICMKF  672

Query  322   LSAAANAKLES  290
             LS A+N K+++
Sbjct  673   LSMASNNKVDA  683



>ref|XP_006343309.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=699

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/668 (62%), Positives = 511/668 (76%), Gaps = 10/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  ++PSW++QLT+RA F SL+L  +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  36    SVERIFESKQVPSWQSQLTLRAFFVSLILGILFTFIVMKLNLTTGIIPSLNVSAGLLGFF  95

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L K+G LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  IA Q+  
Sbjct  96    FVKTWTKFLDKSGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEGIAKQSTE  155

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N  +NVK  S+GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHT
Sbjct  156   ANAADNVKNPSLGWMITFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFHT  215

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K F+FSFL+G FQWFF   DGCGF SFPTFGLKA+  RFYFDFS+
Sbjct  216   PQGAKLAKKQVKALGKFFTFSFLWGFFQWFFTGGDGCGFGSFPTFGLKAFENRFYFDFSA  275

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVSLL+GAI+SWGI+WP+I  ++G WYP + S SSL GIQGY+VF+A
Sbjct  276   TYVGVGMICPYLINVSLLVGAILSWGIMWPLIEDRKGHWYPADQSPSSLHGIQGYRVFIA  335

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T      +   +K G  S+LPV    +  + +    +D Q R
Sbjct  336   IAMILGDGLYNFIKVLGRTLYGIYCQFYEKKTG--SVLPVGARASPAEASL--SYDDQIR  391

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP  VA+ GY+++A ++ I +P IF  LKWY+I V Y  AP+LAFCNAYGCG
Sbjct  392   TELFLKDQIPTWVAIVGYVSIAIISTITLPHIFHQLKWYYIVVIYIFAPVLAFCNAYGCG  451

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+I +T SDL QDFKTGY+TL
Sbjct  452   LTDWSLASTYGKLAIFTIGAWAGASHGGVLAGLAACGVMMNIATTASDLTQDFKTGYMTL  511

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQ+ GTAMGC ++P VFW+FYKA+  LG   S YPAPYA VYR +A+LGV+G
Sbjct  512   ASPRSMFISQIIGTAMGCVISPCVFWLFYKAFHDLGVPGSEYPAPYAIVYRNMAILGVEG  571

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP NCL L   FF+ AIAIN   + L K + KY     IP PM MAIPFYLG YF I
Sbjct  572   FSALPKNCLTLCYIFFIGAIAINALRDALGKNKAKY-----IPIPMAMAIPFYLGSYFTI  626

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLILF+W   NK +A  FGPAVASGLICG+ +W +P++ILAL+GV  PICMKFLS
Sbjct  627   DMCLGSLILFIWTKINKAKADAFGPAVASGLICGDGIWTLPSSILALSGVNPPICMKFLS  686

Query  316   AAANAKLE  293
                N +++
Sbjct  687   RKDNIRVD  694



>ref|XP_002510093.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF52280.1| oligopeptide transporter, putative [Ricinus communis]
Length=709

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/670 (63%), Positives = 510/670 (76%), Gaps = 10/670 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE+  +PSW+ QLT RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  43    SVEQIFERQGVPSWREQLTWRAFGVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  102

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +++WT +L K GLLKQPFTRQENTVIQTC+VASSGIAFS G  SY+ GMS   A Q+  
Sbjct  103   FVRTWTKILEKPGLLKQPFTRQENTVIQTCIVASSGIAFSGGFGSYLFGMSERAAQQSSE  162

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   ++K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  163   DNGATSIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  222

Query  1753  PNGAKLAKQQVaalfkcfsfsfl-fggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             P GAKLAK+QV  L K FSFSFL      +F A +D CGFS+FPTFGLKA    FYFDFS
Sbjct  223   PQGAKLAKKQVRELGKFFSFSFLWAFFQWFFEAEEDYCGFSNFPTFGLKAKDNMFYFDFS  282

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP ++N+S+L+G I+SWG++WP+I T++G WYP +LS  SL G+QGYKVF+
Sbjct  283   ATYVGVGMICPYIINISVLLGGILSWGLMWPLIDTRKGDWYPADLSPKSLHGLQGYKVFI  342

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             AIAM+LGDGL+NF  ++  T LS   + +S+ N     LPV D     K   L  FD QR
Sbjct  343   AIAMILGDGLYNFCKVLSQTILSLYYQFKSKGNKTTD-LPVADS-PPLKIPNLS-FDDQR  399

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP   AV GYI  AA++ I +PFIF  LKWY++ + Y  AP LAFCNAYGC
Sbjct  400   RTQLFLKDQIPTWFAVTGYITTAAISTIVLPFIFTQLKWYYVIIIYVFAPTLAFCNAYGC  459

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGYLT
Sbjct  460   GLTDWSLASTYGKLAIFTIGAWAGASHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYLT  519

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVD  680
             LASP +MF SQV GTAMGC ++P VFW+FYKA+  LG  +S YP P+A VYR +A+LGVD
Sbjct  520   LASPRSMFVSQVIGTAMGCVISPCVFWLFYKAFDDLGLPDSTYPVPFAVVYRGMAILGVD  579

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NCL L  GFFVAA+ INI  +V  K   K+R  RFIP PM MAIPFYLG YFA
Sbjct  580   GFSSLPKNCLYLCYGFFVAAVLINIIKDVAGK---KWR--RFIPLPMAMAIPFYLGPYFA  634

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMCVGSLILF+W   NK +A  F PAVASGLICG+ +W +P++ILALAGVKAPICM+F 
Sbjct  635   IDMCVGSLILFIWERINKTKADAFAPAVASGLICGDGIWVLPSSILALAGVKAPICMRFF  694

Query  319   SAAANAKLES  290
             +   N++++ 
Sbjct  695   NRGTNSRIDQ  704



>ref|XP_008676713.1| PREDICTED: uncharacterized protein LOC100272237 isoform X1 [Zea 
mays]
 gb|ACN34648.1| unknown [Zea mays]
 gb|ADG21035.1| oligopeptide transporter [Zea mays]
 gb|ADO21000.1| yellow stripe-like transporter 14A [Zea mays]
 gb|AFW63091.1| transposon protein [Zea mays]
Length=716

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/669 (61%), Positives = 507/669 (76%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  51    SVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  110

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA   + G L+QPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS  IA QA  
Sbjct  111   FVRMWTAAAERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATE  170

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 NN+K   +GWM+ FL++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  171   AKDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  230

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSF +G FQWF+ A D CGF +FPT GL+AY  RF+FDFS 
Sbjct  231   PEGAKLAKKQVKTLGKYFVFSFFWGFFQWFYTAGDECGFKNFPTLGLEAYNNRFFFDFSP  290

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWG++WP+I  K+G WYP NL  SSL G+Q Y+VF++
Sbjct  291   TYVGVGMICPYIVNVSVLLGGILSWGLMWPLIAKKKGSWYPANLEDSSLHGLQAYRVFIS  350

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   +       S+LPV D  +     +   FD +RR
Sbjct  351   IALILGDGLYNFIKVLIRTIAGFISMVQQNSK---SMLPVSDNGSSMSSMEAVSFDDERR  407

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
               NFLKD IP +VA GGY+A+AA++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  408   IENFLKDQIPKSVAYGGYVAVAAISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSG  467

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  +GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  468   LTDWSLASTYGKLAIFVFGAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  527

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT MGC + P +FW+FYKA+  +G+S + YPAPYA VYR +A+LGVDG
Sbjct  528   ASPRSMFISQVIGTGMGCVIGPCIFWLFYKAFGDIGESGTEYPAPYAIVYRNMAILGVDG  587

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             FGSLP NCL L   FF AAI IN+  ++     T Y+V RFIP PM MAIPFY+G YFAI
Sbjct  588   FGSLPKNCLTLCYIFFAAAITINLVRDL-----TPYKVSRFIPLPMAMAIPFYIGSYFAI  642

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA V+ PICMKFLS
Sbjct  643   DMFLGSAILFVWERLNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVQPPICMKFLS  702

Query  316   AAANAKLES  290
              + NAK++S
Sbjct  703   RSTNAKVDS  711



>dbj|BAE44205.1| hypothetical protein [Oryza sativa Japonica Group]
Length=727

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/669 (62%), Positives = 510/669 (76%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  63    SVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  122

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT+ + + GLLKQPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS TIA QA  
Sbjct  123   FVRLWTSAVERIGLLKQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSETIAKQATE  182

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  N+K   +GWM+ FL++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  183   AKDAQNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  242

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSF +G FQWF+ A D CGF +FPT GL+AY  RF+FDFS 
Sbjct  243   PEGAKLAKKQVKTLGKYFLFSFFWGFFQWFYTAGDDCGFKNFPTLGLEAYNNRFFFDFSP  302

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWG++WP+I  K+G WYP ++S +SL G+Q Y+VF++
Sbjct  303   TYVGVGMICPYIVNVSVLLGGILSWGVMWPLIAKKKGSWYPADISDNSLHGLQAYRVFIS  362

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   ++   G   +LPV D       A+   FD +RR
Sbjct  363   IALILGDGLYNFLKVLIRTIAGFISMVQNNSKG---MLPVSDNGMSMSTAEEVSFDDERR  419

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP +VA GGY+ +AA++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  420   TEIFLKDQIPKSVAYGGYVVVAALSIGTLPEIFPQLKWYYILVAYIVAPVLAFCNAYGSG  479

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  +GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  480   LTDWSLASTYGKLAIFVFGAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  539

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT MGC + P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVDG
Sbjct  540   ASPRSMFISQVIGTGMGCVIAPCVFWLFYKAFSNIGTSGTEYPAPYAIVYRNMAILGVDG  599

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAIAIN+  ++       ++V RFIP PM MAIPFY+G YFAI
Sbjct  600   FNSLPENCLTLCYIFFAAAIAINLIRDL-----APHKVSRFIPLPMAMAIPFYIGSYFAI  654

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS+ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA VK PICMKFLS
Sbjct  655   DMFLGSVILFVWEKLNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLS  714

Query  316   AAANAKLES  290
              AANAK++S
Sbjct  715   RAANAKVDS  723



>ref|XP_006648859.1| PREDICTED: probable metal-nicotianamine transporter YSL14-like, 
partial [Oryza brachyantha]
Length=694

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/669 (62%), Positives = 507/669 (76%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S +LS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  30    SVERVFADKAVPSWREQLTLRAFVVSALLSVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  89

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT+ + + GLL+QPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS TIA QA  
Sbjct  90    FVRLWTSAVERMGLLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSETIAKQATE  149

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  N+K   +GWM+ FL++VSF+GL ++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  150   AKDAQNIKDPHLGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  209

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSF +G FQWFF A D CGF +FPT GL+AY  RF+FDFS 
Sbjct  210   PEGAKLAKKQVKTLGKYFLFSFFWGFFQWFFTAGDDCGFKNFPTLGLEAYKNRFFFDFSP  269

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWG++WP+I  K+G WYP ++  SSL G+Q Y+VF++
Sbjct  270   TYVGVGMICPYIVNVSVLLGGILSWGVMWPLIAKKKGSWYPADIPDSSLHGLQAYRVFIS  329

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   ++   G   +LPV D        +   FD +RR
Sbjct  330   IALILGDGLYNFLKVLIRTIAGFISMVQNNSKG---MLPVSDNGMSISTTEAVSFDDERR  386

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP +VA GGY+ +AA++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  387   TEIFLKDQIPKSVAYGGYVVVAALSIGTLPEIFPQLKWYYILVAYVVAPVLAFCNAYGSG  446

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  +GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  447   LTDWSLASTYGKLAIFVFGAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  506

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT MGC + P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVDG
Sbjct  507   ASPRSMFISQVIGTGMGCVIAPCVFWLFYKAFSNIGTSGTEYPAPYAIVYRNMAILGVDG  566

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAIAIN+  ++       ++V RFIP PM MAIPFY+G YFAI
Sbjct  567   FDSLPENCLTLCYIFFAAAIAINLIRDL-----APHKVSRFIPLPMAMAIPFYIGSYFAI  621

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GSLILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA VK PICMKFLS
Sbjct  622   DMFLGSLILFVWEKLNKTKADAFGPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLS  681

Query  316   AAANAKLES  290
              AANAK++S
Sbjct  682   RAANAKVDS  690



>sp|Q6H7J6.1|YSL14_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL14; 
AltName: Full=Protein YELLOW STRIPE LIKE 14; Short=OsYSL14 
[Oryza sativa Japonica Group]
 dbj|BAD25303.1| oligopeptide transporter OPT-like [Oryza sativa Japonica Group]
Length=727

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/669 (62%), Positives = 510/669 (76%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  63    SVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  122

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT+ + + GLLKQPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS TIA QA  
Sbjct  123   FVRLWTSAVERIGLLKQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSETIAKQATE  182

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  N+K   +GWM+ FL++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  183   AKDAQNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  242

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSF +G FQWF+ A D CGF +FPT GL+AY  RF+FDFS 
Sbjct  243   PEGAKLAKKQVKTLGKYFLFSFFWGFFQWFYTAGDDCGFKNFPTLGLEAYNNRFFFDFSP  302

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWG++WP+I  K+G WYP ++S +SL G+Q Y+VF++
Sbjct  303   TYVGVGMICPYIVNVSVLLGGILSWGVMWPLIAKKKGSWYPADISDNSLHGLQAYRVFIS  362

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   ++   G   +LPV D       A+   FD +RR
Sbjct  363   IALILGDGLYNFLKVLIRTIAGFISMVQNNSKG---MLPVSDNGMSMSTAEEVSFDDERR  419

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP +VA GGY+ +AA++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  420   TEIFLKDQIPKSVAYGGYVVVAALSIGTLPEIFPQLKWYYILVAYIVAPVLAFCNAYGSG  479

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  +GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  480   LTDWSLASTYGKLAIFVFGAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  539

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT MGC + P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVDG
Sbjct  540   ASPRSMFISQVIGTGMGCVIAPCVFWLFYKAFSNIGTSGTEYPAPYAIVYRNMAILGVDG  599

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAIAIN+  ++       ++V RFIP PM MAIPFY+G YFAI
Sbjct  600   FNSLPENCLTLCYIFFAAAIAINLIRDL-----APHKVSRFIPLPMAMAIPFYIGSYFAI  654

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS+ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA VK PICMKFLS
Sbjct  655   DMFLGSVILFVWEKLNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLS  714

Query  316   AAANAKLES  290
              AANAK++S
Sbjct  715   RAANAKVDS  723



>ref|NP_001152285.1| yellow stripe-like transporter 14A [Zea mays]
 gb|ACG46801.1| transposon protein [Zea mays]
Length=716

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/669 (61%), Positives = 506/669 (76%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  51    SVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  110

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA   + G L+QPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS  IA QA  
Sbjct  111   FVRMWTAAAERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATE  170

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 NN+K   +GWM+ FL++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  171   AKDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  230

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSF +G FQWF+ A D CGF +FPT GL+AY  RF+FDFS 
Sbjct  231   PEGAKLAKKQVKTLGKYFVFSFFWGFFQWFYTAGDECGFKNFPTLGLEAYNNRFFFDFSP  290

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G  +SWG++WP+I  K+G WYP NL  SSL G+Q Y+VF++
Sbjct  291   TYVGVGMICPYIVNVSVLLGGFLSWGLMWPLIAKKKGSWYPANLEDSSLHGLQAYRVFIS  350

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   +       S+LPV D  +     +   FD +RR
Sbjct  351   IALILGDGLYNFIKVLIRTIAGFISMVQQNSK---SMLPVSDNGSSMSSMEAVSFDDERR  407

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
               NFLKD IP +VA GGY+A+AA++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  408   IENFLKDQIPKSVAYGGYVAVAAISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSG  467

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  +GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  468   LTDWSLASTYGKLAIFVFGAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  527

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT MGC + P +FW+FYKA+  +G+S + YPAPYA VYR +A+LGVDG
Sbjct  528   ASPRSMFISQVIGTGMGCVIGPCIFWLFYKAFGDIGESGTEYPAPYAIVYRNMAILGVDG  587

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             FGSLP NCL L   FF AAI IN+  ++     T Y+V RFIP PM MAIPFY+G YFAI
Sbjct  588   FGSLPKNCLILCYIFFAAAITINLVRDL-----TPYKVSRFIPLPMAMAIPFYIGSYFAI  642

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA V+ PICMKFLS
Sbjct  643   DMFLGSAILFVWERLNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVQPPICMKFLS  702

Query  316   AAANAKLES  290
              + NAK++S
Sbjct  703   RSTNAKVDS  711



>ref|XP_006363210.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=692

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/668 (62%), Positives = 514/668 (77%), Gaps = 10/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+NQLT+RA   S +L  +F FIV KL+LTTG+IPSLNV+AGLLGF 
Sbjct  29    SVERIFESKEVPSWQNQLTLRAFCVSFILGILFTFIVLKLSLTTGIIPSLNVSAGLLGFF  88

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT LL K+G+LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+  MS   A Q+  
Sbjct  89    FLKTWTKLLEKSGILKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFAMSEVAAKQSTE  148

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K  S+GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  149   ANNAFNIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  208

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWFF A D CGF+SFPTFGLKAY  +FYFDFS+
Sbjct  209   PQGAKLAKKQVKALAKFFSFSFLWGFFQWFFTAGDDCGFASFPTFGLKAYENKFYFDFSA  268

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLL+G+I+SWGI+WP+I  ++G W+P + S SSL G+QGYKVF+A
Sbjct  269   TYVGVGMICPYLINISLLLGSILSWGIMWPLIQDRKGHWFPADESPSSLHGLQGYKVFIA  328

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  +   T      +  S+  G  ++LPV    +  + +    FD QRR
Sbjct  329   IAMILGDGLYNFCKVFGRTLYGLYLQFCSKDEG--AVLPVGARPSPPEPSM--SFDDQRR  384

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP  V++ GY+ +A ++ I +P IF  LKWYHI V Y  AP+LAFCNAYGCG
Sbjct  385   TTLFLKDQIPIWVSIVGYVGIAIISTITLPHIFHQLKWYHIIVIYVFAPVLAFCNAYGCG  444

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGY+TL
Sbjct  445   LTDWSLASTYGKLAIFTIGAWAGASHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYMTL  504

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQ+ GTAMGC ++P VFW+FYKA+P LG   SAYPAPYA VYR ++++GV+G
Sbjct  505   ASPRSMFISQIIGTAMGCLISPCVFWLFYKAFPDLGTQGSAYPAPYALVYRNMSIIGVEG  564

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP NCL L   FF+ AI IN   +++ K + KY     IP PM MAIPFYLG YFAI
Sbjct  565   FSALPKNCLTLCYVFFIGAIVINGIRDLVGKNKAKY-----IPLPMAMAIPFYLGSYFAI  619

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLILFVW   NK +A  FGPAVASGLICG+ +W +P++ILAL GVK PICMKFLS
Sbjct  620   DMCLGSLILFVWTKINKAKADAFGPAVASGLICGDGIWTLPSSILALVGVKPPICMKFLS  679

Query  316   AAANAKLE  293
               AN +++
Sbjct  680   RNANTRVD  687



>ref|XP_007029356.1| YELLOW STRIPE like 5 [Theobroma cacao]
 gb|EOY09858.1| YELLOW STRIPE like 5 [Theobroma cacao]
Length=689

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/668 (62%), Positives = 514/668 (77%), Gaps = 16/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSW+ QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  32    SVEQIFESQEVPSWRKQLTMRAFAVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  91

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q  S
Sbjct  92    FVKTWTKMLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERIAQQ--S  149

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+    VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ ++LTYPSGTATA+LINSFHT
Sbjct  150   GDT-RGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFRLTYPSGTATAHLINSFHT  208

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A++ CGF +FPT GLKAY  +F+FDFS+
Sbjct  209   PQGAKLAKKQVKTLGKFFSFSFLWGFFQWFYTAEETCGFFNFPTLGLKAYENKFFFDFSA  268

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I T++G WYP ++SSS++ G+QGYKVF+A
Sbjct  269   TYVGVGMICPYIINISVLLGGILSWGVMWPLIETRKGDWYPADVSSSNMHGLQGYKVFIA  328

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NFF ++  T +    + R  +  P +  P  D   K        +D QRR
Sbjct  329   IAMILGDGLYNFFKVLSRTLIGLFHQIRGRQALPIANQPSPDTSKK------LSYDDQRR  382

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   +V GY+ +A ++ I +P IF  LKWY+I V YA AP LAFCNAYGCG
Sbjct  383   TQLFLKDQIPTWFSVAGYVTIAVISTIVLPHIFHELKWYYILVLYAFAPTLAFCNAYGCG  442

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGYLTL
Sbjct  443   LTDWSLASTYGKLAIFTIGAWAG-SHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYLTL  501

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR ++LLGV G
Sbjct  502   ASPRSMFISQVIGTAMGCIVSPCVFWLFYKAFDDLGLPNSQYPAPFAVVYRNMSLLGVQG  561

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP NCL L   FF AAI IN+  + + K    Y     IP PM MAIPFY+G YFAI
Sbjct  562   FSALPKNCLVLCYVFFGAAILINLVKDRVGKKWGSY-----IPLPMAMAIPFYIGSYFAI  616

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILFVW   NK +A  FGPAVASGLICG+ +W +P++ILALAGVK PICMKFLS
Sbjct  617   DMCVGSLILFVWEKINKAKADAFGPAVASGLICGDGIWTLPSSILALAGVKPPICMKFLS  676

Query  316   AAANAKLE  293
              A NA+++
Sbjct  677   RATNARVD  684



>gb|ACD77012.1| metal transporter protein [Brassica juncea]
Length=689

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/671 (62%), Positives = 518/671 (77%), Gaps = 15/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEI--PSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE+     P+W+NQLT RAM  S +LS +F F+V KLNLTTG+IPSLN++AGLL 
Sbjct  26    SVERIFEESADAPPAWQNQLTFRAMIVSFILSILFTFVVMKLNLTTGIIPSLNISAGLLS  85

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT +L KAG+LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  86    FFFVKTWTKILNKAGILKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEVVAKQS  145

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N P N+K   +GWM+ FL+ VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  146   AEANTPLNIKNPHLGWMIGFLFTVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  205

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + DGCGF++FPTFGL+AY  +FYFDF
Sbjct  206   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGDGCGFANFPTFGLEAYENKFYFDF  265

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLL+G+I+SWGI+WP+I  ++G WY  +LSS+SL G+QGYKVF
Sbjct  266   SATYVGVGMICPYLINVSLLVGSILSWGIMWPLIGAQKGKWYSADLSSTSLHGLQGYKVF  325

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF   + V G + +   +  KN  A  LPV+D            +D +
Sbjct  326   IAIAMILGDGLYNF---IKVLGRTIVGLYKQFKNRDA--LPVNDR--SPSNTATISYDDK  378

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+ +AV GY+ +A V+I+ VP IFP L+WYHI   Y +AP+LAFCNAYG
Sbjct  379   RRTELFLKDRIPSWIAVTGYVVMAIVSIVTVPHIFPQLRWYHILTMYIIAPVLAFCNAYG  438

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  439   CGLTDWSLASTYGKLAIFTIGAWAGSANGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  498

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G + +AYPAPYA VYR +++LGV
Sbjct  499   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQTGTAYPAPYALVYRNMSILGV  558

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL +   FF AA+ +N   + +       +  RFIP PM MAIPFY+GGYF
Sbjct  559   EGFSALPQHCLMICYIFFAAAVFVNGVRDAVGP-----KWSRFIPLPMAMAIPFYIGGYF  613

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMCVGSLILFVWR  N+ +A  +  AVASGLICGE +W +P+++LALAGVK PICMKF
Sbjct  614   TIDMCVGSLILFVWRKLNRPKADAYSSAVASGLICGEGIWTLPSSVLALAGVKPPICMKF  673

Query  322   LSAAANAKLES  290
             LS A N K++S
Sbjct  674   LSGATNVKVDS  684



>ref|XP_011072072.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=697

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/670 (62%), Positives = 516/670 (77%), Gaps = 14/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+ QLT+RA   S +LS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  34    SVERIFENKEVPSWRKQLTVRAFAVSFLLSVMFCFIVMKLNLTTGIIPSLNVSAGLLGFF  93

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT L+ K+G+L+QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+E 
Sbjct  94    FVKTWTKLIAKSGMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEQIAQQSEH  153

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  + K  S+GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  154   RKDGFDYKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  213

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWFF A D CGF+ FPTFGL+AY  +F+FDFS+
Sbjct  214   PEGAKLAKKQVRELGKFFSFSFLWGFFQWFFTAADECGFAKFPTFGLQAYEYKFFFDFSA  273

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVS+L+G I+SWGI+WP+I  ++G W+  +L  +SLKG+QGYKVF+ 
Sbjct  274   TYVGVGMICPHIINVSVLVGGILSWGIMWPLIENRKGDWFSADLPPNSLKGLQGYKVFIG  333

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IAM+LGDGL+NFF ++  T  GL F+K +  + N   S +PV    +     + + +D Q
Sbjct  334   IAMILGDGLYNFFKVLSRTLAGL-FLKLQERKAN---SQMPVTQ--HSSPSIESQSYDDQ  387

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR+  FLKD IP   AVGGY+A+AAV+   +P IF  LKWYHI V Y  AP LAFCNA+G
Sbjct  388   RRSQLFLKDQIPKWFAVGGYVAIAAVSTATLPHIFHHLKWYHIIVIYIFAPALAFCNAFG  447

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GG+LAGLA+CGVMM+IVST SDLMQDFKTGYL
Sbjct  448   CGLTDWSLASTYGKLAIFTIGAWAGASHGGILAGLAACGVMMNIVSTASDLMQDFKTGYL  507

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQV GTAMGC ++P VFWIFY A+P +G   SAYPAP+A VY  +A LGV
Sbjct  508   TLASPRSMFVSQVIGTAMGCVISPCVFWIFYNAFPDIGYPTSAYPAPFATVYYNMAKLGV  567

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP NCL L   FF AAI IN+  + L K  +      FIP PM MAIPFYLG YF
Sbjct  568   EGFSALPKNCLKLCYVFFAAAILINMIRDSLGKKRS-----WFIPLPMAMAIPFYLGSYF  622

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLIL++W+  NK +A  FGPAVASGLICG+ +W +P+++LALAGVK PICMKF
Sbjct  623   AIDMCVGSLILYIWQKMNKAKADAFGPAVASGLICGDGMWTLPSSVLALAGVKPPICMKF  682

Query  322   LSAAANAKLE  293
             +S A N++++
Sbjct  683   ISRATNSRVD  692



>ref|XP_009105166.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Brassica 
rapa]
 emb|CDY07462.1| BnaA07g25410D [Brassica napus]
Length=690

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/672 (62%), Positives = 519/672 (77%), Gaps = 17/672 (3%)
 Frame = -2

Query  2293  STERVFEKVEI--PSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE+     P+W+NQLT RAM  S +LS +F F+V KLNLTTG+IPSLN++AGLL 
Sbjct  27    SVERIFEESADAPPAWQNQLTFRAMIVSFILSILFTFVVMKLNLTTGIIPSLNISAGLLS  86

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT +L KAG+LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  87    FFFVKTWTKILNKAGILKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEVVAKQS  146

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N P N+K   +GWM+ FL+ VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  147   AEANTPLNIKNPHLGWMIGFLFTVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  206

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + DGCGF++FPTFGL+AY  +FYFDF
Sbjct  207   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGDGCGFANFPTFGLEAYENKFYFDF  266

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLL+G+I+SWGI+WP+I  ++G WY  +LSS+SL G+QGYKVF
Sbjct  267   SATYVGVGMICPYLINVSLLVGSILSWGIMWPLIGAQKGKWYSADLSSTSLHGLQGYKVF  326

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF   + V G + +   +  KN  A  LPV+D            +D +
Sbjct  327   IAIAMILGDGLYNF---IKVLGRTIVGLYKQFKNRDA--LPVNDR--SPSNTATISYDDK  379

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+ +AV GY+ +A V+I+ VP IFP L+WYHI   Y +AP+LAFCNAYG
Sbjct  380   RRTELFLKDRIPSWIAVTGYVVMAIVSIVTVPHIFPQLRWYHILTMYIIAPVLAFCNAYG  439

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  440   CGLTDWSLASTYGKLAIFTIGAWAGSANGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  499

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G + +AYPAPYA VYR +++LGV
Sbjct  500   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQTGTAYPAPYALVYRNMSILGV  559

Query  682   DGFGSLPTNCLNLAIGFFVAAIAIN-IFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             +GF +LP +CL +   FF AA+ +N +   V  K+       RFIP PM MAIPFY+GGY
Sbjct  560   EGFSALPQHCLMICYIFFAAAVFVNGVRDAVGPKWS------RFIPLPMAMAIPFYIGGY  613

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             F IDMCVGSLILFVWR  N+ +A  +  AVASGLICGE +W +P+++LALAGVK PICMK
Sbjct  614   FTIDMCVGSLILFVWRKLNRPKADAYSSAVASGLICGEGIWTLPSSVLALAGVKPPICMK  673

Query  325   FLSAAANAKLES  290
             FLS A N K++S
Sbjct  674   FLSGATNVKVDS  685



>ref|XP_006372621.1| hypothetical protein POPTR_0017s03320g [Populus trichocarpa]
 gb|ERP50418.1| hypothetical protein POPTR_0017s03320g [Populus trichocarpa]
Length=698

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/671 (63%), Positives = 508/671 (76%), Gaps = 16/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+NQLT+RA+  S VLS +F  IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  37    SVERIFENQEVPSWRNQLTLRALVVSFVLSILFCVIVMKLNLTTGIIPSLNVSAGLLGFF  96

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS T+A Q   
Sbjct  97    FIKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAKQLTE  156

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +  K  S+ WM+ FL+VVSF+GLFS VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  157   DS--DAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHT  214

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A DGCGF+ FP+ GLKA+  +F+FDFS+
Sbjct  215   PAGAKLAKKQVRVLGKFFSFSFLWGFFQWFYTAGDGCGFAEFPSLGLKAHENKFFFDFSA  274

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I TK+G WYP +L   SL G+QGYKVF+A
Sbjct  275   TYVGVGMICPYIINISVLLGGILSWGLMWPLIDTKKGDWYPADLKPGSLHGLQGYKVFIA  334

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
              A++LGDGL+NFF ++  T   L F  R R         LPV D            +D Q
Sbjct  335   TALVLGDGLYNFFKVLSRTLAALFFQLRGRDATGA----LPVADR--SSPETSRISYDEQ  388

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRTH FLKD IP   AV GY+ +AA++   VP IFP LKWY+I V Y  AP LAFCNAYG
Sbjct  389   RRTHLFLKDQIPTWFAVAGYVTIAAISTTTVPHIFPELKWYYILVIYIFAPALAFCNAYG  448

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YG +AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  449   CGLTDWSLASTYGTLAIFVIGAWAGGSHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYL  508

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG   S YPAPYA V+R +A+LGV
Sbjct  509   TLSSPRSMFVSQLIGTAMGCMISPCVFWLFFKAFKDLGTPGSQYPAPYATVFRNMAILGV  568

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF SLP NCL L   FF AAI IN+  +VL K        RFIPNPM MAIPFY+G YF
Sbjct  569   EGFSSLPKNCLYLCYWFFGAAILINLIKDVLGKKRA-----RFIPNPMAMAIPFYIGSYF  623

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +K +A  FGPAVASGLICG+ +W +P++ILALAGVK PICMKF
Sbjct  624   AIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSSILALAGVKPPICMKF  683

Query  322   LSAAANAKLES  290
             LS   NAK+++
Sbjct  684   LSRRTNAKVDA  694



>ref|XP_010528609.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Tarenaya 
hassleriana]
Length=689

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/671 (63%), Positives = 516/671 (77%), Gaps = 16/671 (2%)
 Frame = -2

Query  2293  STERVFEKV--EIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE      P W +QLTIRAM  S VLS +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  28    SVERIFEASGEAPPPWHHQLTIRAMVVSFVLSILFTFVVMKLNLTTGIIPSLNISAGLLG  87

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT LL KAG LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  88    FFFVKTWTKLLHKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQS  147

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N   N+K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSF
Sbjct  148   AEANSVMNIKNPQLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLIYPSGTATAHLINSF  207

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF A D CGF+SFPTFGL+AYA +FYFDF
Sbjct  208   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTAGDDCGFASFPTFGLEAYANKFYFDF  267

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLL+G+I+SWG++WP+I  ++G WY  ++SSSSL G+QGYKVF
Sbjct  268   SATYVGVGMICPYLINVSLLVGSILSWGVMWPLIGAQKGKWYSADISSSSLHGLQGYKVF  327

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF  ++  T     K+ ++       +LPV+D   +     +  +D +
Sbjct  328   IAIAMILGDGLYNFVKVLGRTIFGLYKQFQNR-----DVLPVND---RSPSFAVVSYDDK  379

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AV GYI LA ++I A+P IFP L+WYHI V Y +AP+LAFCNAYG
Sbjct  380   RRTELFLKDGIPAWFAVCGYIILAVISIFALPHIFPQLRWYHILVMYVIAPVLAFCNAYG  439

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  440   CGLTDWSLASTYGKLAIFTIGAWAGASHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  499

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FY A+   G S S+YPAPYA VYR +++LGV
Sbjct  500   TLASPRSMFISQFIGTAMGCVISPCVFWLFYNAFGDFGQSGSSYPAPYALVYRNMSILGV  559

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL L   FF AA+ +N   + +       +  RFIP PM MAIPFY+GGYF
Sbjct  560   EGFSALPKHCLMLCYVFFAAAVIVNGVRDAVGP-----KWARFIPLPMAMAIPFYIGGYF  614

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMCVGSLILFVWR  NK +A  FGPAVASGLICGE +W +P+++LALAGVK PICMKF
Sbjct  615   TIDMCVGSLILFVWRKLNKPKADAFGPAVASGLICGEGIWTLPSSVLALAGVKPPICMKF  674

Query  322   LSAAANAKLES  290
             LS++ N K++S
Sbjct  675   LSSSTNTKVDS  685



>ref|XP_010069525.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Eucalyptus 
grandis]
 gb|KCW57905.1| hypothetical protein EUGRSUZ_H00652 [Eucalyptus grandis]
Length=698

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/669 (63%), Positives = 520/669 (78%), Gaps = 12/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVFE  E+PSW+ QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  37    SVERVFEGKEVPSWRQQLTVRAFVVSFVLSVLFSFIVMKLNLTTGIIPSLNVSAGLLGFF  96

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+G+L+ PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q  +
Sbjct  97    FVKTWTKVLEKSGMLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDHIAEQMGN  156

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G   N+ K LS+ W++ FL++VSF+GL ++VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  157   GPGANDYKKLSLPWIIGFLFIVSFLGLLAVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  216

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A+DGCGF +FPT GLKAY  +FYFDFS+
Sbjct  217   PEGAKLAKKQVRTLGKFFSFSFLWGFFQWFYTAEDGCGFVNFPTLGLKAYEYKFYFDFSA  276

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVS+L+G I+SWG++WP+I  K G WY  +L  SS+ G+QGYKVF++
Sbjct  277   TYVGVGMICPYIINVSVLLGGIVSWGLMWPLIENKAGDWYSADLKLSSMHGLQGYKVFIS  336

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T L    + + + +     LP     +  +  QL  FD QRR
Sbjct  337   IAMILGDGLYNFCKVLSGTLLGMYHQFKGKNS-----LPRVASSSPPESPQLS-FDDQRR  390

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP + A+GGYI +A ++II++P IF  LKWY+I V Y  AP LAFCNAYGCG
Sbjct  391   TSLFLKDQIPTSFAIGGYIIIAIISIISLPHIFHQLKWYYILVMYLAAPTLAFCNAYGCG  450

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  451   LTDWSLASTYGKLAIFVIGAWAGKSHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  510

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT+MGC ++P VFW+FYKA+  LG S SAYPAPYA +YR++A+LGV+G
Sbjct  511   ASPRSMFVSQVIGTSMGCVISPCVFWLFYKAFKDLGLSTSAYPAPYANIYRSMAILGVEG  570

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL+L  GFF A+I IN   + + K   KY   RFIP PM MAIPFYLG YFAI
Sbjct  571   FSSLPKHCLSLCYGFFAASIVINAIRDAVPK---KYS--RFIPLPMAMAIPFYLGSYFAI  625

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLIL+VW   NK +A  FGPAVASGLICG+ +W +P++ILAL GVK PICMKFLS
Sbjct  626   DMCVGSLILYVWERINKAKADAFGPAVASGLICGDGIWTLPSSILALVGVKPPICMKFLS  685

Query  316   AAANAKLES  290
              AANA++++
Sbjct  686   RAANARVDN  694



>gb|KDP45817.1| hypothetical protein JCGZ_17424 [Jatropha curcas]
Length=698

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/669 (62%), Positives = 516/669 (77%), Gaps = 13/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++F + E+PSW+ QLT+RA   S +LS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  38    SVEQIFREQEVPSWQQQLTVRAFVVSFILSILFTFIVMKLNLTTGIIPSLNVSAGLLGFF  97

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K WT+ L K+ LLK PFTRQENTVIQTCVVASSGIAFS G  SY+ GMS TIA Q+  
Sbjct  98    FLKIWTSFLEKSRLLKHPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETIAKQS--  155

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N  ++ K  ++ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  156   -NDKSDHKNPAVAWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  214

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A DGCGFS+FPTFGLKAY  +FYFDFS+
Sbjct  215   PAGAKLAKKQVKTLGKFFSFSFLWGFFQWFYTAGDGCGFSNFPTFGLKAYENKFYFDFSA  274

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+S+L G ++SWG++WP+I+T++G W+P +LSSS+++G+QGY+VF+A
Sbjct  275   TYVGVGMICPYIVNISVLFGGVLSWGLMWPLINTRKGDWFPADLSSSNIRGLQGYRVFIA  334

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NFF ++  T  +   + R+   G +S LP+ D  +  +  +   +D +RR
Sbjct  335   IAMILGDGLYNFFKVLSRTLAALFLQLRAR--GASSGLPIADR-HSPRSTKFA-YDEERR  390

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   A+ GYI +AAV+   +P IF  LKWY+IAV Y  AP LAFCNAYGCG
Sbjct  391   TQLFLKDQIPTWFAIAGYIVVAAVSTATLPHIFHQLKWYYIAVIYIFAPALAFCNAYGCG  450

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  451   LTDWSLASTYGKLAIFTIGAWAGASHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  510

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             +SP +MF SQV GTAMGC ++P VFW+FYKA+  LG   S YP+P A +YR +A+LGV G
Sbjct  511   SSPRSMFVSQVIGTAMGCIISPCVFWLFYKAFDDLGSPGSQYPSPNAVIYRNMAMLGVQG  570

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP +CL L   FF +AI IN   + L K     +  R+IP PM MAIPFYLG YFAI
Sbjct  571   FSALPKDCLLLCYVFFGSAILINFTKDTLGK-----KWARYIPLPMAMAIPFYLGPYFAI  625

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILFVW   NK +A  FGPAVASGLICG+ +W +P++ILALAG+K PICMKFLS
Sbjct  626   DMCVGSLILFVWEKINKAKADAFGPAVASGLICGDGIWTLPSSILALAGIKPPICMKFLS  685

Query  316   AAANAKLES  290
                N+K+++
Sbjct  686   RGTNSKVDA  694



>ref|XP_010933277.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=727

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/678 (62%), Positives = 504/678 (74%), Gaps = 8/678 (1%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             K  S E+ FE   +P+W+ QLT+RA   S  LS +F+ IV KLNLTTG+IPSLNVAAGLL
Sbjct  57    KTMSMEKAFEGKRVPTWREQLTLRAFVVSFFLSVLFSIIVMKLNLTTGIIPSLNVAAGLL  116

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  IK+WT  L K GLL+ PFTRQENTVIQTC VA+  IAFS G  SY+ GMS  IA Q
Sbjct  117   GFFFIKTWTKALEKTGLLRLPFTRQENTVIQTCCVAAYDIAFSGGFGSYLFGMSGRIAKQ  176

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             A   N   ++K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LIN 
Sbjct  177   ASEANNEQDIKDPKLGWMIGFLFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAFLING  236

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K F  SFL+G F+WF+ A D CGF++FPTFGLKAY   F+FD
Sbjct  237   FHTPEGAKLAKKQVRTLGKFFISSFLWGFFRWFYTAGDDCGFAAFPTFGLKAYENEFFFD  296

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VN+S+L+G I+SWGI+WP+I  K+G WYP ++ SSSL  +QGY+V
Sbjct  297   FSATYVGVGMICPYIVNISVLLGGILSWGIMWPLIANKKGSWYPADIPSSSLHSLQGYRV  356

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+AIAM+LGDGL+NF  + V++G            G  S LPV D  +         FD 
Sbjct  357   FIAIAMILGDGLYNF--LKVLSGTISSIISIVRSKGSTSTLPVSDNGHSVTTTTTTSFDD  414

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRRT  FLKD IP +VA GGY+A+A ++I  +P IFP LKWY++ V+Y  AP+LAFCNAY
Sbjct  415   QRRTEIFLKDQIPKSVAYGGYVAVAIISIATLPHIFPQLKWYYVLVSYIFAPVLAFCNAY  474

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMMSIVST SDLMQDFKTGY
Sbjct  475   GCGLTDWSLASTYGKLAIFLIGAWAGASHGGVLAGLAACGVMMSIVSTASDLMQDFKTGY  534

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             LTLASP +MF SQV GTAMGC + P VFW+FYKA+  LG  NS YPAPYA +YR IA+LG
Sbjct  535   LTLASPRSMFVSQVIGTAMGCVIAPCVFWLFYKAFNDLGLPNSEYPAPYAIIYRNIAILG  594

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             VDG  SLP +CL L   FF AAI IN+    +R +  K +V RFIP PM MAIPFY+G Y
Sbjct  595   VDGISSLPKHCLTLCCIFFAAAILINL----IRDFSPK-KVARFIPLPMAMAIPFYIGSY  649

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILFVW   NK QA  FGPAVASGLICG+ LW +P ++LALA VK PICMK
Sbjct  650   FAIDMCVGSLILFVWEKINKTQADAFGPAVASGLICGDGLWTLPQSLLALAKVKPPICMK  709

Query  325   FLSAAANAKLESS*PKIS  272
             FLS   N +++    K+S
Sbjct  710   FLSRKMNDRVDDFIAKLS  727



>gb|AET00398.2| OPT family oligopeptide transporter [Medicago truncatula]
Length=682

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/678 (62%), Positives = 515/678 (76%), Gaps = 32/678 (5%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE   +PSW+ Q+T+RA+  S++LS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  21    SIEKGFEGKSVPSWQKQVTVRAIVVSIMLSVMFTFIVMKLNLTTGIIPSLNVSAGLLGFF  80

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT LL KAG L QPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMSPTIA Q   
Sbjct  81    FVKTWTKLLEKAGWLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSPTIAKQIPE  140

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 N+VK+L +GWM+AFL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  141   AGTANDVKSLGLGWMIAFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHT  200

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
               GAKLAK+QV AL K FSFSFL+G FQWFFAA D CGF++FPTFGL+AY ++FYFDFS+
Sbjct  201   SEGAKLAKKQVKALGKFFSFSFLWGFFQWFFAAGDSCGFTNFPTFGLEAYQRKFYFDFSA  260

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLLIG ++SWG++WP+I  K+G W+P +L  SSL G+QGY+VF+ 
Sbjct  261   TYVGVGMICPYIINISLLIGGVLSWGVMWPLIGAKKGDWFPADLKESSLHGLQGYRVFIG  320

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED------  1232
             IAM+LGDGL+NF  ++  T +   K+ +                 K KGAQ ED      
Sbjct  321   IAMILGDGLYNFVKVLGTTLIGLYKQLK----------------KKDKGAQSEDPNAPLP  364

Query  1231  ----FDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPI  1064
                 FD +RRT  FLKD IP+  A+ GY+ +A ++II +P IF  LKWYHI   Y +AP 
Sbjct  365   PTLSFDDKRRTEMFLKDQIPSWFAIAGYVIIAIISIITIPHIFHQLKWYHIICIYIIAPA  424

Query  1063  LAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLM  884
             LAFCNAYGCGLTDWSLAS YGK+AI I  +W G  NGG+LA LA+CGVMM+IVST SDLM
Sbjct  425   LAFCNAYGCGLTDWSLASTYGKLAIFIIGAWAGPANGGILASLAACGVMMNIVSTASDLM  484

Query  883   QDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavy  707
             QDFKTGY+TLASP +MF SQV GTA+GC ++P VFW+FY A+  LG   SAYPAPYA VY
Sbjct  485   QDFKTGYMTLASPKSMFVSQVIGTAIGCVVSPCVFWLFYHAFGTLGQPGSAYPAPYALVY  544

Query  706   raiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAI  527
             R IA+LGVDGF +LP NCL L I FF  AI IN   +++ K   KY     IP PM MAI
Sbjct  545   RNIAILGVDGFSALPKNCLVLCIIFFTGAIIINFVRDLVGKKYAKY-----IPVPMAMAI  599

Query  526   PFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGV  347
             PFY+G YFAIDMCVGSLILF+W+  ++ +A  F  AVASGLICG+ +W +P++ LALAGV
Sbjct  600   PFYIGSYFAIDMCVGSLILFIWQKLDRAKADAFASAVASGLICGDGIWSLPSSFLALAGV  659

Query  346   KAPICMKFLSAAANAKLE  293
             + PICMKFLS AANAK++
Sbjct  660   QPPICMKFLSRAANAKVD  677



>ref|XP_007152542.1| hypothetical protein PHAVU_004G138900g [Phaseolus vulgaris]
 gb|ESW24536.1| hypothetical protein PHAVU_004G138900g [Phaseolus vulgaris]
Length=701

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/671 (62%), Positives = 511/671 (76%), Gaps = 18/671 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF+ + +PSW+NQLT RA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  42    SVERVFQHLLVPSWRNQLTGRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  101

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L K+G+L+QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+  
Sbjct  102   FVKTWTKFLEKSGMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEEIANQSTD  161

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 ++ K  S+GW++AFL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  162   ---TSDFKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMVVDFKLTYPSGTATAHLINSFHT  218

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SFL+G FQWF+ A D CGF +FP+ GLKAY  RFYFDFS+
Sbjct  219   PQGAKLAKKQVKMLGKFFSMSFLWGFFQWFYTATDQCGFQAFPSLGLKAYENRFYFDFSA  278

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
              YVGVGM+CP ++N+S+L+G I+SWGI+WP+I TKEG WY   L   +L GIQGY+VF+A
Sbjct  279   IYVGVGMICPYIINISVLLGGILSWGIMWPLIKTKEGHWYAKGLGEGNLHGIQGYRVFIA  338

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA++LGDGL+NF  ++  T  GL    + R ++N     LPV D+ +     QL  +D +
Sbjct  339   IALILGDGLYNFIKVITHTLSGLYHQFQERQQENE----LPVADQ-DSPSNPQLS-YDDR  392

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR   FLKD IP   AV GY+A+AA++   +P +FP LKWY+I V Y +AP LAFCNAYG
Sbjct  393   RRIQLFLKDQIPTWFAVAGYVAIAAISTATLPHLFPQLKWYYIIVIYLVAPTLAFCNAYG  452

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G   GGVLAGLA+CGVMM+IVST SDLMQDFKTGYL
Sbjct  453   CGLTDWSLASTYGKLAIFTIGAWAGASKGGVLAGLAACGVMMNIVSTASDLMQDFKTGYL  512

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ+ GT MGC ++P VFWIFYKA+P LG S S YPAPYA +YR +A+LGV
Sbjct  513   TLASPRSMFVSQIIGTTMGCVVSPSVFWIFYKAFPDLGKSTSEYPAPYAIIYRNMAILGV  572

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
              GFGSLP NCL L   FF AA+ IN+F + L K        +FIP PM MAIPFY+G YF
Sbjct  573   QGFGSLPKNCLLLCYIFFAAAVVINLFKDFLGKKG------KFIPLPMAMAIPFYIGPYF  626

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLIL+VW   NK +A  F PAVASGLICG+ +W +PA+ILALA VK PICM+F
Sbjct  627   AIDMCVGSLILYVWERINKAKADAFAPAVASGLICGDGIWTLPASILALAEVKPPICMRF  686

Query  322   LSAAANAKLES  290
              S AAN+K+++
Sbjct  687   FSRAANSKVDT  697



>ref|XP_004234495.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=696

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/671 (62%), Positives = 510/671 (76%), Gaps = 9/671 (1%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             +V+S ER+FE  ++ SW++QLT+RA F SL+L  +F FIV KLNLTTG+IPSLNV+AGLL
Sbjct  26    EVQSVERIFESKQVSSWESQLTLRAFFVSLLLGILFTFIVMKLNLTTGIIPSLNVSAGLL  85

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  +K+WT  L K+G+LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  IA Q
Sbjct  86    GFFFVKTWTKFLDKSGVLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVIAKQ  145

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +   N  +NVK  S+GWM+ FL VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINS
Sbjct  146   STEANAADNVKNPSLGWMITFLLVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINS  205

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K F+FSFL+G FQWFF   DGCGF SFPT GLKAY  RFYFD
Sbjct  206   FHTPQGAKLAKKQVKTLGKFFTFSFLWGFFQWFFTGGDGCGFGSFPTLGLKAYENRFYFD  265

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VNVSLL+GAI+SWGI+WP+I  ++G WYP + S +SL GIQGY+V
Sbjct  266   FSATYVGVGMICPYLVNVSLLVGAILSWGIMWPLIEDRKGHWYPADQSPTSLHGIQGYRV  325

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+AIAM+LGDGL+NF  ++  T      + R +K G   +LPV         A L  +D 
Sbjct  326   FIAIAMILGDGLYNFIKVLGRTLYGIYCQFREKKAG--LVLPVGAPRASPAEASLS-YDD  382

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             Q RT  FLKD IP  VA+ GY+++A +++I +P IF  LKWY+I V Y   P LAFCNAY
Sbjct  383   QIRTELFLKDQIPTWVAIVGYVSIAIISMITLPHIFHQLKWYYIVVIYIFTPALAFCNAY  442

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM++V+T SDL QDFKTGY
Sbjct  443   GTGLTDWSLASTYGKLAIFTIGAWAGASHGGVLAGLAACGVMMNVVTTASDLTQDFKTGY  502

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             +TLASP +MF SQ+ GTAMGC ++P VFW+FYKA+  LG   S YPAPYA VYR +++LG
Sbjct  503   MTLASPRSMFISQMIGTAMGCVISPCVFWLFYKAFHDLGIPGSEYPAPYALVYRNMSILG  562

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+GF +LP NCL L   FF+ AIAIN   + L K + KY     IP PM MAIPFYLG Y
Sbjct  563   VEGFSALPKNCLTLCYIFFIGAIAINALRDALGKNKAKY-----IPLPMAMAIPFYLGSY  617

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMC+GSLILF+W   NK +A  FGPAVASGLICG+ +W +P++ILAL+GV  PICMK
Sbjct  618   FAIDMCIGSLILFIWTKINKAKADAFGPAVASGLICGDGIWTLPSSILALSGVNPPICMK  677

Query  325   FLSAAANAKLE  293
             FLS   N +++
Sbjct  678   FLSRKDNIRVD  688



>ref|XP_003617439.1| Yellow stripe-like protein 2.8 [Medicago truncatula]
Length=690

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/678 (62%), Positives = 515/678 (76%), Gaps = 32/678 (5%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE   +PSW+ Q+T+RA+  S++LS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  21    SIEKGFEGKSVPSWQKQVTVRAIVVSIMLSVMFTFIVMKLNLTTGIIPSLNVSAGLLGFF  80

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT LL KAG L QPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMSPTIA Q   
Sbjct  81    FVKTWTKLLEKAGWLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSPTIAKQIPE  140

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 N+VK+L +GWM+AFL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  141   AGTANDVKSLGLGWMIAFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHT  200

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
               GAKLAK+QV AL K FSFSFL+G FQWFFAA D CGF++FPTFGL+AY ++FYFDFS+
Sbjct  201   SEGAKLAKKQVKALGKFFSFSFLWGFFQWFFAAGDSCGFTNFPTFGLEAYQRKFYFDFSA  260

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLLIG ++SWG++WP+I  K+G W+P +L  SSL G+QGY+VF+ 
Sbjct  261   TYVGVGMICPYIINISLLIGGVLSWGVMWPLIGAKKGDWFPADLKESSLHGLQGYRVFIG  320

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED------  1232
             IAM+LGDGL+NF  ++  T +   K+ +                 K KGAQ ED      
Sbjct  321   IAMILGDGLYNFVKVLGTTLIGLYKQLK----------------KKDKGAQSEDPNAPLP  364

Query  1231  ----FDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPI  1064
                 FD +RRT  FLKD IP+  A+ GY+ +A ++II +P IF  LKWYHI   Y +AP 
Sbjct  365   PTLSFDDKRRTEMFLKDQIPSWFAIAGYVIIAIISIITIPHIFHQLKWYHIICIYIIAPA  424

Query  1063  LAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLM  884
             LAFCNAYGCGLTDWSLAS YGK+AI I  +W G  NGG+LA LA+CGVMM+IVST SDLM
Sbjct  425   LAFCNAYGCGLTDWSLASTYGKLAIFIIGAWAGPANGGILASLAACGVMMNIVSTASDLM  484

Query  883   QDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavy  707
             QDFKTGY+TLASP +MF SQV GTA+GC ++P VFW+FY A+  LG   SAYPAPYA VY
Sbjct  485   QDFKTGYMTLASPKSMFVSQVIGTAIGCVVSPCVFWLFYHAFGTLGQPGSAYPAPYALVY  544

Query  706   raiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAI  527
             R IA+LGVDGF +LP NCL L I FF  AI IN   +++ K   KY     IP PM MAI
Sbjct  545   RNIAILGVDGFSALPKNCLVLCIIFFTGAIIINFVRDLVGKKYAKY-----IPVPMAMAI  599

Query  526   PFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGV  347
             PFY+G YFAIDMCVGSLILF+W+  ++ +A  F  AVASGLICG+ +W +P++ LALAGV
Sbjct  600   PFYIGSYFAIDMCVGSLILFIWQKLDRAKADAFASAVASGLICGDGIWSLPSSFLALAGV  659

Query  346   KAPICMKFLSAAANAKLE  293
             + PICMKFLS AANAK++
Sbjct  660   QPPICMKFLSRAANAKVD  677



>ref|XP_004953195.1| PREDICTED: probable metal-nicotianamine transporter YSL14-like 
[Setaria italica]
Length=724

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/669 (62%), Positives = 505/669 (75%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  59    SVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  118

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + + G L+QPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS  IA QA  
Sbjct  119   FVRMWTAAVERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIANQATE  178

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 NN+K   +GWM+ FL++VSF+GL ++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  179   AKDANNIKDPHLGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  238

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSF +G FQWF+ A D CGF +FPT GL+AY  RF+FDFS 
Sbjct  239   PEGAKLAKKQVKTLGKYFVFSFFWGFFQWFYTAGDDCGFKNFPTLGLEAYNNRFFFDFSP  298

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWG++WP+I  K+G WYP ++  SSL G+Q Y+VF++
Sbjct  299   TYVGVGMICPYIVNVSVLLGGILSWGVMWPLIAKKKGSWYPADVGDSSLHGLQAYRVFIS  358

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   +       S+LPV D  +    A+   FD +RR
Sbjct  359   IALILGDGLYNFIKVLIRTIAGFISMVQQNSK---SMLPVSDHGSSMSTAEAVSFDEERR  415

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP +VA GGY A+AAV+I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  416   TELFLKDQIPKSVAYGGYAAVAAVSIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSG  475

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G   GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  476   LTDWSLASTYGKLAIFVFGAWAGLAQGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  535

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT MGC + P +FW+FYKA+  +G+S + YPAPYA VYR +A+LGVDG
Sbjct  536   ASPRSMFISQVIGTGMGCVIAPCIFWLFYKAFGDIGESGTEYPAPYAIVYRNMAILGVDG  595

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             FGSLP NCL L   FF AAIAIN+  ++     T  RV RFIP PM MAIPFY+G YFAI
Sbjct  596   FGSLPKNCLTLCYIFFAAAIAINLVRDL-----TPNRVSRFIPLPMAMAIPFYIGSYFAI  650

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G  ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA VK PICMKFLS
Sbjct  651   DMFLGCAILFVWERLNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLS  710

Query  316   AAANAKLES  290
              A NAK++S
Sbjct  711   RATNAKVDS  719



>emb|CDY39272.1| BnaC06g27190D [Brassica napus]
Length=689

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/671 (62%), Positives = 517/671 (77%), Gaps = 15/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEI--PSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE+     P W+NQLT RAM  S +LS +F F+V KLNLTTG+IPSLN++AGLL 
Sbjct  26    SVERIFEESADAPPPWQNQLTFRAMIVSFILSILFTFVVMKLNLTTGIIPSLNISAGLLS  85

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT +L KAG+LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  86    FFFVKTWTKILNKAGILKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEVVAKQS  145

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N P N+K   +GWM+ FL+ VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  146   PEANTPLNIKNPHLGWMIGFLFTVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  205

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + DGCGF++FPTFGL+AY  +FYFDF
Sbjct  206   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGDGCGFANFPTFGLEAYENKFYFDF  265

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLL+G+I+SWG++WP+I  ++G WY  +LSS+SL G+QGYKVF
Sbjct  266   SATYVGVGMICPYLINVSLLVGSILSWGVMWPLIGAQKGKWYSADLSSTSLHGLQGYKVF  325

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF   + V G + +   +  KN  A  LPV+D            +D +
Sbjct  326   IAIAMILGDGLYNF---IKVLGRTIVGLYKQFKNRDA--LPVNDR--SPSNTVTISYDDK  378

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+ +AV GY+ +A V+I+ VP IFP L+WYHI   Y +AP+LAFCNAYG
Sbjct  379   RRTELFLKDRIPSWIAVTGYVVMAIVSIVTVPHIFPQLRWYHILTMYIIAPVLAFCNAYG  438

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  439   CGLTDWSLASTYGKLAIFTIGAWAGSANGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  498

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G + +AYPAPYA VYR +++LGV
Sbjct  499   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQTGTAYPAPYALVYRNMSILGV  558

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL +   FF AA+ +N   + +    +     RFIP PM MAIPFY+GGYF
Sbjct  559   EGFSALPQHCLMICYIFFAAAVFVNGARDAVGPNWS-----RFIPLPMAMAIPFYIGGYF  613

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMCVGSLILFVWR  N+ +A  +  AVASGLICGE +W +P+++LALAGVK PICMKF
Sbjct  614   TIDMCVGSLILFVWRKLNRPKADAYSSAVASGLICGEGIWTLPSSVLALAGVKPPICMKF  673

Query  322   LSAAANAKLES  290
             LS A N K++S
Sbjct  674   LSGATNVKVDS  684



>ref|XP_008805741.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Phoenix 
dactylifera]
Length=683

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/670 (63%), Positives = 505/670 (75%), Gaps = 11/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE  E+PSW +QLT RA   SL+L   F+FIV KL+LTTG+IPSLNV+AGLLGF 
Sbjct  17    SLEQHFESKEVPSWTDQLTFRAFAVSLMLGFFFSFIVIKLSLTTGIIPSLNVSAGLLGFF  76

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L KAGLLKQPFTRQENTVIQT VVA SGIAFS G  SY+LGMS  +A     
Sbjct  77    FVKTWTKILEKAGLLKQPFTRQENTVIQTSVVALSGIAFSGGFGSYILGMSKNVANDLNE  136

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G      K  S+GWM+ FL+ VSFVGLF+IVPLRK+MIL YKLTYPSGTATAYLINSFHT
Sbjct  137   GYTARYTKEPSLGWMIGFLFTVSFVGLFTIVPLRKIMILGYKLTYPSGTATAYLINSFHT  196

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA  AK+QV  LFK F  SFL+  FQWF+ A DGCGF++FPTFGLKAY +RFYFDFS+
Sbjct  197   PQGAMQAKKQVTFLFKTFVASFLWAFFQWFYTAGDGCGFAAFPTFGLKAYDRRFYFDFSA  256

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP M+N+SLL+G+IISWGI+WP I +K+G+WY  ++ SSS+ G+ GYKVF++
Sbjct  257   TYVGVGMICPYMINISLLLGSIISWGILWPYIDSKKGVWYDASVPSSSMHGLTGYKVFIS  316

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMK--RRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IAM+LGDGLF++  +   +        RRR E   P +    DD        Q   FD +
Sbjct  317   IAMILGDGLFHYLLVFFRSSYDIYNKCRRRKEVITPCT----DDN---AIPDQPRSFDDR  369

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR  +FLKD IP    V GYI LAA+A+I VP IFP LK+YH+ VAY +AP+LAFCN+YG
Sbjct  370   RRAMSFLKDQIPIVFVVAGYIILAAIAVIVVPIIFPQLKFYHVIVAYLIAPVLAFCNSYG  429

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS+Y K+AI IF +WVG  +GG++AGLA+CGVMM IVST SDLMQDFKTGYL
Sbjct  430   TGLTDWSLASSYAKLAIFIFGAWVGLSHGGIMAGLAACGVMMGIVSTASDLMQDFKTGYL  489

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVD  680
             TLASP +MF SQV GTAMGC ++P+VFWIFY A+P+G   S YPAPYA VYR IALLGV+
Sbjct  490   TLASPRSMFVSQVVGTAMGCVISPIVFWIFYTAFPVGSEGSEYPAPYAKVYRGIALLGVE  549

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NC+NL + FF  AIAIN   EV      K+R+ R++P+ M MAIPFYLG YF 
Sbjct  550   GFSSLPKNCMNLCVIFFSLAIAINALKEVAG--HKKWRISRYVPSAMGMAIPFYLGSYFT  607

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMCVGSLILFVW   NK+ A  F PA+ASGLICG+ +W +PA++LALA V  PICM FL
Sbjct  608   IDMCVGSLILFVWERMNKRHADIFAPALASGLICGDGIWSLPASLLALAKVNPPICMGFL  667

Query  319   SAAANAKLES  290
             S A  A +++
Sbjct  668   SRADKAMVDA  677



>ref|XP_002446809.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor]
 gb|EES11137.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor]
Length=722

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/668 (62%), Positives = 509/668 (76%), Gaps = 13/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF +  +PSW+ QLT+RA   S  L+ +F+ IV KL LTTG+IPSLNV+AGLLGF 
Sbjct  62    SVERVFAEQAVPSWREQLTVRAFVVSFFLAVMFSIIVMKLGLTTGIIPSLNVSAGLLGFF  121

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + + GLLKQPFTRQENTVIQTCVVA+  IAFS G  +Y+ GMS TIA QA  
Sbjct  122   FVRLWTAAIERVGLLKQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATE  181

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              + P NVK   IGWM+ FL++ SF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  182   ADDPQNVKNPHIGWMIGFLFLASFIGLFALVPLRKVMIVDYKLTYPSGTATAYLINGFHT  241

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSFL+G FQWF+   D CGF +FPT GL+AY  RFYFDFS 
Sbjct  242   PEGAKLAKKQVKTLGKFFLFSFLWGFFQWFYTGGDNCGFQNFPTLGLQAYKNRFYFDFSP  301

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K+G WYP +LS SSL G+QGY+VF++
Sbjct  302   TYVGVGMICPHIVNVSVLLGGILSWGIMWPLIRNKKGSWYPASLSESSLHGLQGYRVFIS  361

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T + F+   +  KN   S LPV +  N    A+   FD +RR
Sbjct  362   IAIILGDGLYNFVKVLIRTTIRFISMMK--KN---STLPVSN--NGSPIAEAVSFDDERR  414

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP +VA GGY+ +AA++I  +P +FP LKWY+I VAY  AP+LAFCNAYG G
Sbjct  415   TELFLKDQIPRSVAYGGYVVVAAISIGTLPQVFPNLKWYYILVAYIFAPVLAFCNAYGTG  474

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI IF +W G  NGGVL GLA+CGVMMSIVST +DLMQDFKTGYLTL
Sbjct  475   LTDWSLASTYGKLAIFIFGAWAGASNGGVLVGLAACGVMMSIVSTAADLMQDFKTGYLTL  534

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAPYA VYR +A+LGVDG
Sbjct  535   ASPRSMFISQVIGTAMGCVIAPCVFWLFYKAFTDIGMSGSEYPAPYAIVYRNMAILGVDG  594

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAI +N+  +++ K     +V  FIP PM MAIPFYLG YFAI
Sbjct  595   FSSLPKNCLTLCYIFFAAAIVVNLIRDLVPK-----KVAGFIPLPMAMAIPFYLGSYFAI  649

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G++ILF W+  N+ +A  FGPAVASGLICG+ +W +P +ILALA VK PICMKFLS
Sbjct  650   DMFIGTVILFAWQMINRAKADAFGPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLS  709

Query  316   AAANAKLE  293
              + NA+++
Sbjct  710   RSVNAQVD  717



>ref|XP_002525883.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF36487.1| oligopeptide transporter, putative [Ricinus communis]
Length=717

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/670 (62%), Positives = 522/670 (78%), Gaps = 11/670 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             +S E +FE  E+P+WK+QLTIRA   S VL  +F+FIV KLNLTTG+IPSLNV+AGLLGF
Sbjct  54    DSVEMIFEAKEVPTWKDQLTIRAFVVSFVLGILFSFIVMKLNLTTGIIPSLNVSAGLLGF  113

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               +K+WT  L K+GLLKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  +A Q+ 
Sbjct  114   FFVKTWTKFLSKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVVAKQST  173

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N   N+K  S+GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFH
Sbjct  174   EANTAGNIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLIYPSGTATAHLINSFH  233

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLAK+QV  L K FSFSFL+G FQWFF A D CGF +FPTFGL+AY  +FYFDFS
Sbjct  234   TPQGAKLAKKQVRELGKFFSFSFLWGFFQWFFTAGDDCGFINFPTFGLQAYQHKFYFDFS  293

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP ++N+SLL GAI+SWGI+WP+I T++G WY  +LS SSL G+QGYKVF+
Sbjct  294   ATYVGVGMICPYLINISLLAGAILSWGIMWPLIDTRKGHWYSADLSPSSLHGLQGYKVFI  353

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             AIAM+LGDG +NFF ++  T L   ++  ++     S+LPV+++ +    +    +D ++
Sbjct  354   AIAMILGDGAYNFFKVLSRTLLGLYQQFSTKD----SVLPVNNK-SPSMNSSTVSYDDKK  408

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP   A+ GY+ +A ++II VP IF  LKWYHI V Y +AP+LAFCNAYGC
Sbjct  409   RTELFLKDQIPTWFAITGYVIIAIISIITVPHIFHQLKWYHIVVIYIIAPVLAFCNAYGC  468

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGY+T
Sbjct  469   GLTDWSLASTYGKLAIFTIGAWAGAAHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYMT  528

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVD  680
             LASP +MF SQ+ GTAMGC ++P VFW+FYKA+  LG   + YPAPYA VYR +++LGV+
Sbjct  529   LASPRSMFVSQIIGTAMGCVISPCVFWLFYKAFHDLGIPGTEYPAPYALVYRNMSILGVE  588

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF +LP +CL L   FF+AAI IN+  +++ K     R  ++IP PM MAIPFYLGGYFA
Sbjct  589   GFSALPKHCLTLCYVFFIAAIVINVIRDIVGK-----RGAQYIPIPMAMAIPFYLGGYFA  643

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMCVGSLILF+WR  NK +A  +GPAVASGLICG+ +W +P++ILAL GV+ PICMKFL
Sbjct  644   IDMCVGSLILFMWRKINKAKADAYGPAVASGLICGDGIWTLPSSILALVGVRPPICMKFL  703

Query  319   SAAANAKLES  290
             S+  N ++++
Sbjct  704   SSKQNGRVDN  713



>gb|EYU25678.1| hypothetical protein MIMGU_mgv1a002252mg [Erythranthe guttata]
Length=695

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/669 (61%), Positives = 502/669 (75%), Gaps = 14/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE  E+P W+ QLT+RA   S VL  +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  36    SIEKTFEGTEVPPWQKQLTLRAFVVSFVLGILFTFIVMKLNLTTGIIPSLNVSAGLLGFF  95

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+W+  L K+GLLKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  IA Q+  
Sbjct  96    FVKTWSKFLEKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVIAKQSTE  155

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   NVK  S+ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHT
Sbjct  156   ANDSQNVKNPSLSWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFHT  215

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSF++  FQWFF A + CGF++FPTFGLKAY  RFYFDFS+
Sbjct  216   PQGAKLAKKQVRTLGKFFSFSFVWAFFQWFFTATESCGFNNFPTFGLKAYDNRFYFDFSA  275

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVSLLIG+++SWGI+WP+I  ++G WY   L S SL G+QGYKVF+A
Sbjct  276   TYVGVGMICPYLINVSLLIGSVLSWGIMWPLIKERKGDWYSSELKSDSLHGLQGYKVFIA  335

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T      + + +   P        + ++        +D ++R
Sbjct  336   IAMILGDGLYNFIKVLAHTLYGLYNQFQEKNKRP--------DLSQSSNTPALSYDDKKR  387

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP  +AV  YIA+A ++   +P IF PLKWY+I V Y  AP LAFCNAYGCG
Sbjct  388   TQLFLKDQIPTWIAVSSYIAIAVISSATLPHIFRPLKWYYIIVIYIFAPALAFCNAYGCG  447

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGY+TL
Sbjct  448   LTDWSLASTYGKLAIFVIGAWAGGSHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYMTL  507

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQ+ GTAMGC ++P VFW+FYKA+P +G S S Y APYA VYR +A+LGV+G
Sbjct  508   ASPRSMFVSQIIGTAMGCVISPCVFWLFYKAFPDIGLSGSQYKAPYALVYRNMAILGVEG  567

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP +CL L   FF+AA+ IN   + +       +  RFIP PM MAIPFYLGGYF I
Sbjct  568   FSALPDHCLTLCYVFFIAAVVINGVRDAV-----GVKWARFIPLPMAMAIPFYLGGYFTI  622

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILFVW   +K +A  FGPAVASGLICG+ +W +P ++LALAGVKAPICMKFLS
Sbjct  623   DMCVGSLILFVWEKIDKAKADAFGPAVASGLICGDGIWALPNSVLALAGVKAPICMKFLS  682

Query  316   AAANAKLES  290
                NA++++
Sbjct  683   RKDNARVDA  691



>sp|Q5JQD7.2|YSL12_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL12; 
AltName: Full=Protein YELLOW STRIPE LIKE 12; Short=OsYSL12 
[Oryza sativa Japonica Group]
 emb|CAH67886.1| OSIGBa0153E02-OSIGBa0093I20.15 [Oryza sativa Indica Group]
Length=717

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/669 (62%), Positives = 507/669 (76%), Gaps = 11/669 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
              S ER F    +PSW+ QLT+RA   S  LS +F+ IV KLNLTTG+IPSLNV+AGLLGF
Sbjct  54    SSVERAFVDRAVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGF  113

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               ++ WTA + + GLL+QPFTRQENTVIQTCVVA+ GIAFS G  +Y+ GMS TIA QA 
Sbjct  114   FFVRLWTAAIERVGLLRQPFTRQENTVIQTCVVAAYGIAFSGGFGTYLFGMSETIAKQAT  173

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N   NVK   IGWM+ FL++VSF+GL ++VPLRK+MI+ YKLTYPSGTATAYLIN FH
Sbjct  174   EANNAQNVKNPHIGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFH  233

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLAK+QV  L K F FSF++G FQWF+ A DGCGF SFPT GL+AY  RFYFDFS
Sbjct  234   TPEGAKLAKKQVKELGKFFLFSFVWGFFQWFYTAGDGCGFQSFPTLGLQAYKNRFYFDFS  293

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
              TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K+G WY  +LS +SL G+QGY+VF+
Sbjct  294   PTYVGVGMICPHIVNVSVLLGGILSWGIMWPLIRNKKGSWYAASLSETSLHGLQGYRVFI  353

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             +IA++LGDGL+NF  +++ T   F+   +  KN   S LPV +  +     +   FD +R
Sbjct  354   SIALILGDGLYNFVKVLIRTTAGFVVMMK--KN---STLPVSNNGSPMVATEAISFDDER  408

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP  VA GGY+A+AAV+I  +P IFP LKWY+I VAY  AP+LAFCNAYG 
Sbjct  409   RTELFLKDQIPKTVAFGGYVAVAAVSIGTLPQIFPQLKWYYILVAYVFAPVLAFCNAYGA  468

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YGK+AI IF +W G  NGGVL GLA+CGVMMSIVST SDLMQDFKTGYLT
Sbjct  469   GLTDWSLASTYGKLAIFIFGAWAGASNGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLT  528

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVD  680
             LASP +MF SQV GTAMGC + P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVD
Sbjct  529   LASPRSMFVSQVIGTAMGCVIAPCVFWLFYKAFADIGVSGTEYPAPYAIVYRNMAILGVD  588

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP +CL L   FF AAIAIN+  ++        +V RFIP PM MAIPFY+G YFA
Sbjct  589   GFSSLPKHCLTLCYIFFAAAIAINLARDL-----APSKVARFIPLPMAMAIPFYIGSYFA  643

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDM +G++ILFVW   NK +A+ F PAVASGLICG+ +W +P +ILALA VK PICMKFL
Sbjct  644   IDMFIGTVILFVWEMVNKAKAEAFAPAVASGLICGDGIWTLPQSILALAKVKPPICMKFL  703

Query  319   SAAANAKLE  293
             S + NA+++
Sbjct  704   SRSVNAQVD  712



>gb|KDP41617.1| hypothetical protein JCGZ_16024 [Jatropha curcas]
Length=690

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/669 (62%), Positives = 507/669 (76%), Gaps = 11/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE   +PSW+ QLT RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  26    SVEQIFESQRVPSWREQLTWRAFGVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  85

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +++WT +L  +GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+  
Sbjct  86    FVRTWTKILETSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSGIVAQQSTE  145

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   ++K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  146   DN-GTDIKDPKLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHT  204

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfq-wffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             P GAKLAK+QV  L K FSFSFL+  FQ +F A DD CGFS+FPTFGLKA   RFYFDFS
Sbjct  205   PEGAKLAKKQVRELGKFFSFSFLWAFFQWFFKAEDDYCGFSNFPTFGLKAKENRFYFDFS  264

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP ++N+S+L+G I+SWG++WP+I +++G W+P +LS  SL G+QGYKVF+
Sbjct  265   ATYVGVGMICPYVINISVLLGGILSWGLMWPLIDSRKGDWFPADLSPKSLSGLQGYKVFI  324

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             AIA++LGDGL+NF  ++  T  S   +   ++N P  L PV D  +     Q   +D QR
Sbjct  325   AIALILGDGLYNFCKVLSQTLASLYFQFYPKRNRPTDL-PVAD--SPPLKLQKLSYDDQR  381

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP   A+ GY+ +AA++   +P IF  LKWY++ V Y  AP LAFCNAYGC
Sbjct  382   RTQLFLKDQIPTWFAITGYVTIAAISAAVLPHIFTQLKWYYVIVIYVFAPTLAFCNAYGC  441

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YG++AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGYLT
Sbjct  442   GLTDWSLASTYGQLAIFTIGAWAGASHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYLT  501

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVD  680
             LASP +MF SQV GTAMGC ++P VFW+F KA+  LG  +S YP P A VYR +A+LGVD
Sbjct  502   LASPRSMFVSQVIGTAMGCVISPSVFWLFDKAFHDLGLPHSTYPVPNAVVYRGMAILGVD  561

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NCL L   FF AAI INI  + L K     +  RFIP PM MAIPFYLG YFA
Sbjct  562   GFSSLPKNCLLLCYCFFAAAILINIIKDFLGK-----KWGRFIPLPMAMAIPFYLGPYFA  616

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMCVGSLILF+W   NK +A  FGPAVASGLICG+ +W +P++ILALAGVKAPICM+F 
Sbjct  617   IDMCVGSLILFIWEKINKAKADAFGPAVASGLICGDGIWVLPSSILALAGVKAPICMRFF  676

Query  319   SAAANAKLE  293
             S + N +++
Sbjct  677   SRSTNNRID  685



>gb|ABB76761.1| YSL transporter 1 [Noccaea caerulescens]
 gb|ABD04076.1| YSL transporter 1 [Noccaea caerulescens]
Length=693

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/673 (63%), Positives = 520/673 (77%), Gaps = 18/673 (3%)
 Frame = -2

Query  2293  STERVFEK--VEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE      P+W+NQLTIRAM  S VLS +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  29    SVERIFEANGEAPPTWQNQLTIRAMIVSFVLSILFTFVVMKLNLTTGIIPSLNISAGLLG  88

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT LL KAG LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  89    FFFVKTWTKLLSKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQS  148

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N P N+K   +GWM+ FL++VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  149   ADANTPLNIKNPHLGWMIGFLFIVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  208

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + D CGF+SFPTFGLKAY  +FYFDF
Sbjct  209   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGDDCGFASFPTFGLKAYKNKFYFDF  268

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLL+G+I+SWGI+WP+I  ++G WY  +L SSSL G+QGYKVF
Sbjct  269   SATYVGVGMICPYLINVSLLVGSILSWGIMWPLIDAQKGKWYSADLKSSSLHGLQGYKVF  328

Query  1399  LAIAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFD  1226
             +AIAM+LGDGL+NF  ++   V GL    ++R        +LPV+D  +      +  +D
Sbjct  329   IAIAMILGDGLYNFIKVLGRTVVGLYTQFKKR-------DVLPVNDRSSSPTAVTIS-YD  380

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              +RRT  FLKD IP+ +A+ GY+ +A V+II VP IFP LKWYHI   Y +AP+LAFCNA
Sbjct  381   DKRRTELFLKDRIPSWMAISGYVIMAIVSIITVPHIFPQLKWYHILTMYIIAPVLAFCNA  440

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YGCGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTG
Sbjct  441   YGCGLTDWSLASTYGKLAIFTIGAWAGAANGGVLAGLAACGVMMNIVSTASDLMQDFKTG  500

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALL  689
             Y+TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G + +AYPAPYA VYR +++L
Sbjct  501   YMTLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQTGTAYPAPYALVYRNMSIL  560

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+GF +LP +CL L   FF AA+ +N   +++       +  RFIP PM MAIPFY+GG
Sbjct  561   GVEGFSALPKHCLMLCYVFFAAAVFVNGVRDLVGP-----KWARFIPLPMAMAIPFYIGG  615

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YF IDMCVGSLILF+WR  NK +A  +  AVASGLICGE +W +P++ILALAGVK PICM
Sbjct  616   YFTIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLPSSILALAGVKPPICM  675

Query  328   KFLSAAANAKLES  290
             KFLS A N K++S
Sbjct  676   KFLSGATNVKVDS  688



>ref|XP_003533289.1| PREDICTED: probable metal-nicotianamine transporter YSL8-like 
[Glycine max]
Length=703

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/671 (62%), Positives = 510/671 (76%), Gaps = 18/671 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF+ + +PSW+NQLT+RA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  44    SVERVFQHLLVPSWRNQLTVRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  103

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L K+ +L+QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+  
Sbjct  104   FVKTWTKFLEKSNMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEEIAKQSSD  163

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  + K   +GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  164   ---TGHFKDPKLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  220

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A D CGF +FP+ GLKAY  +F+FDF++
Sbjct  221   PQGAKLAKKQVKMLGKFFSFSFLWGFFQWFYTATDQCGFQAFPSLGLKAYNNKFFFDFAA  280

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
              YVGVGM+CP ++N+S+L+G I+SWGI+WP+I TKEG WY   L   +L GIQGY+VF+A
Sbjct  281   IYVGVGMICPYIINISVLLGGILSWGIMWPLIKTKEGDWYDKGLGEGNLHGIQGYRVFIA  340

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA++LGDGL+NF  ++  T  GL    R +  +N     LPV D+ +      L  +D Q
Sbjct  341   IALILGDGLYNFIKVLTHTLWGLYHQVRVKQRENA----LPVADQ-DSPSNPHLS-YDDQ  394

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   A+ GY+A+AA++   +P IFP LKWY+I V Y +AP LAFCNAYG
Sbjct  395   RRTQLFLKDQIPTWFAIAGYVAIAAISTATLPHIFPQLKWYYIIVIYLIAPTLAFCNAYG  454

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGYL
Sbjct  455   CGLTDWSLASTYGKLAIFTIGAWAGSSHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYL  514

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ+ GT MGC ++P VFWIFYKA+P LG S S YPAPYA +YR +A+LGV
Sbjct  515   TLASPRSMFVSQIIGTTMGCVISPSVFWIFYKAFPDLGRSTSEYPAPYAIIYRNMAILGV  574

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
              GFG+LP NCL L   FF AA+AIN+  + +          RFIP PM MAIPFY+G YF
Sbjct  575   QGFGNLPKNCLLLCYIFFAAAVAINLIKDFIGNKG------RFIPLPMAMAIPFYIGPYF  628

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLIL+VW   NK +A  F PAVASGLICG+ +W +PA+ILALAGVK PICMKF
Sbjct  629   AIDMCVGSLILYVWERINKAKADAFAPAVASGLICGDGIWTLPASILALAGVKPPICMKF  688

Query  322   LSAAANAKLES  290
             LS AANA++++
Sbjct  689   LSRAANARVDT  699



>ref|XP_004976283.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Setaria italica]
Length=718

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/669 (61%), Positives = 506/669 (76%), Gaps = 13/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER FE   +PSW+ QLT+RA   S  LS +F+ IV KLNLTTG+IPSLNV+AGLL F 
Sbjct  58    SVERAFEGQPVPSWREQLTVRAFVVSFFLSVMFSVIVMKLNLTTGIIPSLNVSAGLLSFF  117

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT  +   GLL+QPFTRQENTVIQTCVVA+  IAFS G  +Y+ GMS TIA QA  
Sbjct  118   FVRLWTKAIESMGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATE  177

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N P NVK   IGWM+ FL++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  178   ANNPQNVKNPHIGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  237

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K F FSFL+G FQWF+   D CGF +FPT GL+AY  RFYFDFS 
Sbjct  238   PEGAKLAKKQVKALGKFFLFSFLWGFFQWFYTGGDSCGFQNFPTLGLQAYKNRFYFDFSP  297

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K+G WYP +L  SSL G+QGY+VF++
Sbjct  298   TYVGVGMICPHIVNVSVLLGGILSWGIMWPLIRNKKGSWYPASLQESSLHGLQGYRVFIS  357

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   + +     S LPV ++       +   FD +RR
Sbjct  358   IAIILGDGLYNFVKVLIRTTAGFISMMKKD-----STLPVSND--SSPITESVSFDDERR  410

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP +VA GGY+A+AA++I  +P +FP LKWY+I VAY  AP+LAFCNAYG G
Sbjct  411   TELFLKDQIPKSVAYGGYVAVAAISIGTLPQVFPQLKWYYILVAYIFAPVLAFCNAYGTG  470

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI IF +W G  +GGVL GLA+CGVMMSIVST +DLMQDFKTGYLTL
Sbjct  471   LTDWSLASTYGKLAIFIFGAWAGASHGGVLVGLAACGVMMSIVSTAADLMQDFKTGYLTL  530

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAPYA VYR +A+LGVDG
Sbjct  531   ASPRSMFISQVIGTAMGCVIAPCVFWLFYKAFADIGLSGSEYPAPYAIVYRNMAILGVDG  590

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAIA+N+  +++ K     +V RFIP PM MAIPFY+G YFAI
Sbjct  591   FSSLPKNCLTLCYVFFAAAIAVNLVRDLVPK-----KVARFIPLPMAMAIPFYIGSYFAI  645

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G++ILF W   NK +A  F PAVASGLICG+ +W +P ++LALA VK PICMKFLS
Sbjct  646   DMFIGTVILFAWEVMNKAKADAFAPAVASGLICGDGIWTLPQSVLALAKVKPPICMKFLS  705

Query  316   AAANAKLES  290
              + NA++++
Sbjct  706   RSVNAQVDT  714



>ref|XP_009798435.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=712

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/672 (63%), Positives = 517/672 (77%), Gaps = 16/672 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             +S ER+FE  E+P+W++QLT RA F S +L  +F FIV KLNLTTG+IPSLNV+AGLLGF
Sbjct  48    QSVERIFESKEVPTWQSQLTFRAFFVSFILGILFTFIVMKLNLTTGIIPSLNVSAGLLGF  107

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               +K+WT  L K+G LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  IA Q+ 
Sbjct  108   FFVKTWTKFLEKSGWLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVIAKQSN  167

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N  +N+K  S+GWM++FL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFH
Sbjct  168   EDNAADNIKNPSLGWMISFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFH  227

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLAK+QV AL K FSFSFL+G FQWFF A DGCGF +FPTFGLKAY  RFYFDFS
Sbjct  228   TPQGAKLAKKQVKALGKFFSFSFLWGFFQWFFTAGDGCGFVNFPTFGLKAYENRFYFDFS  287

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP ++N+SLL+GAI+SWGI+WP+I  ++G WYP N S SSL GIQGY+VF+
Sbjct  288   ATYVGVGMICPYLINISLLVGAILSWGIMWPLIQDRKGHWYPANQSDSSLHGIQGYRVFI  347

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE---DFD  1226
             AIAM+LGDGL+NF  ++  T      + R ++ G  S+LPV       +G+ +E    +D
Sbjct  348   AIAMILGDGLYNFCKVLGRTLYGIYFQIREKRAG--SVLPVG-----ARGSPIEPSLSYD  400

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              Q RT  FLKD IP  VA+ GY+++A V+ + +P IF  LKWY+I V Y  APILAFCNA
Sbjct  401   DQIRTELFLKDQIPTWVAIAGYVSIAIVSTVTLPHIFHQLKWYYIVVIYIFAPILAFCNA  460

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YGCGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTG
Sbjct  461   YGCGLTDWSLASTYGKLAIFTIGAWAGAAHGGVLAGLAACGVMMNIVSTASDLTQDFKTG  520

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALL  689
             Y+TLASP +MF SQ+ GTAMGC ++P VFW+FYKA+  LG   S YPAPYA VYR +++L
Sbjct  521   YMTLASPRSMFISQIIGTAMGCVISPCVFWLFYKAFHDLGVPGSEYPAPYALVYRNMSIL  580

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+GF +LP NCL L   FF+ AIAIN   + + K + KY     IP PM MAIPFYLG 
Sbjct  581   GVEGFSALPKNCLTLCYVFFLGAIAINALRDAVGKNKAKY-----IPLPMAMAIPFYLGS  635

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDMC+GSLILFVW   +K +A  FGPAVASGLICG+ +W +P++ILALAGV  PICM
Sbjct  636   YFAIDMCLGSLILFVWTKIDKVKADAFGPAVASGLICGDGIWTLPSSILALAGVNPPICM  695

Query  328   KFLSAAANAKLE  293
             KFLS   N +++
Sbjct  696   KFLSRKDNIRVD  707



>ref|XP_009593058.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
tomentosiformis]
Length=713

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/672 (63%), Positives = 517/672 (77%), Gaps = 16/672 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             +S ER+FE  E+P+W++QLT RA F S VL  +F FIV KLNLTTG+IPSLNV+AGLLGF
Sbjct  49    QSVERIFESKEVPTWQSQLTFRAFFVSFVLGILFTFIVMKLNLTTGIIPSLNVSAGLLGF  108

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               +K+WT  L K+G LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  IA Q+ 
Sbjct  109   FFVKTWTKFLEKSGWLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVIAKQSN  168

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N  +N+K  S+GWM++FL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFH
Sbjct  169   EDNAADNIKNPSLGWMISFLFVVSFLGLFSVVPLRKIMIIDFKLVYPSGTATAHLINSFH  228

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLAK+QV AL K FSFSFL+G FQWFF A DGCGF +FPTFGLKAY  RFYFDFS
Sbjct  229   TPQGAKLAKKQVKALGKFFSFSFLWGFFQWFFTAGDGCGFVNFPTFGLKAYENRFYFDFS  288

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP ++N+SLL+GAI+SWGI+WP+I  ++G WYP N S+SSL GIQGY+VF+
Sbjct  289   ATYVGVGMICPYLINISLLVGAILSWGIMWPLIQDRKGHWYPANQSASSLHGIQGYRVFI  348

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE---DFD  1226
             AIAM+LGDGL+NF  ++  T      + R ++ G  S+LPV       +G+  E    +D
Sbjct  349   AIAMILGDGLYNFCKVLGRTLYGIYFQIREKRAG--SVLPVG-----ARGSPTEPSLSYD  401

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              Q RT  FLKD IP  VA+ GY+++A V+ + +P IF  LKWY+I V Y  APILAFCNA
Sbjct  402   DQIRTELFLKDQIPTWVAIAGYVSIAIVSTVTLPHIFHQLKWYYIVVIYIFAPILAFCNA  461

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YGCGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTG
Sbjct  462   YGCGLTDWSLASTYGKLAIFTIGAWAGAAHGGVLAGLAACGVMMNIVSTASDLTQDFKTG  521

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALL  689
             Y+TLASP +MF SQ+ GTAMGC ++P VFW+FYKA+  LG   S YPAPYA VYR +++L
Sbjct  522   YMTLASPRSMFISQIIGTAMGCVISPCVFWLFYKAFHDLGVPGSEYPAPYALVYRNMSIL  581

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+GF +LP NCL L   FF+ AIAIN   + + K + KY     IP PM MAIPFYLG 
Sbjct  582   GVEGFSALPKNCLTLCYVFFLGAIAINALRDAVGKNKAKY-----IPLPMAMAIPFYLGS  636

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDMC+GSLILFVW   +K +A  FGPAVASGLICG+ +W +P++ILALAGV  PICM
Sbjct  637   YFAIDMCLGSLILFVWTKIDKVKADAFGPAVASGLICGDGIWTLPSSILALAGVNPPICM  696

Query  328   KFLSAAANAKLE  293
             KFLS   N +++
Sbjct  697   KFLSRKDNIRVD  708



>ref|XP_003620154.1| Yellow stripe-like protein 2.1 [Medicago truncatula]
 gb|AES76372.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=712

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/669 (61%), Positives = 512/669 (77%), Gaps = 14/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+VF+ + +PSW+NQLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  53    SIEKVFKHLLVPSWRNQLTIRAFVVSFFLSVLFSFIVMKLNLTTGIIPSLNVSAGLLGFF  112

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L K+ +LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+  
Sbjct  113   FVKTWTKFLEKSDMLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEHVATQSSD  172

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 ++ K   +GW++AFL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  173   ---TSDFKDPKLGWIIAFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  229

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A DGCGF +FP+ GLKAY  +FYFDFS+
Sbjct  230   PQGAKLAKKQVKLLGKFFSFSFLWGFFQWFYTASDGCGFQAFPSLGLKAYENKFYFDFST  289

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
              Y+GVGM+CP ++NVS+L+G ++SWG++WP+I T+EG WY   L  S+L+GIQGY+VF+A
Sbjct  290   LYIGVGMICPYIINVSVLLGGVLSWGVMWPLIETREGHWYKKGLGPSNLQGIQGYRVFIA  349

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T L    + R ++   A  LPV D+ +     +L  +D QRR
Sbjct  350   IAMILGDGLYNFVKVLTHTLLGLYSQLRDKRREDA--LPVADQ-DSPSSPELS-YDDQRR  405

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IP   AV GY+A+AA++   +P+IFP LKWY+I V Y +AP LAFCNAYGCG
Sbjct  406   KQLFLKDQIPTLFAVSGYVAIAAISTATLPYIFPQLKWYYILVIYLIAPTLAFCNAYGCG  465

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLA LA+CGVMM+IV+T SDLMQDFKTGYLTL
Sbjct  466   LTDWSLASTYGKLAIFSIGAWAGASHGGVLASLAACGVMMNIVATASDLMQDFKTGYLTL  525

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQ+ GT MGC ++P VFWIFYKA+P LG   S YPAPYA VYR +A+LGV G
Sbjct  526   ASPRSMFVSQIIGTTMGCIISPCVFWIFYKAFPDLGTHKSQYPAPYAIVYRNMAILGVQG  585

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAI +N+  +++ K      V RFIP PM MAIPFYLG YFAI
Sbjct  586   FSSLPDNCLLLCYIFFGAAIVVNLIKDLVGK------VGRFIPLPMAMAIPFYLGPYFAI  639

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILF+W   +K +A  F PAVASGLICG+ +W +PA+ILAL GVK PICMKFLS
Sbjct  640   DMCVGSLILFIWEKVDKAKADAFAPAVASGLICGDGIWTLPASILALFGVKPPICMKFLS  699

Query  316   AAANAKLES  290
              + N ++++
Sbjct  700   RSTNDRVDT  708



>ref|XP_003575422.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Brachypodium 
distachyon]
Length=715

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/669 (61%), Positives = 507/669 (76%), Gaps = 11/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA+  S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  53    SVERVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  112

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT+   + GL  QPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS TIA QA  
Sbjct  113   FVRLWTSAFERMGLFHQPFTRQENTVIQTCVVSAYGIAFSGGFGSYIFGMSETIAKQATE  172

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  N+K   +GWM+ FL++VSFVG+F++VP+RK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  173   AKDAQNIKDPHLGWMIGFLFLVSFVGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHT  232

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F  SF +G FQWFF A D CGF +FPT GL+AY  RF+FDFS 
Sbjct  233   PEGAKLAKKQVKTLGKFFMSSFFWGFFQWFFTAGDDCGFKNFPTLGLEAYKNRFFFDFSP  292

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+S+L+G IISWGI+WP+I  K+G WY  +L  SSL G+Q Y+VF++
Sbjct  293   TYVGVGMICPHIVNLSVLLGGIISWGIMWPLIAMKKGSWYDASLEESSLHGLQAYRVFIS  352

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+     +KN  A +LPV D  N    ++   FD +RR
Sbjct  353   IALILGDGLYNFIKVLIRTIAGFIS--MVQKNSKA-MLPVSD--NGRPTSEAVSFDDERR  407

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP +VA GGY+ +AA++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  408   TELFLKDQIPTSVAYGGYVVVAAISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSG  467

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  NGGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  468   LTDWSLASTYGKLAIFVFGAWAGLANGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  527

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVDG
Sbjct  528   ASPRSMFISQVIGTAMGCVISPCVFWLFYKAFSDIGKSGTEYPAPYAIVYRNMAILGVDG  587

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAIAIN+  ++     T ++V RFIP PM MAIPFY+G YFAI
Sbjct  588   FSSLPENCLTLCYIFFAAAIAINLIRDL-----TPHKVSRFIPLPMAMAIPFYIGSYFAI  642

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA VK PICMKFL+
Sbjct  643   DMFLGSFILFVWERVNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLT  702

Query  316   AAANAKLES  290
              A N ++++
Sbjct  703   RADNVRVDN  711



>ref|XP_002452492.1| hypothetical protein SORBIDRAFT_04g026840 [Sorghum bicolor]
 gb|EES05468.1| hypothetical protein SORBIDRAFT_04g026840 [Sorghum bicolor]
Length=728

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/669 (61%), Positives = 503/669 (75%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  63    SVERVFADKALPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  122

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + + G L+QPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS  IA QA  
Sbjct  123   FVRMWTAAVERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIANQATE  182

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 NN+K   +GWM+ FL++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  183   AKDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  242

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSF +G FQWF+ A D CGF +FPT GL+AY  RFYFDFS 
Sbjct  243   PEGAKLAKKQVKTLGKYFVFSFFWGLFQWFYTAGDECGFKNFPTLGLEAYNNRFYFDFSP  302

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWG++WP+I  K+G WYP NL  SSL G+Q Y+VF++
Sbjct  303   TYVGVGMICPYIVNVSVLLGGILSWGVMWPLIAKKKGSWYPANLEDSSLHGLQAYRVFIS  362

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   +        +LPV D  +     +   FD +RR
Sbjct  363   IALILGDGLYNFIKVLIRTIAGFISMVQQNSK---IMLPVSDNGSSMSSTEAVSFDDERR  419

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IP +VA GGY+A+AA++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  420   IEIFLKDQIPKSVAYGGYVAVAAISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSG  479

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G   GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  480   LTDWSLASTYGKLAIFVFGAWAGLSQGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  539

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT MGC + P VFW+FYKA+  +G+S + YPAPYA VYR +A+LGVDG
Sbjct  540   ASPRSMFISQVIGTGMGCVIGPCVFWLFYKAFGDIGESGTEYPAPYAIVYRNMAILGVDG  599

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAI IN+  ++     T  RV RFIP PM MAIPFY+G YFAI
Sbjct  600   FRSLPENCLTLCYIFFAAAIVINLVRDL-----TPQRVSRFIPLPMAMAIPFYIGSYFAI  654

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G +ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA V+ PICMKFLS
Sbjct  655   DMFLGCVILFVWEQLNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVQPPICMKFLS  714

Query  316   AAANAKLES  290
              + NAK++S
Sbjct  715   RSTNAKVDS  723



>ref|XP_009794095.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Nicotiana sylvestris]
Length=686

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/671 (62%), Positives = 519/671 (77%), Gaps = 10/671 (1%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             ++S ER+FE  E+PSW++QLT+RA   S +L  +F FIV KLNLTTG+IPSLNV+AGLLG
Sbjct  21    LDSVERIFESKEVPSWQSQLTLRAFVVSFILGVLFTFIVMKLNLTTGIIPSLNVSAGLLG  80

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT+LL K+G LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  +A QA
Sbjct  81    FFFVKTWTSLLEKSGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVVAKQA  140

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N   N+K  S+GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  141   VEANNEANIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSF  200

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K F+FSFL+G FQWFF A D CGF+SFPTFGLKAY  RFYFDF
Sbjct  201   HTPQGAKLAKKQVKALGKFFTFSFLWGFFQWFFTAGDDCGFASFPTFGLKAYENRFYFDF  260

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++N+SLL+G+I+SWGI+WP+I  ++G WYP + S +S  G+QGYKVF
Sbjct  261   SATYVGVGMICPYLINISLLLGSILSWGIMWPLIQDRKGHWYPADESPASFHGLQGYKVF  320

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF  ++  T      + R +  G  ++LPV    +  + +    FD Q
Sbjct  321   IAIAMILGDGLYNFCKVLGRTLYGLYMQFRDKNEG--AVLPVGARPSPQEPSI--SFDDQ  376

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP  VA+ GY+ +A ++II +P IF  LKWYHI V Y  AP+LAFCNAYG
Sbjct  377   RRTELFLKDQIPTWVAIVGYVGIAIISIITLPHIFHQLKWYHIVVIYIFAPVLAFCNAYG  436

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGY+
Sbjct  437   CGLTDWSLASTYGKLAIFTIGAWAGAAHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYM  496

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ+ GTAMGC ++P VFW+F KA+  LG   SAYPAPYA V+R+++++GV
Sbjct  497   TLASPRSMFISQIIGTAMGCVISPCVFWLFLKAFHSLGTPGSAYPAPYALVFRSMSIIGV  556

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL L   FFV AI IN   +++ K + KY     IP PM MAIPFYLG YF
Sbjct  557   EGFSALPKHCLTLCYIFFVGAIVINGIRDLVGKNKAKY-----IPLPMAMAIPFYLGSYF  611

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMC+GSLILFVW   NK +A  FGPAVASGLICG+ +W +P++ILAL+GVK PICMKF
Sbjct  612   AIDMCLGSLILFVWSKINKAKADAFGPAVASGLICGDGVWTLPSSILALSGVKPPICMKF  671

Query  322   LSAAANAKLES  290
             LS   N +++S
Sbjct  672   LSKKDNTRVDS  682



>gb|KDP27275.1| hypothetical protein JCGZ_21006 [Jatropha curcas]
Length=690

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/671 (62%), Positives = 515/671 (77%), Gaps = 17/671 (3%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             ES E++FE  ++P W++QLT+RA   S VL  +F+FIV KLNLTTG+IPSLNV+AGLLGF
Sbjct  31    ESVEKIFEAKQVPKWQSQLTLRAFVVSFVLGVLFSFIVMKLNLTTGIIPSLNVSAGLLGF  90

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA-  1940
               +K+WT  L KAG LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  +A Q+ 
Sbjct  91    FFVKTWTKFLQKAGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVVAKQSV  150

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
             E+GN P NVK  S+GW++ FL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSF
Sbjct  151   EAGN-PQNVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSF  209

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV  L K FSFSFL+G FQWFF A DGCGF +FPTFGLKAY Q+FYFDF
Sbjct  210   HTPQGAKLAKKQVRELGKFFSFSFLWGFFQWFFTAADGCGFVNFPTFGLKAYEQKFYFDF  269

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++N+SLL+GAI+SWGI+WP+I  ++G WY   LSSSSL G+QGYKVF
Sbjct  270   SATYVGVGMICPYLINISLLVGAILSWGIMWPLIDKRKGHWYSAELSSSSLHGLQGYKVF  329

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDG +NFF ++  T     K+  +      ++LP+       K +    +D  
Sbjct  330   IAIAMILGDGAYNFFKVLGKTLFGLYKQFNNR-----NVLPLASP----KASSPLSYDDT  380

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             +RT  FL+D IP  +AV GY+ +A ++ I VP IF  LKWY+I V Y +AP+LAFCNAYG
Sbjct  381   KRTELFLRDQIPAWLAVTGYVIIAIISAITVPRIFHQLKWYYIIVIYIIAPVLAFCNAYG  440

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  441   CGLTDWSLASTYGKLAIFTIGAWAGSSHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  500

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL SP +MF SQ+ GTAMGC ++P VFW+FYKA+  LG   S YPAPYA VYR +++LGV
Sbjct  501   TLTSPRSMFVSQIIGTAMGCVISPCVFWLFYKAFHDLGLPESEYPAPYALVYRNMSILGV  560

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL L   FF AAI IN   + + K        RFIP PM MAIPFYLGG F
Sbjct  561   EGFSALPKHCLTLCYIFFAAAIVINAIRDAVGKKRA-----RFIPLPMAMAIPFYLGGDF  615

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+WR  NK +A  FGPAVASGLICG+ +W +P++ILALAGV  PICMKF
Sbjct  616   AIDMCVGSLILFIWRKVNKGKADAFGPAVASGLICGDGIWTLPSSILALAGVNPPICMKF  675

Query  322   LSAAANAKLES  290
             LS + N K++S
Sbjct  676   LSRSQNTKVDS  686



>ref|XP_004515282.1| PREDICTED: probable metal-nicotianamine transporter YSL5-like 
[Cicer arietinum]
Length=709

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/672 (61%), Positives = 512/672 (76%), Gaps = 12/672 (2%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             +  S E+VF+ + +PSW+NQLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLL
Sbjct  45    EAASVEKVFKHLLVPSWRNQLTIRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLL  104

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  +K+WT  L K+ +LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q
Sbjct  105   GFFFVKTWTKFLEKSDMLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEHVAKQ  164

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +      ++ K   + W++AFL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINS
Sbjct  165   SSD---TSDFKDPKLVWIIAFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINS  221

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K FS SFL+G FQWF+ A DGCGF +FP+ GLKAY  RFYFD
Sbjct  222   FHTPQGAKLAKKQVKVLGKFFSLSFLWGFFQWFYTASDGCGFQAFPSLGLKAYDNRFYFD  281

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+ Y+GVGM+CP ++N+S+L+G I+SWG++WP+I T+EG WY   L  +SL+GIQGY+V
Sbjct  282   FSTLYIGVGMICPYIINISVLLGGILSWGVMWPLIETREGHWYKAGLGDASLEGIQGYRV  341

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+AIAM+LGDGL+NF  ++  T      + R+++    ++LPV  + +    +    +D 
Sbjct  342   FIAIAMILGDGLYNFLKVLSHTLWGLYNQIRNKRRD--NVLPVGADQDSSSSSPELSYDD  399

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRR   FLKD IP   AVGGY+A+AA++   +P IFP LKWY+I V Y +AP LAFCNAY
Sbjct  400   QRRKQLFLKDQIPTWFAVGGYVAIAAISTATLPHIFPQLKWYYILVIYLIAPTLAFCNAY  459

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLAS YGK+AI    +W G  +GGVLA LA+CGVMM+IVST SDLMQDFKTGY
Sbjct  460   GCGLTDWSLASTYGKLAIFTIGAWAGASHGGVLASLAACGVMMNIVSTASDLMQDFKTGY  519

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLG  686
             LTLASP +MF SQ+ GT MGC ++P VFWIFYKA+P LG   S YPAPYA VYR +A+LG
Sbjct  520   LTLASPRSMFVSQIIGTTMGCVISPCVFWIFYKAFPDLGTRKSQYPAPYAIVYRNMAILG  579

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V GFGSLP NCL L   FF AAI +N+  +++ K      V RFIP PM MAIPFYLG Y
Sbjct  580   VQGFGSLPDNCLLLCYIFFGAAIVVNLTKDLIGK------VGRFIPLPMAMAIPFYLGPY  633

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILF+W   NK +A  F PAVASGLICG+ +W +PA+ILAL GVK PICMK
Sbjct  634   FAIDMCVGSLILFIWEKINKAKADAFAPAVASGLICGDGIWTLPASILALFGVKPPICMK  693

Query  325   FLSAAANAKLES  290
             FLS A N+++++
Sbjct  694   FLSRATNSRVDT  705



>gb|KEH34580.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=696

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/672 (61%), Positives = 516/672 (77%), Gaps = 18/672 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE   +P+W+ Q+T+RA+F SL+LS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  35    SIEKGFEGKLVPTWQKQVTVRALFVSLMLSVMFTFIVMKLNLTTGIIPSLNVSAGLLGFF  94

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT LL KAG L QPF+RQENTVIQTCVVASSGIAFS G  SY+ GM+PTIA Q   
Sbjct  95    FVKTWTKLLEKAGWLTQPFSRQENTVIQTCVVASSGIAFSGGFGSYLFGMTPTIAKQIPE  154

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  N+VK L +GWM+AFL+VVSF+GLFS++PLRK+MI+ + LTYPSGTATA+LINSFHT
Sbjct  155   FDGSNDVKILGLGWMIAFLFVVSFLGLFSVLPLRKIMIVDFGLTYPSGTATAHLINSFHT  214

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
               GAKLAK+QV AL K FSFSFL+G FQWFF A D CGF++FPTFGL+AY ++FYFDFS+
Sbjct  215   SEGAKLAKKQVKALGKFFSFSFLWGFFQWFFTAGDACGFANFPTFGLEAYHRKFYFDFSA  274

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLLIG I+SW ++WP+I +K+G W+   L+ +SL G+QGYKVF++
Sbjct  275   TYVGVGMICPYIINISLLIGGILSWAVMWPLIGSKKGDWFSAELNENSLHGLQGYKVFIS  334

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE---DFDG  1223
             IAM+LGDGL+NF  ++  T +   K+   +  G  S  P          A L+    FD 
Sbjct  335   IAMILGDGLYNFVKVLSTTLIGMYKQWNKKDKGAESNDP---------NAPLQPTLSFDD  385

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             +RRT  FLKD IP+  ++ GY+ +  ++II +P IF  +KWYH+ + Y +AP LAFCNAY
Sbjct  386   KRRTEMFLKDQIPSWFSIAGYVIIGIISIITIPHIFHQIKWYHVILIYIIAPALAFCNAY  445

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY
Sbjct  446   GCGLTDWSLASTYGKLAIFTIGAWAGSANGGVLAGLAACGVMMNIVSTASDLMQDFKTGY  505

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             +TLASP +MF SQV GTAMGC ++P VFW+FY A+  LG   SAYPAPYA V+R IA++G
Sbjct  506   MTLASPKSMFVSQVIGTAMGCIISPCVFWLFYHAFGTLGQPGSAYPAPYALVFRNIAIIG  565

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             VDGF +LP NCL L I FF +AI IN   +++ K   KY   +FIP PM MAIPFY+G  
Sbjct  566   VDGFSALPKNCLRLCIAFFFSAIVINFVRDLVPK---KYS--KFIPVPMAMAIPFYIGSS  620

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILF+W+  ++ +A  FG AVASGLICG+ +W +P++ LALAGVK PICMK
Sbjct  621   FAIDMCVGSLILFIWQKVDRAKADAFGSAVASGLICGDGIWTLPSSFLALAGVKPPICMK  680

Query  325   FLSAAANAKLES  290
             FLS A NAK+++
Sbjct  681   FLSKAKNAKVDA  692



>ref|XP_006391519.1| hypothetical protein EUTSA_v10018216mg [Eutrema salsugineum]
 gb|ESQ28805.1| hypothetical protein EUTSA_v10018216mg [Eutrema salsugineum]
Length=691

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/671 (63%), Positives = 520/671 (77%), Gaps = 15/671 (2%)
 Frame = -2

Query  2293  STERVFE-KVEIPS-WKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE   E+P  W+NQLT RAM  S VLS +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  28    SVERIFEASSEVPPPWQNQLTFRAMIVSFVLSILFTFVVMKLNLTTGIIPSLNISAGLLG  87

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT LL K G LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  88    FFFVKTWTKLLHKGGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQS  147

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N P N+K   +GWM+ FL++VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  148   SEANSPLNIKNPHLGWMIGFLFIVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  207

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + D CGF++FPTFGLKAY Q+FYFDF
Sbjct  208   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGDDCGFANFPTFGLKAYKQKFYFDF  267

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLL+G+I+SWG++WP+I  ++G WY  +L SSSL G+QGYKVF
Sbjct  268   SATYVGVGMICPYLINVSLLVGSILSWGVMWPLIDAQKGKWYAADLESSSLHGLQGYKVF  327

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF  ++  T +   K+ ++       +LPV+D  +    A    +D +
Sbjct  328   IAIAMILGDGLYNFVKVLGRTVVGLYKQFKNR-----DVLPVNDRSSPTTVA--VSYDDK  380

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+ +AV GY+ +A V+II VP IFP LKWYHI   Y +AP+LAFCNAYG
Sbjct  381   RRTELFLKDRIPSWIAVTGYVIMAIVSIITVPHIFPQLKWYHILTMYIIAPVLAFCNAYG  440

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  441   CGLTDWSLASTYGKLAIFTIGAWAGAANGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  500

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G + +AYPAPYA VYR +++LGV
Sbjct  501   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQTGTAYPAPYALVYRNMSILGV  560

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL L   FF AA+ +N   +++       R  RFIP PM MAIPFY+GGYF
Sbjct  561   EGFSALPKHCLMLCYIFFAAAVIVNGVRDLVGP-----RWARFIPLPMAMAIPFYIGGYF  615

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMCVGSLILF+WR  NK +A  +  AVASGLICGE +W +P++ILALAGVK PICMKF
Sbjct  616   TIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLPSSILALAGVKPPICMKF  675

Query  322   LSAAANAKLES  290
             LS + N K++S
Sbjct  676   LSGSTNLKVDS  686



>ref|XP_002520094.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF42283.1| oligopeptide transporter, putative [Ricinus communis]
Length=694

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/674 (61%), Positives = 511/674 (76%), Gaps = 18/674 (3%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             K  S E++FE+ E+PSW+ QLT+RA   S VLS +F+FIV KLNLTTG++P LNV+AGLL
Sbjct  30    KYYSVEQIFEEQEVPSWRKQLTVRAFLVSFVLSILFSFIVMKLNLTTGILPLLNVSAGLL  89

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  +K WT+ L K  LL QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS TIA Q
Sbjct  90    GFFFLKIWTSFLSKFRLLSQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETIAKQ  149

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +    I +  K  S+ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINS
Sbjct  150   SAEDKIDH--KNPSLPWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINS  207

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K FSFSFL+G FQWF+AA DGCGF SFPTFGL+AY  +FYFD
Sbjct  208   FHTPAGAKLAKKQVKTLGKFFSFSFLWGFFQWFYAAGDGCGFGSFPTFGLEAYKNKFYFD  267

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VN+S+L+G ++SWG++WP+I T++G WYP  LSS+ + G+QGY+V
Sbjct  268   FSATYVGVGMICPYIVNISVLLGGVLSWGLMWPLIDTRKGDWYPAALSSNDIHGLQGYRV  327

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE---D  1232
             F+AIAM+LGDGL+NFF ++  T ++   + R+   G  + LP     N G+ +       
Sbjct  328   FIAIAMILGDGLYNFFKVLTRTLVALFLQLRNR--GARNFLP-----NAGQLSPRSCNFS  380

Query  1231  FDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFC  1052
             +D +RRT  FLKD IP   A+  Y+A+AA++   +P IF  LKWY+I V Y  AP LAFC
Sbjct  381   YDDERRTRLFLKDQIPTWFAIASYVAIAAISTATLPHIFHQLKWYYILVIYFFAPTLAFC  440

Query  1051  NAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFK  872
             NAYGCGLTDWSLAS YGK+AI    +W G  +GGV+AGLA+CGVMM+IV+T SDL QDFK
Sbjct  441   NAYGCGLTDWSLASTYGKLAIFTIGAWAGASHGGVIAGLAACGVMMNIVATASDLTQDFK  500

Query  871   TGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiA  695
             TGYLTL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG   S YP+P A +YR +A
Sbjct  501   TGYLTLSSPRSMFVSQVIGTAMGCIISPCVFWLFYKAFDDLGQPGSEYPSPNAVIYRNMA  560

Query  694   LLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYL  515
             +LGV GF +LP +CL L   FF AAI I++  + L K     R  RFIP PM MAIPFYL
Sbjct  561   ILGVQGFSALPKDCLLLCYVFFGAAILIDVIKDTLGK-----RWARFIPLPMAMAIPFYL  615

Query  514   GGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPI  335
             G YFAIDMCVGS ILFVW   NK +A  FGPAVASGLICG+ +W +P++ILALAGVK PI
Sbjct  616   GPYFAIDMCVGSFILFVWEKINKTKADAFGPAVASGLICGDGIWTLPSSILALAGVKPPI  675

Query  334   CMKFLSAAANAKLE  293
             CMKFLS  AN++++
Sbjct  676   CMKFLSEGANSRVD  689



>ref|XP_008645969.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Zea 
mays]
 gb|AFW72448.1| hypothetical protein ZEAMMB73_917654 [Zea mays]
Length=721

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/669 (61%), Positives = 505/669 (75%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S +L+ +FN IV KLNLTTG++PSLNV+AGLLGF 
Sbjct  56    SLERVFADKAVPSWREQLTLRAFVVSALLAVMFNVIVMKLNLTTGIVPSLNVSAGLLGFF  115

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + + G L  PFTRQENT+IQTCVV++ GIAFS G  SY+ GMS  IA QA  
Sbjct  116   FVRMWTAAVERMGFLCHPFTRQENTIIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATE  175

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 NN+K   +GWM+ FL++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  176   AKDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  235

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSF +G FQWF+ A D CGF +FPT GL+AY  RF+FDFS 
Sbjct  236   PEGAKLAKKQVKTLGKYFMFSFFWGFFQWFYTAGDECGFKNFPTLGLEAYNNRFFFDFSP  295

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWG++WP+I  K+G WY  ++  SSL G+Q Y VF++
Sbjct  296   TYVGVGMICPYIVNVSVLLGGILSWGVMWPLIAKKKGSWYLASVDDSSLHGLQAYMVFIS  355

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   +    G   +LPV D  +     +   FD +RR
Sbjct  356   IALILGDGLYNFIKVLIRTIAGFISMVQQNSKG---MLPVSDNGSSMSATEALSFDDERR  412

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FL+D +P +VA GGY+ +AA++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  413   TEIFLRDQVPKSVAYGGYVVVAAISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSG  472

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  +GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  473   LTDWSLASTYGKLAIFVFGAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  532

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT MGC + P VFW+FYKA+  +G+S + YPAPYA VYR +A+LGVDG
Sbjct  533   ASPRSMFVSQVIGTGMGCVIGPCVFWLFYKAFGDIGESGTEYPAPYAIVYRNMAILGVDG  592

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             FGSLP NCL L   FF AAIAIN+  ++     T +RV RFIP PM MAIPFY+G YFAI
Sbjct  593   FGSLPENCLTLCYIFFAAAIAINLARDL-----TPHRVSRFIPLPMAMAIPFYIGSYFAI  647

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS+ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA V+ PICMKFLS
Sbjct  648   DMFLGSMILFVWERLNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVQPPICMKFLS  707

Query  316   AAANAKLES  290
              + NAK++S
Sbjct  708   RSTNAKVDS  716



>ref|XP_010666835.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Beta 
vulgaris subsp. vulgaris]
Length=672

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/659 (63%), Positives = 509/659 (77%), Gaps = 10/659 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE  E+P W+ QLT+RA   S +LS +F FIV KLNLTTG+IPSLN++AGLLGF 
Sbjct  21    SIEKNFEATEVPPWQQQLTLRAFVVSFLLSILFTFIVMKLNLTTGIIPSLNISAGLLGFF  80

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K WT LL K+G LKQPFTRQENTVIQTC+VASSGIAFS G ASY+LGMS  IA   E 
Sbjct  81    FVKCWTKLLEKSGFLKQPFTRQENTVIQTCIVASSGIAFSGGAASYVLGMSERIANLGEK  140

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
               + +  K  S+GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  141   AYLLDT-KNPSLGWMIGFLFVVSFIGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  199

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA +AK++V  L K FSFSFL+G FQWFF   D CGF+SFPTFGLKAY Q+FYFDFS+
Sbjct  200   PEGAIIAKKKVKVLGKFFSFSFLWGFFQWFFTGGDDCGFASFPTFGLKAYKQKFYFDFSA  259

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+C  + N+SLL+GAI+SWG++WP+I T++G WY  +LS +SL G+QGYK+F+A
Sbjct  260   TYVGVGMICSHLTNISLLLGAILSWGVMWPLIGTRKGRWYDASLSDNSLHGLQGYKIFIA  319

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  + + + +      + + +G  ++LP  D  +  + +  + FD QRR
Sbjct  320   IAIILGDGLYNFAKVSLRSMVGLYLEYKKKNSG--AILPCTDR-DSTEVSPDQLFDDQRR  376

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKDSIPN  AV GY+A+A +AI  +P I   LKWYH+ + Y +AP LAFCNAYGCG
Sbjct  377   TQYFLKDSIPNWAAVAGYVAIAVIAIAVLPHIIHQLKWYHVVILYIVAPPLAFCNAYGCG  436

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI I   W G  +GG++AGLA+CGVMM+IVST SDL QDFKTGY+TL
Sbjct  437   LTDWSLASTYGKLAIFIIGGWAGASHGGIVAGLAACGVMMNIVSTASDLTQDFKTGYMTL  496

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQ+ GTAMGC L+P VFWIFYKA+P LG   S YPAPYA++YR IALLGV+G
Sbjct  497   ASPRSMFVSQIIGTAMGCVLSPCVFWIFYKAFPNLGLPESRYPAPYASLYRNIALLGVEG  556

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP NC+ L I FF  AI IN   + L K   KY   RFIP PM MAIPFY+GGYFAI
Sbjct  557   LSSLPKNCVTLCIIFFFGAIVINGLKDFLGK---KYA--RFIPIPMAMAIPFYIGGYFAI  611

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             DMCVGSLILF+W++KNK +A  F PAVASGLICG+ +W +P++ILALAG+  PICMKF+
Sbjct  612   DMCVGSLILFLWQYKNKAEADAFSPAVASGLICGDGIWTLPSSILALAGINPPICMKFV  670



>ref|XP_009615007.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Nicotiana tomentosiformis]
Length=689

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/671 (62%), Positives = 517/671 (77%), Gaps = 10/671 (1%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             ++S ER+FE  E+PSW++QLT+RA   S +L  +F FIV KLNLTTG+IPSLNV+AGLLG
Sbjct  24    LDSVERIFESKEVPSWQSQLTLRAFVVSFILGVLFTFIVMKLNLTTGIIPSLNVSAGLLG  83

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT LL K+G LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  +A QA
Sbjct  84    FFFVKTWTRLLEKSGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEVVAKQA  143

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N   N+K  S+GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  144   VEANNAANIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSF  203

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K F+FSFL+G FQWFF A D CGF+SFPTFGLKAY  RFYFDF
Sbjct  204   HTPQGAKLAKKQVKALGKFFTFSFLWGFFQWFFTAGDDCGFASFPTFGLKAYENRFYFDF  263

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++N+SLL+G+I+SWGI+WP+I  ++G WYP + S +S  G+QGYKVF
Sbjct  264   SATYVGVGMICPYLINISLLLGSILSWGIMWPLIQDRKGHWYPADESPASFHGLQGYKVF  323

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF  ++  T      + R +  G  ++LPV    +  + +    FD Q
Sbjct  324   IAIAMILGDGLYNFCKVLGRTLYGLYMQLRIKNEG--AVLPVGARPSPPEPSM--SFDDQ  379

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP  VA+ GY+ +A ++II +P IF  LKWYHI V Y  AP+LAFCNAYG
Sbjct  380   RRTELFLKDQIPTWVAIVGYVGIAVISIITLPHIFHQLKWYHIIVIYIFAPVLAFCNAYG  439

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGY+
Sbjct  440   CGLTDWSLASTYGKLAIFTIGAWAGAAHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYM  499

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ+ GTAMGC ++P VFW+F KA+  LG   SAYPAPYA V+R+++++GV
Sbjct  500   TLASPRSMFISQIIGTAMGCVISPCVFWLFLKAFHSLGTPGSAYPAPYALVFRSMSIIGV  559

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL L   FFV AI IN   +++ K + KY     IP PM MAIPFYLG YF
Sbjct  560   EGFSALPKHCLTLCYIFFVGAIVINGIRDLVGKNKAKY-----IPLPMAMAIPFYLGSYF  614

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMC+GSLILFVW   NK +A  FGPAVASGLICG+ +W +P++ILALAGVK PICMKF
Sbjct  615   TIDMCLGSLILFVWSKINKAKADAFGPAVASGLICGDGVWTLPSSILALAGVKPPICMKF  674

Query  322   LSAAANAKLES  290
             LS   N +++S
Sbjct  675   LSRKDNTRVDS  685



>ref|XP_004500424.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cicer arietinum]
Length=670

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/669 (62%), Positives = 512/669 (77%), Gaps = 12/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER FE   +P+W+ Q+T+RA+F S+VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  9     SVERGFEGKSVPTWQKQVTVRAIFVSMVLSVLFSFIVMKLNLTTGIIPSLNVSAGLLGFF  68

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT LL K+GLL QPFTRQENTVIQTCVVA+SGIAFS G  SY+  MSP IA Q+  
Sbjct  69    FVKTWTKLLAKSGLLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFAMSPAIADQSPD  128

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +   + K+  +GWM++FL+VVSF+GLFS+VPLRK+MI+ ++LTYPSGTATA+LINSFHT
Sbjct  129   ASTAIDTKSPGLGWMISFLFVVSFLGLFSVVPLRKIMIVDFRLTYPSGTATAHLINSFHT  188

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
               GAKLAK+QV AL K FSFSFL+G FQWFF A D CGF+SFP FGL+AY + FYFDFS+
Sbjct  189   TEGAKLAKKQVKALGKFFSFSFLWGFFQWFFTAGDACGFASFPAFGLEAYQKMFYFDFSA  248

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLLIG I+SWG++WP+I  K+G WY  +L  SSL G+QGYKVF+A
Sbjct  249   TYVGVGMICPYIINISLLIGGILSWGVMWPLIDAKKGDWYSADLKQSSLHGLQGYKVFIA  308

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T      +   +  G  S  P     N    + L  +D +RR
Sbjct  309   IAMILGDGLYNFVKVLGRTVFGLYNQFNKKDIGAPSNDP-----NAPMPSTLS-YDDKRR  362

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   A+ GY+ +A ++I+ +P IF  LKWY+I   Y +AP LAFCNAYGCG
Sbjct  363   TEMFLKDQIPPWFAIAGYVTIAIISIVTLPHIFHQLKWYYIVCIYIIAPALAFCNAYGCG  422

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    SW G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+TL
Sbjct  423   LTDWSLASTYGKLAIFTIGSWAGASNGGVLAGLAACGVMMNIVSTASDLMQDFKTGYMTL  482

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   SAYPAPYA VYR +A+LGVDG
Sbjct  483   ASPKSMFVSQVIGTAMGCIISPCVFWLFYKAFVTLGHPGSAYPAPYALVYRNMAILGVDG  542

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP NCL L   FFV A+ IN+  ++  K     +  +FIP PM MAIPFY+G YFAI
Sbjct  543   FSALPKNCLVLCCVFFVGAMIINLVRDLAGK-----KWAKFIPVPMAMAIPFYIGSYFAI  597

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILF+W+  +K +A  FG AVASGLICG+ +W +P++ LALAGV+ PICMKFLS
Sbjct  598   DMCVGSLILFIWQRVDKAKADAFGSAVASGLICGDGIWSLPSSFLALAGVQPPICMKFLS  657

Query  316   AAANAKLES  290
              AANAK+++
Sbjct  658   RAANAKVDA  666



>ref|XP_011046072.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Populus euphratica]
Length=701

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/670 (62%), Positives = 511/670 (76%), Gaps = 14/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+NQLT+RA   S VLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  38    SVERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFF  97

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  L K+GLL+QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS T+A Q   
Sbjct  98    FIKTWTKFLEKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDTVAKQLTE  157

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +  K  S+ WM+ FL+VVSF+GLFS VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  158   DS--DAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHT  215

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A DGCGF+ FP+ GLKA+  +F+FDFS+
Sbjct  216   PAGAKLAKKQVRVLGKFFSFSFLWGFFQWFYTAGDGCGFAEFPSLGLKAHENKFFFDFSA  275

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I TK+G WYP +L   SL G+QGYKVF+A
Sbjct  276   TYVGVGMICPYIINISVLLGGILSWGLMWPLIDTKKGDWYPADLKPGSLHGLQGYKVFIA  335

Query  1393  IAMMLGDGLFNFFYMMVVT-GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
              A++LGDGL++FF ++  T    F + R  +  G    LPV D  +  + +++  +D QR
Sbjct  336   TALILGDGLYSFFKVLSRTLAALFCQLRGRDATGA---LPVADR-SSPETSKIS-YDEQR  390

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT   LKD IP   AV GY+ +AA++   VP IFP LKWY+I V Y  AP LAFCNAYGC
Sbjct  391   RTQLLLKDQIPTWFAVAGYVTIAAISTATVPRIFPELKWYYILVIYIFAPALAFCNAYGC  450

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YG +AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLT
Sbjct  451   GLTDWSLASTYGTLAIFVIGAWAGASHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYLT  510

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVD  680
             L+SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG   S YPAPYA V+R +A+LGV+
Sbjct  511   LSSPRSMFVSQLIGTAMGCMISPCVFWLFFKAFKDLGTPGSEYPAPYATVFRNMAILGVE  570

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NCL L   FF AAI IN+  +VL K        R IPNPM MAIPFY+G YFA
Sbjct  571   GFSSLPKNCLYLCYWFFGAAILINLIKDVLGKKRA-----RLIPNPMAMAIPFYIGSYFA  625

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMC+GSLILF+W   +K +A  FGPAVASGLICG+ +W +P++ILALAGVK PICMKFL
Sbjct  626   IDMCIGSLILFIWENIDKAKADAFGPAVASGLICGDGIWTLPSSILALAGVKPPICMKFL  685

Query  319   SAAANAKLES  290
             S   NAK+++
Sbjct  686   SRRTNAKVDA  695



>ref|XP_010940749.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Elaeis 
guineensis]
Length=690

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/667 (61%), Positives = 506/667 (76%), Gaps = 6/667 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSW +QLT RA F S +L    +FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  16    SMEQLFESKEVPSWSDQLTFRAFFVSSILGFFLSFIVMKLNLTTGIIPSLNVSAGLLGFF  75

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT +L +A  L QPFTRQENTVIQTCVVA +G+AFS G  SY L MS T+A     
Sbjct  76    LVKTWTKILQRADFLMQPFTRQENTVIQTCVVACAGVAFSGGFGSYFLAMSETVANDFNE  135

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   + K  S GWM+AFL++VSF+GLFS+VPLRK+MIL+YKLTYPSG ATAYLINSFHT
Sbjct  136   ANTKVDTKEPSFGWMVAFLFIVSFIGLFSVVPLRKIMILRYKLTYPSGMATAYLINSFHT  195

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA LA++QV+ LFK FS SFL+  FQWF+ A + CGF +FPT GL+AY  +FYFDFS+
Sbjct  196   PQGALLARKQVSYLFKSFSASFLWSFFQWFYTAGENCGFKAFPTLGLEAYKDKFYFDFST  255

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGMLCP M+N SLL+GA+ISWGI+WP I +K+G WY   + S+SL G+ GY+VF++
Sbjct  256   TYVGVGMLCPYMINASLLVGALISWGILWPYIESKKGDWYSETIPSTSLSGLNGYQVFIS  315

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGLF+FF +++ T      +R+ EK   A+  P   E N+     L  FD +RR
Sbjct  316   IAMILGDGLFHFFSVLLRTTYDMYNKRQREKE--ATTTPF-SELNRTPDPALS-FDDRRR  371

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T+ FLKD+IP  VA+ GY+ LA ++IIA+P I P LK YHI VAY +AP+LAFCN YGCG
Sbjct  372   TNVFLKDAIPTRVAIAGYLILATISIIAIPLIIPQLKSYHIIVAYLIAPVLAFCNCYGCG  431

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDW+LA++Y K+AI IF +WVG D+GGVLAGLA+CGV M IVST SDLMQDFKTGYLTL
Sbjct  432   LTDWNLATSYAKLAIFIFGAWVGLDDGGVLAGLAACGVTMGIVSTASDLMQDFKTGYLTL  491

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGF  674
             ASP +M  SQ  GTAMGC ++ LVFWIFY A+PLG  +S YPAPYA VYR IALLGV GF
Sbjct  492   ASPRSMIISQSIGTAMGCVISTLVFWIFYNAFPLGAQDSEYPAPYAKVYRGIALLGVKGF  551

Query  673   GSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAID  494
              +LP NC++  +GFF  A AIN   EV       + +Y ++P+ M MAIPFYLG  FAID
Sbjct  552   DTLPKNCISFCVGFFFLAFAINAVREVAS--NKGWWIYNYVPSAMGMAIPFYLGSSFAID  609

Query  493   MCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSA  314
             MCVGSLI+F+W   +++ AK FGPAVASG+ CG+ +W +PA++LAL  V+ PICMKFLS 
Sbjct  610   MCVGSLIMFLWERTDQRHAKAFGPAVASGMTCGDGIWSLPASLLALWDVRPPICMKFLSR  669

Query  313   AANAKLE  293
             A NAK++
Sbjct  670   ADNAKVD  676



>ref|XP_011046074.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X4 [Populus euphratica]
Length=700

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/670 (62%), Positives = 511/670 (76%), Gaps = 14/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER FE  E+PSW+NQLT+RA   S VLS +F  IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  37    SVERKFENQEVPSWRNQLTLRAFVLSFVLSILFTVIVMKLNLTTGIIPSLNVSAGLLGFF  96

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  L K+GLLKQPFTRQENTVIQTCVVASSGIAF+ G   Y+LGMS T+A Q+  
Sbjct  97    FIKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFNGGFGHYLLGMSETVARQSTE  156

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +  K  S+ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  157   DS--DAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAHLINSFHT  214

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A DGCGF+ FP+ GLKA+  +F+FDFS+
Sbjct  215   PAGAKLAKKQVRVLGKFFSFSFLWGFFQWFYTAGDGCGFAEFPSLGLKAHENKFFFDFSA  274

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I TK+G WYP +L   SL G+QGYKVF+A
Sbjct  275   TYVGVGMICPYIINISVLLGGILSWGLMWPLIDTKKGDWYPADLKPGSLHGLQGYKVFIA  334

Query  1393  IAMMLGDGLFNFFYMMVVT-GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
              A++LGDGL++FF ++  T    F + R  +  G    LPV D  +  + +++  +D QR
Sbjct  335   TALILGDGLYSFFKVLSRTLAALFCQLRGRDATGA---LPVADR-SSPETSKIS-YDEQR  389

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT   LKD IP   AV GY+ +AA++   VP IFP LKWY+I V Y  AP LAFCNAYGC
Sbjct  390   RTQLLLKDQIPTWFAVAGYVTIAAISTATVPRIFPELKWYYILVIYIFAPALAFCNAYGC  449

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YG +AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLT
Sbjct  450   GLTDWSLASTYGTLAIFVIGAWAGASHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYLT  509

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVD  680
             L+SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG   S YPAPYA V+R +A+LGV+
Sbjct  510   LSSPRSMFVSQLIGTAMGCMISPCVFWLFFKAFKDLGTPGSEYPAPYATVFRNMAILGVE  569

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NCL L   FF AAI IN+  +VL K        R IPNPM MAIPFY+G YFA
Sbjct  570   GFSSLPKNCLYLCYWFFGAAILINLIKDVLGKKRA-----RLIPNPMAMAIPFYIGSYFA  624

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMC+GSLILF+W   +K +A  FGPAVASGLICG+ +W +P++ILALAGVK PICMKFL
Sbjct  625   IDMCIGSLILFIWENIDKAKADAFGPAVASGLICGDGIWTLPSSILALAGVKPPICMKFL  684

Query  319   SAAANAKLES  290
             S   NAK+++
Sbjct  685   SRRTNAKVDA  694



>ref|XP_008240337.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Prunus 
mume]
Length=735

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/669 (62%), Positives = 512/669 (77%), Gaps = 10/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FEK  +PSWK QLT+RA F SLVLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  68    SVERIFEKQTVPSWKEQLTVRAFFISLVLSVLFSVIVMKLNLTTGIIPSLNVSAGLLGFF  127

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +++WT  L + GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+  
Sbjct  128   FVRTWTKFLDRCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSARIAQQSAD  187

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +   ++K   + W + FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  188   RST-RDIKEPGLLWFIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  246

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A   CGF+SFPT GLKAY  +F+FDFS+
Sbjct  247   PQGAKLAKKQVKELGKFFSFSFLWGFFQWFYTAGSDCGFASFPTLGLKAYQNQFFFDFSA  306

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+S+L+G I+SWG++WP+I  + G WY   LS  S+ G+QGYKVF+A
Sbjct  307   TYVGVGMICPYIVNISVLLGGILSWGLMWPLIENRSGDWYSKELSPKSMNGLQGYKVFIA  366

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T ++   + R++     ++LP++D+ +    + L  +D QRR
Sbjct  367   IAMILGDGLYNFLKVLSRTLIALQSQLRAKDVN--NILPIEDQVSPAVTSALS-YDDQRR  423

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   AVGGY+A+AAV+I  VP IFP LKWY+I V Y  AP LAFCNAYGCG
Sbjct  424   TQLFLKDQIPAWFAVGGYVAIAAVSIATVPHIFPQLKWYYILVIYLFAPALAFCNAYGCG  483

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  484   LTDWSLASTYGKVAIFMIGAWAGSAHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  543

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   SAYPAP+A VYR +A+LGV+G
Sbjct  544   ASPRSMFVSQVIGTAMGCVISPCVFWLFYKAFTDLGTPKSAYPAPFAVVYRNMAILGVEG  603

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL L   FF AAI  N+  + + K        RF+P PM MAIPFYLG YFAI
Sbjct  604   FKSLPKHCLLLCAVFFGAAILTNVIKDCIGKKRA-----RFVPLPMAMAIPFYLGSYFAI  658

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLI+F+W   NK +A  F PAVASGLICG+ +W +PA+ILALAGVK PICM+FLS
Sbjct  659   DMCIGSLIVFLWERVNKAKADAFVPAVASGLICGDGVWTLPASILALAGVKPPICMRFLS  718

Query  316   AAANAKLES  290
              A N ++ +
Sbjct  719   RAENDRVTT  727



>ref|XP_006653608.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Oryza brachyantha]
Length=693

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/669 (61%), Positives = 504/669 (75%), Gaps = 11/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S  LS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  31    SVERVFADRPVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFF  90

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + + GLL+QPFTRQENTVIQTCVVA+  IAFS G  +Y+ GMS TIA QA  
Sbjct  91    FVRLWTAAIERLGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATE  150

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   NVK   IGWM+ FL++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  151   ANDAQNVKNPHIGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  210

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSF++G FQWF+   DGCGF +FP+ GL+AY  RFYFDFS 
Sbjct  211   PEGAKLAKKQVKTLGKFFLFSFVWGFFQWFYTGGDGCGFQNFPSLGLQAYKNRFYFDFSP  270

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN S+L+G I+SWG++WP+I  K+G WY  +L  +SL G+QGY+VF++
Sbjct  271   TYVGVGMICPHIVNASVLLGGILSWGVMWPLIRNKKGSWYSASLKETSLHGLQGYRVFIS  330

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   +  KN   S LPV ++ +     +   FD +RR
Sbjct  331   IALILGDGLYNFVKVLIRTTTGFVAMMK--KN---STLPVSNDGSPMVTGEAASFDDERR  385

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP  VA GGY+A+AAV+I A+P IFP LKWY+I VAY  AP+LAFCNAYG G
Sbjct  386   TELFLKDQIPKTVAYGGYVAVAAVSIGALPQIFPQLKWYYILVAYVFAPVLAFCNAYGAG  445

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI IF +W G   GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  446   LTDWSLASTYGKLAIFIFGAWAGASQGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  505

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT+MGC + P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVDG
Sbjct  506   ASPRSMFISQVIGTSMGCVIAPCVFWLFYKAFTDIGVSGTEYPAPYAIVYRNMAILGVDG  565

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL L   FF AAIAIN+  ++        +V RFIP PM MAIPFY+G YFAI
Sbjct  566   FSSLPKHCLTLCYIFFAAAIAINLARDL-----APPKVARFIPLPMAMAIPFYIGSYFAI  620

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G++I+FVW   N+ +A  F PAVASGLICG+ +W +P +ILALA VK PICMKFLS
Sbjct  621   DMFIGTVIVFVWGMVNRAKADAFAPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLS  680

Query  316   AAANAKLES  290
              + NAK+  
Sbjct  681   RSVNAKVND  689



>gb|EMT06635.1| Putative metal-nicotianamine transporter YSL14 [Aegilops tauschii]
Length=711

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/668 (61%), Positives = 503/668 (75%), Gaps = 11/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+VF    +PSW+ QLT+RA+  S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  49    SVEQVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  108

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT    + GL+  PFTRQENTVIQTCVV++ GIAFS G  SY+ GMS TIA QA  
Sbjct  109   FVRLWTNAFERMGLVGHPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIAKQATE  168

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N P N+K   +GWM+ FL++VSF+G+F++VP+RK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  169   ANDPWNIKEPHLGWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHT  228

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L + F  SF +G FQWFF+  D CGF +FPT GL+AY  RFYFDFS 
Sbjct  229   PEGAKLAKKQVKILGRYFMVSFFWGFFQWFFSGGDDCGFKNFPTLGLEAYKNRFYFDFSP  288

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TY+GVGM+CP +VNVS+++G IISWGI+WP+I  K+G WYP +L  SSL G+Q Y+VF++
Sbjct  289   TYIGVGMICPHIVNVSVMLGGIISWGIMWPLIGKKKGSWYPASLPESSLHGLQAYRVFIS  348

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+      KN  A +LPV D  N    A+   FD +RR
Sbjct  349   IALILGDGLYNFVKVLIRTIAGFIS--MVHKNSKA-MLPVSD--NGSPTAEAMSFDDERR  403

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP AVA GGY  +A+++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  404   TELFLKDQIPMAVAYGGYAVVASISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSG  463

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  NGGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  464   LTDWSLASTYGKLAIFVFGAWAGLANGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  523

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT+MGC ++P VFW+FYKA+  +G S S YPAPYA VYR +A+LGVDG
Sbjct  524   ASPKSMFISQVIGTSMGCVISPCVFWLFYKAFSDIGISGSEYPAPYAIVYRNMAILGVDG  583

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP NCL L   FF AAIAIN+  ++     T ++  RFIP PM MAIPFY+G YFAI
Sbjct  584   FNTLPKNCLTLCYIFFAAAIAINLIRDL-----TPHKFSRFIPLPMAMAIPFYIGSYFAI  638

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA V  PICMKFL+
Sbjct  639   DMFLGSFILFVWEKVNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVNPPICMKFLT  698

Query  316   AAANAKLE  293
                N K++
Sbjct  699   RGDNVKVD  706



>ref|XP_009383038.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=688

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/669 (60%), Positives = 501/669 (75%), Gaps = 12/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVFE   +P+W+ QLT+RA   S  L+ +F+ IV KLNLTTG+IPSLNVAAGLLGF 
Sbjct  25    SVERVFEGQRVPAWREQLTVRAFVVSFFLAVMFSVIVMKLNLTTGIIPSLNVAAGLLGFF  84

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K WT  L   GLL+ PFTRQENTVIQTCVVA+ G+AFS G  SY+ GMS  +AAQA  
Sbjct  85    FVKLWTKGLESTGLLRTPFTRQENTVIQTCVVAAYGLAFSGGYGSYLFGMSSRVAAQATD  144

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +   N+K   +GWM+ F++VVSF+GLFS+VPLRK+M++ YKL YPSGTATAYLIN FHT
Sbjct  145   DDDSQNIKDPRLGWMIGFMFVVSFLGLFSVVPLRKIMVIDYKLIYPSGTATAYLINGFHT  204

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P G KLAKQQV  L K F+ SFL+G FQWF+ A DGCGF+SFP+ GL+A+  +F+FDFS+
Sbjct  205   PQGEKLAKQQVRTLGKYFAGSFLWGFFQWFYTAGDGCGFASFPSLGLQAFDHKFFFDFSA  264

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+GAI+SWG++WP+I  ++G WY   L  S+L G+QGY+VF+ 
Sbjct  265   TYVGVGMICPYLVNVSVLLGAILSWGVMWPLIENQKGNWYSATLPPSNLHGLQGYRVFIG  324

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T  +F+   R     PA  LPV D+    +      FD +RR
Sbjct  325   IAMILGDGLYNFLKVLHRTTSAFITAARKR---PAGTLPVSDD---DRPTSALSFDDERR  378

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP  +A GGY+A+A V+I+ +P IF PLKWY + VAY +APILAFCNAYGCG
Sbjct  379   TEVFLKDQIPRWIAYGGYVAVAIVSIVTLPHIFHPLKWYFVLVAYVIAPILAFCNAYGCG  438

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI IF +WVG  NGGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  439   LTDWSLASTYGKLAIFIFGAWVGAGNGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  498

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT MGC + P VFW+F+ AY  +G   S YPAPYA +YR +A+LGV+G
Sbjct  499   ASPRSMFVSQVIGTCMGCVIAPCVFWLFFNAYKDIGTPESQYPAPYAIIYRNMAILGVEG  558

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL L   FF  AI IN+  ++  K     +V RFIP PM MAIPFY+G YFAI
Sbjct  559   FSSLPKHCLTLCYVFFALAIVINLARDLAGK-----KVARFIPIPMAMAIPFYIGSYFAI  613

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS+IL+VW  +NK +A  F PA+ASGLICG+ +W +P A+LALA VK PICMKFLS
Sbjct  614   DMFIGSVILYVWERRNKAKADAFAPAMASGLICGDGIWTLPQAVLALAQVKPPICMKFLS  673

Query  316   AAANAKLES  290
                N K+++
Sbjct  674   RTMNDKVDA  682



>ref|XP_007210334.1| hypothetical protein PRUPE_ppa002002mg [Prunus persica]
 gb|EMJ11533.1| hypothetical protein PRUPE_ppa002002mg [Prunus persica]
Length=731

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/669 (62%), Positives = 512/669 (77%), Gaps = 10/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE+  +PSWK QLT+RA F SLVLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  66    SVERIFEQQTVPSWKEQLTVRAFFISLVLSVLFSLIVMKLNLTTGIIPSLNVSAGLLGFF  125

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +++WT  L + GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+  
Sbjct  126   FVRTWTKFLDRCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSARIAQQSAD  185

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +++K   + W + FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  186   SST-SDIKEPGLLWFIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  244

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A   CGF+SFPT GLKAY  +F+FDFS+
Sbjct  245   PQGAKLAKKQVKELGKFFSFSFLWGFFQWFYTAGSDCGFASFPTLGLKAYQNQFFFDFSA  304

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+S+L+G I+SWG++WP+I  + G WY   LS  S+ G+QGYKVF+A
Sbjct  305   TYVGVGMICPYIVNISVLLGGILSWGLMWPLIENRSGDWYSKELSPKSMNGLQGYKVFIA  364

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T ++   + R++     ++LP++D+ +    + L  +D QRR
Sbjct  365   IAMILGDGLYNFLKVLSRTLIALQSQLRAKDVN--NILPIEDQVSPAVTSALS-YDDQRR  421

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   AVGGY+A+AAV+I  VP IFP LKWY+I V Y  AP LAFCNAYGCG
Sbjct  422   TQLFLKDQIPAWFAVGGYVAIAAVSIATVPHIFPQLKWYYILVIYLFAPSLAFCNAYGCG  481

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  482   LTDWSLASTYGKVAIFMIGAWAGSAHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  541

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   SAYPAP A VYR +A+LGV+G
Sbjct  542   ASPRSMFVSQVIGTAMGCVISPCVFWLFYKAFTDLGTPKSAYPAPLAVVYRNMAILGVEG  601

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL L   FF AAI  N+  + + K        RF+P PM MAIPFYLG YFAI
Sbjct  602   FKSLPKHCLLLCTVFFGAAILTNVIKDCIGKKRA-----RFVPLPMAMAIPFYLGSYFAI  656

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLI+F+W   NK +A  F PAVASGLICG+ +W +PA+IL+LAGVK PICM+FLS
Sbjct  657   DMCIGSLIVFLWERVNKAKADAFVPAVASGLICGDGVWTLPASILSLAGVKPPICMRFLS  716

Query  316   AAANAKLES  290
              A N ++ +
Sbjct  717   RAENDRVTT  725



>ref|XP_002886962.1| hypothetical protein ARALYDRAFT_475677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63221.1| hypothetical protein ARALYDRAFT_475677 [Arabidopsis lyrata subsp. 
lyrata]
Length=693

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/671 (63%), Positives = 515/671 (77%), Gaps = 15/671 (2%)
 Frame = -2

Query  2293  STERVFEKV-EIPS-WKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE   EIP  W+ QLT RA+  S +L+ +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  30    SVERIFEASHEIPPPWQKQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLG  89

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT +L KAG LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  90    FFFVKTWTKILNKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQS  149

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N P N+K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  150   AEANTPMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  209

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + D CGF++FPTFGLKAY  +FYFDF
Sbjct  210   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGDDCGFANFPTFGLKAYENKFYFDF  269

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLLIG+I+SWGI+WP+I  ++G WY  +L SSSL G+QGYKVF
Sbjct  270   SATYVGVGMICPYLINVSLLIGSILSWGIMWPLIGAQKGKWYSADLESSSLHGLQGYKVF  329

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF  ++  T     K+ +++      +LPV+D            +D +
Sbjct  330   IAIAMILGDGLYNFIKVLGRTVFGLYKQFKNK-----DVLPVNDR--SSPATVTISYDDK  382

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+  AV GY+ +A V+II VP IF  LKWYHI   Y +AP+LAFCNAYG
Sbjct  383   RRTELFLKDRIPSWFAVTGYVVMAIVSIITVPHIFHQLKWYHILTMYIIAPVLAFCNAYG  442

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  443   CGLTDWSLASTYGKLAIFTIGAWAGAANGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  502

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G + +AYPAPYA VYR +++LGV
Sbjct  503   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQTGTAYPAPYALVYRNMSILGV  562

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL L   FF AA+ +N   + +       R  RFIP PM MAIPFY+GGYF
Sbjct  563   EGFSALPKHCLMLCYIFFAAAVIVNGVRDAVGP-----RWARFIPLPMAMAIPFYIGGYF  617

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMCVGSLILF+WR  NK +A  +  AVASGLICGE +W +P++ILALAGVK PICMKF
Sbjct  618   TIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLPSSILALAGVKPPICMKF  677

Query  322   LSAAANAKLES  290
             LS AAN K++S
Sbjct  678   LSTAANLKVDS  688



>dbj|BAJ92335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/668 (60%), Positives = 505/668 (76%), Gaps = 11/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+VF    +PSW+ QLT+RA+  S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  49    SVEQVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  108

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT+   + GL+ QPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS TIA QA  
Sbjct  109   FVRLWTSAFERMGLIGQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIAKQATE  168

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GWM+ FL++VSF+G+F++VP+RK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  169   ANDAWNIKEPHLGWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHT  228

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L + F  SF +G FQWFF+  D CGF +FPT GL+AY  RFYFDFS 
Sbjct  229   PEGAKLAKKQVKILGRYFMVSFFWGFFQWFFSGGDDCGFKNFPTLGLEAYKNRFYFDFSP  288

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TY+GVGM+CP +VNVS+++G IISWGI+WP+I  K+G WYP +L  SSL G+Q Y+VF++
Sbjct  289   TYIGVGMICPHIVNVSVILGGIISWGIMWPLIGKKKGSWYPASLPESSLHGLQAYRVFIS  348

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+     +KN  A +LPV D  N    A+   FD +RR
Sbjct  349   IALILGDGLYNFVKVLIRTIAGFIS--MVQKNSKA-MLPVSD--NGSPTAEAMSFDDERR  403

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP AVA GGY  +A+++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  404   TELFLKDQIPMAVAYGGYAVVASISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSG  463

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  NGGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  464   LTDWSLASTYGKLAIFVFGAWAGLANGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  523

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT+MGC ++P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVDG
Sbjct  524   ASPKSMFISQVIGTSMGCVISPCVFWLFYKAFSDIGTSGTEYPAPYAIVYRNMAILGVDG  583

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP NC+ L   FF AAIAIN+  ++     T ++  RFIP PM MAIPFY+G YFAI
Sbjct  584   FNTLPANCMTLCYIFFAAAIAINLIRDL-----TPHKFSRFIPLPMAMAIPFYIGSYFAI  638

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA V  PICMKFL+
Sbjct  639   DMFLGSFILFVWEKVNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVNPPICMKFLT  698

Query  316   AAANAKLE  293
                N K++
Sbjct  699   RGDNVKVD  706



>dbj|BAJ89062.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/668 (61%), Positives = 506/668 (76%), Gaps = 11/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+VF    +PSW+ QLT+RA+  S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  49    SVEQVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  108

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT+   + GL+ QPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS TIA QA  
Sbjct  109   FVRLWTSAFERMGLIGQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIAKQATE  168

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GWM+ FL++VSF+G+F++VP+RK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  169   ANDAWNIKEPHLGWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHT  228

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L + F  SF +G FQWFF+  D CGF +FPT GL+AY  RFYFDFS 
Sbjct  229   PEGAKLAKKQVKILGRYFMVSFFWGFFQWFFSGGDDCGFKNFPTLGLEAYKNRFYFDFSP  288

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TY+GVGM+CP +VNVS+++G IISWGI+WP+I  K+G WYP +L  SSL G+Q Y+VF++
Sbjct  289   TYIGVGMICPHIVNVSVILGGIISWGIMWPLIGKKKGSWYPASLPESSLHGLQAYRVFIS  348

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+     +KN  A +LPV D  N    A+   FD +RR
Sbjct  349   IALILGDGLYNFVKVLIRTIAGFIS--MVQKNSKA-MLPVSD--NGSPTAEAMSFDDERR  403

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP AVA GGY A+A+++I  +P IFP LKWY+I VAY +AP+LAFCNAYG G
Sbjct  404   TELFLKDQIPMAVAYGGYAAVASISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGNG  463

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +F +W G  NGGVL GLA+CGVMMSIVST SDLMQDFKTGYLTL
Sbjct  464   LTDWSLASTYGKLAIFVFGAWAGLANGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTL  523

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT+MGC ++P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVDG
Sbjct  524   ASPKSMFISQVIGTSMGCVISPCVFWLFYKAFSDIGTSGTEYPAPYAIVYRNMAILGVDG  583

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP NC+ L   FF AAIAIN+  ++     T ++  RFIP PM MAIPFY+G YFAI
Sbjct  584   FNTLPANCMTLCYIFFAAAIAINLIRDL-----TPHKFSRFIPLPMAMAIPFYIGSYFAI  638

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +GS ILFVW   NK +A  FGPAVASGLICG+ +W +P +ILALA V  PICMKFL+
Sbjct  639   DMFLGSFILFVWEKVNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVNPPICMKFLT  698

Query  316   AAANAKLE  293
                N K++
Sbjct  699   RGDNVKVD  706



>dbj|BAE91892.1| hypothetical protein [Oryza sativa Japonica Group]
Length=716

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/658 (62%), Positives = 502/658 (76%), Gaps = 11/658 (2%)
 Frame = -2

Query  2263  IPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKSWTALLL  2084
             +PSW+ QLT+RA   S  LS +F+ IV KLNLTTG+IPSLNV+AGLLGF  ++ WTA + 
Sbjct  64    VPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFFFVRLWTAAIE  123

Query  2083  KAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIPNNVKTL  1904
             + GLL+QPFTRQENTVIQTCVVA+ GIAFS G  +Y+ GMS TIA QA   N   NVK  
Sbjct  124   RVGLLRQPFTRQENTVIQTCVVAAYGIAFSGGFGTYLFGMSETIAKQATEANNAQNVKNP  183

Query  1903  SIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQ  1724
              IGWM+ FL++VSF+GL ++VPLRK+MI+ YKLTYPSGTATAYLIN FHTP GAKLAK+Q
Sbjct  184   HIGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHTPEGAKLAKKQ  243

Query  1723  VaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCP  1544
             V  L K F FSF++G FQWF+ A DGCGF SFPT GL+AY  RFYFDFS TYVGVGM+CP
Sbjct  244   VKELGKFFLFSFVWGFFQWFYTAGDGCGFQSFPTLGLQAYKNRFYFDFSPTYVGVGMICP  303

Query  1543  IMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLF  1364
              +VNVS+L+G I+SWGI+WP+I  K+G WY  +LS +SL G+QGY+VF++IA++LG+GL+
Sbjct  304   HIVNVSVLLGGILSWGIMWPLIRNKKGSWYAASLSETSLHGLQGYRVFISIALILGNGLY  363

Query  1363  NFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIP  1184
             NF  +++     F+   +  KN   S LPV +  +     +   FD +RRT  FLKD IP
Sbjct  364   NFVKVLIRKTAGFVVMMK--KN---STLPVSNNGSPMVATEAISFDDERRTELFLKDQIP  418

Query  1183  NavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNY  1004
               VA GGY+A+AAV+I  +P IFP LKWY+I VAY  AP+LAFCNAYG GLTDWSLAS Y
Sbjct  419   KTVAFGGYVAVAAVSIGTLPQIFPQLKWYYILVAYVFAPVLAFCNAYGAGLTDWSLASTY  478

Query  1003  GKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQ  824
             GK+AI IF +W G  NGGVL GLA+CGVMMSIVST SDLMQDFKTGYLTLASP +MF SQ
Sbjct  479   GKLAIFIFGAWAGASNGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTLASPRSMFVSQ  538

Query  823   VAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDGFGSLPTNCLN  647
             V GTAMGC + P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVDGF SLP +CL 
Sbjct  539   VIGTAMGCVIAPCVFWLFYKAFADIGVSGTEYPAPYAIVYRNMAILGVDGFSSLPKHCLT  598

Query  646   LAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILF  467
             L   FF AAIAIN+  ++        +V RFIP PM MAIPFY+G YFAIDM +G++ILF
Sbjct  599   LCYIFFAAAIAINLARDL-----APSKVARFIPLPMAMAIPFYIGSYFAIDMFIGTVILF  653

Query  466   VWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAANAKLE  293
             VW   NK +A+ F PAVASGLICG+ +W +P +ILALA VK PICMKFLS + NA+++
Sbjct  654   VWEMVNKAKAEAFAPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLSRSVNAQVD  711



>ref|XP_009413131.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=688

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/668 (62%), Positives = 500/668 (75%), Gaps = 11/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER FE   +P W+ QLT RA+  S  LS +F+ IV KLNLTTG+IPSLNVAAGLLGF 
Sbjct  24    SVERAFEGQRVPGWREQLTARALVVSFFLSVMFSVIVMKLNLTTGIIPSLNVAAGLLGFF  83

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K WT  L   GLL+ PFTRQENTVIQTCVVA+ G+AFS G  SY+ GMS  IA QA  
Sbjct  84    FVKLWTKGLESTGLLRTPFTRQENTVIQTCVVAAYGLAFSGGFGSYIFGMSSRIADQATE  143

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GWM+ F++VVSF+GLFS+VPLRK+MI+ YKL YPSGTATAYLIN FHT
Sbjct  144   ENNSQNIKEPKLGWMIGFMFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAYLINGFHT  203

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P G KLAK+QV  L K F  SFL+G FQWF+ A D CGF++FPT GLKAY  RF+FDFS+
Sbjct  204   PQGEKLAKKQVWTLGKFFVISFLWGFFQWFYTAGDDCGFAAFPTLGLKAYDNRFFFDFSA  263

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP MVN+S+L+GAI+SWGI+WP+I+ ++G WY  +LS +SL G+QGY+VF+ 
Sbjct  264   TYVGVGMICPYMVNISVLLGAILSWGIMWPLINNQKGHWYSASLSPTSLHGLQGYRVFIG  323

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T  +F+   R     P + LPV D+           FD +RR
Sbjct  324   IAMILGDGLYNFLKVLHRTTSAFITAARKR---PTTTLPVSDD--DRPATTPTTFDDERR  378

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP  VA GGYIA+A ++II +P IFPPLKWY I VAY  AP+LAFCNAYGCG
Sbjct  379   TEVFLKDQIPKWVAFGGYIAVAIISIITLPHIFPPLKWYFILVAYVFAPVLAFCNAYGCG  438

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI IF +W G  +GGVLAGLA+CGVMM++VST SDLMQDFKTGYLTL
Sbjct  439   LTDWSLASTYGKLAIFIFGAWAGASHGGVLAGLAACGVMMNVVSTASDLMQDFKTGYLTL  498

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GT+MGC + P VFW+F+KA+  +G   S YPAPYA +YR +A+LGVDG
Sbjct  499   ASPRSMFVSQVIGTSMGCVIAPCVFWLFFKAFKDIGMPGSEYPAPYAIIYRNMAILGVDG  558

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL L   FF  AIAIN+  ++  K     +V RFIP PM MAIPFY+G YFAI
Sbjct  559   FSSLPKHCLTLCYIFFALAIAINLARDLSPK-----KVARFIPIPMAMAIPFYIGSYFAI  613

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM VGS+ILFVW   NK +A  FGPAVASGLICG+ +W +P A+LALA VK PICMKFLS
Sbjct  614   DMFVGSVILFVWEQLNKAKADAFGPAVASGLICGDGIWTLPQAVLALAQVKPPICMKFLS  673

Query  316   AAANAKLE  293
                N K++
Sbjct  674   RKMNDKVD  681



>ref|XP_011046073.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X3 [Populus euphratica]
Length=700

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/670 (62%), Positives = 509/670 (76%), Gaps = 14/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER FE  E+PSW+NQLT+RA   S VLS +F  IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  37    SVERKFENQEVPSWRNQLTLRAFVLSFVLSILFTVIVMKLNLTTGIIPSLNVSAGLLGFF  96

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  L K+GLLKQPFTRQENTVIQTCVVASSGIAF+ G  SY+ GMS T+A Q   
Sbjct  97    FIKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFNGGFGSYLFGMSDTVAKQLTE  156

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +  K  S+ WM+ FL+VVSF+GLFS VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  157   DS--DAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHT  214

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A DGCGF+ FP+ GLKA+  +F+FDFS+
Sbjct  215   PAGAKLAKKQVRVLGKFFSFSFLWGFFQWFYTAGDGCGFAEFPSLGLKAHENKFFFDFSA  274

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I TK+G WYP +L   SL G+QGYKVF+A
Sbjct  275   TYVGVGMICPYIINISVLLGGILSWGLMWPLIDTKKGDWYPADLKPGSLHGLQGYKVFIA  334

Query  1393  IAMMLGDGLFNFFYMMVVT-GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
              A++LGDGL++FF ++  T    F + R  +  G    LPV D  +  + +++  +D QR
Sbjct  335   TALILGDGLYSFFKVLSRTLAALFCQLRGRDATGA---LPVADR-SSPETSKIS-YDEQR  389

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT   LKD IP   AV GY+ +AA++   VP IFP LKWY+I V Y  AP LAFCNAYGC
Sbjct  390   RTQLLLKDQIPTWFAVAGYVTIAAISTATVPRIFPELKWYYILVIYIFAPALAFCNAYGC  449

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YG +AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLT
Sbjct  450   GLTDWSLASTYGTLAIFVIGAWAGASHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYLT  509

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVD  680
             L+SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG   S YPAPYA V+R +A+LGV+
Sbjct  510   LSSPRSMFVSQLIGTAMGCMISPCVFWLFFKAFKDLGTPGSEYPAPYATVFRNMAILGVE  569

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NCL L   FF AAI IN+  +VL K        R IPNPM MAIPFY+G YFA
Sbjct  570   GFSSLPKNCLYLCYWFFGAAILINLIKDVLGKKRA-----RLIPNPMAMAIPFYIGSYFA  624

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMC+GSLILF+W   +K +A  FGPAVASGLICG+ +W +P++ILALAGVK PICMKFL
Sbjct  625   IDMCIGSLILFIWENIDKAKADAFGPAVASGLICGDGIWTLPSSILALAGVKPPICMKFL  684

Query  319   SAAANAKLES  290
             S   NAK+++
Sbjct  685   SRRTNAKVDA  694



>ref|XP_011046070.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Populus euphratica]
Length=704

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/677 (62%), Positives = 507/677 (75%), Gaps = 22/677 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER FE  E+PSW+NQLT+RA   S VLS +F  IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  37    SVERKFENQEVPSWRNQLTLRAFVLSFVLSILFTVIVMKLNLTTGIIPSLNVSAGLLGFF  96

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  L K+GLLKQPFTRQENTVIQTCVVASSGIAF+ G   Y+LGMS T+A Q+  
Sbjct  97    FIKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFNGGFGHYLLGMSETVARQSTE  156

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +  K  S+ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  157   DS--DAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHT  214

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K  SFSFL+G FQWF+ A DGCGF+ FP+ GLKAY  +F+FDFS+
Sbjct  215   PAGAKLAKKQVKALGKFLSFSFLWGFFQWFYTAGDGCGFAEFPSLGLKAYENKFFFDFSA  274

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I TK+G WY  +L  SSL G+QGYKVF+A
Sbjct  275   TYVGVGMICPYIINISVLLGGILSWGLMWPLIDTKKGDWYSADLKPSSLHGLQGYKVFIA  334

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA++LGDGL+ FF ++  T   L F  + R    G    LP+ D            ++ Q
Sbjct  335   IALILGDGLYTFFKVLSRTLAALFFQLQMRDATGG----LPIADR--SSPETSRISYNDQ  388

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AV GY+A+AA++   +P IFP LKWY+I+V Y  AP LAFCNAYG
Sbjct  389   RRTQLFLKDQIPTWFAVAGYVAIAAISTATLPHIFPELKWYYISVIYIFAPALAFCNAYG  448

Query  1039  CGLTDWSLASNYGKIAILIFSSWV------GHDNGGVLAGLASCGVMMSIVSTTSDLMQD  878
             CG TDWSLAS YGK+AI I           G  +GGVLAGLA+CGVMM+IV+T SDL QD
Sbjct  449   CGHTDWSLASTYGKLAIFIIRPQERIPPSNGASHGGVLAGLAACGVMMNIVATASDLSQD  508

Query  877   FKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyra  701
             FKTGYLTL+SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG   S YPAP A V+R 
Sbjct  509   FKTGYLTLSSPRSMFVSQLIGTAMGCIISPCVFWLFFKAFKDLGTPGSQYPAPNATVFRN  568

Query  700   iALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPF  521
             +A+LGV+GF SLP NCL L  GFF AAI IN+  + L K     +  RFIPNPM MAIPF
Sbjct  569   MAILGVEGFSSLPKNCLYLCYGFFGAAILINLIKDALGK-----KWARFIPNPMAMAIPF  623

Query  520   YLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKA  341
             Y+G YFAIDMCVGSLILF+W   +K +A  FGPAVASGLICG+ +W +P AILALAGVK 
Sbjct  624   YIGSYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPRAILALAGVKP  683

Query  340   PICMKFLSAAANAKLES  290
             PICMKFLS   NAK+++
Sbjct  684   PICMKFLSRGTNAKVDA  700



>ref|XP_006493428.1| PREDICTED: probable metal-nicotianamine transporter YSL5-like 
[Citrus sinensis]
Length=703

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/670 (62%), Positives = 510/670 (76%), Gaps = 16/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER F+  E+PSW+ QLTIRA   S VLS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  42    SVERAFDGKEVPSWRKQLTIRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  101

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L  + +L+QPFTRQENTVIQTCVVASSGIAFS G  SY+LGMS  IA Q+E 
Sbjct  102   FVKTWTKFLENSRILRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLGMSDRIAIQSED  161

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N+    K LS+ W++ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  162   TNL--GYKNLSLTWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHT  219

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
               GAKLAK+QV  L K FSFSFL+G FQWFF A D CGF SFPTFGLKAY  RFYFDFS+
Sbjct  220   TAGAKLAKKQVRTLGKFFSFSFLWGFFQWFFTAGDNCGFVSFPTFGLKAYEYRFYFDFSA  279

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
              YVGVGM+CP ++N+S+L+G I+SWG++WP+I  ++G WY  +LS +SL+G+QGYKVF++
Sbjct  280   IYVGVGMICPYIINISVLLGGILSWGLMWPLIEKRKGDWYSADLSPTSLQGLQGYKVFIS  339

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA++LGDGL+NF  ++  T  GL +  R R+     +S LPV +  +  + A+L  +D Q
Sbjct  340   IALILGDGLYNFCKVLSRTLVGLFYQVRTRNA----SSDLPVAEN-SSPETAKLS-YDDQ  393

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   A+ GY+A+A V+II +P IF  LKWYH+ V Y  AP LAFCNAYG
Sbjct  394   RRTRLFLKDQIPTWFAISGYVAIAIVSIIVLPHIFHQLKWYHVLVIYLFAPTLAFCNAYG  453

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  454   CGLTDWSLASTYGKLAIFTIGAWAGSSHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYL  513

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQV GTA+GC ++P VFW+FYKA+  LG   S Y AP+A VYR +A LGV
Sbjct  514   TLASPRSMFVSQVIGTAIGCIVSPCVFWLFYKAFDDLGVPGSEYAAPFAMVYRNMAKLGV  573

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP NCL L    F AAI IN+  + +RK        RFIP PM MAIPFYLG YF
Sbjct  574   EGFSALPKNCLLLCYVLFGAAIVINLIRDSIRKEWA-----RFIPLPMAMAIPFYLGPYF  628

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSL+LF+W   +K +A  FGPAVASGLICG+ +W +P++ILALA V+ P+CMKF
Sbjct  629   AIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKF  688

Query  322   LSAAANAKLE  293
             LS   NA+++
Sbjct  689   LSRRTNARVD  698



>ref|XP_006441429.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
 gb|ESR54669.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
Length=703

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/670 (62%), Positives = 512/670 (76%), Gaps = 16/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER F+  E+PSW+ QLTIRA   S VLS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  42    SVERAFDGKEVPSWRKQLTIRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  101

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L  + +L+QPFTRQENTVIQTCVVASSGIAFS G  SY+LGMS  IA Q+E 
Sbjct  102   FVKTWTKFLENSRILRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLGMSDRIALQSED  161

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N+    K LS+ W++ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  162   TNL--GYKNLSLTWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHT  219

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA+LAK+QV  L K FSFSFL+G FQWFF A D CGF SFPTFGLKAY  RFYFDFS+
Sbjct  220   PEGARLAKKQVRTLGKFFSFSFLWGFFQWFFTAGDNCGFVSFPTFGLKAYEYRFYFDFSA  279

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
              YVGVGM+CP ++N+S+L+G I+SWG++WP+I  ++G WY  +LS +SL+G+QGYKVF++
Sbjct  280   IYVGVGMICPYIINISVLLGGILSWGLMWPLIEKRKGDWYSADLSPTSLQGLQGYKVFIS  339

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA++LGDGL+NF  ++  T  GL +  R R+     +S LPV +  +  + A+L  +D Q
Sbjct  340   IALILGDGLYNFCKVLSRTLVGLFYQVRTRNA----SSDLPVAEN-SSPETAKLS-YDDQ  393

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   A+ GY+A+A V+II +P IF  LK YH+ V Y  AP LAFCNAYG
Sbjct  394   RRTRLFLKDQIPTWFAISGYVAIAIVSIIVLPHIFHQLKCYHVLVIYLFAPTLAFCNAYG  453

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  454   CGLTDWSLASTYGKLAIFMIGAWAGSSHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYL  513

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQV GTA+GC ++P VFW+FYKA+  LG   S Y AP+A VYR++A LGV
Sbjct  514   TLASPRSMFVSQVIGTAIGCIVSPCVFWLFYKAFDDLGVPGSEYAAPFAMVYRSMAKLGV  573

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP NCL L    F AAI IN+  + +RK        RFIP PM MAIPFYLG YF
Sbjct  574   EGFSALPKNCLLLCYVHFGAAIVINLIRDSIRKEWA-----RFIPLPMAMAIPFYLGPYF  628

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSL+LF+W   +K +A  FGPAVASGLICG+ +W +P++ILALA V+ PICMKF
Sbjct  629   AIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSSILALAKVQPPICMKF  688

Query  322   LSAAANAKLE  293
             LS   NA+++
Sbjct  689   LSRRTNARVD  698



>ref|XP_002883075.1| hypothetical protein ARALYDRAFT_479246 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59334.1| hypothetical protein ARALYDRAFT_479246 [Arabidopsis lyrata subsp. 
lyrata]
Length=714

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/671 (59%), Positives = 515/671 (77%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSW  QLT+RA   S +LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  46    SVEKIFESREVPSWTKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  105

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  106   FVKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQ--S  163

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  164   GDVSRGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  223

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSF +  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  224   PQGAKLAKKQVRVLGKFFSFSFFWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  283

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P N+ SSS+ G+Q YKVF+A
Sbjct  284   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPDNVPSSSMHGLQAYKVFIA  343

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL F++ R    +   +   ++++ +    +  + +D Q
Sbjct  344   VAIILGDGLYNFCKVLSRTLSGL-FVQLRGPTTSISRTSFTLEEDPHASPLSPKQSYDDQ  402

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  403   RRTRFFLKDQIPTWFAVGGYITIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYG  462

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  463   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYL  522

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  N+ YPAP+A VYR++A LGV
Sbjct  523   TLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGLPNTEYPAPFATVYRSMAKLGV  582

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF  AI +NI  + L+      +  RFIP PM MAIPF+LG YF
Sbjct  583   EGVASLPRECLVLCYAFFGVAILVNIVKDSLQS-----QWGRFIPLPMAMAIPFFLGPYF  637

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +  +A+ FG AVASGLICG+ +W +P+++LA+AGV  P+CMKF
Sbjct  638   AIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKF  697

Query  322   LSAAANAKLES  290
             LSAA N+K+++
Sbjct  698   LSAATNSKVDN  708



>ref|NP_566584.1| putative metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
 sp|Q9LUN2.1|YSL5_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL5; 
AltName: Full=Protein YELLOW STRIPE LIKE 5; Short=AtYSL5 [Arabidopsis 
thaliana]
 dbj|BAB02055.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS00694.1| metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
 gb|AEE75985.1| putative metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
Length=714

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/671 (59%), Positives = 513/671 (76%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S +LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  46    SVEKIFESREVPSWKKQLTVRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  105

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  106   FVKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQ--S  163

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  164   GDVSRGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  223

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SF +  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  224   PQGAKLAKKQVRVLGKFFSLSFFWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  283

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P N+ SSS+ G+Q YKVF+A
Sbjct  284   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPDNVPSSSMHGLQAYKVFIA  343

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL F++ R    +   +   ++++ +    +  + +D Q
Sbjct  344   VAIILGDGLYNFCKVLSRTLSGL-FVQLRGPTTSISRTSFTLEEDPHASPLSPKQSYDDQ  402

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  403   RRTRFFLKDQIPTWFAVGGYITIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYG  462

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  463   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYL  522

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  N+ YPAP+A VYR++A LGV
Sbjct  523   TLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGLPNTEYPAPFATVYRSMAKLGV  582

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF  AI +NI  + L          RFIP PM MAIPF+LG YF
Sbjct  583   EGVASLPRECLVLCYAFFGVAILVNIVKDSLHS-----NWGRFIPLPMAMAIPFFLGPYF  637

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +  +A+ FG AVASGLICG+ +W +P+++LA+AGV  P+CMKF
Sbjct  638   AIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKF  697

Query  322   LSAAANAKLES  290
             LS+A N+K+++
Sbjct  698   LSSATNSKVDN  708



>ref|NP_001054241.1| Os04g0674600 [Oryza sativa Japonica Group]
 dbj|BAF16155.1| Os04g0674600, partial [Oryza sativa Japonica Group]
Length=708

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/681 (59%), Positives = 506/681 (74%), Gaps = 16/681 (2%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S ERVFE   +P WK Q+T+RA+  S +L A+F+ IV KLNLTTG+IPSLNV+AGLLG
Sbjct  39    VVSVERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLG  98

Query  2119  FAVIKSWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             F ++ SWT LL KAG+   +PFTRQENTV+QTCVVA SGIAFS G  SY+  MS  I+ Q
Sbjct  99    FFLLTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQ  158

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +      +N+K  S+GWM+ FL++VSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LINS
Sbjct  159   SGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINS  218

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK QV  L K F  SF +G FQWF+   DGCGF SFPT GL+AY  +F+FD
Sbjct  219   FHTPQGAKLAKMQVKMLGKFFVMSFSWGFFQWFYTGGDGCGFMSFPTLGLEAYRNKFFFD  278

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VN+S+L+G ++SWGI+WP+I  K+G WYP +L  SSL+GI GY+V
Sbjct  279   FSATYVGVGMICPYLVNISVLLGGVMSWGIMWPLIEHKKGDWYPADLKPSSLRGIVGYRV  338

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQL--EDF  1229
             F++I+++LGDGL+NF  +M  T  + + + R+  + P   LPV      G G Q   E F
Sbjct  339   FISISLILGDGLYNFLKVMTRTTTALVMQVRAMMSEPT--LPV-----SGGGGQTPEETF  391

Query  1228  DGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCN  1049
             D +RRT  FLKD IPN +A+  Y+ +A V+I  VP IF  L+WYH+AV+Y +AP+LAFCN
Sbjct  392   DDKRRTELFLKDQIPNWLALSAYVVIAVVSIATVPRIFHQLRWYHVAVSYVVAPVLAFCN  451

Query  1048  AYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKT  869
             AYGCGLTDWSLA+ YGK+AI    +W    +GG++AGLA+CGVM+ IVST SDL QDFKT
Sbjct  452   AYGCGLTDWSLATTYGKLAIFTVGAWADASDGGIIAGLAACGVMIGIVSTASDLTQDFKT  511

Query  868   GYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiAL  692
             GY+TLASP +MF SQV GTAMGC + P VFW+FYKA+  +G   S YP+P A VYR +A+
Sbjct  512   GYMTLASPRSMFVSQVIGTAMGCVIAPSVFWLFYKAFHDIGMPGSEYPSPNALVYRNMAI  571

Query  691   LGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLG  512
             LGV G GSLP +CL+L IGFFVAAIA+N+  ++        +V RF+P PM MAIPFYLG
Sbjct  572   LGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDL-----AAPKVARFLPLPMAMAIPFYLG  626

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
              YF IDMC+GSLI FVW   +  +AK F P VASGLICG+ +W +P ++LALAGVK PIC
Sbjct  627   PYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQSVLALAGVKPPIC  686

Query  331   MKFLSAAANAKLESS*PKISS  269
             MKFLS   N K+++   K+ S
Sbjct  687   MKFLSRTTNIKVDAFIAKLPS  707



>sp|Q0J932.2|YSL10_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL10; 
AltName: Full=Protein YELLOW STRIPE LIKE 10; Short=OsYSL10 
[Oryza sativa Japonica Group]
 dbj|BAE91890.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAG91535.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61895.1| hypothetical protein OsJ_16603 [Oryza sativa Japonica Group]
Length=686

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/681 (59%), Positives = 506/681 (74%), Gaps = 16/681 (2%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S ERVFE   +P WK Q+T+RA+  S +L A+F+ IV KLNLTTG+IPSLNV+AGLLG
Sbjct  17    VVSVERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLG  76

Query  2119  FAVIKSWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             F ++ SWT LL KAG+   +PFTRQENTV+QTCVVA SGIAFS G  SY+  MS  I+ Q
Sbjct  77    FFLLTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQ  136

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +      +N+K  S+GWM+ FL++VSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LINS
Sbjct  137   SGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINS  196

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK QV  L K F  SF +G FQWF+   DGCGF SFPT GL+AY  +F+FD
Sbjct  197   FHTPQGAKLAKMQVKMLGKFFVMSFSWGFFQWFYTGGDGCGFMSFPTLGLEAYRNKFFFD  256

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VN+S+L+G ++SWGI+WP+I  K+G WYP +L  SSL+GI GY+V
Sbjct  257   FSATYVGVGMICPYLVNISVLLGGVMSWGIMWPLIEHKKGDWYPADLKPSSLRGIVGYRV  316

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQL--EDF  1229
             F++I+++LGDGL+NF  +M  T  + + + R+  + P   LPV      G G Q   E F
Sbjct  317   FISISLILGDGLYNFLKVMTRTTTALVMQVRAMMSEPT--LPV-----SGGGGQTPEETF  369

Query  1228  DGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCN  1049
             D +RRT  FLKD IPN +A+  Y+ +A V+I  VP IF  L+WYH+AV+Y +AP+LAFCN
Sbjct  370   DDKRRTELFLKDQIPNWLALSAYVVIAVVSIATVPRIFHQLRWYHVAVSYVVAPVLAFCN  429

Query  1048  AYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKT  869
             AYGCGLTDWSLA+ YGK+AI    +W    +GG++AGLA+CGVM+ IVST SDL QDFKT
Sbjct  430   AYGCGLTDWSLATTYGKLAIFTVGAWADASDGGIIAGLAACGVMIGIVSTASDLTQDFKT  489

Query  868   GYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiAL  692
             GY+TLASP +MF SQV GTAMGC + P VFW+FYKA+  +G   S YP+P A VYR +A+
Sbjct  490   GYMTLASPRSMFVSQVIGTAMGCVIAPSVFWLFYKAFHDIGMPGSEYPSPNALVYRNMAI  549

Query  691   LGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLG  512
             LGV G GSLP +CL+L IGFFVAAIA+N+  ++        +V RF+P PM MAIPFYLG
Sbjct  550   LGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDL-----AAPKVARFLPLPMAMAIPFYLG  604

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
              YF IDMC+GSLI FVW   +  +AK F P VASGLICG+ +W +P ++LALAGVK PIC
Sbjct  605   PYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQSVLALAGVKPPIC  664

Query  331   MKFLSAAANAKLESS*PKISS  269
             MKFLS   N K+++   K+ S
Sbjct  665   MKFLSRTTNIKVDAFIAKLPS  685



>gb|EAY86805.1| hypothetical protein OsI_08181 [Oryza sativa Indica Group]
Length=771

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/711 (58%), Positives = 511/711 (72%), Gaps = 51/711 (7%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S +L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  65    SVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  124

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFS--------------------  1994
              ++ WT+ + + GLLKQPFTRQENTVIQTCVV++ GIAFS                    
Sbjct  125   FVRLWTSAVERIGLLKQPFTRQENTVIQTCVVSAYGIAFSGKRLRRFRLYSDFYCTTFVG  184

Query  1993  ----------------------SGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAF  1880
                                   SG  SY+ GMS TIA QA       N+K   +GWM+ F
Sbjct  185   LGLLVAAGVLCVLMSTSELNGASGFGSYLFGMSETIAKQATEAKDAQNIKDPHLGWMIGF  244

Query  1879  LYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcf  1700
             L++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHTP GAKLAK+QV  L K F
Sbjct  245   LFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTPEGAKLAKKQVKTLGKYF  304

Query  1699  sfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVsll  1520
              FSF +G FQWF+ A D CGF +FPT GL+AY  RF+FDFS TYVGVGM+CP +VNVS+L
Sbjct  305   LFSFFWGFFQWFYTAGDDCGFKNFPTLGLEAYNNRFFFDFSPTYVGVGMICPYIVNVSVL  364

Query  1519  igaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVV  1340
             +G I+SWG++WP+I  K+G WYP ++S +SL G+Q Y+VF++IA++LGDGL+NF  +++ 
Sbjct  365   LGGILSWGVMWPLIAKKKGSWYPADISDNSLHGLQAYRVFISIALILGDGLYNFLKVLIR  424

Query  1339  TGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggy  1160
             T   F+   ++   G   +LPV D       A+   FD +RRT  FLKD IP +VA GGY
Sbjct  425   TLAGFISMVQNNSKG---MLPVSDNGMSMSTAEEVSFDDERRTEIFLKDQIPKSVAYGGY  481

Query  1159  ialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIF  980
             + +AA++I  +P IFP LKWY+I VAY +AP+LAFCNAYG GLTDWSLAS YGK+AI +F
Sbjct  482   VVVAALSIGTLPEIFPQLKWYYILVAYIVAPVLAFCNAYGSGLTDWSLASTYGKLAIFVF  541

Query  979   SSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGC  800
              +W G  +GGVL GLA+CGVMMSIVST SDLMQDFKTGYLTLASP +MF SQV GT MGC
Sbjct  542   GAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTLASPRSMFISQVIGTGMGC  601

Query  799   TLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVA  623
              + P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVDGF SLP NCL L   FF A
Sbjct  602   VIAPCVFWLFYKAFSNIGTSGTEYPAPYAIVYRNMAILGVDGFNSLPENCLTLCYIFFAA  661

Query  622   AIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQ  443
             AIAIN+  ++       ++V RFIP PM MAIPFY+G YFAIDM +GS+ILFVW   NK 
Sbjct  662   AIAINLIRDL-----APHKVSRFIPLPMAMAIPFYIGSYFAIDMFLGSVILFVWEKLNKA  716

Query  442   QAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAANAKLES  290
             +A  FGPAVASGLICG+ +W +P +ILALA VK PICMKFLS AANAK++S
Sbjct  717   KADAFGPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLSRAANAKVDS  767



>ref|XP_003580167.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Brachypodium 
distachyon]
Length=717

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/669 (61%), Positives = 499/669 (75%), Gaps = 11/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER FE   +P+W+ QLT+RA   S  L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  56    SVERAFEGKAVPTWREQLTLRAFVVSFFLAIMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  115

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT  + + G L+QPFTRQENTVIQTCVVA+  IAFS G  +Y+  MS TIA Q   
Sbjct  116   FVRLWTGAIERMGFLRQPFTRQENTVIQTCVVAAYDIAFSGGFGNYLFAMSDTIANQTTE  175

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  N+K   +GWM+AFL++VSFVGLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  176   AKDAQNIKNPHVGWMIAFLFLVSFVGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  235

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F FSFL+G FQWF+   D CGFSSFPT GL+AY  RFYFDFS 
Sbjct  236   PEGAKLAKKQVKTLGKFFLFSFLWGFFQWFYTGGDSCGFSSFPTLGLQAYKNRFYFDFSP  295

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWG++WP+I  K GIW+  +L  SSL G+QGY+VF++
Sbjct  296   TYVGVGMICPHIVNVSVLLGGILSWGVMWPLISNKRGIWFSADLPDSSLHGLQGYRVFIS  355

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             I+++LGDGL+NF  ++V T  +F    +  KN   +++PV DE       +   +D QRR
Sbjct  356   ISLILGDGLYNFLKVLVRTTAAFATMVK--KN---NMIPVSDEGGAMVTGEAVSYDDQRR  410

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FL+D IP  VA  GY A+AAV+I  +P +FP LKWY+I VAY  AP+LAFCNAYG G
Sbjct  411   TELFLRDQIPKTVAYAGYAAVAAVSIATLPLLFPQLKWYYILVAYLFAPVLAFCNAYGTG  470

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI IF +W G  +GGVL GLA+CGVMMSIVST +DLMQDFKTGYLTL
Sbjct  471   LTDWSLASTYGKLAIFIFGAWAGAPHGGVLVGLAACGVMMSIVSTAADLMQDFKTGYLTL  530

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAPYA VYR +A+LGVDG
Sbjct  531   ASPRSMFISQVIGTAMGCVIAPCVFWLFYKAFTDIGISGSEYPAPYAIVYRNMAILGVDG  590

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAI IN+  ++        +V +FIP PM MAIPFY+G YFAI
Sbjct  591   FSSLPKNCLTLCFIFFAAAIVINLARDL-----APSKVAKFIPLPMAMAIPFYIGSYFAI  645

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM VGS+ILFVW   NK +A  F PAVASGLICG+ +W +P +ILALA VK PICMKFLS
Sbjct  646   DMFVGSVILFVWGIVNKAKADAFAPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLS  705

Query  316   AAANAKLES  290
              + NAK++ 
Sbjct  706   RSVNAKVDD  714



>gb|EPS65244.1| hypothetical protein M569_09533, partial [Genlisea aurea]
Length=616

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/620 (65%), Positives = 495/620 (80%), Gaps = 13/620 (2%)
 Frame = -2

Query  2266  EIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKSWTALL  2087
             E+PSWKNQ+T+RA+  S++LS +FN IVCKLNL+TGVIPSLNVAAGLLGFA++KSWT L+
Sbjct  10    EVPSWKNQITVRAVVVSVLLSFLFNVIVCKLNLSTGVIPSLNVAAGLLGFAMVKSWTYLI  69

Query  2086  LKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIPNNVKT  1907
              K GLLKQPFTRQENTVIQTCVVASSGIAFSSGTASY+L MSP  AAQ ++GN P NVK 
Sbjct  70    SKFGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLAMSPYTAAQVDAGNNPINVKP  129

Query  1906  LSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQ  1727
             LS+GWM+AFL+++SFVGLFSI P+RK+MILKYKLTYPSGTATA LINSFHT  GAKLAK+
Sbjct  130   LSLGWMIAFLFIMSFVGLFSIAPMRKLMILKYKLTYPSGTATACLINSFHTSRGAKLAKK  189

Query  1726  QVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLC  1547
             +V  LFK    SF++  FQWFF+A  GCGF SFPTFGL AY +RFYFDFS TY G+GM+C
Sbjct  190   KVRVLFKTMIGSFIWACFQWFFSAAHGCGFDSFPTFGLPAYRKRFYFDFSGTYTGIGMIC  249

Query  1546  PIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGL  1367
             P MVNVSLLIGAIISWGI+WP I +K+G W+  +L + SL GIQGY+VFLAIAM+LGDGL
Sbjct  250   PYMVNVSLLIGAIISWGILWPYIESKKGSWFSADLPAGSLHGIQGYRVFLAIAMILGDGL  309

Query  1366  FNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSI  1187
             F+  Y++  +  SF+++   +K       P++D   +     + D++ ++R   FLKD I
Sbjct  310   FHLIYVLSTSVTSFIQKSSEKK-------PLNDGTER---EAVADYEEKKRIEFFLKDQI  359

Query  1186  PNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASN  1007
             P++ A+ GY+  AA++I  VP IF  +KWYH++ AYA+APILAFCNAYGCGLTDWSLASN
Sbjct  360   PDSYAIVGYMVSAAISIGLVPVIFEQIKWYHVSTAYAIAPILAFCNAYGCGLTDWSLASN  419

Query  1006  YGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFS  827
             YGKIAIL+FSSWVG D GG++AGL  CG+ MSIVST SDLMQDFKTGYLTL+SP +MF S
Sbjct  420   YGKIAILVFSSWVGMDGGGIVAGLVGCGLTMSIVSTASDLMQDFKTGYLTLSSPRSMFLS  479

Query  826   QVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGSLPTNCLN  647
             QV GTA+GC  +P+VFW F++AY +GD   ++PAPYAA+YR I LLG +G  SL +NC+ 
Sbjct  480   QVMGTAVGCVFSPVVFWFFHEAYRVGDPEGSFPAPYAAMYRGIGLLGTEGLSSLQSNCVR  539

Query  646   LAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILF  467
             LA   F  A+AI+  S  LR+YET++ +YRF+PNP C+A+ FYLGGYFAIDMCVGSLILF
Sbjct  540   LAAASFAGAVAIDAASAALRRYETRWGLYRFVPNPTCVAVAFYLGGYFAIDMCVGSLILF  599

Query  466   VWRWKNKQQAKDFGPAVASG  407
             V     K++AK+ G A ASG
Sbjct  600   V---LGKEKAKELGGAAASG  616



>ref|XP_009384580.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=697

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/669 (61%), Positives = 499/669 (75%), Gaps = 10/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER FE+  +P W+ QLT RA+  S +LS +F+ IV KLNLTTG+IPSLNVAAGLLGF 
Sbjct  32    SVERTFERQRVPPWREQLTARALAVSFLLSVMFSVIVMKLNLTTGIIPSLNVAAGLLGFF  91

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K WT  L  AGLL+ PFTRQENTVIQT VVA+ G+AFS G  SY+ GMS  IA Q   
Sbjct  92    FVKVWTKALEHAGLLRTPFTRQENTVIQTSVVAAYGLAFSGGFGSYLFGMSSKIANQTTE  151

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GWM+ F++VVSF+GLFS+VPLR++MI+ YKL YPSGTATAYLIN FHT
Sbjct  152   ANDSQNIKDPKLGWMIGFMFVVSFLGLFSLVPLREIMIIDYKLIYPSGTATAYLINGFHT  211

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P G KLAK+QV  + K F +SFL+G FQWF+ A D CGF +FPTFGLKAYA +F+FDFS+
Sbjct  212   PQGEKLAKKQVRTMGKFFVYSFLWGFFQWFYTAGDDCGFEAFPTFGLKAYANKFFFDFSA  271

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVSLL+GAI+SWG++WP+I+ ++G WY  ++  SSL  +QGY+VFLA
Sbjct  272   TYVGVGMICPYIVNVSLLLGAILSWGLMWPLINNQKGHWYSADIPPSSLHSLQGYRVFLA  331

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             +A++LGDGL+N   ++  T  SF+   R     P S LP+ D   +   +    FD +RR
Sbjct  332   VALILGDGLYNILKVLHRTIYSFVSAARKR---PTSSLPISDG-GRAVTSPAASFDDKRR  387

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  F+KD IP  VA  GY A+A V+I+ +P +FPPLKWYHI VAY  AP+LAFCNAYGCG
Sbjct  388   TEMFVKDQIPKWVAYVGYSAIAIVSIVTIPHLFPPLKWYHILVAYVFAPLLAFCNAYGCG  447

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDW+LAS YGK+AI +F +W G  +GGVLAGLA+CGVMMSIV+T SDLMQDFKTGYLTL
Sbjct  448   LTDWNLASTYGKLAIFVFGAWAGAHHGGVLAGLAACGVMMSIVATASDLMQDFKTGYLTL  507

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAPYA +YR +A+LGVDG
Sbjct  508   ASPRSMFVSQVVGTAMGCVIAPCVFWLFYKAFDDIGISGSQYPAPYALIYRNMAILGVDG  567

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL L   FF  AI IN+  +   K     +V RFIP PM MAIPFY+G  FAI
Sbjct  568   FSSLPKHCLTLCYTFFALAIVINLARDTCPK-----KVARFIPIPMAMAIPFYIGTSFAI  622

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GS IL+VW   NK +A  FGPAVASGLICG+ +W +P  +LALA VK PICMKFLS
Sbjct  623   DMCLGSAILYVWGRINKAKADAFGPAVASGLICGDGIWSLPQGVLALARVKPPICMKFLS  682

Query  316   AAANAKLES  290
                N K+++
Sbjct  683   RKMNNKVDA  691



>gb|KDO46150.1| hypothetical protein CISIN_1g005295mg [Citrus sinensis]
Length=703

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/670 (62%), Positives = 510/670 (76%), Gaps = 16/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER F+  E+PSW+ QLTIRA   S VLS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  42    SVERAFDGKEVPSWRKQLTIRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  101

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L  + +L+QPFTRQENTVIQTCVVASSGIAFS G  SY+LGMS  IA Q+E 
Sbjct  102   FVKTWTKFLENSRILRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLGMSDRIALQSED  161

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N+    K LS+ W++ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  162   TNL--GYKNLSLTWIIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHT  219

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA+LAK+QV  L K FSFSFL+G FQWFF A D CGF SFPTFGLKAY  RFYFDFS+
Sbjct  220   PEGARLAKKQVRTLGKFFSFSFLWGFFQWFFTAGDNCGFVSFPTFGLKAYEYRFYFDFSA  279

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
              YVGVGM+CP ++N+S+L+G I+SWG++WP+I  ++G WY  +LS +SL+G+QGYKVF++
Sbjct  280   IYVGVGMICPYIINISVLLGGILSWGLMWPLIEKRKGDWYSADLSPTSLQGLQGYKVFIS  339

Query  1393  IAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA++LGDGL+NF  ++  T  GL +  R R+     +S LPV +  +  + A+L  +D Q
Sbjct  340   IALILGDGLYNFCKVLSRTLVGLFYQVRTRNA----SSDLPVAEN-SSPETAKLS-YDDQ  393

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   A+ GY+A+A V+II +P IF  LK YH+ V Y  AP LAFCNAYG
Sbjct  394   RRTRLFLKDQIPTWFAISGYVAIAIVSIIVLPHIFHQLKCYHVLVIYLFAPTLAFCNAYG  453

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  454   CGLTDWSLASTYGKLAIFTIGAWAGSSHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYL  513

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQV GTA+GC ++P VFW+FYKA+  LG   S Y AP+A VYR +A LGV
Sbjct  514   TLASPRSMFVSQVIGTAIGCIVSPCVFWLFYKAFDDLGVPGSEYAAPFAMVYRNMAKLGV  573

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP NCL L    F AAI IN+  + +RK        RFIP PM MAIPFYLG YF
Sbjct  574   EGFSALPKNCLLLCYVLFGAAIVINLIRDSIRKEWA-----RFIPLPMAMAIPFYLGPYF  628

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSL+LF+W   +K +A  FGPAVASGLICG+ +W +P++ILALA V+ P+CMKF
Sbjct  629   AIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSSILALAKVQPPMCMKF  688

Query  322   LSAAANAKLE  293
             LS   NA+++
Sbjct  689   LSRRTNARVD  698



>gb|KFK41018.1| hypothetical protein AALP_AA2G074700 [Arabis alpina]
Length=690

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/671 (62%), Positives = 518/671 (77%), Gaps = 15/671 (2%)
 Frame = -2

Query  2293  STERVFE--KVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE      P+W+NQLT RAM  S +LS +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  27    SVERIFEVSGEAPPAWQNQLTFRAMIVSFILSILFTFVVMKLNLTTGIIPSLNISAGLLG  86

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT LL KAG LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  87    FFFVKTWTKLLHKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQS  146

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N P N+K   +GWM+ FL++VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  147   GEANTPINIKNPHLGWMIGFLFIVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  206

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + D CGF++FPTFGLKAY  +FYFDF
Sbjct  207   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGDDCGFANFPTFGLKAYKNKFYFDF  266

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLL+G+I+SWG++WP+I  ++G WY  +L S+SL G+QGYKVF
Sbjct  267   SATYVGVGMICPYLINVSLLVGSILSWGVMWPLIGAQKGNWYSSDLKSTSLHGLQGYKVF  326

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIA++LGDGL+NF  ++  T +   K+ ++       +LPV+D            +D +
Sbjct  327   IAIALILGDGLYNFIKVLGRTIVGLYKQFKNR-----DVLPVNDR--SSPTTITVSYDDK  379

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+ +AV GYI +A V+II VP IFP LKWYHI   Y +AP+LAFCNAYG
Sbjct  380   RRTELFLKDRIPSWMAVSGYIIMAIVSIITVPHIFPQLKWYHILTMYIIAPVLAFCNAYG  439

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  440   CGLTDWSLASTYGKLAIFTIGAWAGAANGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  499

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G + +AYPAPYA VYR +++LGV
Sbjct  500   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQTGTAYPAPYALVYRNMSILGV  559

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL L   FF AA+ +N   +++       +  R+IP PM MAIPFY+GGYF
Sbjct  560   EGFSALPKHCLMLCYIFFAAAVFVNGVRDLVGP-----KWARYIPLPMAMAIPFYIGGYF  614

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMCVGSLILF+WR  N+ +A  +  AVASGLICGE +W +P++ILALAGVK PICMKF
Sbjct  615   TIDMCVGSLILFIWRKLNRPKADAYSSAVASGLICGEGIWTLPSSILALAGVKPPICMKF  674

Query  322   LSAAANAKLES  290
             LS++ N K++S
Sbjct  675   LSSSTNVKVDS  685



>ref|XP_010487657.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Camelina sativa]
Length=711

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/671 (60%), Positives = 514/671 (77%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  43    SVEKIFESREVPSWKKQLTLRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  102

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  103   FVKTWTKMLHRSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQ--S  160

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+    VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  161   GDAYRGVKNPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  220

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SFL+  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  221   PQGAKLAKKQVRVLGKFFSISFLWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  280

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P N+ SSS+ G+Q YKVF+A
Sbjct  281   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPDNVPSSSMHGLQAYKVFIA  340

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL F++ R +  +   +   ++++ +    +  + +D Q
Sbjct  341   VAIILGDGLYNFCKVLSRTLSGL-FVQLRGTTTSISRTSFTLEEDPHASPLSPKQSYDDQ  399

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  400   RRTRFFLKDQIPTWFAVGGYIIIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYG  459

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  460   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYL  519

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LGV
Sbjct  520   TLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGV  579

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF  AI +NI  + L     K +  RFIP PM MAIPF+LG YF
Sbjct  580   EGVSSLPRECLVLCYAFFSVAILVNIVKDSL-----KSKWGRFIPLPMAMAIPFFLGPYF  634

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +  +A+ FG AVASGLICG+ +W +P+++LA+AGV  P+CMKF
Sbjct  635   AIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKF  694

Query  322   LSAAANAKLES  290
             LSAA N+K+++
Sbjct  695   LSAATNSKVDN  705



>emb|CDY46890.1| BnaA01g27900D [Brassica napus]
Length=715

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/673 (60%), Positives = 511/673 (76%), Gaps = 13/673 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSW  QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  46    SVEKIFESREVPSWTKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  105

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  106   FVKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQ--S  163

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  164   GDVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  223

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  224   PQGAKLAKKQVRVLGKFFSFSFLWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  283

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P ++  SS+ G+Q YKVF+A
Sbjct  284   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPADVEPSSMHGLQAYKVFIA  343

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQL--EDFD  1226
             +A++LGDGL+NF  ++   ++GL F++ R +  +       V +E +     Q   E +D
Sbjct  344   VAIILGDGLYNFCKVLSRTLSGL-FVQLRGTTPSFSRRSFTVQEEEDPHASPQTPKESYD  402

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              QRRT  FLKD IP   AVGGYI ++A +   +P +F  L+WY+I V Y  AP+LAFCNA
Sbjct  403   DQRRTRFFLKDQIPTWFAVGGYITISAASTAILPHMFHQLRWYYILVIYICAPVLAFCNA  462

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YG GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTG
Sbjct  463   YGAGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTG  522

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALL  689
             YLTL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A L
Sbjct  523   YLTLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGIPNSEYPAPFATVYRSMAKL  582

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+G  SLP  CL L   FF  AI +NI  + L       R  RF+P PM MAIPF+LG 
Sbjct  583   GVEGVASLPRECLVLCYAFFSVAILVNIVKDSLPS-----RWGRFVPLPMAMAIPFFLGP  637

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDMCVGSL+LFVW   +  +A+ FG AVASGLICG+ +W  P+++LA+AGV  P+CM
Sbjct  638   YFAIDMCVGSLVLFVWERVDAAKAEAFGTAVASGLICGDGIWSFPSSVLAIAGVNPPVCM  697

Query  328   KFLSAAANAKLES  290
             KFLSAA N++++S
Sbjct  698   KFLSAATNSRVDS  710



>ref|XP_004976284.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like 
[Setaria italica]
Length=712

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/668 (60%), Positives = 494/668 (74%), Gaps = 8/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ F    +PSW+ QLT+RA     +LS +F+ IV KLNLTTG+IPSLNV+A LL + 
Sbjct  49    SVEQAFAGKPVPSWREQLTVRAFVVGALLSVLFSVIVMKLNLTTGIIPSLNVSASLLSYF  108

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++  WT  +   GLLKQPFTRQENTVIQTCVV++ GIAFS G  SY+ GMS TIA QA  
Sbjct  109   LVSLWTKAIESMGLLKQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSSTIAKQATE  168

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GWM+ F+++VSFVGLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  169   ANDALNIKDPHLGWMIGFMFLVSFVGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  228

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA+LAK+QV  L K FS SFL+  FQWF+ A D CGFSSFPT GL+AY  +FYFDFS+
Sbjct  229   PEGAELAKKQVRTLGKYFSLSFLWAFFQWFYTAGDDCGFSSFPTLGLEAYKNKFYFDFSA  288

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVSLL+G IISWG++WP+I TK+G WY  +L  SSL G+ GYKVF+ 
Sbjct  289   TYVGVGMICPYIVNVSLLLGGIISWGVMWPLISTKKGSWYSESLPDSSLHGLNGYKVFIT  348

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  + + +  + +      KN  A+ LPV D+       + E FD +RR
Sbjct  349   IAVILGDGLYNFLKVFIRSVCAIISVY---KNKNANTLPVSDDGTPIPTIETESFDDKRR  405

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IP  VA+GGY+ LAA+ I  +P I P LKWYHI  AY +APILAFCNAYGCG
Sbjct  406   VELFLKDQIPKVVALGGYVVLAAITIGCLPLIIPQLKWYHILAAYILAPILAFCNAYGCG  465

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI I  +W G  +GGVL GLA+CGVMMSIV T SDLMQDFKTGYLTL
Sbjct  466   LTDWSLASTYGKLAIFIIGAWAGASHGGVLVGLAACGVMMSIVGTASDLMQDFKTGYLTL  525

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGF  674
             ASP +MF SQV GTAMGC + P VFW+FYK++ +G S+ AYPAPY  +YR +A+LGVDG 
Sbjct  526   ASPRSMFISQVIGTAMGCVIAPCVFWLFYKSFDIGASDGAYPAPYTIMYRNMAILGVDGL  585

Query  673   GSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAID  494
               LP +CL L   FF  + AIN     L K +   +V +FIP PM  AIPFYLG YFAID
Sbjct  586   SLLPKHCLTLCYIFFAISFAIN-----LIKDQVPEKVAKFIPIPMAAAIPFYLGPYFAID  640

Query  493   MCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSA  314
             M +GS+ILF W WKNK +A  FGPAVASGL+CG+ LW +P A+L+LA V  PICMKFLS 
Sbjct  641   MFLGSVILFFWEWKNKAEATSFGPAVASGLMCGDGLWALPQAVLSLANVNPPICMKFLSR  700

Query  313   AANAKLES  290
             + NAK++S
Sbjct  701   SVNAKVDS  708



>ref|XP_010551587.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Tarenaya hassleriana]
Length=694

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/675 (61%), Positives = 518/675 (77%), Gaps = 15/675 (2%)
 Frame = -2

Query  2293  STERVFEK--VEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE+     P W+NQLTIRA+  S VLS +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  23    SVERIFEESGAVPPPWQNQLTIRALVVSFVLSIMFTFVVMKLNLTTGIIPSLNISAGLLG  82

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ-  1943
             F  +K+WT LL KAG LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q 
Sbjct  83    FFFVKTWTKLLHKAGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQI  142

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +   + P  +K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINS
Sbjct  143   SPEPSPPMTIKNPQLGWMIGFLFVVSFIGLFSVVPLRKIMIVDFKLTYPSGTATAHLINS  202

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K FSFSFL+G FQWFF   D CGF++FPTFGLKAYA +F+FD
Sbjct  203   FHTPQGAKLAKKQVRTLGKFFSFSFLWGFFQWFFTGGDDCGFTAFPTFGLKAYASKFFFD  262

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FSSTYVGVGM+C  ++N+S+L+GAI+SWG++WP+I  ++G WY   + +SSL G+QGY+V
Sbjct  263   FSSTYVGVGMICSYLINISVLLGAILSWGVMWPLIGAQKGKWYSSEIPASSLHGLQGYRV  322

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEK---NGPASLLPVDDEFNKGKGAQLED  1232
             F+AIAM+LGDG+++F  ++  T L ++ R R +    +  + +LPVDD   +        
Sbjct  323   FIAIAMILGDGIYSFIKVLFNTLLFYLCRCRDDLLVFDQHSFVLPVDD---RSPSFPSVS  379

Query  1231  FDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFC  1052
             FD +RRT  FLKD IP   AVGGY+  +A++IIAVPFIFP L+WY+I V Y +APILAFC
Sbjct  380   FDDKRRTELFLKDGIPAWFAVGGYVIFSAISIIAVPFIFPQLRWYYILVMYLIAPILAFC  439

Query  1051  NAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFK  872
             NA+GCGLTDWSLASNYGKIAI    +W G  NGG++AGLA+CGV+M+IVST SDLMQDFK
Sbjct  440   NAFGCGLTDWSLASNYGKIAIFAIGAWAGASNGGIIAGLAACGVIMNIVSTASDLMQDFK  499

Query  871   TGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiA  695
             TGYLTLASP +MF SQV GTAMGC ++P VFW+FY A+   G S SAYPAP+A VYR ++
Sbjct  500   TGYLTLASPRSMFISQVIGTAMGCLISPSVFWLFYTAFDGFGQSGSAYPAPFALVYRNMS  559

Query  694   LLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYL  515
             +LGV+GF +LP +CL L   FF  + A+N   + +       +  RFIP PM MAIPFYL
Sbjct  560   ILGVEGFSTLPKHCLMLCYIFFGGSFAVNGLRDAVGP-----KWSRFIPLPMAMAIPFYL  614

Query  514   GGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPI  335
             GGYFA+DMCVGSLILF+WR  NK  A  F PAVASGLICG+ +W +P +ILALAGVK PI
Sbjct  615   GGYFAVDMCVGSLILFIWRKVNKPNADAFSPAVASGLICGDGIWTLPNSILALAGVKPPI  674

Query  334   CMKFLSAAANAKLES  290
             CMKFLS++ N +++ 
Sbjct  675   CMKFLSSSDNVRVDD  689



>ref|NP_564525.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
 sp|Q6R3K4.2|YSL8_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL8; 
AltName: Full=Protein YELLOW STRIPE LIKE 8; Short=AtYSL8 [Arabidopsis 
thaliana]
 gb|AAK62655.1| At1g48370/F11A17_27 [Arabidopsis thaliana]
 gb|AAQ65095.1| At1g48370/F11A17_27 [Arabidopsis thaliana]
 gb|AEE32281.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
Length=724

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/671 (61%), Positives = 509/671 (76%), Gaps = 12/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E +FE  E+PSWK QLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  55    SVEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  114

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA Q  S
Sbjct  115   FVKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQ--S  172

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GWM+AFL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHT
Sbjct  173   GDVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHT  232

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSF +G FQWFF A + CGF+SFPTFGL+AY  +FYFDFS+
Sbjct  233   PQGAKLAKKQVRVLGKFFSFSFFWGFFQWFFTAGENCGFNSFPTFGLRAYQYKFYFDFSA  292

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLL+G I+SWG++WP+I T++G W+P N+ SSS+ G+Q YKVF+A
Sbjct  293   TYVGVGMICPYIINISLLLGGILSWGLMWPLIETRKGDWFPSNVDSSSMNGLQAYKVFIA  352

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE---DFDG  1223
             +A +LGDGL+NF  +++ T    + + R +    +SL   +D       + L     +D 
Sbjct  353   VATILGDGLYNFCKVLIRTFSGLISQIRGKAGSRSSLAHKEDP-PASPASPLTPRISYDD  411

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRRT  FLKD IP+  AVGGY+ ++AV+   +P +F  L+WY+I V Y  APILAFCNAY
Sbjct  412   QRRTRFFLKDQIPSWFAVGGYVVISAVSTAILPHMFSQLRWYYIIVIYIFAPILAFCNAY  471

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLAS YGK+AI    +W G D+GG+LAGLA+CGVMM+IVST SDL QDFKTGY
Sbjct  472   GAGLTDWSLASTYGKLAIFTIGAWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGY  531

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             LTL+SP AMF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LG
Sbjct  532   LTLSSPRAMFVSQVIGTAMGCLVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLG  591

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G  SLP +CL L   FF  AI IN+  + L       R  RF+P PM MAIPF+LG Y
Sbjct  592   VEGVSSLPRDCLMLCYVFFGVAILINLIKDCLGN-----RWGRFVPLPMAMAIPFFLGPY  646

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGS ILFVW   +  +A+ F  AVASGLICG+ +W +P+++LA+AGVK PICMK
Sbjct  647   FAIDMCVGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPICMK  706

Query  325   FLSAAANAKLE  293
             FLSAA N +++
Sbjct  707   FLSAATNHRVD  717



>emb|CBG76262.1| OO_Ba0005L10-OO_Ba0081K17.13 [Oryza officinalis]
Length=691

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/673 (59%), Positives = 505/673 (75%), Gaps = 10/673 (1%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             VES ERVFE   +P WK Q+T+RA+  S +L A+F+ IV KLNLTTG+IPSLNV+AGLLG
Sbjct  18    VESVERVFEGRVVPEWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLG  77

Query  2119  FAVIKSWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             F ++ SWT LL KAG+   +PFTRQENTV+QTCVVA SGIAFS G  SY+  MS  I+ Q
Sbjct  78    FFLLTSWTKLLHKAGVAGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQ  137

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +      +N+K  S+GWM+ FL++VSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LINS
Sbjct  138   SGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINS  197

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK QV  L K F  SF +G FQWF+   DGCGF SFPT GL+AY  +F+FD
Sbjct  198   FHTPQGAKLAKMQVKMLGKFFMMSFSWGFFQWFYTGGDGCGFMSFPTLGLEAYRNKFFFD  257

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VN+S+L+G ++SWGI+WP+I  K+G WYP +L  SSL+GI GY+V
Sbjct  258   FSATYVGVGMICPYLVNISVLLGGVMSWGIMWPLIEQKKGDWYPADLKPSSLRGIVGYRV  317

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED-FD  1226
             F++I+++LGDGL+NF  +M  T  + + + R+  + P   LP+      G G   E+ FD
Sbjct  318   FISISLILGDGLYNFLKVMTRTTTALVMQARAMMSEPT--LPISGGSGGGGGQTPEETFD  375

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              +RRT  FLKD IPN +A+  Y+ +AA++I  VP IF  L+WYH+AV Y +AP+LAFCNA
Sbjct  376   DKRRTELFLKDQIPNWLALSAYVVIAALSIATVPRIFHQLRWYHVAVTYVVAPVLAFCNA  435

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YGCGLTDWSLA+ YGK+AI    +W    +GG++AGLA+CGVM+ IVST SDL QDFKTG
Sbjct  436   YGCGLTDWSLATTYGKLAIFTVGAWADASDGGIIAGLAACGVMIGIVSTASDLTQDFKTG  495

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALL  689
             Y+TLASP +MF SQV GTAMGC + P VFW+FYKA+  +G   S YP+P A VYR +A+L
Sbjct  496   YMTLASPRSMFVSQVIGTAMGCVIAPSVFWLFYKAFHDIGMPGSEYPSPNALVYRNMAIL  555

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV G GSLP +CL+L IGFFVAAIA+N+  ++        +V RF+P PM MAIPFYLG 
Sbjct  556   GVQGLGSLPKHCLDLCIGFFVAAIAVNLARDL-----AAPKVARFLPLPMAMAIPFYLGP  610

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YF IDMC+GSL+ FVW   +  +AK F P VASGLICG+ +W +P ++LALAGVK PICM
Sbjct  611   YFGIDMCIGSLVRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQSVLALAGVKPPICM  670

Query  328   KFLSAAANAKLES  290
             KFLS + N K+++
Sbjct  671   KFLSRSTNLKVDA  683



>ref|XP_009392235.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Musa 
acuminata subsp. malaccensis]
Length=680

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/669 (61%), Positives = 503/669 (75%), Gaps = 8/669 (1%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             +S ER+F+  E+P W  QLT+R++  S +L    +FIV KLNLT G+IPSLNV+AGLLGF
Sbjct  16    QSVERMFDCQEVPPWTQQLTLRSLAVSAILGFFLSFIVMKLNLTAGIIPSLNVSAGLLGF  75

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
              ++K+WT LL K GLL QPFTRQENTVIQTCVVA SGIAFS G  SY+LGMS  +A Q  
Sbjct  76    FMVKTWTTLLEKTGLLNQPFTRQENTVIQTCVVACSGIAFSGGFGSYILGMSKKVADQFG  135

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               +   N+K  S+GW++ FL  VSFVGLFS+VPLR++MI+ YKLTYPSGTATA+LINSFH
Sbjct  136   EADTGVNMKEPSLGWLICFLLAVSFVGLFSVVPLRRIMIIAYKLTYPSGTATAHLINSFH  195

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GA LA++QV+ LFK F  SF++  FQWF+ A DGCGF SFPTFGL+AY  RFYFDFS
Sbjct  196   TPQGALLARKQVSLLFKTFGASFIWAMFQWFYTASDGCGFVSFPTFGLQAYENRFYFDFS  255

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP ++N+SL +G+IISWGI+WP I +K+G+WY  +L  SSL GI GYKVF+
Sbjct  256   ATYVGVGMICPYIINISLFLGSIISWGILWPYIRSKQGVWYDASLPESSLHGINGYKVFI  315

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             +IAM+LGDGLF+F  +   +    M  +R  K+                      FD +R
Sbjct  316   SIAMILGDGLFHFLVVFFRSSYD-MYNKRQRKDAATPFADAAALVGP-----CLSFDDRR  369

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             R++ FLKD IP  VA+ GY+  A +++IAVPFIFP LK+YHI VAY +AP+LAFCN+YGC
Sbjct  370   RSNVFLKDQIPTTVAIAGYVLFAVISVIAVPFIFPQLKFYHIIVAYIIAPVLAFCNSYGC  429

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS+YGK+AI IF +W+G +NGGVLAGLASCGVMMSIVST SDLMQD KTGYLT
Sbjct  430   GLTDWSLASSYGKLAIFIFGAWIGMNNGGVLAGLASCGVMMSIVSTASDLMQDLKTGYLT  489

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L+SP +MF SQV GTAMGC + P VFWIFY A+ LG   S YPAPYA VYR IA+LGV+G
Sbjct  490   LSSPRSMFVSQVIGTAMGCVIAPSVFWIFYSAFDLGSETSGYPAPYAKVYRGIAILGVEG  549

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               +LP  CLN    FF  + AIN   EV  KY+  +++Y +IP+ M MAIPFYLG YF I
Sbjct  550   LSALPKYCLNFCAVFFFVSFAINGLKEV-AKYK-NWKIYNYIPSAMGMAIPFYLGSYFTI  607

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLIL++W   +K+ A  F PAVASGLICG+ +W +PA++L+LA V+ PICMKFLS
Sbjct  608   DMCVGSLILYLWERADKRHATVFAPAVASGLICGDGIWSLPASLLSLAKVQPPICMKFLS  667

Query  316   AAANAKLES  290
              A N K+++
Sbjct  668   RADNDKVDA  676



>ref|XP_009113863.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Brassica rapa]
Length=714

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/673 (60%), Positives = 508/673 (75%), Gaps = 12/673 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSW  QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  44    SVEKIFESREVPSWTKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  103

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  104   FVKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQ--S  161

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  162   GDVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  221

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  222   PQGAKLAKKQVRVLGKFFSFSFLWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  281

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P ++  SS+ G+Q YKVF+A
Sbjct  282   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPADVEPSSMHGLQAYKVFIA  341

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQL--EDFD  1226
             +A++LGDGL+NF  ++   ++GL    R  +      S    ++E +     Q   E +D
Sbjct  342   VAIILGDGLYNFCKVLSRTLSGLFVQLRGTTPSFSRRSFTVQEEEEDPHASPQTPKESYD  401

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              QRRT  FLKD IP   AVGGYI ++A +   +P +F  L+WY+I V Y  AP+LAFCNA
Sbjct  402   DQRRTRFFLKDQIPTWFAVGGYITISAASTAILPHMFHQLRWYYILVIYICAPVLAFCNA  461

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YG GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTG
Sbjct  462   YGAGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTG  521

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALL  689
             YLTL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A L
Sbjct  522   YLTLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGIPNSEYPAPFATVYRSMAKL  581

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+G  SLP  CL L   FF  AI +NI  + L       R  RF+P PM MAIPF+LG 
Sbjct  582   GVEGVASLPRECLVLCYAFFSVAILVNIVKDSLPS-----RWGRFVPLPMAMAIPFFLGP  636

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDMCVGSL+LFVW   +  +A+ FG AVASGLICG+ +W  P+++LA+AGV  P+CM
Sbjct  637   YFAIDMCVGSLVLFVWERVDAAKAEAFGTAVASGLICGDGIWSFPSSVLAIAGVNPPVCM  696

Query  328   KFLSAAANAKLES  290
             KFLSAA N++++S
Sbjct  697   KFLSAATNSRVDS  709



>ref|XP_010112419.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
 gb|EXC33540.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
Length=692

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/669 (62%), Positives = 507/669 (76%), Gaps = 16/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+F   E+PSW+NQLT+RA   S VLS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  35    SVERIFASQEVPSWRNQLTVRAFVVSFVLSILFTFIVMKLNLTTGIIPSLNVSAGLLGFF  94

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K WT  L K+G+LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA  +  
Sbjct  95    FVKVWTKFLEKSGILKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSKRIAKDSSD  154

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 ++ K  S+ W++ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  155   ---TSDFKNPSLAWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  211

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A D CGF SFP+ GLKA+  +FYFDFS+
Sbjct  212   PEGAKLAKKQVRVLGKFFSFSFLWGFFQWFYTAGDDCGFGSFPSLGLKAFKHKFYFDFSA  271

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+S+L+G I+SWG++WP+I  ++G W+  +LSSSS+ G+QGYKVF+A
Sbjct  272   TYVGVGMICPYIVNISVLLGGILSWGVMWPLIENQKGDWFSASLSSSSMHGLQGYKVFIA  331

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++ +T LS M  +  E++    +LPV D  N         FD QRR
Sbjct  332   IAMILGDGLYNFIKVLGIT-LSGMYSQVRERD----VLPVAD--NSAPTKPELSFDDQRR  384

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   AV GY+ +AA++I  +P IF  LKWY+I V Y  AP LAFCNAYGCG
Sbjct  385   TELFLKDQIPTWFAVAGYVVVAAISIATLPHIFHQLKWYYILVIYIFAPTLAFCNAYGCG  444

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  445   LTDWSLASTYGKLAIFTIGAWAGSSHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  504

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   S YPAPYA VYR +A+LGV+G
Sbjct  505   ASPRSMFVSQVIGTAMGCIISPSVFWLFYKAFTDLGQPESQYPAPYAVVYRNMAILGVEG  564

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP  CL L   FF AA  IN+  + + K     +  RFIP PM MAIPFY+G YFAI
Sbjct  565   FSSLPRYCLTLCYIFFGAAFLINLVKDCINK-----KWARFIPIPMAMAIPFYIGSYFAI  619

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILFVW   NK +A  F PAVASGLICG+ +W +PA+ILALAGVK PICMKFLS
Sbjct  620   DMCVGSLILFVWTKVNKAKADAFVPAVASGLICGDGIWTLPASILALAGVKPPICMKFLS  679

Query  316   AAANAKLES  290
              A N ++++
Sbjct  680   RATNDRVDT  688



>ref|XP_010037026.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48663.1| hypothetical protein EUGRSUZ_K02319 [Eucalyptus grandis]
Length=714

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/671 (61%), Positives = 512/671 (76%), Gaps = 14/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE   +PSW  QLT RA   S +LS +F FIV KLNLT G+IPSLNV+AGLLGF 
Sbjct  51    SAERIFEGQAVPSWGRQLTFRAFAVSFMLSIMFAFIVMKLNLTAGIIPSLNVSAGLLGFF  110

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLL+ PFTRQENTVIQTCVVASSGIAFS G  SY+  MS  +A Q+  
Sbjct  111   FVKTWTKVLDKSGLLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSARVAGQSTD  170

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 +  K  S+ WM+ FL+VVSF+GLF++VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  171   PQSAHVFKNPSLAWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  230

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWF+ A DGCGF++FPT GLKA+  RFYFDFS+
Sbjct  231   PQGAKLAKKQVKALGKFFSFSFLWGFFQWFYTAGDGCGFTNFPTLGLKAFQNRFYFDFSA  290

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I T++G WYP   S +S++G+QGYKVF+A
Sbjct  291   TYVGVGMICPYIINISVLLGGILSWGLMWPLIETRKGHWYPAEASPTSMRGLQGYKVFIA  350

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA +LGDGL+NFF ++   ++GL +   R +E +    +LP+ +  +  +  Q+  +D Q
Sbjct  351   IATILGDGLYNFFKVLGRTLSGL-YHHLRDTEMS---HVLPIANG-SSPENPQVS-YDDQ  404

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AV GY+A+AA++   +P +FP LKWY+I V Y  AP L FCNAYG
Sbjct  405   RRTQLFLKDQIPTWFAVAGYVAIAAISTATLPHMFPQLKWYYILVIYLFAPTLGFCNAYG  464

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSL S YGK+AI +  +W G  +GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  465   CGLTDWSLVSTYGKLAIFVIGAWAGASHGGILAGLAACGVMMNIVSTASDLTQDFKTGYL  524

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   S YP P+  VYR++A LGV
Sbjct  525   TLASPRSMFVSQVIGTAMGCVISPCVFWLFYKAFKDLGLPGSEYPVPFGTVYRSMAELGV  584

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF SLP +CL L  GFF AA+ IN F +++ K     +  RFIP PM MAIPFY+G YF
Sbjct  585   EGFSSLPKHCLMLCYGFFAAAMIINGFRDLVGK-----KWARFIPLPMAMAIPFYIGPYF  639

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   NK +A  FGPAVASGLICG+ +W +P++ILALAGV  PICMKF
Sbjct  640   AIDMCVGSLILFIWEKINKTKADAFGPAVASGLICGDGIWTLPSSILALAGVNPPICMKF  699

Query  322   LSAAANAKLES  290
             LS AAN ++++
Sbjct  700   LSRAANKRVDA  710



>ref|XP_010465820.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Camelina sativa]
Length=711

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/671 (60%), Positives = 513/671 (76%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  43    SVEKIFESREVPSWKKQLTLRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  102

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  103   FVKTWTKMLHRSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQ--S  160

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+    VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  161   GDAYRGVKNPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  220

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P G KLAK+QV  L K FS SFL+  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  221   PQGVKLAKKQVRVLGKFFSISFLWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  280

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P N+ SSS+ G+Q YKVF+A
Sbjct  281   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPDNVPSSSMHGLQAYKVFIA  340

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL F++ R +  +   +   ++++ +    +  + +D Q
Sbjct  341   VAIILGDGLYNFCKVLSRTLSGL-FVQLRGTTTSISRTSFTLEEDPHASPLSPKQSYDDQ  399

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  400   RRTRFFLKDQIPTWFAVGGYIIIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYG  459

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  460   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYL  519

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LGV
Sbjct  520   TLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGV  579

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF  AI +NI  + L     K +  RFIP PM MAIPF+LG YF
Sbjct  580   EGVSSLPRECLVLCYAFFSVAILVNIVKDSL-----KSKWGRFIPLPMAMAIPFFLGPYF  634

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +  +A+ FG AVASGLICG+ +W +P+++LA+AGV  P+CMKF
Sbjct  635   AIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKF  694

Query  322   LSAAANAKLES  290
             LSAA N+K+++
Sbjct  695   LSAATNSKVDN  705



>gb|AAL09744.1| AT3g17650/MKP6_20 [Arabidopsis thaliana]
 gb|AAN46868.1| At3g17650/MKP6_20 [Arabidopsis thaliana]
Length=714

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/671 (59%), Positives = 512/671 (76%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S +LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  46    SVEKIFESREVPSWKKQLTVRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  105

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  106   FVKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQ--S  163

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  164   GDVSRGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  223

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
               GAKLAK+QV  L K FS SF +  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  224   TQGAKLAKKQVRVLGKFFSLSFFWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  283

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P N+ SSS+ G+Q YKVF+A
Sbjct  284   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPDNVPSSSMHGLQAYKVFIA  343

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL F++ R    +   +   ++++ +    +  + +D Q
Sbjct  344   VAIILGDGLYNFCKVLSRTLSGL-FVQLRGPTTSISRTSFTLEEDPHASPLSPKQSYDDQ  402

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  403   RRTRFFLKDQIPTWFAVGGYITIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYG  462

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  463   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYL  522

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  N+ YPAP+A VYR++A LGV
Sbjct  523   TLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGLPNTEYPAPFATVYRSMAKLGV  582

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF  AI +NI  + L          RFIP PM MAIPF+LG YF
Sbjct  583   EGVASLPRECLVLCYAFFGVAILVNIVKDSLHS-----NWGRFIPLPMAMAIPFFLGPYF  637

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +  +A+ FG AVASGLICG+ +W +P+++LA+AGV  P+CMKF
Sbjct  638   AIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKF  697

Query  322   LSAAANAKLES  290
             LS+A N+K+++
Sbjct  698   LSSATNSKVDN  708



>ref|XP_010505667.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Camelina sativa]
Length=711

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/670 (60%), Positives = 512/670 (76%), Gaps = 11/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  43    SVEKIFESREVPSWKKQLTLRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  102

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  103   FVKTWTKMLHRSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQ--S  160

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+    VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  161   GDAYRGVKNPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  220

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P G KLAK+QV  L K FS SFL+  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  221   PQGVKLAKKQVRVLGKFFSISFLWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  280

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P N+ SSS+ G+Q YKVF+A
Sbjct  281   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPDNVPSSSMHGLQAYKVFIA  340

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL F++ R +  +   +   ++++ +    +  + +D Q
Sbjct  341   VAIILGDGLYNFCKVLSRTLSGL-FVQLRGTTTSISRTSFTLEEDPHASPLSPKQSYDDQ  399

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  400   RRTRFFLKDQIPTWFAVGGYIIIAATSTAILPNMFHQLRWYYILVIYICAPVLAFCNAYG  459

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  460   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYL  519

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LGV
Sbjct  520   TLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGV  579

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF  AI +NI  + L     K +  RFIP PM MAIPF+LG YF
Sbjct  580   EGVSSLPRECLVLCYAFFSVAILVNIVKDSL-----KSKWGRFIPLPMAMAIPFFLGPYF  634

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +  +A+ FG AVASGLICG+ +W +P+++LA+AGV  P+CMKF
Sbjct  635   AIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKF  694

Query  322   LSAAANAKLE  293
             LSAA N+K++
Sbjct  695   LSAATNSKVD  704



>ref|XP_006393421.1| hypothetical protein EUTSA_v10011269mg [Eutrema salsugineum]
 gb|ESQ30707.1| hypothetical protein EUTSA_v10011269mg [Eutrema salsugineum]
Length=721

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/668 (61%), Positives = 508/668 (76%), Gaps = 9/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E +FE  E+PSWK QLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  55    SVEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  114

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA Q  S
Sbjct  115   FVKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSERIAIQ--S  172

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GW++AFL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  173   GDVARGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  232

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSF +G FQWFF   D CGF +FPTFGL+AY  +FYFDFS+
Sbjct  233   PQGAKLAKKQVRVLGKFFSFSFFWGFFQWFFTGGDNCGFHNFPTFGLRAYQYKFYFDFSA  292

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLL+G I+SWG++WP+I TK+G W+P N+ SSS+ G+Q YKVF+A
Sbjct  293   TYVGVGMICPYIINISLLLGGILSWGLMWPLIETKKGDWFPSNVDSSSMNGLQAYKVFIA  352

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             +AM+LGDG++NF  ++  T LS +  +   K G  + L  ++E           +D QRR
Sbjct  353   VAMILGDGVYNFCKVLSRT-LSGLSSQIRGKAGSRTSLSHEEEPPASPLTPKVSYDDQRR  411

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP+ +A  GY+A+AA +   +P +FP L+WY+I V Y  AP+LAFCNAYG G
Sbjct  412   TRFFLKDQIPSWLAGVGYVAIAAASTAILPQMFPQLRWYYILVIYVFAPVLAFCNAYGAG  471

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G D+GG+LAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  472   LTDWSLASTYGKLAIFTIGAWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  531

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             +SP AMF SQV GTAMGC ++P VFW+FY+A+  LG  +S YPAP+A VYR++A LGV+G
Sbjct  532   SSPRAMFVSQVIGTAMGCLVSPCVFWLFYEAFDDLGLPSSRYPAPFATVYRSMAKLGVEG  591

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP +CL L   FF  AI IN+  + L       R  RF+P PM MAIPF+LG YFAI
Sbjct  592   VSSLPRDCLVLCYAFFGVAIFINLVRDGLGD-----RWGRFVPLPMAMAIPFFLGPYFAI  646

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILFVW   +  +A+ F   VASGLICG+ +W +P+++LA+AGVK PICMKFLS
Sbjct  647   DMCVGSLILFVWERLDAAKAEAFATVVASGLICGDGIWTLPSSVLAIAGVKPPICMKFLS  706

Query  316   AAANAKLE  293
             +A N +++
Sbjct  707   SATNHRVD  714



>ref|XP_006297072.1| hypothetical protein CARUB_v10013074mg [Capsella rubella]
 gb|EOA29970.1| hypothetical protein CARUB_v10013074mg [Capsella rubella]
Length=714

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/671 (60%), Positives = 512/671 (76%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S +LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  46    SVEKIFESREVPSWKKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  105

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  106   FVKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQ--S  163

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+    VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  164   GDGYRGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  223

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SF +  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  224   PLGAKLAKKQVRVLGKFFSISFFWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  283

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P N+ SSS+ G+Q YKVF+A
Sbjct  284   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPDNVPSSSMHGLQAYKVFIA  343

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL F++ R    +   +   ++++ +    +  + +D Q
Sbjct  344   VAIILGDGLYNFCKVLSRTLSGL-FVQLRGPTTSISRTSFTLEEDPHASPLSPKQSYDDQ  402

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  403   RRTRFFLKDQIPTWFAVGGYIIIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYG  462

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  463   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYL  522

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LGV
Sbjct  523   TLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGV  582

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF  AI INI  + L+      R  RFIP PM MAIPF+LG YF
Sbjct  583   EGVSSLPRECLVLCYAFFGVAILINIVKDSLQS-----RWGRFIPLPMAMAIPFFLGPYF  637

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +   A+ FG AVASGLICG+ +W +P+++LA+AGV  P+CMKF
Sbjct  638   AIDMCVGSLILFIWERVDAANAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKF  697

Query  322   LSAAANAKLES  290
             LS A N+K+++
Sbjct  698   LSTATNSKVDN  708



>emb|CAH67887.1| OSIGBa0153E02-OSIGBa0093I20.16 [Oryza sativa Indica Group]
 gb|EAY94901.1| hypothetical protein OsI_16701 [Oryza sativa Indica Group]
Length=712

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/668 (59%), Positives = 495/668 (74%), Gaps = 8/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ F    +PSW+ QLT+RA     +LS +FN IV KL+LTTGVIPSLNV+A LLGF 
Sbjct  49    SVEQAFADKPVPSWREQLTVRAFVVGFLLSIMFNIIVMKLSLTTGVIPSLNVSASLLGFF  108

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             +++ WTA + + G LKQPFTRQENTVIQTCVV++ G+AFS G  SY+ GMS TIA QA  
Sbjct  109   LVRLWTAAIERVGFLKQPFTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATE  168

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N P N+K   +GW++ F+++VSFVGLF++VP+RK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  169   ANDPMNIKNPHLGWIIGFMFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHT  228

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA LAK+QV  L K FS SFL+  FQWF+ A D CGFSSFPTFGL+A+  RFYFDFS 
Sbjct  229   PEGADLAKKQVRTLGKYFSISFLWAFFQWFYTAGDNCGFSSFPTFGLEAFKNRFYFDFSP  288

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVSLLIG IISWGI+WP+I  K+G WYP  L  SSL G+Q YKVF+ 
Sbjct  289   TYVGVGMICPYIVNVSLLIGGIISWGIMWPLISKKKGSWYPETLPESSLLGLQAYKVFIT  348

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +   T   F+      KN  ++ LP+ D        + E FD +RR
Sbjct  349   IAVILGDGLYNFVKVFGYTIKGFIVMY---KNKNSNTLPISDNGTPANATEEESFDDKRR  405

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IP  VA+GGY+ LA +    +P I P LKWY+I +AY  API+AFCNAYG G
Sbjct  406   NELFLKDQIPKTVAIGGYVVLAVITSGCLPLIIPQLKWYYILIAYIFAPIMAFCNAYGSG  465

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLA+ YGK+AI +F +W G  +GGVL GLA+CGVMM+IV T SDLMQDFKTGY+TL
Sbjct  466   LTDWSLATTYGKLAIFVFGAWAGASHGGVLVGLAACGVMMNIVGTASDLMQDFKTGYMTL  525

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGF  674
             ASP +MF SQV GTAMGC + P VFW+FYK++ +G S+ AYPAPY  +YR +A+LGV+G 
Sbjct  526   ASPRSMFVSQVIGTAMGCVIAPCVFWLFYKSFDIGASDGAYPAPYTIMYRNMAILGVNGL  585

Query  673   GSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAID  494
              SLP  CL L    FVAA  IN+  +++ +     RV ++IP PM  AIPFYLG YFAID
Sbjct  586   SSLPKYCLTLCYIAFVAAFIINLIKDLVPE-----RVAKYIPIPMAAAIPFYLGPYFAID  640

Query  493   MCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSA  314
             M +GS+IL+ W W+NK +A+ FGPAVASGL+CG+ LW +P A+L+L  V  P+CMKFLS 
Sbjct  641   MFMGSVILYFWEWRNKDEAQSFGPAVASGLMCGDGLWALPQAVLSLVNVNPPLCMKFLSR  700

Query  313   AANAKLES  290
             AANAK+++
Sbjct  701   AANAKVDT  708



>gb|KCW57904.1| hypothetical protein EUGRSUZ_H00651 [Eucalyptus grandis]
Length=683

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/659 (63%), Positives = 507/659 (77%), Gaps = 13/659 (2%)
 Frame = -2

Query  2284  RVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIK  2105
             + FE  E+PSW+ QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF  IK
Sbjct  32    KAFESKEVPSWRQQLTVRAFAVSFVLSVMFSFIVMKLNLTTGIIPSLNVSAGLLGFFFIK  91

Query  2104  SWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNI  1925
             +WT +L K+G+L+ PFTRQENTVIQTCVVASSGIAFS G  SY+  MS  IA+QAESG  
Sbjct  92    TWTKVLEKSGMLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSGRIASQAESGPG  151

Query  1924  PNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNG  1745
              N+ K  S+GW++ FL++VSFVGL S+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP G
Sbjct  152   TNDYKDPSLGWIIGFLFIVSFVGLLSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTPEG  211

Query  1744  AKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYV  1565
             AKLAK+QV AL K FSFSFL+  FQWF+ A D CGF +FPT G+KAY  +FYFDFS+TYV
Sbjct  212   AKLAKKQVRALGKFFSFSFLWAFFQWFYTAADYCGFVNFPTLGVKAYENKFYFDFSATYV  271

Query  1564  GVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAM  1385
             GVGM+CP ++N+SLLIG I+SWG++WP+I  KEG WY       ++ GIQGYKVF++IAM
Sbjct  272   GVGMICPYIINISLLIGGILSWGLMWPLIEKKEGDWY-DKPDPGNMHGIQGYKVFISIAM  330

Query  1384  MLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHN  1205
             +LGDGL+NF  ++  T L  +  + S+KN     LP     +  +  QL  FD QRRT  
Sbjct  331   ILGDGLYNFCKVLSRTLLG-LYHQLSKKNS----LPRVANGSPPESPQLS-FDEQRRTSL  384

Query  1204  FLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTD  1025
             FL D I +  AVGGYI +A ++I+++P IF  LKWYHI V Y  APILAFCNAYGCGLTD
Sbjct  385   FLNDQISSIFAVGGYIVIAVISIVSLPHIFHQLKWYHILVVYLAAPILAFCNAYGCGLTD  444

Query  1024  WSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASP  845
             WSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGY+TLASP
Sbjct  445   WSLASTYGKLAIFVIGAWAGASHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYMTLASP  504

Query  844   LAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDGFGS  668
              +MF SQV GTAMGC ++P VFW+FYKA+  LG   S YPAPYA++YR++A+LGV+GF S
Sbjct  505   RSMFLSQVVGTAMGCVISPSVFWLFYKAFKDLGLKTSTYPAPYASIYRSMAILGVEGFSS  564

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP +CL L  GFF AAI IN   +++ K   KY   RFIP PM MAIPFYLG YFAIDMC
Sbjct  565   LPKHCLTLCYGFFAAAIVINAIRDLVPK---KYS--RFIPVPMAMAIPFYLGSYFAIDMC  619

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAA  311
             +GSLILF+W   +K +A  F PAVASGLICG+ +W +P++ILAL GVK PICMKFLS A
Sbjct  620   IGSLILFLWERMDKTKADAFAPAVASGLICGDGIWTLPSSILALVGVKPPICMKFLSRA  678



>ref|XP_009420946.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=697

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/672 (60%), Positives = 505/672 (75%), Gaps = 14/672 (2%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             +  S E  F+   +P W+ QLT RA   SLVL A+F+ IV KLNLTTGVIPSLNV+AGLL
Sbjct  33    EAPSIESEFDGERVPPWREQLTARAFAVSLVLGAMFSVIVMKLNLTTGVIPSLNVSAGLL  92

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  +++WT  L +AGLL+QPFTRQENTVIQTCVVA+SGIA S G  SY+  MS TIA Q
Sbjct  93    GFFFVRTWTVALGRAGLLRQPFTRQENTVIQTCVVATSGIASSGGFGSYLFAMSETIAKQ  152

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +   N   N+K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LINS
Sbjct  153   STEANDSQNIKNPKLGWMIGFLFVVSFLGLFSLVPLRKIMIVDYKLIYPSGTATAHLINS  212

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K F+ SFL+G FQWF+ A D CGF++FPT GL+AY  +FYFD
Sbjct  213   FHTPQGAKLAKKQVRTLGKFFTVSFLWGFFQWFYTAGDDCGFAAFPTLGLQAYQNKFYFD  272

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VN+S+L+G I+SWGI+WP+I  K+G WY  +L S+SL+G+QGY+V
Sbjct  273   FSATYVGVGMICPYLVNISVLLGGILSWGIMWPLIGAKKGDWYSADLPSTSLQGLQGYRV  332

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+AIA++LGDGL+NFF ++  T  +F+ + RS+ +  A+ LP  D+ +          D 
Sbjct  333   FIAIALILGDGLYNFFKVLSKTVAAFVTQIRSKSS--ATPLPFSDDTSA------VTIDD  384

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRR   FLKD IP  +A GGY+ +AAV+   +P I P L+WY++ VAY  AP+LAFCNAY
Sbjct  385   QRRVQLFLKDQIPKPIAYGGYLVVAAVSTATLPHIIPQLRWYYVLVAYVFAPVLAFCNAY  444

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLAS YGK+AI    +W G   GGVLAGLA+CGVMMSIVST SDLMQDFKTGY
Sbjct  445   GAGLTDWSLASTYGKLAIFTIGAWAGASRGGVLAGLAACGVMMSIVSTASDLMQDFKTGY  504

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLG  686
             LTLASP +MF SQV GTAMGC + P VFW+F KA+  +G   + YP+P A VYR +A+LG
Sbjct  505   LTLASPRSMFVSQVIGTAMGCVIAPSVFWLFLKAFEDIGVPGTEYPSPNALVYRNMAILG  564

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+GF SLP +CL L   FF+AA+ +N   +V+ K     +  RFIP PM +AIPFYLG  
Sbjct  565   VEGFSSLPKHCLVLCYVFFLAAVLVNASRDVVGK-----KAARFIPLPMAIAIPFYLGSA  619

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSL+LF+W   +K +A+ FGPAVASGLICG+ +W +P ++LALA VK PICMK
Sbjct  620   FAIDMCVGSLMLFIWERTDKAKAEAFGPAVASGLICGDGIWTLPQSVLALAKVKPPICMK  679

Query  325   FLSAAANAKLES  290
             FLS + N K+++
Sbjct  680   FLSRSMNEKVDA  691



>ref|XP_002891428.1| hypothetical protein ARALYDRAFT_473974 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67687.1| hypothetical protein ARALYDRAFT_473974 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/668 (61%), Positives = 508/668 (76%), Gaps = 9/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E +FE  E+PSWKNQLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  55    SVEGIFESREVPSWKNQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  114

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA Q  S
Sbjct  115   FVKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQ--S  172

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GWM+AFL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHT
Sbjct  173   GDVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHT  232

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSF +G FQWFF A + CGF+SFPTFGL+AY  +FYFDFS+
Sbjct  233   PQGAKLAKKQVRVLGKFFSFSFFWGFFQWFFTAGENCGFNSFPTFGLRAYQYKFYFDFSA  292

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLL+G I+SWG++WP+I T++G W+P N+ SSS+ G+Q YKVF+A
Sbjct  293   TYVGVGMICPYIINISLLLGGILSWGLMWPLIETRKGDWFPSNVDSSSMNGLQAYKVFIA  352

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             +AM+LGDGL+NF  ++  T    + + R + +   SL   +D        ++  +D QRR
Sbjct  353   VAMILGDGLYNFCKVLYRTLSGLVSQIRGKADSRTSLAHEEDPPASPLTPKIS-YDDQRR  411

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP+  A+GGY+ ++AV+   +P +F  L+WY+I V Y  APILAFCNAYG G
Sbjct  412   TRFFLKDQIPSWFAIGGYVVISAVSTAILPHMFSQLRWYYIIVIYVFAPILAFCNAYGAG  471

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G D+GG+LAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  472   LTDWSLASTYGKLAIFTIGAWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  531

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             +SP AMF SQ+ GTAMGC ++P VF +FYKA+  LG  NS YPAP+A VYR++A LGV+G
Sbjct  532   SSPRAMFVSQMIGTAMGCLVSPCVFLLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGVEG  591

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP +CL L   FF  A  IN+  + L       R  RF+P PM MAIPF+LG YFAI
Sbjct  592   VSSLPRDCLVLCYSFFAVAGLINLIKDGLGN-----RWGRFVPLPMAMAIPFFLGPYFAI  646

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILFVW   +  +A+ F  AVASGLICG+ +W +P+++LA+AGVK PICMKFLS
Sbjct  647   DMCVGSLILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPICMKFLS  706

Query  316   AAANAKLE  293
              A N +++
Sbjct  707   GATNHRVD  714



>sp|Q7X660.1|YSL11_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL11; 
AltName: Full=Protein YELLOW STRIPE LIKE 11; Short=OsYSL11 
[Oryza sativa Japonica Group]
 emb|CAE05635.1| OSJNBa0038O10.1 [Oryza sativa Japonica Group]
 emb|CAI44638.1| OSJNBb0065J09.18 [Oryza sativa Japonica Group]
 gb|EAZ31387.1| hypothetical protein OsJ_15515 [Oryza sativa Japonica Group]
Length=712

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/668 (59%), Positives = 495/668 (74%), Gaps = 8/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ F    +PSW+ QLT+RA     +LS +FN IV KL+LTTGVIPSLNV+A LLGF 
Sbjct  49    SVEQAFADKPVPSWREQLTVRAFVVGFLLSIMFNIIVMKLSLTTGVIPSLNVSASLLGFF  108

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             +++ WTA + + G LKQPFTRQENTVIQTCVV++ G+AFS G  SY+ GMS TIA QA  
Sbjct  109   LVRLWTAAIERVGFLKQPFTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATE  168

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N P N+K   +GW++ F+++VSFVGLF++VP+RK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  169   ANDPMNIKNPHLGWIIGFMFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHT  228

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA LAK+QV  L K FS SFL+  FQWF+ A D CGFSSFPTFGL+A+  RFYFDFS 
Sbjct  229   PEGADLAKKQVRTLGKYFSISFLWAFFQWFYTAGDNCGFSSFPTFGLEAFKNRFYFDFSP  288

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVSLLIG IISWGI+WP+I  K+G WYP  L  SSL G+Q YKVF+ 
Sbjct  289   TYVGVGMICPYIVNVSLLIGGIISWGIMWPLISKKKGSWYPETLPESSLLGLQAYKVFIT  348

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +   T   F+      KN  ++ LP+ D        + E FD +RR
Sbjct  349   IAVILGDGLYNFVKVFGYTIKGFIVMY---KNKNSNTLPISDNGTPANATEEESFDDKRR  405

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IP  VA+GGY+ LA +    +P I P LKWY+I +AY  API+AFCNAYG G
Sbjct  406   NELFLKDQIPKTVAIGGYVVLAVITSGCLPLIIPQLKWYYILIAYIFAPIMAFCNAYGSG  465

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLA+ YGK+AI +F +W G  +GGVL GLA+CGVMM+IV T SDLMQDFKTGY+TL
Sbjct  466   LTDWSLATTYGKLAIFVFGAWAGASHGGVLVGLAACGVMMNIVGTASDLMQDFKTGYMTL  525

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGF  674
             ASP +MF SQV GTAMGC + P VFW+FYK++ +G S+ AYPAPY  +YR +A+LGV+G 
Sbjct  526   ASPRSMFVSQVIGTAMGCVIAPCVFWLFYKSFNIGASDGAYPAPYTIMYRNMAILGVNGL  585

Query  673   GSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAID  494
              SLP  CL L    FVAA  IN+  +++ +     RV ++IP PM  AIPFYLG YFAID
Sbjct  586   SSLPKYCLTLCYIAFVAAFIINLIKDLVPE-----RVAKYIPIPMAAAIPFYLGPYFAID  640

Query  493   MCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSA  314
             M +GS+IL+ W W+NK +A+ FGPAVASGL+CG+ LW +P A+L+L  V  P+CMKFLS 
Sbjct  641   MFMGSVILYFWEWRNKDEAQSFGPAVASGLMCGDGLWALPQAVLSLVNVNPPLCMKFLSR  700

Query  313   AANAKLES  290
             AANAK+++
Sbjct  701   AANAKVDT  708



>ref|NP_001185468.1| yellow stripe-like transporter 12 [Zea mays]
 gb|ADO20999.1| yellow stripe-like transporter 12 [Zea mays]
 gb|AFW58896.1| hypothetical protein ZEAMMB73_279911 [Zea mays]
Length=718

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/668 (61%), Positives = 502/668 (75%), Gaps = 13/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER F    +PSW+ QLT+RA   S  L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  58    SVERAFADQAVPSWREQLTVRAFVVSFFLAIMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  117

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + + GLL+QPFTRQENTVIQTCVVA+  IAFS G  +Y+ GMS TIA QA  
Sbjct  118   FVRLWTAAIERVGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATE  177

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              + P NVK   IGWM+ FL++VSF+GLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  178   ADNPQNVKNPHIGWMIGFLFLVSFIGLFALVPLRKVMIVDYKLTYPSGTATAYLINGFHT  237

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K F  SFL+G FQWF+   D CGF +FPT GL+AY  +FYFDFS 
Sbjct  238   PEGAKLAKKQVKTLGKFFLMSFLWGFFQWFYTGGDNCGFQNFPTLGLQAYKNKFYFDFSP  297

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  ++G WY  +L  SSL G+QGY+VF++
Sbjct  298   TYVGVGMICPHIVNVSVLLGGILSWGIMWPLIGNQKGNWYDASLPESSLHGLQGYRVFIS  357

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +++ T   F+   +  KN   S LPV +  N     +   FD +RR
Sbjct  358   IAIILGDGLYNFVKVLIRTTAGFISMMK--KN---STLPVSN--NGSPITEGVSFDDERR  410

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IP +VA GGY+A+AA++I  +P +FP LKWY+I VAY  AP+LAFCNAYG G
Sbjct  411   RDLFLKDQIPRSVAYGGYVAVAAISIGTLPQVFPQLKWYYILVAYIFAPVLAFCNAYGTG  470

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI IF +W G  NGGVL GLA+CGVMMSIVST +DLMQD KTGYLTL
Sbjct  471   LTDWSLASTYGKLAIFIFGAWAGASNGGVLVGLAACGVMMSIVSTAADLMQDLKTGYLTL  530

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAPYA VYR +A+LGVDG
Sbjct  531   ASPRSMFISQVIGTAMGCVIAPCVFWLFYKAFADIGLSGSEYPAPYAIVYRNMAILGVDG  590

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AAI +N+  +++ K     +V RFIP PM MAIPFYLG +FAI
Sbjct  591   FSSLPKNCLTLCYIFFAAAIVVNLVRDLVPK-----KVARFIPLPMAMAIPFYLGSFFAI  645

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G++ILF W   NK +A  F PAVASGLICG+ +W +P +ILALA VK PICMKFLS
Sbjct  646   DMFIGTVILFAWETINKAKANAFAPAVASGLICGDGIWTLPQSILALAKVKPPICMKFLS  705

Query  316   AAANAKLE  293
              + NA+++
Sbjct  706   RSVNAQVD  713



>ref|XP_002446810.1| hypothetical protein SORBIDRAFT_06g023020 [Sorghum bicolor]
 gb|EES11138.1| hypothetical protein SORBIDRAFT_06g023020 [Sorghum bicolor]
Length=723

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/670 (59%), Positives = 496/670 (74%), Gaps = 8/670 (1%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S E+ FE   +PSW+ QLT+RA     +LS +F+ IV KLNLTTG+IPSLNV+A LLG
Sbjct  58    VASVEQAFEDKPVPSWREQLTVRAFVVGFILSILFSVIVMKLNLTTGIIPSLNVSASLLG  117

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F +++ WT  +   GLLKQPFTRQENTVIQTCVV++ G+AFS G  SY+ GMS +IA QA
Sbjct  118   FFLVRLWTKAIESMGLLKQPFTRQENTVIQTCVVSAYGLAFSGGFGSYLFGMSRSIAEQA  177

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N   N+K   +GWM+ F+++VSFVGLF +VPLRK+MI+ YKLTYPSGTATAYLIN F
Sbjct  178   TEANDAQNIKDPHLGWMIGFMFLVSFVGLFVLVPLRKVMIVDYKLTYPSGTATAYLINGF  237

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA+ +K+QV  L K FS SFL+  FQWF+ A D CGF+SFP+ GL+AY  +FYFDF
Sbjct  238   HTPQGAERSKKQVRTLGKYFSLSFLWAFFQWFYTAGDDCGFTSFPSLGLEAYKNKFYFDF  297

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP +VNVSLL+G IISWG++WP+I TK+G WYP +L  SSL G+ GYKVF
Sbjct  298   SATYVGVGMICPYIVNVSLLLGGIISWGVMWPLISTKKGSWYPESLPDSSLHGLNGYKVF  357

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             + I+++LGDGL+NF  +   T  +F+     +    A+ LPV D        + E FD +
Sbjct  358   ITISVILGDGLYNFLKVFGNTIRAFISMYWKKH---ANTLPVSDNGGPPATTETESFDDK  414

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR   F+KD IP +VA+GGY+ LAA+ I  +P I   +KWYHI VAY  APILAFCNAYG
Sbjct  415   RRIELFVKDQIPKSVALGGYVCLAAITIGCLPLIISQIKWYHILVAYIFAPILAFCNAYG  474

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI +  +W G  +GGVL GLA+CGVMMSIV T SDLMQDFKTGYL
Sbjct  475   CGLTDWSLASTYGKLAIFVIGAWAGASHGGVLVGLAACGVMMSIVGTASDLMQDFKTGYL  534

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVD  680
             TLASP +MF SQV GTA+GC + P VFW+FYK++ +G S  AYPAPYA +YR +++LGVD
Sbjct  535   TLASPRSMFISQVIGTAIGCVVAPCVFWLFYKSFDIGVSGGAYPAPYAIMYRNMSILGVD  594

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             G   LP NCL L   FF  + AIN+  ++L +     +V +FIP PM  AIPFYLG YFA
Sbjct  595   GLSLLPKNCLTLCYIFFAVSFAINLIKDLLPQ-----KVAKFIPIPMAAAIPFYLGPYFA  649

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDM +GS+ILF W WKNK +A  F PAVASGL+CG+ LW +P A+L+LA V  PICMKFL
Sbjct  650   IDMFLGSVILFFWEWKNKAEADTFTPAVASGLMCGDGLWALPQAVLSLANVNPPICMKFL  709

Query  319   SAAANAKLES  290
             S + NAK+++
Sbjct  710   SRSVNAKVDT  719



>ref|XP_006300806.1| hypothetical protein CARUB_v10019889mg [Capsella rubella]
 gb|EOA33704.1| hypothetical protein CARUB_v10019889mg [Capsella rubella]
Length=694

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/672 (62%), Positives = 520/672 (77%), Gaps = 16/672 (2%)
 Frame = -2

Query  2293  STERVFEKV-EIPS-WKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ERVFE+  E+P  W+NQLT RA+  S +L+ +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  31    SVERVFEQSNEVPPPWQNQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLG  90

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT +L KAG+LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+
Sbjct  91    FFFVKTWTKILNKAGVLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVIAKQS  150

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N   N+K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA LINSF
Sbjct  151   AEANSAMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATATLINSF  210

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + + CGF++FPTFGLKAY  +FYFDF
Sbjct  211   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGEDCGFANFPTFGLKAYENKFYFDF  270

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLLIG+I+SWG++WP+I  ++G WY  +L  S+L G+QGY+VF
Sbjct  271   SATYVGVGMICPYLINVSLLIGSILSWGVMWPLIGAQKGKWYSADLRDSNLHGLQGYRVF  330

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             + IAM+LGDGL+NF   + V G +     +  KN  A  LP++D+ +     ++  +D +
Sbjct  331   IGIAMILGDGLYNF---IKVLGRTIFGLYKQFKNKDA--LPINDDRSSPDIVKIS-YDDK  384

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+  A+ GY+ LA V+II VP IF  LKWYHI   Y +AP+LAFCNAYG
Sbjct  385   RRTELFLKDKIPSWFAITGYVVLAIVSIITVPHIFHQLKWYHILTMYIIAPVLAFCNAYG  444

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  445   CGLTDWSLASTYGKLAIFTIGAWAGAANGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  504

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P LG   SAYPAPYAAVYR +++LGV
Sbjct  505   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPELGQQESAYPAPYAAVYRNMSILGV  564

Query  682   DGFGSLPTNCLNLAIGFFVAAIAIN-IFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             +GF +LP +CL L   FF AA+ +N +   V  K+       RFIP PM MAIPFY+GGY
Sbjct  565   EGFSALPKHCLVLCYIFFAAAVIVNGVRDAVGSKWA------RFIPLPMAMAIPFYIGGY  618

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             F IDMCVGSLILF+WR  NK +A  +  AVASGLICGE +W +P+++LALAGVK PICMK
Sbjct  619   FTIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLPSSVLALAGVKPPICMK  678

Query  325   FLSAAANAKLES  290
             FLS++AN K++S
Sbjct  679   FLSSSANKKVDS  690



>ref|XP_010025985.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=827

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/662 (63%), Positives = 509/662 (77%), Gaps = 13/662 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE  E+PSW+ QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  173   SVEKAFESKEVPSWRQQLTVRAFAVSFVLSVMFSFIVMKLNLTTGIIPSLNVSAGLLGFF  232

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT +L K+G+L+ PFTRQENTVIQTCVVASSGIAFS G  SY+  MS  IA+QAES
Sbjct  233   FIKTWTKVLEKSGMLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSGRIASQAES  292

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G   N+ K  S+GW++ FL++VSFVGL S+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  293   GPGTNDYKDPSLGWIIGFLFIVSFVGLLSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  352

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+  FQWF+ A D CGF +FPT G+KAY  +FYFDFS+
Sbjct  353   PEGAKLAKKQVRALGKFFSFSFLWAFFQWFYTAADYCGFVNFPTLGVKAYENKFYFDFSA  412

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLLIG I+SWG++WP+I  KEG WY       ++ GIQGYKVF++
Sbjct  413   TYVGVGMICPYIINISLLIGGILSWGLMWPLIEKKEGDWY-DKPDPGNMHGIQGYKVFIS  471

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T L  +  + S+KN     LP     +  +  QL  FD QRR
Sbjct  472   IAMILGDGLYNFCKVLSRTLLG-LYHQLSKKNS----LPRVANGSPPESPQLS-FDEQRR  525

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FL D I +  AVGGYI +A ++I+++P IF  LKWYHI V Y  APILAFCNAYGCG
Sbjct  526   TSLFLNDQISSIFAVGGYIVIAVISIVSLPHIFHQLKWYHILVVYLAAPILAFCNAYGCG  585

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGY+TL
Sbjct  586   LTDWSLASTYGKLAIFVIGAWAGASHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYMTL  645

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   S YPAPYA++YR++A+LGV+G
Sbjct  646   ASPRSMFLSQVVGTAMGCVISPSVFWLFYKAFKDLGLKTSTYPAPYASIYRSMAILGVEG  705

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL L  GFF AAI IN   +++ K   KY   RFIP PM MAIPFYLG YFAI
Sbjct  706   FSSLPKHCLTLCYGFFAAAIVINAIRDLVPK---KYS--RFIPVPMAMAIPFYLGSYFAI  760

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLILF+W   +K +A  F PAVASGLICG+ +W +P++ILAL GVK PICMKFLS
Sbjct  761   DMCIGSLILFLWERMDKTKADAFAPAVASGLICGDGIWTLPSSILALVGVKPPICMKFLS  820

Query  316   AA  311
              A
Sbjct  821   RA  822



>gb|KFK36098.1| hypothetical protein AALP_AA4G077100 [Arabis alpina]
Length=713

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/664 (61%), Positives = 506/664 (76%), Gaps = 9/664 (1%)
 Frame = -2

Query  2281  VFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKS  2102
             +FE  E+PSWK QLTIRA   S  LS +F+FIV KLNLTTG+IP+LNV+AGLLGF  +K+
Sbjct  51    IFESREVPSWKKQLTIRAFVVSFFLSILFSFIVMKLNLTTGIIPTLNVSAGLLGFFFVKT  110

Query  2101  WTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIP  1922
             WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA Q  SG+  
Sbjct  111   WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSERIANQ--SGDAA  168

Query  1921  NNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGA  1742
               +K  S+GW++AFL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHTP GA
Sbjct  169   RGIKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTPQGA  228

Query  1741  KLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVG  1562
             KLAK+QV  L K FS SF +G FQWFF A + CGF+SFPTFGLKAY  +FYFDFS+TYVG
Sbjct  229   KLAKKQVRVLGKFFSLSFFWGFFQWFFTAGENCGFNSFPTFGLKAYQYKFYFDFSATYVG  288

Query  1561  VGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMM  1382
             VGM+CP ++N+SLL+G I+SWG++WP+I  ++G W+P N+ SSS+ G+Q YKVF+A+AM+
Sbjct  289   VGMICPYIINISLLLGGILSWGLMWPLIENRKGDWFPSNVDSSSMHGLQAYKVFIAVAMI  348

Query  1381  LGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNF  1202
             LGDG++NF  ++  T    + + R + +   SL   +D        ++  +D QRRT  F
Sbjct  349   LGDGVYNFCKVLSRTLQGLVSQFRGKADSRTSLSHEEDPPASPLTPKIS-YDDQRRTRFF  407

Query  1201  LKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDW  1022
             LKD IP+  A GGY+A+AAV+   +P +F  L+WY+I V Y  AP+LAFCNAYG GLTDW
Sbjct  408   LKDQIPSWFAAGGYVAIAAVSTAILPQMFGQLRWYYILVIYVFAPVLAFCNAYGAGLTDW  467

Query  1021  SLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPL  842
             SLAS YGK+AI    +W G D+GG+LAGLA+CGVMM+IVST SDL QDFKTGYLTL+SP 
Sbjct  468   SLASTYGKLAIFTIGAWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGYLTLSSPR  527

Query  841   AMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGSL  665
             AMF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LGV+G  SL
Sbjct  528   AMFISQVIGTAMGCVVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGVEGVSSL  587

Query  664   PTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCV  485
             P +CL L   FF  AI IN+  + L       R  RFIP PM MAIPF+LG YFAIDMCV
Sbjct  588   PRDCLVLCYVFFAVAIIINLVRDSLGN-----RWGRFIPLPMAMAIPFFLGPYFAIDMCV  642

Query  484   GSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAAN  305
             GSLILFVW   +  +A+ F  AVASGLICG+ +W +P+++LA+AGVK P+CMKFLS+A N
Sbjct  643   GSLILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPVCMKFLSSATN  702

Query  304   AKLE  293
              +++
Sbjct  703   HRVD  706



>ref|XP_006306886.1| hypothetical protein CARUB_v10008440mg [Capsella rubella]
 gb|EOA39784.1| hypothetical protein CARUB_v10008440mg [Capsella rubella]
Length=723

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/664 (61%), Positives = 504/664 (76%), Gaps = 8/664 (1%)
 Frame = -2

Query  2281  VFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKS  2102
             +FE  E+PSWK QLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF  +K+
Sbjct  60    IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  119

Query  2101  WTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIP  1922
             WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA Q  SG+  
Sbjct  120   WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQ--SGDAF  177

Query  1921  NNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGA  1742
               VK  S+GW++AFL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHTP GA
Sbjct  178   RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  237

Query  1741  KLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVG  1562
             KLAK+QV  L K FS SF +G FQWFF A + CGF+SFPTFGLKAY  +FYFDFS+TYVG
Sbjct  238   KLAKKQVRVLGKFFSLSFFWGFFQWFFTAGENCGFNSFPTFGLKAYQYKFYFDFSATYVG  297

Query  1561  VGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMM  1382
             VGM+CP ++N+SLL+G I+SWG++WP+I T++G W+P N+ SSS+ G+Q YKVF+A+AM+
Sbjct  298   VGMICPYIINISLLLGGILSWGLMWPLIETRKGDWFPSNVDSSSMSGLQAYKVFIAVAMI  357

Query  1381  LGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNF  1202
             LGDGL+NF  ++  T    + + R +     + L  +++           +D QRRT  F
Sbjct  358   LGDGLYNFCKVLTRTLSGLVSQIRGKAGSRTTSLAREEDPPASPLTPKISYDDQRRTRFF  417

Query  1201  LKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDW  1022
             LKD IP+ +AVGGY+A++AV+   +P +F  L+WY+I V Y  APILAFCNAYG GLTDW
Sbjct  418   LKDQIPSWLAVGGYVAISAVSTAILPHMFSQLRWYYILVIYVFAPILAFCNAYGAGLTDW  477

Query  1021  SLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPL  842
             SLAS YGK+AI    +W G D+GG+LAGLA+CGVMM+IVST SDL QDFKTGYLTL+SP 
Sbjct  478   SLASTYGKLAIFTIGAWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGYLTLSSPR  537

Query  841   AMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGSL  665
             AMF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LGV+G  SL
Sbjct  538   AMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGVEGVSSL  597

Query  664   PTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCV  485
             P +CL L   FF  AI IN+  + L       R  RF+P PM MAIPF+LG YFAIDMCV
Sbjct  598   PRDCLVLCYAFFGIAIIINVVKDGLGN-----RWGRFVPLPMAMAIPFFLGPYFAIDMCV  652

Query  484   GSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAAN  305
             GS +LFVW   N   A+ F  AVASGLICG+ +W +P+++LA+AGVK PICMKFLSAA N
Sbjct  653   GSFLLFVWERLNAPNAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPICMKFLSAATN  712

Query  304   AKLE  293
              +++
Sbjct  713   HRVD  716



>ref|XP_007211297.1| hypothetical protein PRUPE_ppa001999mg [Prunus persica]
 gb|EMJ12496.1| hypothetical protein PRUPE_ppa001999mg [Prunus persica]
Length=731

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/669 (61%), Positives = 511/669 (76%), Gaps = 10/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE+  +PSWK QLT+RA F S VLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  66    SVERIFEQQIVPSWKEQLTVRAFFISFVLSVLFSVIVMKLNLTTGIIPSLNVSAGLLGFF  125

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +++WT  L + GLLKQPFTRQENTVIQTCVVASS IAFS G  +Y+ GMS  IA Q+ +
Sbjct  126   FVRTWTKFLDRCGLLKQPFTRQENTVIQTCVVASSSIAFSGGFGNYLFGMSARIAQQS-T  184

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N  +++K   + W + FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  185   DNSTSDIKDPGLLWFIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  244

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A   CGF+SFPT GLKAY  +F+FDFS+
Sbjct  245   PQGAKLAKKQVKELGKFFSFSFLWGFFQWFYTAGSDCGFASFPTLGLKAYQNKFFFDFSA  304

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+S+L+G I+SWG++WP+I  + G WY   LS  S+ G+QGYK+F+A
Sbjct  305   TYVGVGMICPYIVNISVLLGGILSWGLMWPLIENRSGDWYSNELSPKSMNGLQGYKIFIA  364

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T ++   + R +     ++LP++D+ +    + L  +D QRR
Sbjct  365   IAMILGDGLYNFLKVLSRTLIALQSQLRGKDVN--NILPIEDQVSPAVTSALS-YDDQRR  421

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   AVGGY+++AAV+I  VP IFP LKWY+I V Y  AP LAFCNAYGCG
Sbjct  422   TQLFLKDQIPAWFAVGGYVSIAAVSIATVPHIFPQLKWYYILVIYLFAPSLAFCNAYGCG  481

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  482   LTDWSLASTYGKVAIFMIGAWAGSAHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  541

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   SAYPAP+A VYR +A+LGV+G
Sbjct  542   ASPRSMFVSQVIGTAMGCVISPCVFWLFYKAFNDLGTPRSAYPAPFAVVYRNMAILGVEG  601

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP +CL L   FF AAI  N+  + + K        RF+P P+ MA+PFYLG YFAI
Sbjct  602   FKSLPKHCLLLCTVFFGAAILTNVIKDCIGKKRA-----RFVPLPVAMAVPFYLGSYFAI  656

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLI+F+W   NK +A  F PAVASGLICG+ +W +PA+ILALAGVK PICM+FLS
Sbjct  657   DMCIGSLIVFLWERVNKAKADAFVPAVASGLICGDGVWTLPASILALAGVKPPICMRFLS  716

Query  316   AAANAKLES  290
              A N ++ +
Sbjct  717   RAENDRVTT  725



>ref|XP_002279707.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=713

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/671 (61%), Positives = 513/671 (76%), Gaps = 13/671 (2%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             K+ S E +F+    PSW+ QLTIRA   S VL  +F FIV KLNLTTG+IPSLNV+AGLL
Sbjct  50    KLPSVEMIFKGQVEPSWREQLTIRAFVVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLL  109

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  +KSWT L+ K+GLLKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS T+A Q
Sbjct  110   GFFFLKSWTKLMEKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSSTVAGQ  169

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +   N   N K  S+ W++ FL+ VSF+GLFS++PLRK+MI+ YKLTYPSGTATA+LINS
Sbjct  170   SSETNAAQNTKDPSLSWIIGFLFAVSFLGLFSVLPLRKIMIIDYKLTYPSGTATAHLINS  229

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K FSFSFL+G FQWFF A DGCGF +FPTFGLKA+  RFYFD
Sbjct  230   FHTPQGAKLAKKQVRTLGKFFSFSFLWGFFQWFFTAGDGCGFVNFPTFGLKAFDNRFYFD  289

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP ++N+S+L+GAI+SWG++WP+I  ++G WY   LS SSL G+QGY+V
Sbjct  290   FSATYVGVGMICPYLINISVLVGAILSWGLMWPLIKNRKGDWYSSELSESSLHGLQGYRV  349

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F++IAM+LGDGL+NF  ++  T   F+K+ + ++     ++PV +  +  K +    +D 
Sbjct  350   FISIAMILGDGLYNFIKVLGRTIQGFIKQYKKKE-----VIPVTERDSPQKVSN--SYDD  402

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             + RT  FLKD IP  V+  GY+A+AAV++  +P IF  +KWY++ V Y +AP LAFCNAY
Sbjct  403   EVRTKLFLKDGIPMWVSFAGYVAIAAVSMGVIPKIFHQMKWYYVLVIYIVAPALAFCNAY  462

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGY
Sbjct  463   GAGLTDWSLASTYGKLAIFAIGAWAGESHGGVLAGLAACGVMMNIVSTASDLMQDFKTGY  522

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLG  686
             +T +SP +MFFSQ+ GTAMGC ++P VFW+FYKA+  LG   S YPAPYAAVYR++++LG
Sbjct  523   MTRSSPRSMFFSQIIGTAMGCLISPCVFWLFYKAFKDLGSPESQYPAPYAAVYRSMSILG  582

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+GFG+LP +CL L   FF  AI IN+  + + K   KY     IP PM MAIPFYLG Y
Sbjct  583   VEGFGALPDHCLTLCYVFFFGAIIINLIRDTIAKKWAKY-----IPLPMAMAIPFYLGSY  637

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILF+W   NK +A  FGPAVASGLICG+ +W +P++ILALAGV+ PICMK
Sbjct  638   FAIDMCVGSLILFIWGKLNKAKADAFGPAVASGLICGDGIWTLPSSILALAGVQPPICMK  697

Query  325   FLSAAANAKLE  293
             FLS   N+ ++
Sbjct  698   FLSRGTNSMVD  708



>gb|AAS00697.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
Length=724

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/671 (61%), Positives = 508/671 (76%), Gaps = 12/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E +FE  E+PSWK QLTIRA   S  LS +F+F+V KLNLTTG+IPSLNV+AGLLGF 
Sbjct  55    SVEGIFESREVPSWKKQLTIRAFVVSFALSILFSFVVMKLNLTTGIIPSLNVSAGLLGFF  114

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +++WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA Q  S
Sbjct  115   FVETWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQ--S  172

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GWM+AFL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHT
Sbjct  173   GDVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHT  232

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSF +G FQWFF A + CGF+SFPTFGL+AY  +FYFDFS+
Sbjct  233   PQGAKLAKKQVRVLGKFFSFSFFWGFFQWFFTAGENCGFNSFPTFGLRAYQYKFYFDFSA  292

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLL+G I+SWG++WP+I T++G W+P N+ SSS+ G+Q YKVF+A
Sbjct  293   TYVGVGMICPYIINISLLLGGILSWGLMWPLIETRKGDWFPSNVDSSSMNGLQAYKVFIA  352

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE---DFDG  1223
             +A +LGDGL+NF  +++ T    + + R +    +SL   +D       + L     +D 
Sbjct  353   VATILGDGLYNFCKVLIRTFSGLISQIRGKAGSRSSLAHKEDP-PASPASPLTPRISYDD  411

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRRT  FLKD IP+  AVGGY+ ++AV+   +P +F  L+WY+I V Y  APILAFCNAY
Sbjct  412   QRRTRFFLKDQIPSWFAVGGYVVISAVSTAILPHMFSQLRWYYIIVIYIFAPILAFCNAY  471

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLAS YGK+AI     W G D+GG+LAGLA+CGVMM+IVST SDL QDFKTGY
Sbjct  472   GAGLTDWSLASTYGKLAIFTIGVWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGY  531

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             LTL+SP AMF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LG
Sbjct  532   LTLSSPRAMFVSQVIGTAMGCLVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLG  591

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G  SLP +CL L   FF  AI IN+  + L       R  RF+P PM MAIPF+LG Y
Sbjct  592   VEGVSSLPRDCLMLCYVFFGVAILINLIKDCLGN-----RWGRFVPLPMAMAIPFFLGPY  646

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGS ILFVW   +  +A+ F  AVASGLICG+ +W +P+++LA+AGVK PICMK
Sbjct  647   FAIDMCVGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPICMK  706

Query  325   FLSAAANAKLE  293
             FLSAA N +++
Sbjct  707   FLSAATNHRVD  717



>ref|XP_008436975.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL5 [Cucumis melo]
Length=693

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/673 (61%), Positives = 506/673 (75%), Gaps = 22/673 (3%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S E  FE  E+PSW+ QLT RA F S  LS +F+FIV KLNLTTG+IPSLNV+AGLLG
Sbjct  34    VLSIEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPSLNVSAGLLG  93

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +KSWT  L ++GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA +A
Sbjct  94    FFFVKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAHKA  153

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
              SG+   + K  S+GWM+ F +VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  154   -SGS--RDFKDPSLGWMIGFXFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSF  210

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA LAK+QV  L + FS SFL+G FQWFF + DGCGFS FPTFGLKAYA +FYFDF
Sbjct  211   HTPRGAALAKKQVRLLGRFFSVSFLWGFFQWFFTSADGCGFSHFPTFGLKAYANKFYFDF  270

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TY+GVGM+CP ++NVS+L+G IISWGI+WP+I  K+G WY   L S  L G++GYKVF
Sbjct  271   SATYIGVGMICPHIINVSVLVGGIISWGIMWPLIEXKKGQWYSEKLRSDDLSGLEGYKVF  330

Query  1399  LAIAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE-DF  1229
             +AIA++LGDGL+NFF ++  T  GL    +RR E           ++F+    ++ E  +
Sbjct  331   IAIAIILGDGLYNFFKVLTRTLSGLFDQLQRRRE----------SEDFSTENSSRSELSY  380

Query  1228  DGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCN  1049
             D  RR   FLKD IP   A+GGY+ +A V+I  +P IFP LKWY+I V Y  AP+LAFCN
Sbjct  381   DDARRKQLFLKDQIPIWFAIGGYVVIAVVSINTLPHIFPQLKWYYIFVIYIFAPVLAFCN  440

Query  1048  AYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKT  869
             AYGCGLTDWSLAS YGK+AI    +W G   GG++AGL++CGVMM+IVST SDL QDFKT
Sbjct  441   AYGCGLTDWSLASTYGKLAIFTIGAWAGPSRGGIIAGLSACGVMMNIVSTASDLTQDFKT  500

Query  868   GYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiAL  692
             GYLTLASP +MF SQV GT MGC ++P VFW+FYKA+  LG     YPAP A ++R +++
Sbjct  501   GYLTLASPRSMFVSQVVGTTMGCIISPCVFWLFYKAFDDLGLPTGEYPAPNAVLFRNMSV  560

Query  691   LGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLG  512
             LGV+G  SLP NCL L   FF  +I IN+  +++ K     +  RFIP PM MAIPFY+G
Sbjct  561   LGVEGASSLPKNCLTLCYIFFATSILINLIKDLIPK-----KWARFIPLPMAMAIPFYIG  615

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
              YFAIDM +GSLILFVW+  N+ +A+ FGPAVASGLICG+ +W +P +ILALAGVKAPIC
Sbjct  616   PYFAIDMSLGSLILFVWQKLNRTKAEAFGPAVASGLICGDGIWTLPNSILALAGVKAPIC  675

Query  331   MKFLSAAANAKLE  293
             MKFLS + NA+++
Sbjct  676   MKFLSRSTNARVD  688



>ref|XP_002266657.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=708

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/670 (62%), Positives = 514/670 (77%), Gaps = 14/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+ QLT+RA   S VLS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  45    SVERIFEGKEVPSWREQLTVRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  104

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +  WT  L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+E+
Sbjct  105   FVSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSQAIAKQSEN  164

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                    K  ++ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  165   AGGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHT  224

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWFFAA D CGF+ FPTFGLKAY  +F+FDFS+
Sbjct  225   PQGAKLAKKQVRVLGKYFSFSFLWGFFQWFFAAGDNCGFAGFPTFGLKAYKYKFFFDFSA  284

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+SLL+G I+SWG++WP+I T++G WYP +L SS+++G+QGYK+F+A
Sbjct  285   TYVGVGMICPHIVNISLLVGGILSWGVMWPLIETRKGDWYPADLPSSNIRGLQGYKIFIA  344

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA +LGDGL+NFF ++   + GL +  + ++    P    P++D       +    ++  
Sbjct  345   IATILGDGLYNFFKVLGQTLLGLFYQLQYKNMSGVP----PIEDR--SSPRSSSTSYNDT  398

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP + A+GGYIA+AA+++  +P IFP LKWY+I V Y +AP +AFCNAYG
Sbjct  399   RRTQVFLKDQIPTSFAIGGYIAIAAISMATLPHIFPQLKWYYILVIYLVAPTMAFCNAYG  458

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GGV+AGLA+CGVMM+IVST SDLMQDFKTGYL
Sbjct  459   CGLTDWSLASTYGKLAIFSIGAWAGAAHGGVIAGLAACGVMMNIVSTASDLMQDFKTGYL  518

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+  LG S S YPAPYA VY  +A+LGV
Sbjct  519   TLASPRSMFVSQFIGTAMGCVISPCVFWLFYKAFDDLGQSGSEYPAPYALVYHNMAVLGV  578

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  +LP NC  L   FF AAI +N+  + + +   +     FIP PM MAIPFYLG YF
Sbjct  579   EGISNLPKNCFTLCCVFFGAAILVNLVRDAVGRKRAQ-----FIPIPMAMAIPFYLGPYF  633

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W+  NK +A+ FGPAVASGLICGE +W +P +ILALAG+K PICMKF
Sbjct  634   AIDMCVGSLILFIWQRINKAKAEAFGPAVASGLICGEGIWTLPGSILALAGIKQPICMKF  693

Query  322   LSAAANAKLE  293
             LS A NA+++
Sbjct  694   LSRATNARVD  703



>dbj|BAE91891.1| hypothetical protein [Oryza sativa Japonica Group]
Length=712

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/668 (59%), Positives = 494/668 (74%), Gaps = 8/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ F    +PSW+ QLT+RA     +LS +FN IV KL+LTTGVIPSLNV+A LLGF 
Sbjct  49    SVEQAFADKPVPSWREQLTVRAFVVGFLLSIMFNIIVMKLSLTTGVIPSLNVSASLLGFF  108

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             +++ WTA + + G LKQP TRQENTVIQTCVV++ G+AFS G  SY+ GMS TIA QA  
Sbjct  109   LVRLWTAAIERVGFLKQPLTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATE  168

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N P N+K   +GW++ F+++VSFVGLF++VP+RK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  169   ANDPMNIKNPHLGWIIGFMFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHT  228

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA LAK+QV  L K FS SFL+  FQWF+ A D CGFSSFPTFGL+A+  RFYFDFS 
Sbjct  229   PEGADLAKKQVRTLGKYFSISFLWAFFQWFYTAGDNCGFSSFPTFGLEAFKNRFYFDFSP  288

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVSLLIG IISWGI+WP+I  K+G WYP  L  SSL G+Q YKVF+ 
Sbjct  289   TYVGVGMICPYIVNVSLLIGGIISWGIMWPLISKKKGSWYPETLPESSLLGLQAYKVFIT  348

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +   T   F+      KN  ++ LP+ D        + E FD +RR
Sbjct  349   IAVILGDGLYNFVKVFGYTIKGFIVMY---KNKNSNTLPISDNGTPANATEEESFDDKRR  405

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IP  VA+GGY+ LA +    +P I P LKWY+I +AY  API+AFCNAYG G
Sbjct  406   NELFLKDQIPKTVAIGGYVVLAVITSGCLPLIIPQLKWYYILIAYIFAPIMAFCNAYGSG  465

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLA+ YGK+AI +F +W G  +GGVL GLA+CGVMM+IV T SDLMQDFKTGY+TL
Sbjct  466   LTDWSLATTYGKLAIFVFGAWAGASHGGVLVGLAACGVMMNIVGTASDLMQDFKTGYMTL  525

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGF  674
             ASP +MF SQV GTAMGC + P VFW+FYK++ +G S+ AYPAPY  +YR +A+LGV+G 
Sbjct  526   ASPRSMFVSQVIGTAMGCVIAPCVFWLFYKSFNIGASDGAYPAPYTIMYRNMAILGVNGL  585

Query  673   GSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAID  494
              SLP  CL L    FVAA  IN+  +++ +     RV ++IP PM  AIPFYLG YFAID
Sbjct  586   SSLPKYCLTLCYIAFVAAFIINLIKDLVPE-----RVAKYIPIPMAAAIPFYLGPYFAID  640

Query  493   MCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSA  314
             M +GS+IL+ W W+NK +A+ FGPAVASGL+CG+ LW +P A+L+L  V  P+CMKFLS 
Sbjct  641   MFMGSVILYFWEWRNKDEAQSFGPAVASGLMCGDGLWALPQAVLSLVNVNPPLCMKFLSR  700

Query  313   AANAKLES  290
             AANAK+++
Sbjct  701   AANAKVDT  708



>ref|XP_002277292.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=713

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/672 (60%), Positives = 506/672 (75%), Gaps = 13/672 (2%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             K  S E +F+   +PSW+ QLTIRA   S VL  +  FIV KLNLTTG+IPSLNV+AGLL
Sbjct  50    KSLSVEMLFKGKVVPSWREQLTIRAFVVSFVLGVLLTFIVMKLNLTTGIIPSLNVSAGLL  109

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  +KSW   + K+G+LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  +A Q
Sbjct  110   GFFFVKSWAKFMEKSGMLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSSIVAGQ  169

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +       N K   + W++ FL+ VSF+GLFS++PLRK+M++ YKLTYPSGTATA+LINS
Sbjct  170   SAKSIDAQNTKDPRLPWIIGFLFAVSFLGLFSVLPLRKIMVIDYKLTYPSGTATAHLINS  229

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAKQQV  L K FSFSFL+G FQWFF   DGCGFS+FPTFGL+AY  RFYFD
Sbjct  230   FHTPQGAKLAKQQVRTLGKFFSFSFLWGFFQWFFTGGDGCGFSNFPTFGLEAYENRFYFD  289

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS T+VGVGM+CP ++NVS+L+GAI+SWG++WP+I  ++G WY   LS S+L G+QGY+V
Sbjct  290   FSGTFVGVGMICPYLINVSVLVGAILSWGLMWPLIKNRKGDWYSAMLSDSNLMGVQGYRV  349

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             FL+IAM+LGDGL+NF  ++ +T   F+K+ +  +     ++PV +  +  K +    +D 
Sbjct  350   FLSIAMILGDGLYNFVKVLGLTIRGFIKQYKKME-----VIPVTERGSPEKVSN--SYDD  402

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             + RT  FLKD IP  V++ GY+A+AAV+I  +P IF  +KWY++ V Y  AP+LAFCNAY
Sbjct  403   EVRTKLFLKDGIPLWVSIVGYVAIAAVSIGVIPKIFHQMKWYYVLVIYIFAPVLAFCNAY  462

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGY
Sbjct  463   GCGLTDWSLASTYGKLAIFAIGAWAGESHGGVLAGLAACGVMMNIVSTASDLMQDFKTGY  522

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             +TLASP +MF SQV GTAMGC ++P VFW+FYKA+  +G  +S YPAP A VYR +++LG
Sbjct  523   MTLASPRSMFVSQVIGTAMGCIISPCVFWLFYKAFVDIGSPDSDYPAPNALVYRNMSVLG  582

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+GFGSLP +CL L    F  +I IN+  + + K   KY     IP PM MAIPFYLG Y
Sbjct  583   VEGFGSLPDHCLTLCYILFAGSIVINLIRDTVAKKWAKY-----IPLPMAMAIPFYLGPY  637

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILF+W   +K +A  FGPAVASGLICG+ +W +P++ILALAGV+ PICMK
Sbjct  638   FAIDMCVGSLILFIWGKLDKAKADAFGPAVASGLICGDGIWSLPSSILALAGVQPPICMK  697

Query  325   FLSAAANAKLES  290
             FLS   NA+++ 
Sbjct  698   FLSRGTNARVDQ  709



>gb|EMT14396.1| Putative metal-nicotianamine transporter YSL13 [Aegilops tauschii]
Length=723

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/670 (60%), Positives = 503/670 (75%), Gaps = 12/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S  L+ +FN IV KLNLT GVIPSLNV+AGLLGF 
Sbjct  58    SLERVFADQRVPSWREQLTVRAFVASFFLAVMFNIIVMKLNLTIGVIPSLNVSAGLLGFF  117

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT+ + + GLLKQPFTRQENTVIQTCVVA+ GI +S G  +Y+L MS  IA+Q   
Sbjct  118   FVRLWTSAIERMGLLKQPFTRQENTVIQTCVVAAYGIPYSGGFGNYLLAMSGRIASQTTE  177

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N P N+K   +GW++ FL++VSF+GLF +VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  178   ANNPQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKIMIIDYKLTYPSGTATAYLINGFHT  237

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P+GAK+A++QV  L K    SFL+G FQWF+ A D CGF  FP+ GL+A+  RFYFDFSS
Sbjct  238   PHGAKIAEKQVKKLGKFLVLSFLWGFFQWFYTATDECGFQKFPSLGLQAFNNRFYFDFSS  297

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K G W+  +L  SSL+G+QGY+VF+A
Sbjct  298   TYVGVGMICPHIVNVSILLGGILSWGIMWPLIANKRGSWFSADLPESSLRGMQGYRVFIA  357

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPV-DDEFNKGKGAQLEDFDGQR  1217
             IA++LGDGL++F  M+++T  S   R    K G AS  PV DDE +    A    +D QR
Sbjct  358   IAVILGDGLYHFLKMLILTVYSLRSRL---KTGSASPFPVSDDEISNSTAAI--SYDEQR  412

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             R   F KD IP  +A GGY+A+AAV+I  VP IFP LKWY I VAY +AP+LAFCNAYG 
Sbjct  413   RKELFQKDQIPWYIAYGGYVAVAAVSIGTVPQIFPQLKWYQILVAYMVAPVLAFCNAYGA  472

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSL + YGK+AI  F +W G  NGGVLAGLA+CGVMMSIVST  DLMQDFKTGYLT
Sbjct  473   GLTDWSLVTTYGKLAIFAFGAWTGASNGGVLAGLAACGVMMSIVSTACDLMQDFKTGYLT  532

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVD  680
             LASP +MF SQ+ GTAMGC + P VFW+FYKA+  +G S S YPAP AA++R++A+LGVD
Sbjct  533   LASPRSMFISQIIGTAMGCVIAPCVFWLFYKAFEDVGVSGSEYPAPNAAIFRSMAILGVD  592

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NC+ L   FFV AIA+N+  +++ K     +V RF+P PM MAIPFYLG YF 
Sbjct  593   GFSSLPKNCITLCYIFFVGAIAVNLIRDLVPK-----KVSRFMPIPMAMAIPFYLGPYFG  647

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDM +G++ILFVW+  +K ++  + PAVASGLICG+ LW +P ++LALA VK PICMKFL
Sbjct  648   IDMFIGTVILFVWQRLDKVKSDTYAPAVASGLICGDGLWVLPQSMLALAKVKPPICMKFL  707

Query  319   SAAANAKLES  290
             S   NAK+++
Sbjct  708   SRGVNAKVDA  717



>ref|XP_006653609.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like, 
partial [Oryza brachyantha]
Length=670

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/673 (59%), Positives = 498/673 (74%), Gaps = 13/673 (2%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             +  S ERVF    +P+W+ QLT+RA     +LS +FN IV KL+LTTGVIPSLNV+A LL
Sbjct  5     EAPSVERVFADRPVPAWREQLTVRAFVVGFLLSVMFNVIVMKLSLTTGVIPSLNVSASLL  64

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF +++ WTA + + G LKQPFTRQENTVIQTCVV++ G+AFS G  SY+ GMS TIA Q
Sbjct  65    GFFLVRLWTAAIERVGFLKQPFTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQ  124

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             A   N P NVK   IGW++ FL++VSFVGLF++VP+RK+MI+ YKLTYPSGTATAYLIN 
Sbjct  125   ATEANDPLNVKNPHIGWIIGFLFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLING  184

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GA+LAK+QV  L K FS SFL+  FQWF+ A D CGFSSFPTFGL+A+  RFYFD
Sbjct  185   FHTPEGAELAKKQVRTLGKYFSLSFLWAFFQWFYTAGDNCGFSSFPTFGLEAFKNRFYFD  244

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FS+TYVGVGM+CP +VN SLL G IISWGI+WP+I TK+GIWY   LS SSL G+Q YKV
Sbjct  245   FSTTYVGVGMICPYIVNASLLFGGIISWGIMWPLISTKKGIWYSDKLSGSSLLGLQAYKV  304

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED--F  1229
             F+ IA++LGDGL+NF  +   T   F+      KN   + LP+ D    G  A +E+  F
Sbjct  305   FITIAVILGDGLYNFLKVFGYTMKGFIDMY---KNRNLNTLPISDN---GTPATIEEESF  358

Query  1228  DGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCN  1049
             D +RR   FLKD IP  VA+GGY+ LA +    +P I P LKWY+I +AY  API+AFCN
Sbjct  359   DDKRRNELFLKDQIPKTVAIGGYVVLAVITTSCLPLIIPQLKWYYILIAYIFAPIMAFCN  418

Query  1048  AYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKT  869
             AYG GLTDWSLA+ YGK+AI +F +W G  +GGVL GLA+CGVMM+IV T SDLMQDFKT
Sbjct  419   AYGSGLTDWSLATTYGKLAIFVFGAWAGASHGGVLVGLAACGVMMNIVGTASDLMQDFKT  478

Query  868   GYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALL  689
             GY+TLASP +MF SQV GTAMGC + P VFW+FY ++ +G S+ AYPAPY  +YR +A+L
Sbjct  479   GYMTLASPRSMFISQVIGTAMGCVVAPCVFWLFYLSFNIGASDGAYPAPYTIMYRNMAIL  538

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+G  SLP  CL L    F AA  IN+  +++ +     +V +FIP PM  AIPFYLG 
Sbjct  539   GVNGLSSLPKYCLTLCYISFAAAFTINLIKDLVPE-----KVAKFIPIPMAAAIPFYLGP  593

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDM +GS ILF+W  +NK +A+ FGPAVASGL+CG+ LW +P AIL+L  +  P+CM
Sbjct  594   YFAIDMFIGSAILFIWERRNKDEAQSFGPAVASGLMCGDGLWALPEAILSLVNLNPPLCM  653

Query  328   KFLSAAANAKLES  290
             KFLS AANAK+++
Sbjct  654   KFLSRAANAKVDT  666



>ref|XP_002269403.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=708

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/668 (62%), Positives = 505/668 (76%), Gaps = 10/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+ QLT+RA   SLV+  +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  45    SVERIFESKEVPSWREQLTVRAFVVSLVVGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  104

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
                 WT  L  +GLLKQPFTRQENTVIQTCVVA SGIAFS G  SY+ GMS  +A ++E 
Sbjct  105   FTSGWTKFLDNSGLLKQPFTRQENTVIQTCVVAISGIAFSGGFGSYLFGMSEVVAKESED  164

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  + K  +IGWM+ FL+VVSF+GLFS++PLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  165   VQSSQDYKNPAIGWMIGFLFVVSFLGLFSVLPLRKIMIIDFKLTYPSGTATAHLINSFHT  224

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA+LAK+QV  L K FSFSFL+  FQWFFAA D CGF +FPTFGLKA    F+FDFS+
Sbjct  225   PEGARLAKKQVRVLGKFFSFSFLWSFFQWFFAAGDDCGFKAFPTFGLKAQENMFFFDFST  284

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+SLL+G I+SWGI+WP+I T++G WYP +L   S+KG+QGYK+F+A
Sbjct  285   TYVGVGMICPYIVNISLLLGGILSWGIMWPLIETRKGDWYPADLPPKSIKGLQGYKIFIA  344

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NFF ++  T L      R +    + +LP++D  +    +    ++ +RR
Sbjct  345   IAMILGDGLYNFFKVISQTLLGLFYHLRHKD--ASIVLPLEDRSSPTNSSL--SYNDKRR  400

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   AVGGYIA+AA++   +P IFP LKWY+IAV Y  API+AFCNAYGCG
Sbjct  401   TQLFLKDQIPIPFAVGGYIAIAAISTATLPHIFPQLKWYYIAVMYIAAPIMAFCNAYGCG  460

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGV+AGLA+CGVMM+IVST SDLMQDFKTGYLTL
Sbjct  461   LTDWSLASTYGKLAIFTIGAWAGGAHGGVIAGLAACGVMMNIVSTASDLMQDFKTGYLTL  520

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQ+ GTAMGC + P VFW+FYKA+  LG   S YPAPYA VYR +A+LGVDG
Sbjct  521   ASPRSMFVSQLIGTAMGCVIAPCVFWLFYKAFDDLGQDGSEYPAPYALVYRNMAILGVDG  580

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP NC  L   FF AA+ +N+  + + K     R  RF P PM MAIP YLG YFAI
Sbjct  581   ISSLPKNCFLLCCVFFAAAVLVNLVRDAVGK-----RRSRFTPIPMAMAIPLYLGPYFAI  635

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLIL++W   NK +A  FGPAVASGLICG+ +W +P++ILALAGVK PICMKFLS
Sbjct  636   DMCVGSLILYIWERMNKAKADAFGPAVASGLICGDGIWTLPSSILALAGVKQPICMKFLS  695

Query  316   AAANAKLE  293
              A N +++
Sbjct  696   RATNVRVD  703



>ref|XP_004138807.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
 gb|KGN63124.1| hypothetical protein Csa_2G404760 [Cucumis sativus]
Length=706

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/670 (62%), Positives = 513/670 (77%), Gaps = 19/670 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+NQLT+RA   S  LS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  48    SVERIFEAQEVPSWQNQLTVRAFVVSFGLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  107

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +KSWT LL K+G LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ G+S  I+ Q  S
Sbjct  108   FVKSWTKLLEKSGWLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGLSQRIS-QLSS  166

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +I N  K  S+GW++ FL++VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  167   DDI-NEFKNPSLGWIIGFLFIVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  225

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWFF A D CGF SFPTFGL+AY  +FYFDFS+
Sbjct  226   PRGAKLAKKQVRTLGKFFSFSFLWGFFQWFFTAGDDCGFVSFPTFGLEAYKNKFYFDFSA  285

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I  K G W+   L  SS  G+QGYKVF++
Sbjct  286   TYVGVGMICPYIINISVLLGGILSWGLMWPLIEKKRGDWFSAELPLSSFHGLQGYKVFIS  345

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED--FDGQ  1220
             IA++LGDG++NF  ++  T +   ++ +        ++PV D    G  + L D  FD +
Sbjct  346   IALILGDGIYNFVKVLATTLIGLHRQLKKR-----DVIPVSD----GSPSSLSDLSFDDK  396

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+  AVGGY+A+AAV+I  +P IF  LKWY+I V Y +AP+LAFCNAYG
Sbjct  397   RRTQRFLKDQIPSWFAVGGYVAIAAVSIATLPHIFSQLKWYYIIVIYVIAPVLAFCNAYG  456

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G  +GGV+AGLA+CGVMM+IVST SDLMQDFKTGYL
Sbjct  457   SGLTDWSLASTYGKLAIFTIGAWAGAAHGGVIAGLAACGVMMNIVSTASDLMQDFKTGYL  516

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG   SAYPAPYA VYR +ALL V
Sbjct  517   TLSSPRSMFVSQVVGTAMGCVISPCVFWLFYKAFDDLGQLGSAYPAPYATVYRNMALLAV  576

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF SLP NCL+L  GFF AAI IN+  ++  K     +V ++IP PM MAIPFY+G YF
Sbjct  577   EGFSSLPKNCLSLCYGFFAAAIVINLIRDLSGK-----KVSQYIPIPMAMAIPFYIGSYF  631

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMC+GSLILFVW   NK +A  F PAVASGLICG+ +W +P++ILAL GVK PICMKF
Sbjct  632   AIDMCLGSLILFVWEKINKAKADAFAPAVASGLICGDGIWTLPSSILALFGVKPPICMKF  691

Query  322   LSAAANAKLE  293
             LS   N K++
Sbjct  692   LSRTTNVKVD  701



>gb|ABB76762.1| YSL transporter 2 [Noccaea caerulescens]
 gb|ABD04074.1| YSL transporter 2 [Noccaea caerulescens]
Length=716

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/671 (59%), Positives = 509/671 (76%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  48    SVEKIFESREVPSWKKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  107

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  108   FVKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQ--S  165

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+     K  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  166   GDASRGFKDPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  225

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SF +  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  226   PQGAKLAKKQVRVLGKFFSISFFWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  285

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P ++ SSS+ G+Q YKVF+A
Sbjct  286   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPADVPSSSMHGLQAYKVFIA  345

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL F++ R +      + L  +++      + ++ +D Q
Sbjct  346   VAIILGDGLYNFCKVLSRTLSGL-FVQLRGTASVSRTTSLTAEEDPPASPLSPMQSYDDQ  404

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  405   RRTRFFLKDEIPTWFAVGGYIIIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYG  464

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  465   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYL  524

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GT+MGC ++P VFW+FYKA+  LG  N+ YPAP+A VYR++A LGV
Sbjct  525   TLSSPKSMFVSQVIGTSMGCVVSPCVFWLFYKAFDDLGLPNTEYPAPFATVYRSMAKLGV  584

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF  AI +NI  + L       R  RFIP PM MAIPF+LG YF
Sbjct  585   EGVSSLPRECLVLCYAFFGVAILVNIVKDSLWS-----RWGRFIPLPMAMAIPFFLGPYF  639

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +  +A+ FG AVASGLICG+ +W +P+++LA+AGV  P+CMKF
Sbjct  640   AIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKF  699

Query  322   LSAAANAKLES  290
             L AA N K+++
Sbjct  700   LPAATNLKVDN  710



>ref|XP_010511122.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Camelina 
sativa]
Length=691

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/671 (62%), Positives = 512/671 (76%), Gaps = 15/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEI--PSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE      PSW++QLT RA+  S +L+ +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  28    SVERIFEASHEVPPSWQHQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLG  87

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT +L KAG+LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  88    FFFVKTWTKILNKAGVLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQS  147

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N   N+K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  148   AEANTAMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  207

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + D CGF++FPTFGLKAY  +FYFDF
Sbjct  208   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGDDCGFANFPTFGLKAYENKFYFDF  267

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLLIG+I+SWG++WP+I  ++G WY   L  SSL G+QGYKVF
Sbjct  268   SATYVGVGMICPYLINVSLLIGSILSWGVMWPLIGNQKGNWYSAELKPSSLHGLQGYKVF  327

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF  ++  T     K+ +++      +LPV+D            +D +
Sbjct  328   IAIAMILGDGLYNFIKVLGRTIFGLYKQFKNK-----DVLPVNDR--SSPNIVKISYDDK  380

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+  AV GY+ LA V+I+ VP IF  LKWYHI   Y +AP+LAFCNAYG
Sbjct  381   RRTELFLKDRIPSWFAVTGYLVLAIVSIVTVPHIFHQLKWYHILTMYIVAPVLAFCNAYG  440

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  441   CGLTDWSLASTYGKLAIFTIGAWAGAANGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  500

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G   +AYPAPYA VYR +++LGV
Sbjct  501   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQVGTAYPAPYALVYRNMSILGV  560

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF +LP +CL L   FF AA+ +N   + +       +  RFIP PM MAIPFY+GGYF
Sbjct  561   EGFSALPKHCLMLCYIFFAAAVIVNGVRDAVGP-----KWARFIPLPMAMAIPFYIGGYF  615

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMCVGSLILF+WR  NK +A  +  AVASGLICGE +W +P++ILALAGVK PICMKF
Sbjct  616   TIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLPSSILALAGVKPPICMKF  675

Query  322   LSAAANAKLES  290
             LS++ N K++S
Sbjct  676   LSSSTNMKVDS  686



>ref|XP_010037024.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48658.1| hypothetical protein EUGRSUZ_K02315 [Eucalyptus grandis]
Length=713

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/668 (60%), Positives = 510/668 (76%), Gaps = 10/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE   +PSW+ QLT RA   S VLS +F FIV KLNLT G+IPSLNV+AGLLGF 
Sbjct  50    SVERIFEGQGVPSWRGQLTFRAFAVSFVLSVMFAFIVMKLNLTAGIIPSLNVSAGLLGFF  109

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLL+ PFTRQENTVIQTCVVASSGIAFS G  SY+  MS  +A Q++ 
Sbjct  110   FVKTWTKVLDKSGLLRVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSKRVADQSKD  169

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                    K  S+ WM+ FL+VVSF+GLF++VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  170   PQRAQVFKDPSLSWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  229

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWF+ A DGCGF+ FPT GLKA   RFYFDFS+
Sbjct  230   PEGAKLAKKQVKALGKFFSFSFLWGFFQWFYTAGDGCGFTEFPTLGLKALQYRFYFDFSA  289

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVS+L+G I+SWG++WP+I T+EG WYP +   +S++GIQGYKVF++
Sbjct  290   TYVGVGMICPYIINVSVLLGGILSWGLMWPLIETREGHWYPEDEGPTSMRGIQGYKVFIS  349

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NFF ++  T LS + R+  ++   + +LP+ +  +  K  Q+  +D +RR
Sbjct  350   IAIILGDGLYNFFKVLGRT-LSGLYRQLQDRE-MSHVLPIANG-SSPKNPQVS-YDDRRR  405

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   A+ GY+ +AA++  ++P +FP LKW++I V Y  AP L FCNAYGCG
Sbjct  406   TQLFLKDQIPTWFAITGYVTIAAISTASLPHMFPQLKWFYILVIYLFAPTLGFCNAYGCG  465

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YG +AI +  +W G  +GG+LAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  466   LTDWSLASTYGTLAIFMIGAWAGASHGGILAGLAACGVMMNIVSTASDLTQDFKTGYLTL  525

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   SAYP PY  V+R++A LGV+G
Sbjct  526   ASPRSMFVSQVIGTAMGCVISPCVFWLFYKAFKDLGLPGSAYPVPYGIVFRSMAELGVEG  585

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP +CL L  GFF AA+ IN F +++ K     +  RFIP PM MAIPFY+G YFAI
Sbjct  586   VSSLPKHCLTLCYGFFSAAMIINGFRDLVGK-----KWVRFIPLPMAMAIPFYIGPYFAI  640

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILF+W   NK +A  FGPAVASGLICG+ +W +P++ILALAGV  PICMKFLS
Sbjct  641   DMCVGSLILFIWEKINKTKADAFGPAVASGLICGDGIWTLPSSILALAGVNPPICMKFLS  700

Query  316   AAANAKLE  293
              A N +++
Sbjct  701   RATNKRVD  708



>ref|XP_004158540.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=706

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/670 (62%), Positives = 513/670 (77%), Gaps = 19/670 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+NQLT+RA   S  LS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  48    SVERIFEAQEVPSWQNQLTVRAFVVSFGLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  107

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +KSWT LL K+G LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ G+S  I+ Q  S
Sbjct  108   FVKSWTKLLEKSGWLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGLSQRIS-QLSS  166

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +I N  K  S+GW++ FL++VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  167   DDI-NEFKNPSLGWIIGFLFIVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  225

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWFF A D CGF SFPTFGL+AY  +FYFDFS+
Sbjct  226   PRGAKLAKKQVRTLGKFFSFSFLWGFFQWFFTAGDDCGFVSFPTFGLEAYKNKFYFDFSA  285

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I  K G W+   L  SS  G+QGYKVF++
Sbjct  286   TYVGVGMICPYIINISVLLGGILSWGLMWPLIEKKXGDWFSAELPLSSFHGLQGYKVFIS  345

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED--FDGQ  1220
             IA++LGDG++NF  ++  T +   ++ +        ++PV D    G  + L D  FD +
Sbjct  346   IALILGDGIYNFVKVLATTLIGLHRQLKKR-----DVIPVSD----GSPSSLSDLSFDDK  396

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+  AVGGY+A+AAV+I  +P IF  LKWY+I V Y +AP+LAFCNAYG
Sbjct  397   RRTQRFLKDQIPSWFAVGGYVAIAAVSIATLPHIFSQLKWYYIIVIYVIAPVLAFCNAYG  456

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G  +GGV+AGLA+CGVMM+IVST SDLMQDFKTGYL
Sbjct  457   SGLTDWSLASTYGKLAIFTIGAWAGAAHGGVIAGLAACGVMMNIVSTASDLMQDFKTGYL  516

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG   SAYPAPYA VYR +ALL V
Sbjct  517   TLSSPRSMFVSQVVGTAMGCVISPCVFWLFYKAFDDLGQLGSAYPAPYATVYRNMALLAV  576

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF SLP NCL+L  GFF AAI IN+  ++  K     +V ++IP PM MAIPFY+G YF
Sbjct  577   EGFSSLPKNCLSLCYGFFAAAIVINLIRDLSGK-----KVSQYIPIPMAMAIPFYIGSYF  631

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMC+GSLILFVW   NK +A  F PAVASGLICG+ +W +P++ILAL GVK PICMKF
Sbjct  632   AIDMCLGSLILFVWEKINKAKADAFAPAVASGLICGDGIWTLPSSILALFGVKPPICMKF  691

Query  322   LSAAANAKLE  293
             LS   N K++
Sbjct  692   LSRTTNVKVD  701



>ref|XP_010551578.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Tarenaya hassleriana]
Length=686

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/672 (61%), Positives = 515/672 (77%), Gaps = 17/672 (3%)
 Frame = -2

Query  2293  STERVFEK--VEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S ER+FE+     P W+NQLTIRA+  S VLS +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  23    SVERIFEESGAVPPPWQNQLTIRALVVSFVLSIMFTFVVMKLNLTTGIIPSLNISAGLLG  82

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ-  1943
             F  +K+WT LL KAG LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q 
Sbjct  83    FFFVKTWTKLLHKAGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVVAKQI  142

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +   + P  +K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINS
Sbjct  143   SPEPSPPMTIKNPQLGWMIGFLFVVSFIGLFSVVPLRKIMIVDFKLTYPSGTATAHLINS  202

Query  1762  FHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFD  1583
             FHTP GAKLAK+QV  L K FSFSFL+G FQWFF   D CGF++FPTFGLKAYA +F+FD
Sbjct  203   FHTPQGAKLAKKQVRTLGKFFSFSFLWGFFQWFFTGGDDCGFTAFPTFGLKAYASKFFFD  262

Query  1582  FSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKV  1403
             FSSTYVGVGM+C  ++N+S+L+GAI+SWG++WP+I  ++G WY   + +SSL G+QGY+V
Sbjct  263   FSSTYVGVGMICSYLINISVLLGAILSWGVMWPLIGAQKGKWYSSEIPASSLHGLQGYRV  322

Query  1402  FLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             F+AIAM+LGDG+++F  ++  T L ++   +      + +LPVDD   +        FD 
Sbjct  323   FIAIAMILGDGIYSFIKVLFNTLLFYLCSFQH-----SFVLPVDD---RSPSFPSVSFDD  374

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             +RRT  FLKD IP   AVGGY+  +A++IIAVPFIFP L+WY+I V Y +APILAFCNA+
Sbjct  375   KRRTELFLKDGIPAWFAVGGYVIFSAISIIAVPFIFPQLRWYYILVMYLIAPILAFCNAF  434

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             GCGLTDWSLASNYGKIAI    +W G  NGG++AGLA+CGV+M+IVST SDLMQDFKTGY
Sbjct  435   GCGLTDWSLASNYGKIAIFAIGAWAGASNGGIIAGLAACGVIMNIVSTASDLMQDFKTGY  494

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLG  686
             LTLASP +MF SQV GTAMGC ++P VFW+FY A+   G S SAYPAP+A VYR +++LG
Sbjct  495   LTLASPRSMFISQVIGTAMGCLISPSVFWLFYTAFDGFGQSGSAYPAPFALVYRNMSILG  554

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+GF +LP +CL L   FF  + A+N   + +       +  RFIP PM MAIPFYLGGY
Sbjct  555   VEGFSTLPKHCLMLCYIFFGGSFAVNGLRDAVGP-----KWSRFIPLPMAMAIPFYLGGY  609

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FA+DMCVGSLILF+WR  NK  A  F PAVASGLICG+ +W +P +ILALAGVK PICMK
Sbjct  610   FAVDMCVGSLILFIWRKVNKPNADAFSPAVASGLICGDGIWTLPNSILALAGVKPPICMK  669

Query  325   FLSAAANAKLES  290
             FLS++ N +++ 
Sbjct  670   FLSSSDNVRVDD  681



>ref|XP_006406708.1| hypothetical protein EUTSA_v10020160mg [Eutrema salsugineum]
 dbj|BAJ33889.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48161.1| hypothetical protein EUTSA_v10020160mg [Eutrema salsugineum]
Length=716

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/669 (59%), Positives = 505/669 (75%), Gaps = 8/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  48    SVEKIFESREVPSWKKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  107

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  108   FVKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQ--S  165

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+    VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  166   GDAARGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  225

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSF +  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  226   PQGAKLAKKQVRVLGKFFSFSFFWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  285

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I T++G W+P ++ SSS+ G+Q YKVF+A
Sbjct  286   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETRKGDWFPADVESSSMNGLQAYKVFIA  345

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             +A++LGDGL+NF  ++  T      + R       +   V+++      +  + +D  RR
Sbjct  346   VAIILGDGLYNFCKVLSRTLSGLFIQLRGTTPPSRTSFTVEEDPPASPLSPQQSYDDLRR  405

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG G
Sbjct  406   TRFFLKDQIPTWFAVGGYIIIAATSTAILPHMFQQLRWYYILVLYICAPVLAFCNAYGAG  465

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  466   LTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  525

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             +SP +MF SQV GTAMGC ++P VFW+FY+A+  LG  NS YPAP+A VYR++A LGV+G
Sbjct  526   SSPKSMFVSQVIGTAMGCVVSPCVFWLFYEAFDDLGLPNSEYPAPFATVYRSMAKLGVEG  585

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP  CL L   FF  AI +NI  + L       R  RFIP PM MAIPF+LG YFAI
Sbjct  586   VSSLPRECLVLCYAFFSVAILVNIVKDSLWS-----RWGRFIPLPMAMAIPFFLGPYFAI  640

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILF+W   +  +A+ FG AVASGLICG+ +W +P+++LA+AGV  P+CMKFLS
Sbjct  641   DMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKFLS  700

Query  316   AAANAKLES  290
             AA N+K+++
Sbjct  701   AATNSKVDN  709



>ref|XP_002305689.1| hypothetical protein POPTR_0004s06790g [Populus trichocarpa]
 gb|EEE86200.1| hypothetical protein POPTR_0004s06790g [Populus trichocarpa]
Length=689

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/669 (62%), Positives = 509/669 (76%), Gaps = 7/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+F K E+PSW+NQLT RA   S +LS +F+FIV KLNLT G+IPSLNV+AGLLGF 
Sbjct  23    SVERIFAKQEVPSWRNQLTWRAFGVSFILSVLFSFIVMKLNLTAGIIPSLNVSAGLLGFF  82

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L   GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA ++  
Sbjct  83    FVKTWTRFLENCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSGRIAQESAD  142

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  ++K  ++GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  143   QPSAKDIKDPALGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  202

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWFF A+D CGF++FPTFGLKAY   F+FDFS+
Sbjct  203   PEGAKLAKKQVRALGKFFSFSFLWGFFQWFFKAEDNCGFANFPTFGLKAYDNMFFFDFSA  262

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N S+L+G I+SWG++WP+I T++  WY   LS  SL G+QGYKVF++
Sbjct  263   TYVGVGMICPYIINASVLLGGILSWGLMWPLIETRKNDWYSAELSPKSLHGLQGYKVFIS  322

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T +    + + +   P   LPVD   +         +D QRR
Sbjct  323   IAMILGDGLYNFCKVLSRTLIGLYIQLQGKD--PKMALPVDG--SPPPKTLTVSYDDQRR  378

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   AV GY+ +AAV+   +P IFP LKWY+I V YA AP LAFCNAYGCG
Sbjct  379   TQLFLKDQIPTWFAVAGYVVIAAVSTATLPHIFPQLKWYYILVIYACAPTLAFCNAYGCG  438

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGYLTL
Sbjct  439   LTDWSLASTYGKLAIFTIGAWAGAAHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYLTL  498

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   S YPAPYA VYR +A+LGV+G
Sbjct  499   ASPKSMFVSQVIGTAMGCVISPCVFWLFYKAFDDLGLPGSQYPAPYAVVYRNMAILGVEG  558

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF  AI INIF +V+ +   K+   +FIP PM MAIPFY+G YFAI
Sbjct  559   FSSLPKNCLKLCYIFFCGAILINIFKDVMERKCKKFA--KFIPLPMAMAIPFYIGPYFAI  616

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLIL+VW   NK +A  F PAVASGLICG+ +W +P++ILALAGVKAPICM+F S
Sbjct  617   DMCVGSLILYVWGRINKAKADAFAPAVASGLICGDGIWTLPSSILALAGVKAPICMRFFS  676

Query  316   AAANAKLES  290
              A + ++++
Sbjct  677   RATSTRIDN  685



>ref|XP_002269277.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=704

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/670 (61%), Positives = 515/670 (77%), Gaps = 14/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+ QLT+RA     VLS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  41    SVERLFEGKEVPSWREQLTVRAFVVRFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  100

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +  WT  L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+E+
Sbjct  101   FVSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSQAIAKQSEN  160

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                    K  ++ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  161   AGGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHT  220

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWFFAA D CGF+ FPTFGLKAY  +F+FDFS+
Sbjct  221   PQGAKLAKKQVRVLGKYFSFSFLWGFFQWFFAAGDDCGFAGFPTFGLKAYKYKFFFDFSA  280

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+SLL+G I+SWG++WP+I T++G WYP +L SS+++G+QGYK+F+A
Sbjct  281   TYVGVGMICPHIVNISLLVGGILSWGLMWPLIETRKGDWYPADLPSSNIRGLQGYKIFIA  340

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA +LGDGL+NFF ++   + GL +  + ++    P    P++D  +    +    ++  
Sbjct  341   IATILGDGLYNFFKVLGQTLLGLFYQLQYKNMSGVP----PIEDRSSPRSSSTC--YNDT  394

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP + A+GGYIA+AA+++  +P IFP LKWY+I V Y +AP +AFCNAYG
Sbjct  395   RRTQVFLKDQIPTSFAIGGYIAIAAISMATLPHIFPQLKWYYILVIYLVAPTMAFCNAYG  454

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  +GGV+AGLA+CGVMM+I ST SDLMQDFKTGYL
Sbjct  455   CGLTDWSLASTYGKLAIFSIGAWAGAAHGGVIAGLAACGVMMNIASTASDLMQDFKTGYL  514

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+  LG S S YPAPYA V+R +A+LGV
Sbjct  515   TLASPRSMFVSQFIGTAMGCVISPCVFWLFYKAFDDLGQSGSEYPAPYALVFRNMAVLGV  574

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  +LP NC  L   FF AAI +N+  + + +   +     FIP PM MAIPFYLG YF
Sbjct  575   EGISNLPKNCFTLCCVFFGAAILVNLVRDTVGRKRAQ-----FIPIPMAMAIPFYLGPYF  629

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W+  NK +A+ FGPAVASGLICG+ LW +P++ILALAG+K PICMKF
Sbjct  630   AIDMCVGSLILFIWQRINKAKAEAFGPAVASGLICGDGLWTLPSSILALAGIKQPICMKF  689

Query  322   LSAAANAKLE  293
             LS A NA+++
Sbjct  690   LSRATNARVD  699



>emb|CAE03239.2| OSJNBa0018M05.14 [Oryza sativa Japonica Group]
Length=695

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/690 (58%), Positives = 506/690 (73%), Gaps = 25/690 (4%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S ERVFE   +P WK Q+T+RA+  S +L A+F+ IV KLNLTTG+IPSLNV+AGLLG
Sbjct  17    VVSVERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLG  76

Query  2119  FAVIKSWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSS---------GTASYML  1970
             F ++ SWT LL KAG+   +PFTRQENTV+QTCVVA SGIAFS          G  SY+ 
Sbjct  77    FFLLTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSDADLCTGGTGGFGSYIF  136

Query  1969  GMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSG  1790
              MS  I+ Q+      +N+K  S+GWM+ FL++VSF+GLFS+VPLRK+MI+ YKL YPSG
Sbjct  137   AMSDRISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSG  196

Query  1789  TATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLK  1610
             TATA+LINSFHTP GAKLAK QV  L K F  SF +G FQWF+   DGCGF SFPT GL+
Sbjct  197   TATAHLINSFHTPQGAKLAKMQVKMLGKFFVMSFSWGFFQWFYTGGDGCGFMSFPTLGLE  256

Query  1609  AYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSS  1430
             AY  +F+FDFS+TYVGVGM+CP +VN+S+L+G ++SWGI+WP+I  K+G WYP +L  SS
Sbjct  257   AYRNKFFFDFSATYVGVGMICPYLVNISVLLGGVMSWGIMWPLIEHKKGDWYPADLKPSS  316

Query  1429  LKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGK  1250
             L+GI GY+VF++I+++LGDGL+NF  +M  T  + + + R+  + P   LPV      G 
Sbjct  317   LRGIVGYRVFISISLILGDGLYNFLKVMTRTTTALVMQVRAMMSEPT--LPV-----SGG  369

Query  1249  GAQL--EDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYA  1076
             G Q   E FD +RRT  FLKD IPN +A+  Y+ +A V+I  VP IF  L+WYH+AV+Y 
Sbjct  370   GGQTPEETFDDKRRTELFLKDQIPNWLALSAYVVIAVVSIATVPRIFHQLRWYHVAVSYV  429

Query  1075  MAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTT  896
             +AP+LAFCNAYGCGLTDWSLA+ YGK+AI    +W    +GG++AGLA+CGVM+ IVST 
Sbjct  430   VAPVLAFCNAYGCGLTDWSLATTYGKLAIFTVGAWADASDGGIIAGLAACGVMIGIVSTA  489

Query  895   SDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapy  719
             SDL QDFKTGY+TLASP +MF SQV GTAMGC + P VFW+FYKA+  +G   S YP+P 
Sbjct  490   SDLTQDFKTGYMTLASPRSMFVSQVIGTAMGCVIAPSVFWLFYKAFHDIGMPGSEYPSPN  549

Query  718   aavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPM  539
             A VYR +A+LGV G GSLP +CL+L IGFFVAAIA+N+  ++        +V RF+P PM
Sbjct  550   ALVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDL-----AAPKVARFLPLPM  604

Query  538   CMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILA  359
              MAIPFYLG YF IDMC+GSLI FVW   +  +AK F P VASGLICG+ +W +P ++LA
Sbjct  605   AMAIPFYLGPYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQSVLA  664

Query  358   LAGVKAPICMKFLSAAANAKLESS*PKISS  269
             LAGVK PICMKFLS   N K+++   K+ S
Sbjct  665   LAGVKPPICMKFLSRTTNIKVDAFIAKLPS  694



>gb|KGN64213.1| hypothetical protein Csa_1G043160 [Cucumis sativus]
Length=693

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/672 (60%), Positives = 501/672 (75%), Gaps = 20/672 (3%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S E  FE  E+PSW+ QLT RA F S  LS +F+FIV KLNLTTG+IPSLNV+AGLLG
Sbjct  34    VLSIEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPSLNVSAGLLG  93

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +KSWT  L ++GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA +A
Sbjct  94    FFFVKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAHKA  153

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
              SG+   + K  S+GWM+ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSF
Sbjct  154   -SGS--RDFKDPSLGWMIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSF  210

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA LAK+QV  L + FS SFL+G FQWFF + DGCGF+ FPTFGLKAYA +FYFDF
Sbjct  211   HTPRGAALAKKQVRLLGRFFSVSFLWGFFQWFFTSADGCGFAHFPTFGLKAYANKFYFDF  270

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TY+GVGM+CP ++NVS+L+G IISWGI+WP+I  K G WY   L S  L G++GYKVF
Sbjct  271   SATYIGVGMICPHIINVSVLVGGIISWGIMWPLIEEKRGQWYSEKLRSDDLSGLEGYKVF  330

Query  1399  LAIAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFD  1226
             +AIA++LGDGL+NFF ++  T  GL    +RR E          D        ++L  +D
Sbjct  331   IAIAIILGDGLYNFFKVLTRTLSGLFDQLQRRRESE--------DFSMENSSSSELS-YD  381

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
               RR   FLKD IP   AVGGY+ +A V++  +P IFP LKWY+I V Y  AP+LAFCNA
Sbjct  382   DARRKQLFLKDQIPIWFAVGGYVVIAVVSMNTLPHIFPQLKWYYILVIYIFAPVLAFCNA  441

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YGCGLTDWSLAS YGK+AI    +W G   GG++AGL++CGVMM+IVST SDL QDFKTG
Sbjct  442   YGCGLTDWSLASTYGKLAIFTIGAWAGPSRGGIIAGLSACGVMMNIVSTASDLTQDFKTG  501

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALL  689
             YLTLASP +MF SQV GT MGC ++P VFW+FYKA+  LG     YPAP A ++R +++L
Sbjct  502   YLTLASPRSMFVSQVVGTTMGCIISPCVFWLFYKAFDDLGLPTGEYPAPNAVLFRNMSVL  561

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+G  SLP NCL L   FF  +I IN+  +++ K     +  RFIP PM MAIPFY+G 
Sbjct  562   GVEGASSLPKNCLTLCYIFFATSILINLIKDLIPK-----KWARFIPLPMAMAIPFYIGP  616

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDM +GSLILFVW+  NK +A+ FGPAVASGLICG+ +W +P +ILAL GVK PICM
Sbjct  617   YFAIDMSLGSLILFVWQKLNKTKAEAFGPAVASGLICGDGIWTLPNSILALVGVKPPICM  676

Query  328   KFLSAAANAKLE  293
             KFLS +AN +++
Sbjct  677   KFLSRSANTRVD  688



>ref|XP_006653020.1| PREDICTED: probable metal-nicotianamine transporter YSL10-like 
[Oryza brachyantha]
Length=694

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/674 (59%), Positives = 500/674 (74%), Gaps = 13/674 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVFE   +P WK Q+T+RA+  S VL A+F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  19    SVERVFEGRVVPEWKEQVTVRALAVSAVLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  78

Query  2113  VIKSWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
             ++ SWT LL KAG+   +PFTRQENTV+QTCVVA SGIAFS G  SY+  MS  I+ Q+ 
Sbjct  79    LLTSWTKLLHKAGVAGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQSG  138

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
                  +N+K  S+ WM+ FL++VSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LINSFH
Sbjct  139   EVRDEHNIKNPSLSWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFH  198

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLAK QV  L K F  SF +G FQWF+   DGCGF SFPT GL+AY  +F+FDFS
Sbjct  199   TPQGAKLAKMQVKTLGKFFVMSFSWGFFQWFYTGGDGCGFMSFPTLGLEAYRNKFFFDFS  258

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP +VN+S+L+G +ISWGI+WP+I  K+G WYP +L  SSL+GI GY+VF+
Sbjct  259   ATYVGVGMICPYLVNISVLLGGVISWGIMWPLIEQKKGDWYPADLKPSSLRGIVGYRVFI  318

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQL----EDF  1229
             +IA++LGDGL+NF  +M  T  + + + R+  +GP   LP+      G G       E F
Sbjct  319   SIALILGDGLYNFLKVMTRTTTALVMQVRASMSGPP--LPISGGNGAGGGGDGQTPEETF  376

Query  1228  DGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCN  1049
             D +RRT  FLKD IPN +A+G Y+ +AAV+I  VP IF  L+WYH+AV Y +AP+LAFCN
Sbjct  377   DDKRRTEVFLKDQIPNWMALGTYVVIAAVSIATVPRIFYQLRWYHVAVTYVVAPVLAFCN  436

Query  1048  AYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKT  869
             AYGCGLTDWSLA+ YGK+AI    +W    +GG++AGLA+CGVM+ IVST SDL QDFKT
Sbjct  437   AYGCGLTDWSLATTYGKLAIFTVGAWADASDGGIIAGLAACGVMIGIVSTASDLTQDFKT  496

Query  868   GYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiAL  692
             GY+TLASP +MF SQV GTAMGC + P VFW+FYKA+  +G   S YP+P A VYR +A+
Sbjct  497   GYMTLASPRSMFVSQVIGTAMGCVIAPSVFWLFYKAFHDIGMPGSEYPSPNALVYRNMAI  556

Query  691   LGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLG  512
             LGV G GSLP +CL+L IGFFVAAIA+N+  ++        +V RF+P PM MAIPFYLG
Sbjct  557   LGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDL-----AGPKVARFVPLPMAMAIPFYLG  611

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
              YF IDMC+GSL+  VW   +  +AK F P VASGLICG+ +W +P ++LALAGVK PIC
Sbjct  612   PYFGIDMCIGSLVRLVWDRLDSARAKAFAPPVASGLICGDGIWTLPQSVLALAGVKPPIC  671

Query  331   MKFLSAAANAKLES  290
             MKFL+   N K++ 
Sbjct  672   MKFLARGTNVKVDE  685



>ref|XP_006372353.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
 gb|ERP50150.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
Length=680

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/669 (61%), Positives = 497/669 (74%), Gaps = 30/669 (4%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+NQLT+RA   S VLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  37    SVERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFF  96

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS T+A Q+  
Sbjct  97    FIKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAEQSTE  156

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +  K  S+ WM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  157   DS--DAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHT  214

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K  SFSFL+G FQWF+ A DGCGF+ FP+ GLKAY  +F+FDFS+
Sbjct  215   PAGAKLAKKQVIALGKFLSFSFLWGFFQWFYTAGDGCGFAEFPSLGLKAYENKFFFDFSA  274

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I TK+G WY  +L  +SL G+QGYKV   
Sbjct  275   TYVGVGMICPYIINISVLLGGILSWGLMWPLIDTKKGDWYSADLKPNSLHGLQGYKVL--  332

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
                              +T L F + +RS+  G   +LP+ D            ++ QRR
Sbjct  333   --------------SRTLTAL-FFQLQRSDATG---VLPIADR--SSPETSRISYNDQRR  372

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   AV GY+A+AA++   +P IFP LKWY+I V Y  AP LAFCNAYGCG
Sbjct  373   TQLFLKDQIPTWFAVAGYVAIAAISTATLPHIFPELKWYYILVIYVFAPALAFCNAYGCG  432

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YG +AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  433   LTDWSLASTYGTLAIFAIGAWAGASHGGVLAGLAACGVMMNIVSTASDLSQDFKTGYLTL  492

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             +SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG   S YPAP A V+R +A+LGVDG
Sbjct  493   SSPRSMFVSQLIGTAMGCVISPCVFWLFFKAFKDLGTPGSQYPAPNATVFRNMAILGVDG  552

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L  GFF AAI IN+  + L K     +  RFIPNPM MAIPFY+G YFAI
Sbjct  553   FSSLPKNCLYLCYGFFSAAILINLMKDALGK-----KWARFIPNPMAMAIPFYIGSYFAI  607

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILF+W   +K +A  FGPAVASGLICG+ +W +P+AILAL GVK PICMKFLS
Sbjct  608   DMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSAILALVGVKPPICMKFLS  667

Query  316   AAANAKLES  290
                NAK+++
Sbjct  668   RGTNAKVDA  676



>ref|XP_010037025.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48660.1| hypothetical protein EUGRSUZ_K02316 [Eucalyptus grandis]
Length=702

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/675 (60%), Positives = 507/675 (75%), Gaps = 22/675 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE   +PSW+ QLT RA   S  LS IF FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  39    SVERIFESQGVPSWRRQLTFRAFAVSFALSVIFAFIVMKLNLTTGIIPSLNVSAGLLGFF  98

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLL+ PFTRQENTVIQTCVVASSGIAFS G  S++  MS  +A Q+  
Sbjct  99    FVKTWTKVLDKSGLLQVPFTRQENTVIQTCVVASSGIAFSGGFGSFLFAMSERVARQSTD  158

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                    K  S+ WM  FL+VVSF+GLF++VPLRK+MI+ +KL+YPSGTATA+LINSFHT
Sbjct  159   PQSAPVYKNPSLLWMTGFLFVVSFLGLFAVVPLRKIMIIDFKLSYPSGTATAHLINSFHT  218

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWF+ A DGCGF+ FPT GLKA   RFYF+FS+
Sbjct  219   PEGAKLAKKQVKALGKFFSFSFLWGFFQWFYTAGDGCGFTEFPTLGLKALQYRFYFNFSA  278

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I T++G WYP + S++S++G+QGYKVF+A
Sbjct  279   TYVGVGMICPYIINISVLLGGILSWGLMWPLIETRKGHWYPADESTTSMRGLQGYKVFIA  338

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED----  1232
             IAM+LGDGL+NFF ++   ++GL    R R   +    +LP+ +      G+ LE+    
Sbjct  339   IAMILGDGLYNFFKVLGRTLSGLYHQLRDREMSH----VLPIAN------GSSLENPQVS  388

Query  1231  FDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFC  1052
             +D QRRT  FLKD IP  +AV GY+ +AA++   +P +FP LKWY+I V Y  AP L FC
Sbjct  389   YDDQRRTQLFLKDQIPTWLAVAGYVTIAAISTATLPHMFPQLKWYYILVIYLFAPTLGFC  448

Query  1051  NAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFK  872
             NAYGCGLTDWSLAS YGK+AI +  +W G  +GG+LA LA+CGVMM+IVST SDL QDFK
Sbjct  449   NAYGCGLTDWSLASTYGKLAIFVIGAWAGASHGGILASLAACGVMMNIVSTASDLTQDFK  508

Query  871   TGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiA  695
             TGYLTLASP ++F SQV GTAMGC ++P VFW+FYKA+  LG   S YP P   V+R++A
Sbjct  509   TGYLTLASPRSLFVSQVIGTAMGCVISPCVFWLFYKAFKDLGLPGSEYPVPNGIVFRSMA  568

Query  694   LLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYL  515
              LGV+G  SLP +CL L  GFF AA+ IN F +++ K     +  RFIP PM MAIPFY+
Sbjct  569   ELGVEGVSSLPKHCLTLCYGFFAAAMIINGFRDLVGK-----KWARFIPLPMAMAIPFYI  623

Query  514   GGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPI  335
             G YFAIDMCVGSLILF+W   +K +A  FGPAVASGLICG+ +W +P +ILALAGV  PI
Sbjct  624   GPYFAIDMCVGSLILFIWEKIDKTKADAFGPAVASGLICGDGIWTLPNSILALAGVNPPI  683

Query  334   CMKFLSAAANAKLES  290
             CMKFLS A N ++++
Sbjct  684   CMKFLSRATNKRVDA  698



>gb|KFK39092.1| hypothetical protein AALP_AA3G199800 [Arabis alpina]
Length=721

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/671 (60%), Positives = 510/671 (76%), Gaps = 12/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  52    SVEKIFESREVPSWKKQLTLRAFMVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  111

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  112   FVKTWTKMLHKSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQ--S  169

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+    VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  170   GDAARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  229

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SF +  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  230   PQGAKLAKKQVRVLGKFFSISFFWSFFQWFFTGGEDCGFSNFPTFGLKAYQYKFYFDFSA  289

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I T++G W+P ++ SSS+ G+Q YKVF+A
Sbjct  290   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETRKGDWFPADVPSSSMHGLQAYKVFIA  349

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASL---LPVDDEFNKGKGAQLEDFDG  1223
             +A++LGDGL+NF  ++  T LS +  +    N PAS       +++ +    +  + +D 
Sbjct  350   VAIILGDGLYNFCKVLSRT-LSGLFVQLRGPNPPASRTTSFTHEEDPHASPLSPKQSYDD  408

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRRT  FLKD IP+  AVGGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAY
Sbjct  409   QRRTRFFLKDQIPSWFAVGGYIIIAATSTAILPHMFQQLRWYYILVIYICAPVLAFCNAY  468

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGY
Sbjct  469   GAGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGY  528

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             LTL+SP +MF SQV GTAMGC ++P VFW+FY+A+  LG  NS YPAP+A VYR++A LG
Sbjct  529   LTLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYQAFDDLGLPNSEYPAPFATVYRSMAKLG  588

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G  SLP  CL L   FF  AI INI  + L       +  RFIP PM MAIPF+LG Y
Sbjct  589   VEGVSSLPRECLVLCYAFFGVAILINIVKDSLWS-----KWGRFIPLPMAMAIPFFLGPY  643

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILF+W   +  +A+ +G AVASGLICG+ +W +P+++LA+AGV  P+CMK
Sbjct  644   FAIDMCVGSLILFIWERVDAGKAEAYGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMK  703

Query  325   FLSAAANAKLE  293
             FLS+A N+K++
Sbjct  704   FLSSATNSKVD  714



>ref|XP_004137637.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=723

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/672 (60%), Positives = 501/672 (75%), Gaps = 20/672 (3%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S E  FE  E+PSW+ QLT RA F S  LS +F+FIV KLNLTTG+IPSLNV+AGLLG
Sbjct  64    VLSIEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPSLNVSAGLLG  123

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +KSWT  L ++GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA +A
Sbjct  124   FFFVKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAHKA  183

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
              SG+   + K  S+GWM+ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSF
Sbjct  184   -SGS--RDFKDPSLGWMIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSF  240

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA LAK+QV  L + FS SFL+G FQWFF + DGCGF+ FPTFGLKAYA +FYFDF
Sbjct  241   HTPRGAALAKKQVRLLGRFFSVSFLWGFFQWFFTSADGCGFAHFPTFGLKAYANKFYFDF  300

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TY+GVGM+CP ++NVS+L+G IISWGI+WP+I  K G WY   L S  L G++GYKVF
Sbjct  301   SATYIGVGMICPHIINVSVLVGGIISWGIMWPLIEEKRGQWYSEKLRSDDLSGLEGYKVF  360

Query  1399  LAIAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFD  1226
             +AIA++LGDGL+NFF ++  T  GL    +RR E          D        ++L  +D
Sbjct  361   IAIAIILGDGLYNFFKVLTRTLSGLFDQLQRRRESE--------DFSMENSSSSELS-YD  411

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
               RR   FLKD IP   AVGGY+ +A V++  +P IFP LKWY+I V Y  AP+LAFCNA
Sbjct  412   DARRKQLFLKDQIPIWFAVGGYVVIAVVSMNTLPHIFPQLKWYYILVIYIFAPVLAFCNA  471

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YGCGLTDWSLAS YGK+AI    +W G   GG++AGL++CGVMM+IVST SDL QDFKTG
Sbjct  472   YGCGLTDWSLASTYGKLAIFTIGAWAGPSRGGIIAGLSACGVMMNIVSTASDLTQDFKTG  531

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALL  689
             YLTLASP +MF SQV GT MGC ++P VFW+FYKA+  LG     YPAP A ++R +++L
Sbjct  532   YLTLASPRSMFVSQVVGTTMGCIISPCVFWLFYKAFDDLGLPTGEYPAPNAVLFRNMSVL  591

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+G  SLP NCL L   FF  +I IN+  +++ K     +  RFIP PM MAIPFY+G 
Sbjct  592   GVEGASSLPKNCLTLCYIFFATSILINLIKDLIPK-----KWARFIPLPMAMAIPFYIGP  646

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDM +GSLILFVW+  NK +A+ FGPAVASGLICG+ +W +P +ILAL GVK PICM
Sbjct  647   YFAIDMSLGSLILFVWQKLNKTKAEAFGPAVASGLICGDGIWTLPNSILALVGVKPPICM  706

Query  328   KFLSAAANAKLE  293
             KFLS +AN +++
Sbjct  707   KFLSRSANTRVD  718



>ref|XP_011046075.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X5 [Populus euphratica]
Length=699

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/674 (61%), Positives = 506/674 (75%), Gaps = 22/674 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSW+NQLT+RA   S VLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  38    SVERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFF  97

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              IK+WT  L K+GLL+QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS T+A Q   
Sbjct  98    FIKTWTKFLEKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDTVAKQLTE  157

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  +  K  S+ WM+ FL+VVSF+GLFS VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  158   DS--DAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHT  215

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWF+ A DGCGF+ FP+ GLKA+  +F+FDFS+
Sbjct  216   PAGAKLAKKQVRVLGKFFSFSFLWGFFQWFYTAGDGCGFAEFPSLGLKAHENKFFFDFSA  275

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWG++WP+I TK+G WYP +L   SL G+QGYKVF+A
Sbjct  276   TYVGVGMICPYIINISVLLGGILSWGLMWPLIDTKKGDWYPADLKPGSLHGLQGYKVFIA  335

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE----DFD  1226
              A++LGDGL+NFF ++  T ++   + R      A  LP+ D       + +E     +D
Sbjct  336   TALILGDGLYNFFKVLSRTLVALFSQLRGRNAIGA--LPIADR------SSVEISSISYD  387

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              QRR   FLKD IP   AV GY+A+AA++   VP IFP LKWY+I V Y  AP LAF NA
Sbjct  388   EQRRNQFFLKDQIPTWFAVAGYVAIAAISTATVPLIFPELKWYYILVIYIFAPALAFSNA  447

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YGCGLTDWSLA +YG +AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTG
Sbjct  448   YGCGLTDWSLAYSYGTLAIFAIGAWAGASHGGVLAGLAACGVMMNIVSTASDLSQDFKTG  507

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALL  689
             YLTL+SP +MF SQ+ GTAMGC ++P VFW+F+KA+  LG   S YPAPYA V+R +A+L
Sbjct  508   YLTLSSPRSMFVSQLIGTAMGCIISPCVFWLFFKAFKDLGTPGSQYPAPYATVFRNMAIL  567

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVL-RKYETKYRVYRFIPNPMCMAIPFYLG  512
             GV+GF SLP NCL L  GFF AAI IN+  + L RK+       RFIP PM MAI FY+G
Sbjct  568   GVEGFSSLPKNCLYLCYGFFGAAILINLIKDALGRKWA------RFIPYPMAMAISFYVG  621

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
              YFAID CVGSLILF+W   +K +A  FGP VASGLICG+ +W +P+++LALAG+K PIC
Sbjct  622   SYFAIDACVGSLILFIWEKIDKAKADAFGPVVASGLICGDGIWTLPSSMLALAGIKPPIC  681

Query  331   MKFLSAAANAKLES  290
             MKFLS   N K+++
Sbjct  682   MKFLSRGTNTKVDA  695



>ref|NP_001276131.1| uncharacterized protein LOC100809484 [Glycine max]
 gb|AFD96645.1| YSL1 [Glycine max]
Length=682

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/668 (61%), Positives = 499/668 (75%), Gaps = 13/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE  E+P W+ Q+T+R+M  SLVL  +F FIV KLNLTTG+IPSLN++AGLLGF 
Sbjct  22    SVEKAFEGKEVPPWERQVTVRSMVVSLVLGVMFTFIVMKLNLTTGIIPSLNISAGLLGFF  81

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT LL K+G+L QP+TRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q+  
Sbjct  82    FVKAWTKLLAKSGMLMQPYTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSSDIAKQSPE  141

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  ++K   +GWM+AF +VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  142   AT-AQDIKDPGLGWMIAFAFVVSFLGLFSLVPLRKIMIVDFKLTYPSGTATAHLINSFHT  200

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
               GAKLAK+QV  L K FSFSF +G FQWF+ A DGCGFS+FPTFGL+AY  +F+FDFS+
Sbjct  201   TEGAKLAKKQVNLLGKFFSFSFFWGFFQWFYTASDGCGFSNFPTFGLEAYKNKFFFDFST  260

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVSLL+G IISW I+WP+I  K+G WY   L  SSL G+QGYKVF+A
Sbjct  261   TYVGVGMICPYIINVSLLVGGIISWAIMWPLIDNKKGDWYSAKLEQSSLHGLQGYKVFIA  320

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDGL+NF  ++  T L    +   +  G +S     +         L  +D +RR
Sbjct  321   IAMILGDGLYNFIKVLGRTLLGLYNQFYRKSLGTSSSSSDPNS------PPLLSYDDERR  374

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IP   AV GY+ +A  +I+ VP IFP LKWY+I V Y +AP LAFCNAYGCG
Sbjct  375   IDMFLKDQIPVWFAVIGYVVIAVASIVIVPHIFPQLKWYYIVVIYIIAPALAFCNAYGCG  434

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G   GGV+AGLA+CGVMM+IVST SDL QDFKTGY+TL
Sbjct  435   LTDWSLASTYGKLAIFTIGAWAGASQGGVIAGLAACGVMMNIVSTASDLTQDFKTGYMTL  494

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   SAYPAPYA VYR +A+LGVDG
Sbjct  495   ASPRSMFLSQVLGTAMGCVISPCVFWLFYKAFGNLGIPGSAYPAPYALVYRNMAILGVDG  554

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F +LP  CL L   FFVAAI IN+  +++ +     +  +FIP PM MAIPFY+G YFAI
Sbjct  555   FSALPQYCLTLCCVFFVAAIGINLVRDLVGE-----KWAKFIPVPMAMAIPFYIGSYFAI  609

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLILF+W+  +K  A  FG AVASGLICG+ +W +P++ LALAGVK PICMKFLS
Sbjct  610   DMCVGSLILFIWQRIDKVNADTFGSAVASGLICGDGIWTLPSSFLALAGVKPPICMKFLS  669

Query  316   AAANAKLE  293
                N K++
Sbjct  670   RGVNTKVD  677



>ref|XP_011035385.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
Length=704

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/669 (61%), Positives = 508/669 (76%), Gaps = 7/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+F K  +PSW+NQLT RA   S +LS +F+FIV KLNLT G+IPSLNV+AGLLGF 
Sbjct  38    SVERIFAKQGVPSWRNQLTRRAFGVSFILSVLFSFIVMKLNLTAGIIPSLNVSAGLLGFF  97

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT  L   GLLKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA ++  
Sbjct  98    FVKTWTRFLESCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSGRIAQESAD  157

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  ++K  ++GW++ FL+VVSF+GLFS+VPLRK+M++ +KL YPSGTATA+LINSFHT
Sbjct  158   QPSAKDIKDPALGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLIYPSGTATAHLINSFHT  217

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWFF A+D CGF++FPTFGLKAY   F+FDFS+
Sbjct  218   PEGAKLAKKQVRALGKFFSFSFLWGFFQWFFKAEDNCGFANFPTFGLKAYDNMFFFDFSA  277

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N S+L+G I+SWG++WP+I T++  WY   LS  SL+G+QGYKVF++
Sbjct  278   TYVGVGMICPYIINASVLLGGILSWGLMWPLIETRKNDWYSAELSPKSLRGLQGYKVFIS  337

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             I+M+LGDGL+NF  ++  T +    + + +   P   LPVD   +         +D QRR
Sbjct  338   ISMILGDGLYNFCKVLTRTLIGLYIQLQGKD--PKMALPVDG--SAPPNTLTASYDDQRR  393

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP   AV GY+ +AAV+   +P IFP LKWY+I V YA AP LAFCNAYGCG
Sbjct  394   TQLFLKDQIPAWFAVAGYVVIAAVSTATLPHIFPQLKWYYILVIYAFAPTLAFCNAYGCG  453

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGYLTL
Sbjct  454   LTDWSLASTYGKLAIFTIGAWAGAAHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYLTL  513

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   S YPAP+A VYR +A+LGV+G
Sbjct  514   ASPKSMFVSQVIGTAMGCVISPCVFWLFYKAFDDLGLPGSQYPAPFAVVYRNMAILGVEG  573

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF  AI INIF +V+ +   K+   +FIP PM MAIPFY+G YFAI
Sbjct  574   FSSLPKNCLKLCYIFFCGAILINIFKDVMERKCKKFA--KFIPLPMAMAIPFYIGPYFAI  631

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLIL+VW   NK +A  F PAVASGLICG+ +W +P++ILALAGVKAPICM+F S
Sbjct  632   DMCVGSLILYVWGRINKAKADAFAPAVASGLICGDGIWTLPSSILALAGVKAPICMRFFS  691

Query  316   AAANAKLES  290
              A N ++++
Sbjct  692   RATNTRIDN  700



>emb|CDY46051.1| BnaC01g34980D [Brassica napus]
Length=960

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/673 (60%), Positives = 509/673 (76%), Gaps = 12/673 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSW  QLT+RA   S VLS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  46    SVEKIFESREVPSWTKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  105

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L ++G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  106   FVKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQ--S  163

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  164   GDVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  223

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+  FQWFF   + CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  224   PQGAKLAKKQVRVLGKFFSFSFLWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSA  283

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P ++  SS+ G+Q YKVF+A
Sbjct  284   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPADVEPSSMHGLQAYKVFIA  343

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQL--EDFD  1226
             +A++LGDGL+NF  ++   ++GL    R  +  +       V +E +     Q   E +D
Sbjct  344   VAIILGDGLYNFCKVLSRTLSGLFVQLRGTTTPSFSRRSFTVQEEEDPHASPQTPKESYD  403

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              QRRT  FLKD IP   AVGGYI ++A +   +P++F  L+WY+I V Y  AP+LAFCNA
Sbjct  404   DQRRTRFFLKDQIPTWFAVGGYITISAASTAILPYMFHQLRWYYILVIYICAPVLAFCNA  463

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YG GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTG
Sbjct  464   YGAGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTG  523

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALL  689
             YLTL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A L
Sbjct  524   YLTLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFEDLGIPNSEYPAPFATVYRSMAKL  583

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+G  SLP  CL L   FF  AI +NI  + L       R  RF+P PM MAIPF+LG 
Sbjct  584   GVEGVASLPRECLVLCYAFFSVAILVNIVKDSLPS-----RWGRFVPLPMAMAIPFFLGP  638

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDMCVGSL+LFVW   +  +A+ FG AVASGLICG+ +W  P+++LA+AGV  P+CM
Sbjct  639   YFAIDMCVGSLVLFVWERVDAAKAEAFGTAVASGLICGDGIWSFPSSVLAIAGVNPPVCM  698

Query  328   KFLSAAANAKLES  290
             KFLSAA N++++S
Sbjct  699   KFLSAATNSRVDS  711



>emb|CAN72423.1| hypothetical protein VITISV_014262 [Vitis vinifera]
Length=684

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/672 (61%), Positives = 512/672 (76%), Gaps = 14/672 (2%)
 Frame = -2

Query  2302  KVESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLL  2123
             K+ S E +F+    PSW+ QLTIRA   S VL  +F FIV KLNLTTG+IPSLNV+AGLL
Sbjct  20    KLPSVEMIFKGQVEPSWREQLTIRAFVVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLL  79

Query  2122  GFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQ  1943
             GF  +KSWT L+ K+GLLKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS T+A Q
Sbjct  80    GFFFLKSWTKLMEKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSSTVAGQ  139

Query  1942  AESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINS  1763
             +   N   N K  S+ W++ FL+ VSF+GLFS++PLRK+MI+ YKLTYPSGTATA+LINS
Sbjct  140   SSETNAAQNTKDPSLSWIIGFLFAVSFLGLFSVLPLRKIMIIDYKLTYPSGTATAHLINS  199

Query  1762  FHTPNGAKLAKQ-QVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYF  1586
             FHTP GAKLAK  QV  L K FSFSFL+G FQWFF A DGCGF +FPTFGLKA+  RFYF
Sbjct  200   FHTPQGAKLAKNIQVRTLGKFFSFSFLWGFFQWFFTAGDGCGFVNFPTFGLKAFDNRFYF  259

Query  1585  DFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYK  1406
             DFS+TYVGVGM+CP ++N+S+L+GAI+SWG++WP+I  ++G WY   LS SSL G+QGY+
Sbjct  260   DFSATYVGVGMICPYLINISVLVGAILSWGLMWPLIKNRKGDWYSSELSESSLHGLQGYR  319

Query  1405  VFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFD  1226
             VF++IAM+LGDGL+NF  ++  T   F+K+ + ++     ++PV +  +  K +    +D
Sbjct  320   VFISIAMILGDGLYNFIKVLGRTIQGFIKQYKKKE-----VIPVTERDSPQKVS--NSYD  372

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              + RT  FLKD IP  V+  GY+A+AAV++  +P IF  +KWY++ V Y +AP LAFCNA
Sbjct  373   DEVRTKLFLKDGIPMWVSFAGYVAIAAVSMGVIPKIFHQMKWYYVLVIYIVAPALAFCNA  432

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YG GLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTG
Sbjct  433   YGAGLTDWSLASTYGKLAIFAIGAWAGESHGGVLAGLAACGVMMNIVSTASDLMQDFKTG  492

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALL  689
             Y+T +SP +MFFSQ+ GTAMGC ++P VFW+FYKA+  LG   S YPAPYAAVYR++++L
Sbjct  493   YMTRSSPRSMFFSQIIGTAMGCLISPCVFWLFYKAFKDLGSPESQYPAPYAAVYRSMSIL  552

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+GFG+LP +CL L   FF  AI IN+  + + K   KY     IP PM MAIPFYLG 
Sbjct  553   GVEGFGALPDHCLTLCYVFFFGAIIINLIRDTIAKKWAKY-----IPLPMAMAIPFYLGS  607

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDMCVGSLILF+W   NK +A  FGPAVASGLICG+ +W +P++ILALAGV+ PICM
Sbjct  608   YFAIDMCVGSLILFIWGKLNKAKADAFGPAVASGLICGDGIWTLPSSILALAGVQPPICM  667

Query  328   KFLSAAANAKLE  293
             KFLS   N+ ++
Sbjct  668   KFLSRGTNSMVD  679



>ref|XP_010470452.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Camelina 
sativa]
Length=692

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/671 (61%), Positives = 512/671 (76%), Gaps = 15/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEI--PSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             S E++FE      PSW++QLT RA+  S +L+ +F F+V KLNLTTG+IPSLN++AGLLG
Sbjct  29    SVEKIFEASHEVPPSWQHQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLG  88

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +K+WT +L KAG+LKQPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+
Sbjct  89    FFFVKTWTKILNKAGVLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQS  148

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                N   N+K   +GWM+ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSF
Sbjct  149   AEANTAMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSF  208

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV AL K FSFSFL+G FQWFF + D CGF++FPTFGLKAY  +FYFDF
Sbjct  209   HTPQGAKLAKKQVRALGKFFSFSFLWGFFQWFFTSGDDCGFANFPTFGLKAYESKFYFDF  268

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++NVSLLIG+I+SWGI+WP+I  ++G WY   L  SSL G+QGYKVF
Sbjct  269   SATYVGVGMICPYLINVSLLIGSILSWGIMWPLIGNQKGNWYSAKLGPSSLHGLQGYKVF  328

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIAM+LGDGL+NF  ++  T     K+ +++      +LPV+D            +D +
Sbjct  329   IAIAMILGDGLYNFIKVLGRTIFGLYKQFKNK-----DVLPVNDR--SSPNIVKISYDDK  381

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+  A+ GY+ LA V+I+ VP IF  LKWYHI   Y +AP+LAFCNAYG
Sbjct  382   RRTELFLKDRIPSWFAITGYVVLAIVSIVTVPHIFHQLKWYHILTMYIIAPVLAFCNAYG  441

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKTGY+
Sbjct  442   CGLTDWSLASTYGKLAIFTIGAWAGAANGGVLAGLAACGVMMNIVSTASDLMQDFKTGYM  501

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQ  GTAMGC ++P VFW+FYKA+P  G + +AYPAPYA VYR +++LGV
Sbjct  502   TLASPRSMFLSQAIGTAMGCVISPCVFWLFYKAFPDFGQNGTAYPAPYALVYRNMSILGV  561

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
              GF +LP +CL L   FF AA+ +N   + +       +  RFIP PM MAIPFY+GGYF
Sbjct  562   AGFSALPKHCLMLCYIFFAAAVIVNGVRDAVGP-----KWARFIPLPMAMAIPFYIGGYF  616

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
              IDMCVGSLILF+WR  NK +A  +  AVASGLICGE +W +P+++LALAGVK PICMKF
Sbjct  617   TIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLPSSVLALAGVKPPICMKF  676

Query  322   LSAAANAKLES  290
             LS++ N K++S
Sbjct  677   LSSSTNMKVDS  687



>emb|CDY68937.1| BnaCnng61140D, partial [Brassica napus]
Length=735

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/668 (60%), Positives = 502/668 (75%), Gaps = 14/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S +LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  48    SVEKIFESREVPSWKKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  107

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  108   FVKTWTKVLYKSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQ--S  165

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+     K  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  166   GDASRGFKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  225

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SFL+  FQWFF   D CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  226   PQGAKLAKKQVRMLGKFFSLSFLWSFFQWFFTGGDNCGFSNFPTFGLKAYQYKFYFDFSA  285

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVS+L+G I+SWGI+WP+I TK+G W+P ++ SSS+ G+Q YKVF+A
Sbjct  286   TYVGVGMICPYIINVSVLLGGILSWGIMWPLIETKKGDWFPADVESSSMHGLQAYKVFIA  345

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL    R  S +      L ++++      +  + +D Q
Sbjct  346   VAIILGDGLYNFCKVLSRTLSGLFVQLRGTSSRAS----LTIEEDPTASPYSPKQSYDDQ  401

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   A+GGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  402   RRTRFFLKDQIPTWFAMGGYIIIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYG  461

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  462   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYL  521

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FY A+  LG  NS YPAP+A VYR++A LGV
Sbjct  522   TLSSPRSMFISQVIGTAMGCVVSPCVFWLFYNAFDDLGLPNSEYPAPFATVYRSMAKLGV  581

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF  AI +NI  + L       R  RF+P PM MAIPF+LG YF
Sbjct  582   EGVASLPRECLVLCYAFFGVAILVNIVKDSLPS-----RWGRFVPLPMAMAIPFFLGPYF  636

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSL+LFVW   +  +A  FG AVASGLICG+ +W +P+++LA+AGV  P+CMKF
Sbjct  637   AIDMCVGSLVLFVWERVDAAKAGAFGTAVASGLICGDGIWSLPSSVLAIAGVSPPVCMKF  696

Query  322   LSAAANAK  299
             L AA N K
Sbjct  697   LDAATNTK  704



>ref|XP_004299460.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/669 (60%), Positives = 505/669 (75%), Gaps = 14/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++F K E+PSW  QLT RA   S +LS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  50    SVEKLFAKQEVPSWTRQLTFRAFIISGMLSVLFSVIVMKLNLTTGIIPSLNVSAGLLGFF  109

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              + +WT ++ KAG L QPFTRQENTVIQTC+VASSGIAFS G  SY+ GMS  IAAQ+  
Sbjct  110   FVSTWTKIVTKAGFLTQPFTRQENTVIQTCIVASSGIAFSGGFGSYLFGMSDRIAAQSSD  169

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  + K   + W++ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  170   ---RGDTKNPGLLWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  226

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SFL+G FQWF+ A D CGF +FP+ GLKAY   F+FDFS+
Sbjct  227   PEGAKLAKKQVKELGKFFSLSFLWGFFQWFYTAGDSCGFINFPSLGLKAYENTFFFDFSA  286

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+S+L+G IIS+G++WP+I  K G WY  +LS  S+ G+Q YKVF+A
Sbjct  287   TYVGVGMICPYIVNISVLLGGIISYGLMWPLIWNKRGDWYSEDLSPKSMNGLQAYKVFIA  346

Query  1393  IAMMLGDGLFNFFYMMVVTGLS-FMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             I+M+LGDGL+NFF ++  T ++ +++ R+ + NG   +LPV D+ +     QL  +D QR
Sbjct  347   ISMILGDGLYNFFKVLGRTLIALYVQLRQKDVNG---ILPVADQASPATLEQLS-YDDQR  402

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP   A  GY+ +AA++I  VP IFP LKWY+I V Y +AP LAFCNAYGC
Sbjct  403   RTQLFLKDQIPAWFAAAGYVGIAAISIATVPHIFPQLKWYYILVIYLIAPTLAFCNAYGC  462

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YGK+AI    +W G  +GGV+AGLA+CGVMM+IV+T SDL QDFKTGYLT
Sbjct  463   GLTDWSLASTYGKVAIFTIGAWAGASHGGVIAGLAACGVMMNIVTTASDLTQDFKTGYLT  522

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVD  680
             LASP +MF SQ+ GTAMGC ++P VFW+FYKA+P LG+  SAY AP+A VYR +++L V+
Sbjct  523   LASPRSMFVSQIIGTAMGCVISPSVFWLFYKAFPDLGNPGSAYAAPFAVVYRNMSILAVE  582

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             G  SLP NCL L   FF AAI IN+  + + K        RFIP PM MAIPFY+G YFA
Sbjct  583   GLDSLPKNCLLLCGVFFAAAILINLIKDCIGKQRA-----RFIPLPMAMAIPFYIGTYFA  637

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDMC+GSLI FVW   NK +A  F PAVASG+ICG+ +W +PA+ILALAGVK PICM+FL
Sbjct  638   IDMCIGSLIKFVWEKINKAKADAFVPAVASGMICGDGIWTLPASILALAGVKPPICMRFL  697

Query  319   SAAANAKLE  293
             S+  NA+++
Sbjct  698   SSKDNARVD  706



>ref|XP_004165464.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=698

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/672 (60%), Positives = 500/672 (74%), Gaps = 20/672 (3%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S E  FE  E+PSW+ QLT RA F S  LS +F+FIV KLNLTTG+IPSLNV+AGLLG
Sbjct  39    VLSIEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPSLNVSAGLLG  98

Query  2119  FAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
             F  +KSWT  L ++GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA +A
Sbjct  99    FFFVKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAHKA  158

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
              SG+   + K  S+GWM+ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSF
Sbjct  159   -SGS--RDFKDPSLGWMIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSF  215

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA LAK+QV  L + FS SFL+G FQWFF + DGCGF+ FPTFGLKAYA +FYFDF
Sbjct  216   HTPRGAALAKKQVRLLGRFFSVSFLWGFFQWFFTSADGCGFAHFPTFGLKAYANKFYFDF  275

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TY+GVGM+CP ++NVS+L+G IISWGI+WP+I  K G WY   L S  L G++GYKVF
Sbjct  276   SATYIGVGMICPHIINVSVLVGGIISWGIMWPLIEEKRGQWYSEKLRSDDLSGLEGYKVF  335

Query  1399  LAIAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFD  1226
             +AIA++LGDGL+NFF ++  T  GL    +RR E          D        ++L  +D
Sbjct  336   IAIAIILGDGLYNFFKVLTRTLSGLFDQLQRRRESE--------DFSMENSSSSELS-YD  386

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
               RR   FLKD IP   AVGGY+ +A V++  +P IFP LKWY+I V Y  AP+LAFCNA
Sbjct  387   DARRKQLFLKDQIPIWFAVGGYVVIAVVSMNTLPHIFPQLKWYYILVIYIFAPVLAFCNA  446

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YGCGLTDWSLAS YGK+AI    +W G   GG++AGL++CGVMM+IVST SDL QDFKTG
Sbjct  447   YGCGLTDWSLASTYGKLAIFTIGAWAGPSRGGIIAGLSACGVMMNIVSTASDLTQDFKTG  506

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALL  689
             YLTLASP +MF SQV GT MGC ++P VFW+FYKA+  LG     YPAP A ++R +++L
Sbjct  507   YLTLASPRSMFVSQVVGTTMGCIISPCVFWLFYKAFDDLGLPTGEYPAPNAVLFRNMSVL  566

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+G  SLP NCL L   FF  +I IN+  +++ K     +  RFIP PM MAIPFY+G 
Sbjct  567   GVEGASSLPKNCLTLCYIFFATSILINLIKDLIPK-----KWARFIPLPMAMAIPFYIGP  621

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDM +GSLILFVW+  N  +A+ FGPAVASGLICG+ +W +P +ILAL GVK PICM
Sbjct  622   YFAIDMSLGSLILFVWQKLNXTKAEAFGPAVASGLICGDGIWTLPNSILALVGVKPPICM  681

Query  328   KFLSAAANAKLE  293
             KFLS +AN +++
Sbjct  682   KFLSRSANTRVD  693



>ref|XP_009107360.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Brassica 
rapa]
 emb|CDY41835.1| BnaA08g03300D [Brassica napus]
Length=718

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/668 (60%), Positives = 505/668 (76%), Gaps = 9/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E +FE  E+PSWK QLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  52    SVEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  111

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA    S
Sbjct  112   FVKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSERIANH--S  169

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+    VK  S+GW++AFL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  170   GDAARGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  229

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SFL+G FQWFF A + CGF SFPTFGL+AY  +FYFDFS+
Sbjct  230   PQGAKLAKEQVRVLGKFFSLSFLWGFFQWFFTAGENCGFHSFPTFGLRAYQYKFYFDFSA  289

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLL+G I+SWG++WP+I T++G W+P ++ SSS+ G+Q YKVF+A
Sbjct  290   TYVGVGMICPYIINISLLLGGILSWGLMWPLIETRKGDWFPSDVESSSMSGLQAYKVFIA  349

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             +AM+LGDG++NF  +   T     K+ R E +   SL   ++E           +D QRR
Sbjct  350   VAMILGDGVYNFCKVFSRTLSGLFKQIRGEASWRNSL-SREEEPPASPLTPKISYDDQRR  408

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP+  A GGY+ +AAV+I  +P +F  L+WY+I V Y  AP+LAFCNAYG G
Sbjct  409   TRFFLKDQIPSWFAGGGYVLIAAVSIAILPQMFDQLRWYYILVIYVFAPVLAFCNAYGAG  468

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G D+GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  469   LTDWSLASTYGKLAIFTIGAWAGSDHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  528

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             +SP AMF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LGV+G
Sbjct  529   SSPRAMFVSQVIGTAMGCLVSPCVFWLFYKAFDDLGLPNSKYPAPFATVYRSMAKLGVEG  588

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP +CL L   FF  AI IN+  + L       R  R++P PM MAIPF+LG YFAI
Sbjct  589   VSSLPRDCLVLCYAFFGFAILINVVKDGLGN-----RWGRYVPLPMAMAIPFFLGPYFAI  643

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSL+LFVW   +  +A+ F  AVASGLICG+ +W +P+++LA+AGV+ PICMKFLS
Sbjct  644   DMCVGSLVLFVWERLDAPRAEAFATAVASGLICGDGIWTLPSSVLAIAGVEPPICMKFLS  703

Query  316   AAANAKLE  293
             +  N +++
Sbjct  704   SETNHRVD  711



>gb|EMT24510.1| Putative metal-nicotianamine transporter YSL13 [Aegilops tauschii]
Length=727

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/683 (58%), Positives = 500/683 (73%), Gaps = 24/683 (4%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER F    +PSW+ QLT+RA   S  L+ +F+ IV KLNLT G+IPSLNV+AGLL F 
Sbjct  48    SVERAFADQRVPSWREQLTVRAFVASFFLATMFSVIVMKLNLTVGIIPSLNVSAGLLSFF  107

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + K GLL+QPFTRQENTVIQTCVVA+ GI+FS G  +Y+L MS  IA+QA+ 
Sbjct  108   FVRLWTAAMEKVGLLRQPFTRQENTVIQTCVVAAYGISFSGGFGNYLLAMSDRIASQADE  167

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRK--------------MMILKYKLTYP  1796
              N P N+K   +GW++ FL +VSF+GLF +VPLRK              +MI+ YKLTYP
Sbjct  168   ANNPQNIKNPHLGWIIGFLLLVSFIGLFGLVPLRKQPCAYHFNQISTVQIMIIDYKLTYP  227

Query  1795  SGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFG  1616
             SGTATAYLIN FHTP+GAK+A +QV  L   F  SF +G FQWF+ A D CGF+ FP+ G
Sbjct  228   SGTATAYLINGFHTPHGAKIAVKQVKKLGLFFVLSFFWGFFQWFYTATDTCGFNQFPSLG  287

Query  1615  LKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSS  1436
             L+AY  RFYFDFS TYVGVGM+CP +VNVS+L+G I+SWGI+W +I  K GIW+  +L+ 
Sbjct  288   LQAYQNRFYFDFSPTYVGVGMICPHIVNVSVLLGGILSWGIMWSLIAKKRGIWFSADLAD  347

Query  1435  SSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNK  1256
             +SL G+QGY+VF+AIA++LGDGL+NF  M+++T  S    R   K   AS LP+ D+  +
Sbjct  348   TSLHGMQGYRVFIAIALILGDGLYNFLKMLILTAWSL---RSQHKKSSASTLPISDD-EQ  403

Query  1255  GKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYA  1076
               G     +D +RR   FLKD IP  +A GGY A+AAV+I  VP IFP LKWY I VAY 
Sbjct  404   SNGTAAISYDEERRNELFLKDQIPWYIAYGGYAAVAAVSIGTVPQIFPQLKWYQILVAYI  463

Query  1075  MAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTT  896
             +APILAFCNAYG GLTDWSL + YGK+AI  F +W G  +GGVLAGLA+CGVMMSIVST 
Sbjct  464   VAPILAFCNAYGTGLTDWSLVTTYGKLAIFAFGAWTGASHGGVLAGLAACGVMMSIVSTA  523

Query  895   SDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapy  719
             +DLMQDFKTGYLTLASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAP 
Sbjct  524   ADLMQDFKTGYLTLASPRSMFISQVIGTAMGCVIAPCVFWLFYKAFDNIGISGSEYPAPN  583

Query  718   aavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPM  539
             AA++R++A+LGVDGF SLP NCL L   FFV AI +N+  +++ K     +V  FIP PM
Sbjct  584   AAIFRSMAILGVDGFSSLPKNCLTLCYIFFVGAIVVNLIRDLVPK-----KVSNFIPIPM  638

Query  538   CMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILA  359
              MAIPFY+G YFAIDM +G++ILFVW+  ++ +++ F PAVASGLICG+ LW +P ++LA
Sbjct  639   AMAIPFYIGSYFAIDMFIGTVILFVWQKLDRAKSETFAPAVASGLICGDGLWVLPQSVLA  698

Query  358   LAGVKAPICMKFLSAAANAKLES  290
             LA VK PICMKFLS   N K+++
Sbjct  699   LAKVKPPICMKFLSRGMNDKVDA  721



>ref|NP_001185810.1| yellow stripe-like transporter 11 [Zea mays]
 gb|ADO20998.1| yellow stripe-like transporter 11 [Zea mays]
Length=714

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/670 (59%), Positives = 491/670 (73%), Gaps = 12/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ F    +PSW+ QLT+RA     +L+ +F+ IV KLNLTTGVIPSLNV+A LLG+ 
Sbjct  51    SVEQAFADEPVPSWREQLTVRAFVVGFILAVLFSVIVMKLNLTTGVIPSLNVSASLLGYF  110

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             +++ WT  +   GLLK PFTRQENTVIQTCVV++ G+AFS G  SY+ GMS TIA QA  
Sbjct  111   LVRLWTKAIESVGLLKHPFTRQENTVIQTCVVSAYGLAFSGGFGSYLFGMSRTIAIQATE  170

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GWM+ F+++VSFVGLF +VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  171   ANDAQNIKDPQLGWMIGFMFLVSFVGLFVLVPLRKVMIVDYKLTYPSGTATAYLINGFHT  230

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA+ AK+QV  L K FS SFL+  FQWF+ A D CGF+SFPT GL+AY  +FYFDFS+
Sbjct  231   PQGAERAKKQVRTLGKYFSLSFLWAFFQWFYTAGDDCGFASFPTLGLEAYKNKFYFDFSA  290

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVSLL+G IISWG++WP+I TK+G WYP +L  SSL G+ GYKVF+ 
Sbjct  291   TYVGVGMICPYIVNVSLLLGGIISWGLMWPLISTKKGSWYPESLPDSSLHGLNGYKVFIT  350

Query  1393  IAMMLGDGLFNFF--YMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IA++LGDGL+NF   +   +  L  M  ++      A+ LPV D        + E FD +
Sbjct  351   IAVILGDGLYNFLKVFGHTIGALISMYWKKH-----ANRLPVSDNMTPPATVETESFDDK  405

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR   F+KD IP  VA+GGY+ LAA +I  +P I P +KWY I VAY  APILAFCNAYG
Sbjct  406   RRIELFVKDQIPKTVALGGYVVLAATSIGCLPLIIPQIKWYQIFVAYIFAPILAFCNAYG  465

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI +  +W G  +GGVL GLA+CGVMMSIV T SDLMQDFKTGYL
Sbjct  466   SGLTDWSLASTYGKLAIFVIGAWAGASHGGVLVGLAACGVMMSIVGTASDLMQDFKTGYL  525

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVD  680
             TLASP +MF SQV GTA+GC   P VFW+FYK++ +G S  AYPAPYA +YR +++LGVD
Sbjct  526   TLASPRSMFISQVIGTAIGCVTAPCVFWLFYKSFDIGASGGAYPAPYAIMYRNMSILGVD  585

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             G   LP NCL L   FF  +  IN+  +++ K     +V +FIP PM  AIPFYLG YFA
Sbjct  586   GLSLLPKNCLTLCYIFFAVSFTINLIKDLVPK-----KVAKFIPIPMAAAIPFYLGPYFA  640

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDM +GS+ILF W WKNK +A  FGPAVASGL+CG+ LW +P A+L+LA VK PICMKFL
Sbjct  641   IDMFLGSVILFFWEWKNKAEADSFGPAVASGLMCGDGLWALPQAVLSLANVKPPICMKFL  700

Query  319   SAAANAKLES  290
             S + NAK+++
Sbjct  701   SRSLNAKVDT  710



>ref|XP_010675190.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Beta 
vulgaris subsp. vulgaris]
Length=683

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/657 (60%), Positives = 502/657 (76%), Gaps = 11/657 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+VF    +  WK QLT+RA   S  LS +F FIV KLNLTTGVIPSLNV+AGLLG+ 
Sbjct  30    SVEKVFSSKPVLPWKQQLTVRAFVVSFFLSILFTFIVMKLNLTTGVIPSLNVSAGLLGYF  89

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K WT  L K G LKQPFTRQENTVIQTCVVA+SGIAFS G  SY+LGMS  IA QA+ 
Sbjct  90    FVKVWTKFLEKFGFLKQPFTRQENTVIQTCVVAASGIAFSGGFGSYILGMSERIAKQADR  149

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G   ++ K   +GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATAYLINSFHT
Sbjct  150   G-YQHDSKNPHLGWLIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAYLINSFHT  208

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA LAK+QV AL K FSFSFL+G FQWFF     CGF +FPTFGLKAY  +FYFDFS+
Sbjct  209   PKGAILAKKQVEALGKFFSFSFLWGFFQWFFTGGTDCGFVAFPTFGLKAYDNKFYFDFSA  268

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
              YVGVGM+CP ++N+SLL+GAI+SWGI+WP+I T++G W+  +L+++ + G+QGY++F+A
Sbjct  269   LYVGVGMICPYLINISLLLGAILSWGIMWPLIETRKGHWFDASLTNT-VHGLQGYQIFVA  327

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  +   T     K+ +++ +G  ++LP D+  N    A  + FD QRR
Sbjct  328   IAIILGDGLYNFVKVFGHTIFGLYKQFQTKDSG--AILPSDEHPNPEVSAS-QSFDEQRR  384

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             TH FLKD IP   A  GY+ +A ++II +P IF  LKWYH+ V Y +AP+LAFCNAYGCG
Sbjct  385   THYFLKDRIPTWFAASGYVTIAVISIITLPHIFHSLKWYHVLVMYVIAPMLAFCNAYGCG  444

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI +  +W G  +GGV+AGLA+CGV+M+IVST SDL QDFKTGY+TL
Sbjct  445   LTDWSLASTYGKLAIFVIGAWAGASHGGVVAGLAACGVLMNIVSTASDLSQDFKTGYMTL  504

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQ+ GTAMGC ++P VFW+FY A+P LG+  S Y APYA++Y  +A+LGV G
Sbjct  505   ASPRSMFVSQIIGTAMGCVISPCVFWLFYNAFPDLGEPTSQYKAPYASIYHNMAVLGVQG  564

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             FGSLP NCL L + FF+ A+AIN   ++L K     +  RFIP PM MAIPFY+GGYFAI
Sbjct  565   FGSLPKNCLKLCLIFFIGAMAINGMRDLLGK-----KWARFIPIPMAMAIPFYIGGYFAI  619

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             DMCVGSLILF+W+  N+  A  FGPAVASGLICG+ +W +P+++LAL GV  P+C++
Sbjct  620   DMCVGSLILFLWQHSNRANADAFGPAVASGLICGDGIWTLPSSVLALVGVHPPLCLQ  676



>gb|AEQ28190.1| yellow stripe-like protein 5 [Malus baccata var. xiaojinensis]
Length=733

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/669 (61%), Positives = 504/669 (75%), Gaps = 11/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE   +PSW+ QLT RA F S VLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  68    SVEKLFENQPVPSWREQLTFRAFFISFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFF  127

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +++WT  L + GLL QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q++ 
Sbjct  128   FVRTWTKFLERCGLLNQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERIAQQSKD  187

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 ++ K   + W++ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  188   ---RSDTKDPGLLWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  244

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P G KLAK+QV  L K FSFSFL+G FQWF+ A D CGF+SFP+ GLKAY   F+FDFS+
Sbjct  245   PEGVKLAKKQVRELGKFFSFSFLWGFFQWFYTAGDNCGFASFPSLGLKAYQNEFFFDFSA  304

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VN+S+L+G I+SWG+IWP+I T+ G WY   LS  S+ G+QGYKVF+A
Sbjct  305   TYVGVGMICPYIVNISILLGGILSWGLIWPLIETRSGDWYDKELSPKSMNGLQGYKVFIA  364

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  ++  T ++   + RS+    + +LPV         +    +D QRR
Sbjct  365   IALILGDGLYNFVKVLSRTLIALQSQLRSKD--ASGILPVKKHHGSPDVSSELSYDDQRR  422

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP  +AVGGY+  AA++I  VP IFP LKWY+I V Y  AP LAFCNAYGCG
Sbjct  423   TQLFLKDQIPAWIAVGGYVVFAAISIATVPHIFPQLKWYYILVIYLFAPTLAFCNAYGCG  482

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  483   LTDWSLASTYGKVAIFTIGAWAGSAHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  542

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQ+ GTAMGC ++P VFW+FYKA+  LG   SAYPAP+A VYR IA+L V+G
Sbjct  543   ASPRSMFVSQIVGTAMGCVVSPCVFWLFYKAFSDLGIPGSAYPAPFAVVYRNIAVLAVEG  602

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP NCL L   FF AAIAIN+  + L K     +  RF+P PM MAIPFYLG YFAI
Sbjct  603   VKSLPKNCLLLCGIFFGAAIAINVLKDCLGK-----KRGRFVPLPMAMAIPFYLGSYFAI  657

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLI+F+W   NK +A  F PAVASGLICG+  W +PA+ILALAGV+ PICMKFLS
Sbjct  658   DMCIGSLIVFLWGRVNKAKADAFVPAVASGLICGDGTWTLPASILALAGVQPPICMKFLS  717

Query  316   AAANAKLES  290
             ++ N ++++
Sbjct  718   SSQNTRVDA  726



>gb|KEH34582.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=690

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/674 (62%), Positives = 518/674 (77%), Gaps = 22/674 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE   +P+W+ Q+T+RA+F SL+LS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  29    SVEKGFEGTSVPTWQKQVTVRAIFASLMLSVMFTFIVMKLNLTTGIIPSLNVSAGLLGFF  88

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT LL KAG L QPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMSPTIA Q   
Sbjct  89    FVKTWTKLLEKAGWLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSPTIAKQIPE  148

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              +  N+VK+L +GWM+AFL+VVSF+GLFS++PLRK+MI+ + LTYPSGTATA+LINSFHT
Sbjct  149   FDSANDVKSLGLGWMIAFLFVVSFLGLFSVLPLRKIMIVDFGLTYPSGTATAHLINSFHT  208

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
               GAKLAK+QV AL K FSFSFL+G FQWFF A D CGF++FPTFGL+AY ++FYFDFS+
Sbjct  209   SEGAKLAKKQVKALGKFFSFSFLWGFFQWFFTAGDACGFTNFPTFGLEAYHRKFYFDFSA  268

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLLIG I+SW ++WP+I +K+G W+P +L  SSL G+QGYKVF+A
Sbjct  269   TYVGVGMICPYIINISLLIGGILSWAVMWPLIGSKKGDWFPSDLKHSSLHGLQGYKVFIA  328

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRR-----RSEKNGPASLLPVDDEFNKGKGAQLEDF  1229
             IAM+LGDGL+NF  ++  T L   K+      R++ + P +  P               F
Sbjct  329   IAMILGDGLYNFVKVLGTTLLGLKKQWKKKDIRAQPDDPNAPFP-----------PTISF  377

Query  1228  DGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCN  1049
             D +RRT  FLKD IP+  A+ GY+ +A ++II +P IF  LKWY+I   Y +AP LAFCN
Sbjct  378   DDKRRTEMFLKDQIPSWFAIAGYVIIAIISIITIPHIFHQLKWYYIICIYIIAPALAFCN  437

Query  1048  AYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKT  869
             AYGCGLTDWSLAS YGK+AI    +W G  NGGVLAGLA+CGVMM+IVST SDLMQDFKT
Sbjct  438   AYGCGLTDWSLASTYGKLAIFAIGAWAGAANGGVLAGLAACGVMMNIVSTASDLMQDFKT  497

Query  868   GYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiAL  692
             GY+TLASP +MF SQV GTAMGC ++P VFW+FY A+  LG   +AYPAPYA V+R IA+
Sbjct  498   GYMTLASPRSMFVSQVIGTAMGCVISPCVFWLFYNAFGTLGQPGTAYPAPYALVFRNIAI  557

Query  691   LGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLG  512
             LGVDGF +LP NCL L I FF  AI IN   +++ K   KY   +FIP PM MAIPFY+G
Sbjct  558   LGVDGFSALPKNCLVLCIVFFFGAIIINFVRDLVGK---KYS--KFIPVPMAMAIPFYIG  612

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
              YFAIDMCVGSLILF+W+  ++ +A   G AVASGLICG+ +W +P++ LALAGV+ PIC
Sbjct  613   SYFAIDMCVGSLILFIWQKVDRAKADALGSAVASGLICGDGIWSLPSSFLALAGVQPPIC  672

Query  331   MKFLSAAANAKLES  290
             MKFLS AANAK+++
Sbjct  673   MKFLSRAANAKVDN  686



>ref|XP_008393519.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Malus 
domestica]
Length=733

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/669 (61%), Positives = 503/669 (75%), Gaps = 11/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE   +PSW+ QLT RA F S VLS +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  68    SVEKLFENQPVPSWREQLTFRAFFISFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFF  127

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +++WT  L + GLL QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  IA Q++ 
Sbjct  128   FVRTWTKFLERCGLLNQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERIAQQSKD  187

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                 ++ K   + W++ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATAYLINSFHT
Sbjct  188   ---RSDTKDPGLLWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHT  244

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P G KLAK+QV  L K FSFSFL+G FQWF+ A D CGF+SFP+ GLKAY  +F+FDFS+
Sbjct  245   PEGVKLAKKQVRELGKFFSFSFLWGFFQWFYTAGDNCGFASFPSLGLKAYQNKFFFDFSA  304

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP  VN+S+L+G I+SWG++WP+I T+ G WY   LS  S+ G+Q YKVF+A
Sbjct  305   TYVGVGMICPYNVNISVLLGGILSWGLMWPLIETRSGDWYDKELSPKSMNGLQXYKVFIA  364

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  ++  T ++   + RS+    + +LPV         +    +D QRR
Sbjct  365   IALILGDGLYNFVKVLSRTLIALQSQLRSKD--ASGILPVKKHQGSPDVSSELSYDDQRR  422

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             T  FLKD IP  +AVGGY+  AA++I  VP IFP LKWY+I V Y  AP LAFCNAYGCG
Sbjct  423   TQLFLKDQIPAWIAVGGYVVFAAISIATVPHIFPQLKWYYILVIYLFAPTLAFCNAYGCG  482

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGYLTL
Sbjct  483   LTDWSLASTYGKVAIFTIGAWAGSAHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYLTL  542

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   SAYP+P+A VYR IA+L V+G
Sbjct  543   ASPRSMFVSQVVGTAMGCVVSPCVFWLFYKAFSDLGIPESAYPSPFAVVYRNIAVLAVEG  602

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
               SLP NCL L   FF AAIAIN+  + L K     +  RF+P PM MAIPFYLG YFAI
Sbjct  603   VKSLPKNCLLLCGIFFGAAIAINVLKDCLGK-----KRGRFVPLPMAMAIPFYLGSYFAI  657

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMC+GSLI+F+W   NK +A  F PAVASGLICG+  W +PA+ILALAGV+ PICMKFLS
Sbjct  658   DMCIGSLIVFLWGRVNKAKADAFVPAVASGLICGDGTWTLPASILALAGVQPPICMKFLS  717

Query  316   AAANAKLES  290
             ++ N ++++
Sbjct  718   SSQNTRVDA  726



>ref|XP_011097988.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=693

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/666 (62%), Positives = 505/666 (76%), Gaps = 15/666 (2%)
 Frame = -2

Query  2281  VFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKS  2102
             +FE  E+P W+ QLT RA   S VL+ +F FIV KLNLTTG+IPSLNV+AGLLGF  +K+
Sbjct  37    IFESREVPPWQKQLTFRAFIVSFVLAVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  96

Query  2101  WTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIP  1922
             WT  L K+GLLKQPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  +A Q+   N  
Sbjct  97    WTKFLEKSGLLKQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSEVVAKQSTEANDA  156

Query  1921  NNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGA  1742
              ++K  S+ WM+ FL+VVSF+GLFS++PLRK+MI+ +KL YPSGTATA+LINSFHTP GA
Sbjct  157   LDIKNPSLAWMIGFLFVVSFLGLFSVLPLRKIMIIDFKLIYPSGTATAHLINSFHTPQGA  216

Query  1741  KLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVG  1562
             KLAK+QV AL K FSFSFL+G FQWFF A D CGF +FPTFGLKAY  +FYFDFS+TYVG
Sbjct  217   KLAKKQVRALGKFFSFSFLWGFFQWFFTAGDDCGFVNFPTFGLKAYENKFYFDFSATYVG  276

Query  1561  VGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMM  1382
             VGM+CP ++N+SLL+GAI+SWGI+WP+I  ++G WY     SSSL G+QGYKVF+AIAM+
Sbjct  277   VGMICPYIINISLLVGAILSWGIMWPLIEQRKGDWYSAEYPSSSLHGLQGYKVFIAIAMI  336

Query  1381  LGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNF  1202
             LGDG++NFF ++  T      + R+      ++LPV  + +    A    +D QRRT  F
Sbjct  337   LGDGIYNFFKVLGRTLFGMYHQLRNR-----NVLPVGSQSSPSPPAL--SYDDQRRTQLF  389

Query  1201  LKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDW  1022
             LKD IP  +A+ GY+ +A V+   +P IF PLKWY+I + Y  AP LAFCNAYGCGLTDW
Sbjct  390   LKDRIPMWLAIVGYVTIAIVSAATLPHIFAPLKWYYIVIIYIFAPTLAFCNAYGCGLTDW  449

Query  1021  SLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPL  842
             SLAS YGK+AI +  +W G  +GGVLAGLA+CGVMM+IVST SDL QDFKTGY+TLASP 
Sbjct  450   SLASTYGKLAIFVIGAWAGAGHGGVLAGLAACGVMMNIVSTASDLTQDFKTGYMTLASPR  509

Query  841   AMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGSL  665
             +MF SQV GTAMGC ++P VFW+FYKA+  LG   S Y APYA VYR +A+LGV+GF +L
Sbjct  510   SMFVSQVIGTAMGCVISPCVFWLFYKAFSDLGVPGSQYSAPYALVYRNMAILGVEGFSAL  569

Query  664   PTNCLNLAIGFFVAAIAIN-IFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             P +CL L   FFVAA  IN I   V  K+       +FIP PM MAIPFYLGGYF IDMC
Sbjct  570   PKHCLTLCYIFFVAAAVINGIRDAVGPKWA------KFIPLPMAMAIPFYLGGYFTIDMC  623

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             VGSLILF+W   +K +A  FGPAVASGLICG+ +W +P+++LALAGVK PICMKFLS  A
Sbjct  624   VGSLILFIWEKIDKVKADAFGPAVASGLICGDGIWTLPSSVLALAGVKPPICMKFLSRKA  683

Query  307   NAKLES  290
             NA++++
Sbjct  684   NARVDT  689



>emb|CAJ86097.1| H0103C06.1 [Oryza sativa Indica Group]
 emb|CAH68189.1| H0403D02.17 [Oryza sativa Indica Group]
Length=700

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/689 (57%), Positives = 504/689 (73%), Gaps = 19/689 (3%)
 Frame = -2

Query  2299  VESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLG  2120
             V S ERVFE   +P WK Q+T+RA+  S +L A+F+ IV KLNLTTG+IPSLNV+AGLLG
Sbjct  18    VVSVERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLG  77

Query  2119  FAVIKSWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSS---------GTASYML  1970
             F ++ SWT  L K G+   +PFTRQENTV+QTCVVA SGIAFS          G  SY+ 
Sbjct  78    FFLLTSWTKFLDKVGVASVRPFTRQENTVVQTCVVACSGIAFSDADLCTGGTGGFGSYIF  137

Query  1969  GMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSG  1790
              MS  I+ Q+      +N+K  S+GWM+ FL++VSF+GLFS+VPLRK+MI+ YKL YPSG
Sbjct  138   AMSDRISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSG  197

Query  1789  TATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLK  1610
             TATA+LINSFHTP GAKLAK QV  L K F  SF +G FQWF+   DGCGF SFPT GL+
Sbjct  198   TATAHLINSFHTPQGAKLAKMQVKMLGKFFVMSFSWGFFQWFYTGGDGCGFMSFPTLGLE  257

Query  1609  AYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSS  1430
             AY  +F+FDFS+TYVGVGM+CP +VN+S+L+G ++SWGI+WP+I  K+G WYP +L  SS
Sbjct  258   AYRNKFFFDFSATYVGVGMICPYLVNISVLLGGVMSWGIMWPLIEHKKGDWYPADLKPSS  317

Query  1429  LKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGK  1250
             L+GI GY+VF++I+++LGDGL+NF  +M  T  + + + R+  + P   LPV      G 
Sbjct  318   LRGIVGYRVFISISLILGDGLYNFLKVMTRTTTALVMQVRAMMSEPT--LPVSGGGGGGG  375

Query  1249  GAQLED-FDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAM  1073
             G   E+ FD +RRT  FLKD IPN +A+  Y+ +A V+I  VP IF  L+WYH+AV+Y +
Sbjct  376   GQTPEETFDDKRRTELFLKDQIPNWLALSAYVVIAVVSIATVPRIFHQLRWYHVAVSYVV  435

Query  1072  APILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTS  893
             AP+LAFCNAYGCGLTDWSLA+ YGK+AI    +W    +GG++AGLA+CGVM+ IVST S
Sbjct  436   APVLAFCNAYGCGLTDWSLATTYGKLAIFTVGAWADASDGGIIAGLAACGVMIGIVSTAS  495

Query  892   DLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapya  716
             DL QDFKTGY+TLASP +MF SQV GTAMGC + P VFW+FYKA+  +G   S YP+P A
Sbjct  496   DLTQDFKTGYMTLASPRSMFVSQVIGTAMGCVIAPSVFWLFYKAFHDIGMPGSEYPSPNA  555

Query  715   avyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMC  536
              VYR +A+LGV G GSLP +CL+L IGFFVAAIA+N+  ++        +V RF+P PM 
Sbjct  556   LVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDLAAP-----KVARFLPLPMA  610

Query  535   MAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILAL  356
             MAIPFYLG YF IDMC+GSLI FVW   +  +AK F P VASGLICG+ +W +P ++LAL
Sbjct  611   MAIPFYLGPYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQSVLAL  670

Query  355   AGVKAPICMKFLSAAANAKLESS*PKISS  269
             AGVK PICMKFLS   N K+++   K+ S
Sbjct  671   AGVKPPICMKFLSRTTNIKVDAFIAKLPS  699



>ref|XP_003581442.1| PREDICTED: probable metal-nicotianamine transporter YSL13 [Brachypodium 
distachyon]
Length=724

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/669 (59%), Positives = 499/669 (75%), Gaps = 10/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ F    +P+W+ QLT+RA   S  L+ +F+ IV KLNLT GVIPSLNV+AGLL F 
Sbjct  59    SVEQAFADQRVPTWREQLTVRAFVVSFFLAVMFSVIVMKLNLTIGVIPSLNVSAGLLSFF  118

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + K GLL+QPFTRQENTVIQTCVVA+  IAFS G  +Y+L MS  IA+Q+  
Sbjct  119   FVRLWTAAIQKVGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGNYLLAMSDRIASQSTE  178

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              + P N+K   +GW++ FL +VSF+GLF +VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  179   ADNPQNIKNPHLGWIIGFLLLVSFIGLFGLVPLRKIMIIDYKLTYPSGTATAYLINGFHT  238

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P+GAK+A +QV  L   F  SFL+G FQWF+ A + CGF+ FP+ G++A+  RFYFDFS 
Sbjct  239   PHGAKIAGKQVKKLGTFFVLSFLWGFFQWFYTATEFCGFNQFPSLGMQAFNNRFYFDFSP  298

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K GIW+  +L+ S+L G+QGY+VF+A
Sbjct  299   TYVGVGMICPHIVNVSVLLGGILSWGIMWPLIAKKRGIWFSADLADSNLHGMQGYRVFIA  358

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  M+ +T  S    R   K   AS LPV D+        +  +D +RR
Sbjct  359   IALILGDGLYNFLKMLFLTVRSL---RSQLKKSNASTLPVSDDETSNSNEAIS-YDEERR  414

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                FLKD IP  +A GGY  +AA++I  VP IFP LKWY I VAY +APILAFCNAYG G
Sbjct  415   NELFLKDQIPWYIAYGGYAVVAAISIGTVPQIFPQLKWYQILVAYIVAPILAFCNAYGAG  474

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSL + YGK+AI  F +W G  +GGVLAGLA+CGVMMSIVST +DLMQDFKTGYLTL
Sbjct  475   LTDWSLVTTYGKLAIFAFGAWTGASHGGVLAGLAACGVMMSIVSTAADLMQDFKTGYLTL  534

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAP AA++R++A+LGVDG
Sbjct  535   ASPRSMFISQVIGTAMGCVIAPCVFWLFYKAFDNIGISGSEYPAPNAAIFRSMAILGVDG  594

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCL L   FF AA+AIN+  +++ K     +V RFIP PM MAIPFYLG YFAI
Sbjct  595   FSSLPKNCLTLCYIFFAAAVAINLIRDLVPK-----KVSRFIPIPMAMAIPFYLGSYFAI  649

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G++ILFVW+  ++ +++ F PAVASGLICG+ LW +P ++LALA VK PICMKFL+
Sbjct  650   DMFLGTVILFVWQRLDRAKSETFAPAVASGLICGDGLWVLPQSVLALAKVKPPICMKFLA  709

Query  316   AAANAKLES  290
                N K+++
Sbjct  710   RGMNEKVDA  718



>ref|XP_010549024.1| PREDICTED: probable metal-nicotianamine transporter YSL8 isoform 
X1 [Tarenaya hassleriana]
Length=703

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/671 (61%), Positives = 513/671 (76%), Gaps = 16/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE  E+PSWK QLT+RA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  40    SVERIFESREVPSWKKQLTVRAFVVSFGLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  99

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  +A  A  
Sbjct  100   FLKTWTKVLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSQRVAKHA--  157

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+     K  S+GW++ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFHT
Sbjct  158   GDSYLGFKDPSLGWIMGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHT  217

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FSFSFL+G FQWFF A + CGFSSFPTFGL+AY  +FYFDFS+
Sbjct  218   PQGAKLAKKQVRVLGKFFSFSFLWGFFQWFFTAGENCGFSSFPTFGLRAYQYKFYFDFSA  277

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVS+L+G I+SWG++WP+I T++G WYP ++  SS+ G+Q YKVF+A
Sbjct  278   TYVGVGMICPYIINVSVLLGGILSWGLMWPLIETRKGHWYPADVDPSSMSGLQAYKVFIA  337

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AM+LGDGL+NF  ++   ++GL    R  +++ G    LP++D       +    +D Q
Sbjct  338   VAMILGDGLYNFCKVLSRTLSGLFVQLRGSNQRTG----LPLEDP--PSPFSPKLSYDDQ  391

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP+  AVGGY+ +A V+   +P +FP L+WY+I V Y  APILAFCNAYG
Sbjct  392   RRTRYFLKDQIPSWFAVGGYVTIAVVSTATLPHMFPQLRWYYILVIYIFAPILAFCNAYG  451

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  452   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGILAGLAACGVMMNIVSTASDLTQDFKTGYL  511

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  LG  +S YPAP+A VYR++A LGV
Sbjct  512   TLSSPRSMFVSQVIGTAMGCVVSPCVFWLFYKAFDDLGLPDSEYPAPFATVYRSMAKLGV  571

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +G  SLP  CL L   FF AAI IN+  + L       R  RF+P PM MAIPF+LG YF
Sbjct  572   EGVSSLPRECLVLCYAFFGAAILINMMKDGLGN-----RWGRFVPLPMAMAIPFFLGPYF  626

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILFVW   +  +A+ F PAVASGLICG+ +W +P+++LA+AGVK PICMKF
Sbjct  627   AIDMCVGSLILFVWERVDAAKAEAFAPAVASGLICGDGIWTLPSSVLAIAGVKPPICMKF  686

Query  322   LSAAANAKLES  290
             LS A NA+++ 
Sbjct  687   LSGATNARVDQ  697



>ref|XP_008779403.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Phoenix 
dactylifera]
Length=680

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/667 (61%), Positives = 502/667 (75%), Gaps = 8/667 (1%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E+VFE  E+P W+ QLT RA+  +  L+ +F+FIV KL LTTG++PSLN+AAGLLGF  +
Sbjct  14    EKVFEGKEVPPWREQLTFRALAVAAFLAIMFSFIVMKLGLTTGIVPSLNIAAGLLGFFFV  73

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             + WT  L   G L++PFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  IA QA   N
Sbjct  74    RLWTKALQMTGCLQKPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSGRIAGQATEDN  133

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
                N+K   +GW++ FL+VVSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LIN FHTP 
Sbjct  134   DAQNIKDPRLGWIIGFLFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAFLINGFHTPQ  193

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+QV  L K F+FSFL+G FQWF++++D CGF  FP+ GL+AY   FYF+FS+ Y
Sbjct  194   GAKLAKKQVRTLGKFFTFSFLWGFFQWFYSSNDQCGFQVFPSLGLQAYKNTFYFNFSAAY  253

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP +VN+S+L+GAI+SWGI+WP+I  KEG WYPP L    L G+QGY+VF+AIA
Sbjct  254   VGVGMICPYIVNISVLLGAILSWGIMWPLIGKKEGSWYPPGLGLGDLHGLQGYRVFIAIA  313

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             ++LGDGL+NF  ++     SF+   RS+  G  S LP+ D+           F+ +RRT 
Sbjct  314   LILGDGLYNFIKVLSRVIFSFISVARSK--GSRSTLPISDDDRPTATTTPISFNDRRRTE  371

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              F+KD IP  +A GGY+A+AA++I  +P IFP LKWY + +AY  AP+LAFCNAYGCGLT
Sbjct  372   FFIKDQIPKRIAFGGYVAIAAISIATLPHIFPQLKWYFVLLAYIFAPVLAFCNAYGCGLT  431

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLAS YGK+AI +F +W G  NGGV+AGLA+CGVMMSIVST SDLMQDFKTGYLTLAS
Sbjct  432   DWSLASAYGKLAIFLFGAWAGASNGGVIAGLAACGVMMSIVSTASDLMQDFKTGYLTLAS  491

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFG  671
             P +MF SQ+ GTAMGC + P VFW+FYKA+  LG S S YPAPYA++YR IA+LGVDGF 
Sbjct  492   PRSMFVSQIIGTAMGCVIAPCVFWLFYKAFDDLGLSGSEYPAPYASIYRGIAILGVDGFS  551

Query  670   SLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDM  491
             SLP +CL     FF AAI IN+     R +  K +V RFIP PM MAIPFY+G YF IDM
Sbjct  552   SLPKHCLTFCYVFFAAAILINL----GRDFSGK-KVARFIPLPMAMAIPFYIGAYFCIDM  606

Query  490   CVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAA  311
             CVGSLILFVW   NK QA  F PAVASGLICG+ +W +P ++LA+A VK PICMKFLS  
Sbjct  607   CVGSLILFVWETVNKAQADAFAPAVASGLICGDGIWTLPQSVLAIAKVKPPICMKFLSRQ  666

Query  310   ANAKLES  290
              N K+++
Sbjct  667   VNDKVDA  673



>gb|EEE57430.1| hypothetical protein OsJ_07631 [Oryza sativa Japonica Group]
Length=697

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/634 (62%), Positives = 487/634 (77%), Gaps = 9/634 (1%)
 Frame = -2

Query  2188  IVCKLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASS  2009
             IV KLNLTTG+IPSLNV+AGLLGF  ++ WT+ + + GLLKQPFTRQENTVIQTCVV++ 
Sbjct  68    IVMKLNLTTGIIPSLNVSAGLLGFFFVRLWTSAVERIGLLKQPFTRQENTVIQTCVVSAY  127

Query  2008  GIAFSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRK  1829
             GIAFS G  SY+ GMS TIA QA       N+K   +GWM+ FL++VSF+GLF++VPLRK
Sbjct  128   GIAFSGGFGSYLFGMSETIAKQATEAKDAQNIKDPHLGWMIGFLFLVSFIGLFALVPLRK  187

Query  1828  MMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADD  1649
             +MI+ YKLTYPSGTATAYLIN FHTP GAKLAK+QV  L K F FSF +G FQWF+ A D
Sbjct  188   IMIVDYKLTYPSGTATAYLINGFHTPEGAKLAKKQVKTLGKYFLFSFFWGFFQWFYTAGD  247

Query  1648  GCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTK  1469
              CGF +FPT GL+AY  RF+FDFS TYVGVGM+CP +VNVS+L+G I+SWG++WP+I  K
Sbjct  248   DCGFKNFPTLGLEAYNNRFFFDFSPTYVGVGMICPYIVNVSVLLGGILSWGVMWPLIAKK  307

Query  1468  EGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPA  1289
             +G WYP ++S +SL G+Q Y+VF++IA++LGDGL+NF  +++ T   F+   ++   G  
Sbjct  308   KGSWYPADISDNSLHGLQAYRVFISIALILGDGLYNFLKVLIRTIAGFISMVQNNSKG--  365

Query  1288  SLLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifpp  1109
              +LPV D       A+   FD +RRT  FLKD IP +VA GGY+ +AA++I  +P IFP 
Sbjct  366   -MLPVSDNGMSMSTAEEVSFDDERRTEIFLKDQIPKSVAYGGYVVVAALSIGTLPEIFPQ  424

Query  1108  LKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLAS  929
             LKWY+I VAY +AP+LAFCNAYG GLTDWSLAS YGK+AI +F +W G  +GGVL GLA+
Sbjct  425   LKWYYILVAYIVAPVLAFCNAYGSGLTDWSLASTYGKLAIFVFGAWAGLSHGGVLVGLAA  484

Query  928   CGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-L  752
             CGVMMSIVST SDLMQDFKTGYLTLASP +MF SQV GT MGC + P VFW+FYKA+  +
Sbjct  485   CGVMMSIVSTASDLMQDFKTGYLTLASPRSMFISQVIGTGMGCVIAPCVFWLFYKAFSNI  544

Query  751   GDSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETK  572
             G S + YPAPYA VYR +A+LGVDGF SLP NCL L   FF AAIAIN+  ++       
Sbjct  545   GTSGTEYPAPYAIVYRNMAILGVDGFNSLPENCLTLCYIFFAAAIAINLIRDL-----AP  599

Query  571   YRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGE  392
             ++V RFIP PM MAIPFY+G YFAIDM +GS+ILFVW   NK +A  FGPAVASGLICG+
Sbjct  600   HKVSRFIPLPMAMAIPFYIGSYFAIDMFLGSVILFVWEKLNKAKADAFGPAVASGLICGD  659

Query  391   SLWGIPAAILALAGVKAPICMKFLSAAANAKLES  290
              +W +P +ILALA VK PICMKFLS AANAK++S
Sbjct  660   GIWTLPQSILALAKVKPPICMKFLSRAANAKVDS  693



>ref|XP_009135543.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Brassica rapa]
Length=713

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/672 (59%), Positives = 503/672 (75%), Gaps = 16/672 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FE  E+PSWK QLT+RA   S +LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  47    SVEKIFESREVPSWKKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  106

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+G LKQPFTRQENTVIQTCVVASSGIAFS G  +Y+ GMS  IA Q  S
Sbjct  107   FVKTWTKVLYKSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQ--S  164

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G+     K  S+GW++ FL+VVSF+GLFS+VPLRK+M++ +KLTYPSGTATA+LINSFHT
Sbjct  165   GDASRGFKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHT  224

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV  L K FS SFL+  FQWFF   D CGFS+FPTFGLKAY  +FYFDFS+
Sbjct  225   PQGAKLAKKQVRMLGKFFSLSFLWSFFQWFFTGGDNCGFSNFPTFGLKAYQYKFYFDFSA  284

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G W+P ++ SSS+ G+Q YKVF+A
Sbjct  285   TYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGDWFPADVESSSMHGLQAYKVFIA  344

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +A++LGDGL+NF  ++   ++GL    R  S +        V+++      +  + +D Q
Sbjct  345   VAIILGDGLYNFCKVLSRTLSGLFVQLRGTSSRAS----FTVEEDPTASPYSPKQSYDDQ  400

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   A+GGYI +AA +   +P +F  L+WY+I V Y  AP+LAFCNAYG
Sbjct  401   RRTRFFLKDQIPTWFAMGGYIIIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYG  460

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQ--DFKTG  866
              GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+CGVMM+IVST S L Q  DFKTG
Sbjct  461   AGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASGLTQDLDFKTG  520

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALL  689
             YLTL+SP +MF SQV GTAMGC ++P VFW+FY A+  LG  NS YPAP+A VYR++A L
Sbjct  521   YLTLSSPRSMFISQVIGTAMGCVVSPCVFWLFYNAFDDLGLPNSEYPAPFATVYRSMAKL  580

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GV+G  SLP  CL L   FF  AI +NI  + L       R  RF+P PM MAIPF+LG 
Sbjct  581   GVEGVASLPRECLVLCYAFFGVAILVNIVKDSLPS-----RWGRFVPLPMAMAIPFFLGP  635

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDMCVGSL+LFVW   +  +A  FG AVASGLICG+ +W +P+++LA+AGV  P+CM
Sbjct  636   YFAIDMCVGSLVLFVWERVDAAKAGAFGTAVASGLICGDGIWSLPSSVLAIAGVSPPVCM  695

Query  328   KFLSAAANAKLE  293
             KFL AA N+K++
Sbjct  696   KFLDAATNSKVD  707



>ref|XP_010461657.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=721

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/664 (60%), Positives = 503/664 (76%), Gaps = 8/664 (1%)
 Frame = -2

Query  2281  VFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKS  2102
             +FE  E+PSWK QLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF  +K+
Sbjct  58    IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  117

Query  2101  WTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIP  1922
             WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA Q  SG+  
Sbjct  118   WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQ--SGDAF  175

Query  1921  NNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGA  1742
               VK  S+GW++AFL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHTP GA
Sbjct  176   RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  235

Query  1741  KLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVG  1562
             KLAK+QV  L K FSFSF +G FQWFF A + CGF+SFPTFGL+AY  +FYFDFS+TYVG
Sbjct  236   KLAKKQVRVLGKFFSFSFFWGFFQWFFTAGENCGFNSFPTFGLRAYQYKFYFDFSATYVG  295

Query  1561  VGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMM  1382
             VGM+CP ++N+SLL+G I+SWG++WP+I T++G W+P +  SSS+ G+Q YKVF+A+AM+
Sbjct  296   VGMICPYIINISLLLGGILSWGLMWPLIETRKGDWFPSSADSSSMSGLQAYKVFIAVAMI  355

Query  1381  LGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNF  1202
             LGDGL+NF  ++  T    + + R +     SL   +++           +D QRRT  F
Sbjct  356   LGDGLYNFCKVLTRTLSGLVSQIRGKAGSRTSLEREEEDPPASPLTPKISYDDQRRTRFF  415

Query  1201  LKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDW  1022
             LKD IP+  AVGGY+ ++AV+   +P +F  L+WY+I V Y  APILAFCNAYG GLTDW
Sbjct  416   LKDQIPSWFAVGGYVVISAVSTAILPHMFSQLRWYYILVIYVFAPILAFCNAYGAGLTDW  475

Query  1021  SLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPL  842
             SLAS YGK+AI    +W G D+GG+LAGLA+CGVMM+IVST SDL QDFKTGYLTL+SP 
Sbjct  476   SLASTYGKLAIFTIGAWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGYLTLSSPR  535

Query  841   AMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGSL  665
             AMF SQV GTA+GC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LGV+G  SL
Sbjct  536   AMFVSQVIGTAIGCVVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGVEGVSSL  595

Query  664   PTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCV  485
             P +CL L   FF  AI IN+  + +       R  RF+P PM MAIPF+LG YFAIDMCV
Sbjct  596   PRDCLVLCYAFFGVAIIINVVKDGIGN-----RWGRFVPLPMAMAIPFFLGPYFAIDMCV  650

Query  484   GSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAAN  305
             GS ILFVW   +  +A+ F  AVASGLICG+ +W +P+++LA+AGVK PICMKFLSA+ N
Sbjct  651   GSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPICMKFLSASTN  710

Query  304   AKLE  293
              +++
Sbjct  711   HRVD  714



>ref|XP_010479258.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=722

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/665 (60%), Positives = 504/665 (76%), Gaps = 9/665 (1%)
 Frame = -2

Query  2281  VFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKS  2102
             +FE  E+PSWK QLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF  +K+
Sbjct  58    IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  117

Query  2101  WTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIP  1922
             WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA Q  SG+  
Sbjct  118   WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQ--SGDAF  175

Query  1921  NNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGA  1742
               VK  S+GW++AFL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHTP GA
Sbjct  176   RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  235

Query  1741  KLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVG  1562
             KLAK+QV  L K FSFSF +G FQWFF A + CGF+SFPTFGL+AY  +FYFDFS+TYVG
Sbjct  236   KLAKKQVRVLGKFFSFSFFWGFFQWFFTAGENCGFNSFPTFGLRAYQYKFYFDFSATYVG  295

Query  1561  VGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMM  1382
             VGM+CP ++N+SLL+G I+SWG++WP+I T++G W+P +  SSS+ G+Q YKVF+A+AM+
Sbjct  296   VGMICPYIINISLLLGGILSWGLMWPLIETRKGDWFPSSADSSSMSGLQAYKVFIAVAMI  355

Query  1381  LGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE-DFDGQRRTHN  1205
             LGDGL+NF  ++  T    + + R +     SL   ++E         +  +D QRRT  
Sbjct  356   LGDGLYNFCKVLTRTLSGLVSQIRGKAGSRTSLEREEEEDPPASPLTPKISYDDQRRTRF  415

Query  1204  FLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTD  1025
             FLKD IP+  AVGGY+ ++AV+   +P +F  L+WY+I V Y  APILAFCNAYG GLTD
Sbjct  416   FLKDQIPSWFAVGGYVVISAVSTAILPHMFSQLRWYYILVIYVFAPILAFCNAYGAGLTD  475

Query  1024  WSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASP  845
             WSLAS YGK+AI    +W G D+GG+LAGLA+CGVMM+IVST SDL QDFKTGYLTL+SP
Sbjct  476   WSLASTYGKLAIFTIGAWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGYLTLSSP  535

Query  844   LAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGS  668
              AMF SQV GTA+GC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LGV+G  S
Sbjct  536   RAMFVSQVIGTAIGCVVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGVEGVSS  595

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP +CL L   FF  AI IN+  + L       R  RF+P PM MAIPF+LG YFAIDMC
Sbjct  596   LPRDCLVLCYAFFGVAIIINVVKDGLGN-----RWGRFVPLPMAMAIPFFLGPYFAIDMC  650

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             VGS ILFVW   +  +A+ F  AVASGLICG+ +W +P+++LA+AGVK PICMKFLS+A 
Sbjct  651   VGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPICMKFLSSAT  710

Query  307   NAKLE  293
             N +++
Sbjct  711   NHRVD  715



>sp|Q7XKF4.2|YSL13_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL13; 
AltName: Full=Protein YELLOW STRIPE LIKE 13; Short=OsYSL13 
[Oryza sativa Japonica Group]
 emb|CAE05719.2| OSJNBb0065J09.15 [Oryza sativa Japonica Group]
 dbj|BAE44204.1| hypothetical protein [Oryza sativa Japonica Group]
Length=724

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/669 (59%), Positives = 496/669 (74%), Gaps = 11/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S  L  +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  59    SVERVFADRPVPSWREQLTVRAFVVSFFLVIMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  118

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + + GLL+QPFTRQENTVIQTCVVA   IAFS G  +Y+L MS  IA     
Sbjct  119   FVRLWTAAIERVGLLRQPFTRQENTVIQTCVVAGYDIAFSGGFGNYILSMSERIAGLGTE  178

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GW++ FL++VSF+GLF +VPLRK+MI+ YKLTYPSGTATA+LIN FHT
Sbjct  179   ANNAQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKVMIIDYKLTYPSGTATAFLINGFHT  238

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P+GAK+A +QV  L   F  SF +G FQWF+ A D CGF  FP+ GL+A+  +F+FDFS 
Sbjct  239   PHGAKIAAKQVKKLGIFFILSFFWGFFQWFYTATDDCGFHKFPSLGLQAFQHKFFFDFSP  298

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K G W+  +L   SL G+QGY+VF+A
Sbjct  299   TYVGVGMICPHIVNVSVLLGGILSWGIMWPLIAKKRGDWFSADLPDGSLHGMQGYRVFIA  358

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  M+++T  S ++ +  +KN  AS LPV D+      A +  +D +RR
Sbjct  359   IALILGDGLYNFLKMIILTAFS-LRSQIKKKN--ASTLPVSDDGMVTTTAAVS-YDEERR  414

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                F+KD IP  VA GGY  +AA++I  VP I P LKWY I VAY +APILAFCNAYG G
Sbjct  415   NELFVKDQIPWYVAYGGYAVVAAISIGTVPQIIPQLKWYQILVAYIVAPILAFCNAYGTG  474

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSL + YGK+AI  F +W G  +GGVLAGLA+CGVMM+IVST +DLMQDFKTGYLTL
Sbjct  475   LTDWSLVTTYGKLAIFAFGAWTGASHGGVLAGLAACGVMMNIVSTAADLMQDFKTGYLTL  534

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAP AAV+R+IA+LGVDG
Sbjct  535   ASPRSMFVSQVIGTAMGCVIAPCVFWLFYKAFDNIGISGSDYPAPNAAVFRSIAILGVDG  594

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCLNL   FF AAI +N+  +++ K      V RFIP PM MAIPFY+G YFAI
Sbjct  595   FSSLPKNCLNLCYAFFAAAIVVNLIRDLVPK------VSRFIPIPMAMAIPFYIGSYFAI  648

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G++ILFVW+  ++ +A  +GPAVASG+ICG+ +W +P ++LALA VK PICMKFLS
Sbjct  649   DMFIGTVILFVWQRVDRAKADTYGPAVASGMICGDGIWVLPQSVLALAKVKPPICMKFLS  708

Query  316   AAANAKLES  290
                N K+++
Sbjct  709   RRTNDKVDA  717



>gb|EMT24509.1| Putative metal-nicotianamine transporter YSL12 [Aegilops tauschii]
Length=723

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/666 (60%), Positives = 495/666 (74%), Gaps = 18/666 (3%)
 Frame = -2

Query  2263  IPSWKNQ-------LTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIK  2105
             +P+W+         LT+RA   S  L+ +F+ IV KLNLTTG+IPSLNV+AGLLGF  ++
Sbjct  64    VPTWREAADAPRLVLTLRAFVVSFFLAIMFSVIVMKLNLTTGIIPSLNVSAGLLGFFFVR  123

Query  2104  SWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNI  1925
              WT+ + + G L+QPFTRQENTVIQTCVVA+  IAFS G  +Y+  MS T+A+QA   N 
Sbjct  124   LWTSAIERMGFLRQPFTRQENTVIQTCVVAAYDIAFSGGFGNYLFAMSGTVASQATEAND  183

Query  1924  PNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNG  1745
               NVK   IGWM+ FL++VSFVGLF++VPLRK+MI+ YKLTYPSGTATAYLIN FHTP G
Sbjct  184   AQNVKDPHIGWMIGFLFLVSFVGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTPEG  243

Query  1744  AKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYV  1565
             AKLAK+QV  L K FSFSFL+G FQWF+ A DGCGF +FPT GL+AY  RFYFDFS TYV
Sbjct  244   AKLAKKQVRTLGKFFSFSFLWGFFQWFYTAGDGCGFQNFPTLGLQAYKSRFYFDFSPTYV  303

Query  1564  GVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAM  1385
             GVGM+CP +VNVS+L+G I+SWG++WP+IH   G WY  +L  SSL G+QGY+VF++IAM
Sbjct  304   GVGMICPHIVNVSVLLGGILSWGVMWPLIHNNRGSWYSADLKDSSLHGLQGYRVFISIAM  363

Query  1384  MLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHN  1205
             +LGDGL+NF  +++ T ++F     ++KN   S +PV D        +   FD QRRT  
Sbjct  364   ILGDGLYNFVKVLIRTSVAFAA--MAKKN---STIPVSDVGGAKATGEPVSFDEQRRTEQ  418

Query  1204  FLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTD  1025
             F+KD IP +VA  GY A+AAV+I  +P IFP LKWY+I VAY  AP+LAFCNAYG GLTD
Sbjct  419   FMKDQIPKSVAYAGYAAVAAVSIATLPQIFPDLKWYYILVAYVFAPVLAFCNAYGTGLTD  478

Query  1024  WSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASP  845
             WSLAS YGK+AI IF +W G  +GGVL GLA+CGVMMSIVST +DLMQDFKTGYLTLASP
Sbjct  479   WSLASTYGKLAIFIFGAWAGAPHGGVLVGLAACGVMMSIVSTAADLMQDFKTGYLTLASP  538

Query  844   LAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDGFGS  668
              +MF SQ+ GT MGC + P VFW+FYKA+  +G S S YPAPYA VYR +A+LGVDGF S
Sbjct  539   RSMFISQIIGTGMGCVIAPCVFWLFYKAFEDIGISGSEYPAPYAIVYRNMAILGVDGFSS  598

Query  667   LPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMC  488
             LP +CL L   FF  AI IN+  +++       +V +FIP PM MAIPFY+G YFAIDM 
Sbjct  599   LPKHCLTLCYVFFAGAILINLVRDLVPA-----KVAKFIPLPMAMAIPFYIGSYFAIDMF  653

Query  487   VGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAA  308
             VG++I+FVW   NK +A  F P VASGLICG+ +W +P +ILALA VK PICMKFLS   
Sbjct  654   VGTVIVFVWGIMNKAKADAFAPGVASGLICGDGIWTLPQSILALAKVKPPICMKFLSRPV  713

Query  307   NAKLES  290
             NA +++
Sbjct  714   NANVDA  719



>emb|CAH67885.1| OSIGBa0153E02-OSIGBa0093I20.14 [Oryza sativa Indica Group]
 gb|EAY94898.1| hypothetical protein OsI_16698 [Oryza sativa Indica Group]
Length=724

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/669 (59%), Positives = 496/669 (74%), Gaps = 11/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+ QLT+RA   S  L  +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  59    SVERVFADRPVPSWREQLTVRAFVVSFFLVIMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  118

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + + GLL+QPFTRQENTVIQTCVVA   IAFS G  +Y+L MS  IA     
Sbjct  119   FVRLWTAAIERVGLLRQPFTRQENTVIQTCVVAGYDIAFSGGFGNYILSMSERIAGLGTE  178

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GW++ FL++VSF+GLF +VPLRK+MI+ YKLTYPSGTATA+LIN FHT
Sbjct  179   ANNAQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKVMIIDYKLTYPSGTATAFLINGFHT  238

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P+GAK+A +QV  L   F  SF +G FQWF+ A D CGF  FP+ GL+A+  +F+FDFS 
Sbjct  239   PHGAKIAAKQVKKLGIFFILSFFWGFFQWFYTATDDCGFHKFPSLGLQAFQHKFFFDFSP  298

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K G W+  +L   SL G+QGY+VF+A
Sbjct  299   TYVGVGMICPHIVNVSVLLGGILSWGIMWPLIAKKRGDWFSADLPDGSLHGMQGYRVFIA  358

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  M+++T  S ++ +  +KN  AS LPV D+      A +  +D +RR
Sbjct  359   IALILGDGLYNFLKMIILTAFS-LRYQIKKKN--ASTLPVSDDGMVTTTAAVS-YDEERR  414

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                F+KD IP  VA GGY  +AA++I  VP I P LKWY I VAY +APILAFCNAYG G
Sbjct  415   NELFVKDQIPWYVAYGGYAVVAAISIGTVPQIIPQLKWYQILVAYIVAPILAFCNAYGTG  474

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSL + YGK+AI  F +W G  +GGVLAGLA+CGVMM+IVST +DLMQDFKTGYLTL
Sbjct  475   LTDWSLVTTYGKLAIFAFGAWTGASHGGVLAGLAACGVMMNIVSTAADLMQDFKTGYLTL  534

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAP AAV+R+IA+LGVDG
Sbjct  535   ASPRSMFVSQVIGTAMGCVIAPCVFWLFYKAFDNIGISGSDYPAPNAAVFRSIAILGVDG  594

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCLNL   FF AAI +N+  +++ K      V RFIP PM MAIPFY+G YFAI
Sbjct  595   FSSLPKNCLNLCYAFFAAAIVVNLIRDLVPK------VSRFIPIPMAMAIPFYIGSYFAI  648

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G++ILFVW+  ++ +A  +GPAVASG+ICG+ +W +P ++LALA VK PICMKFLS
Sbjct  649   DMFIGTVILFVWQRVDRAKADTYGPAVASGMICGDGIWVLPQSVLALAKVKPPICMKFLS  708

Query  316   AAANAKLES  290
                N K+++
Sbjct  709   RRTNDKVDA  717



>emb|CDO98563.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/630 (62%), Positives = 482/630 (77%), Gaps = 10/630 (2%)
 Frame = -2

Query  2179  KLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIA  2000
             KLNLTTG+IPSLNV+AGLLGF  IK+WT LL K+GLLKQPFTRQENTVIQTCVVA+SGIA
Sbjct  2     KLNLTTGIIPSLNVSAGLLGFFFIKTWTTLLEKSGLLKQPFTRQENTVIQTCVVAASGIA  61

Query  1999  FSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMI  1820
             FS G  SY+  MS  +  Q+E G      K  ++GWM+ FL+VVSF+GLFS+VPLRK+MI
Sbjct  62    FSGGFGSYLFAMSERVIKQSEEGKAGFQYKNPTLGWMIGFLFVVSFLGLFSVVPLRKIMI  121

Query  1819  LKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCG  1640
             + +KLTYPSGTATA+LINSFHTP GAKLAK+QV  L K FSFSFL+G FQWFF A D CG
Sbjct  122   IDFKLTYPSGTATAHLINSFHTPEGAKLAKKQVRELGKFFSFSFLWGFFQWFFTAGDDCG  181

Query  1639  FSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGI  1460
             F+SFPTFGLKAY  +FYFDFS+TYVGVGM+CP ++NVS+L+G I+SWG++WP+I T+EG 
Sbjct  182   FASFPTFGLKAYNYKFYFDFSATYVGVGMICPHIINVSVLVGGILSWGLMWPLIETREGD  241

Query  1459  WYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLL  1280
             WYP  LS ++L+G+QGYKVF+ IAM+LGDGL+NFF ++  T ++ +  +  +++    + 
Sbjct  242   WYPAGLSHNNLQGLQGYKVFIGIAMILGDGLYNFFKVLSRT-VAGLVTKIHDRSASMHIP  300

Query  1279  PVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKW  1100
              VD      K      FD QRRT  FLKD IP   A GGYIA+A ++ + +P IF  LKW
Sbjct  301   TVDSPSPTNKPL---SFDDQRRTRLFLKDQIPTWFACGGYIAIAVISTLTLPHIFHQLKW  357

Query  1099  YHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGV  920
             YHI + Y  AP+LAFCNA+GCGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+CGV
Sbjct  358   YHIILIYTFAPVLAFCNAFGCGLTDWSLASTYGKLAIFTIGAWAGTSHGGVLAGLAACGV  417

Query  919   MMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDS  743
             MM+IVST SDLMQDFKTGYLTLASP +MF SQV GTAMGC + P VFWIFYKA+P LG  
Sbjct  418   MMNIVSTASDLMQDFKTGYLTLASPRSMFVSQVIGTAMGCVVAPCVFWIFYKAFPDLGVP  477

Query  742   NSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRV  563
              + YPAP+A VY  +A LGV+GF +LP NCL L   FF A+I IN+  + + K   +Y  
Sbjct  478   GTTYPAPFATVYYNMAKLGVEGFSALPKNCLKLCYAFFCASILINMIRDAVGKKRGRY--  535

Query  562   YRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLW  383
                IP PM MAIPFYLG YFAIDMCVGSLIL++W+  N+ +A  F PAVASGLICG+ +W
Sbjct  536   ---IPLPMAMAIPFYLGSYFAIDMCVGSLILYIWQRINRAKADAFAPAVASGLICGDGIW  592

Query  382   GIPAAILALAGVKAPICMKFLSAAANAKLE  293
              +P +ILALAGVK PICMKFLS   N++++
Sbjct  593   TLPNSILALAGVKPPICMKFLSKGTNSRVD  622



>gb|EEC78242.1| hypothetical protein OsI_17899 [Oryza sativa Indica Group]
Length=691

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/665 (58%), Positives = 495/665 (74%), Gaps = 10/665 (2%)
 Frame = -2

Query  2254  WKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAG  2075
             WK Q+T+RA+  S +L A+F+ IV KLNLTTG+IPSLNV+AGLLGF ++ SWT  L K G
Sbjct  33    WKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFLLTSWTKFLDKVG  92

Query  2074  LLK-QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSI  1898
             +   +PFTRQENTV+QTCVVA SGIAFS G  SY+  MS  I+ Q+      +N+K  S+
Sbjct  93    VASVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQSGEARDEHNIKNPSL  152

Query  1897  GWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVa  1718
             GWM+ FL++VSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LINSFHTP GAKLAK QV 
Sbjct  153   GWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHTPQGAKLAKMQVK  212

Query  1717  alfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIM  1538
              L K F  SF +G FQWF+   DGCGF SFPT GL+AY  +F+FDFS+TYVGVGM+CP +
Sbjct  213   MLGKFFVMSFSWGFFQWFYTGGDGCGFMSFPTLGLEAYRNKFFFDFSATYVGVGMICPYL  272

Query  1537  VNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNF  1358
             VN+S+L+G ++SWGI+WP+I  K+G WYP +L  SSL+GI GY+VF++I+++LGDGL+NF
Sbjct  273   VNISVLLGGVMSWGIMWPLIEHKKGDWYPADLKPSSLRGIVGYRVFISISLILGDGLYNF  332

Query  1357  FYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED-FDGQRRTHNFLKDSIPN  1181
               +M  T  + + + R+  + P   LPV      G G   E+ FD +RRT  FLKD IPN
Sbjct  333   LKVMTRTTTALVMQVRAMMSEPT--LPVSGGGGGGGGQTPEETFDDKRRTELFLKDQIPN  390

Query  1180  avavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYG  1001
              +A+  Y+ +A V+I  VP IF  L+WYH+AV+Y +AP+LAFCNAYGCGLTDWSLA+ YG
Sbjct  391   WLALSAYVVIAVVSIATVPRIFHQLRWYHVAVSYVVAPVLAFCNAYGCGLTDWSLATTYG  450

Query  1000  KIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQV  821
             K+AI    +W    +GG++AGLA+CGVM+ IVST SDL QDFKTGY+TLASP +MF SQV
Sbjct  451   KLAIFTVGAWADASDGGIIAGLAACGVMIGIVSTASDLTQDFKTGYMTLASPRSMFVSQV  510

Query  820   AGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGSLPTNCLNL  644
              GTAMGC + P VFW+FYKA+  +G   S YP+P A VYR +A+LGV G GSLP +CL+L
Sbjct  511   IGTAMGCVIAPSVFWLFYKAFHDIGMPGSEYPSPNALVYRNMAILGVQGLGSLPKHCLDL  570

Query  643   AIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFV  464
              IGFFVAAIA+N+  ++        +V RF+P PM MAIPFYLG YF IDMC+GSLI FV
Sbjct  571   CIGFFVAAIAVNLARDLAAP-----KVARFLPLPMAMAIPFYLGPYFGIDMCIGSLIRFV  625

Query  463   WRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAANAKLESS*  284
             W   +  +AK F P VASGLICG+ +W +P ++LALAGVK PICMKFLS   N K+++  
Sbjct  626   WDRLDGARAKAFAPPVASGLICGDGIWTLPQSVLALAGVKPPICMKFLSRTTNIKVDAFI  685

Query  283   PKISS  269
              K+ S
Sbjct  686   AKLPS  690



>gb|EMS55053.1| putative metal-nicotianamine transporter YSL10 [Triticum urartu]
Length=706

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/689 (57%), Positives = 498/689 (72%), Gaps = 30/689 (4%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVFE  E+P WK Q+T RA+  S +L  +F+ IV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  17    SIERVFEGQEVPDWKEQVTARALAVSALLGFMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  76

Query  2113  VIKSWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
             ++ SWT LL KAG+   +PFTRQENTV+QTCVVA SGIAFS G  SYM GMS  I+ Q+ 
Sbjct  77    LLHSWTRLLDKAGIPGVKPFTRQENTVVQTCVVACSGIAFSGGFGSYMFGMSERISEQSG  136

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRK-------------------MMILK  1814
                  +++K  S+GWM+ FL++VSF+GLFS+VPLRK                   +MI+ 
Sbjct  137   EVRDEDSIKNPSLGWMIGFLFIVSFLGLFSVVPLRKACTSHHSTDLYSQHFDFTNIMIID  196

Query  1813  YKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFS  1634
             YKL YPSGTATA+LINSFHTP GAKLAK QV  L K F+ SF +G FQWF+     CGFS
Sbjct  197   YKLIYPSGTATAHLINSFHTPQGAKLAKLQVKTLGKFFAMSFSWGFFQWFYTGGKDCGFS  256

Query  1633  SFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWY  1454
             SFPT GL+A  Q+FYFDFS+TY+GVGM+CP +VN+S+L+G IISWGI+WPII  K+G WY
Sbjct  257   SFPTLGLEARRQKFYFDFSATYLGVGMICPYLVNLSVLLGGIISWGIMWPIIEHKKGDWY  316

Query  1453  PPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPV  1274
             P +L  SSL+GI GY+VF++I+++LGDGL+NF  ++  T  + + + R   +GP   LP+
Sbjct  317   PADLKPSSLRGIVGYRVFISISLILGDGLYNFLKVLTRTMTALVAQVRGMMSGPT--LPI  374

Query  1273  DDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYH  1094
              +    G     E FD QRRT  F+KD IPN +A+  Y+  A +++I VP IF  L+WYH
Sbjct  375   SEA--GGDLTPAETFDDQRRTELFMKDQIPNTLALSAYVITAVISVITVPRIFHQLRWYH  432

Query  1093  IAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMM  914
             +A +Y +AP+LAFCNAYGCGLTDWSLA+ YGK+AI +  +W G  NGG++AGLA+CGVM+
Sbjct  433   VATSYVIAPVLAFCNAYGCGLTDWSLATTYGKLAIFLVGAWAGASNGGIIAGLAACGVMI  492

Query  913   SIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNS  737
              IVST SDL QDFKTGY+TLASP +MF SQV GTAMGC + P VFW+FYKA+  +G   S
Sbjct  493   GIVSTASDLTQDFKTGYMTLASPRSMFVSQVIGTAMGCVIAPSVFWLFYKAFGDIGTPGS  552

Query  736   aypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYR  557
              YP+P A VYR +A+LGV G GSLP +CL+L I FFV AI +N+  ++         + +
Sbjct  553   EYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIVFFVGAIVVNLARDL-----AGPNIAQ  607

Query  556   FIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGI  377
             FIP PM MAIPFYLG YF IDMC+GSLI FVW   +  +AK F P VASGLICG+ +W +
Sbjct  608   FIPLPMAMAIPFYLGPYFGIDMCIGSLIRFVWDHVDGARAKAFAPPVASGLICGDGIWTL  667

Query  376   PAAILALAGVKAPICMKFLSAAANAKLES  290
             P ++LALAGV+ PICMKFL  A N ++E+
Sbjct  668   PQSVLALAGVRPPICMKFLPRATNIQVEA  696



>emb|CAN70906.1| hypothetical protein VITISV_043868 [Vitis vinifera]
Length=697

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/653 (60%), Positives = 494/653 (76%), Gaps = 13/653 (2%)
 Frame = -2

Query  2245  QLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAGLLK  2066
              LTIRA   S VL  +  FIV KLNLTTG+IPSLNV+AGLLGF  +KSW   + K+G+LK
Sbjct  53    SLTIRAFVVSFVLGVLLTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKSWAKFMEKSGMLK  112

Query  2065  QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWML  1886
             QPFTRQENTVIQTCVVA+SGIAFS G  SY+ GMS  +A Q+       N K   + W++
Sbjct  113   QPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSSIVAGQSAKSIDAQNTKDPRLPWII  172

Query  1885  AFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfk  1706
              FL+ VSF+GLFS++PLRK+M++ YKLTYPSGTATA+LINSFHTP GAKLAKQQV  L K
Sbjct  173   GFLFAVSFLGLFSVLPLRKIMVIDYKLTYPSGTATAHLINSFHTPQGAKLAKQQVRTLGK  232

Query  1705  cfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVs  1526
              FSFSFL+G FQWFF   DGCGFS+FPTFGL+AY  RFYFDFS T+VGVGM+CP ++NVS
Sbjct  233   FFSFSFLWGFFQWFFTGGDGCGFSNFPTFGLEAYENRFYFDFSGTFVGVGMICPYLINVS  292

Query  1525  lligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMM  1346
             +L+GAI+SWG++WP+I  ++G WY   LS S+L G+QGY+VFL+IAM+LGDGL+NF  ++
Sbjct  293   VLVGAILSWGLMWPLIKNRKGDWYSAMLSDSNLMGVQGYRVFLSIAMILGDGLYNFVKVL  352

Query  1345  VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavg  1166
              +T   F+K+ +  +     ++PV +  +  K +    +D + RT  FLKD IP  V++ 
Sbjct  353   GLTIRGFIKQYKKME-----VIPVTERGSPEKVSN--SYDDEVRTKLFLKDGIPLWVSIV  405

Query  1165  gyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAIL  986
             GY+A+AAV+I  +P IF  +KWY++ V Y  AP+LAFCNAYGCGLTDWSLAS YGK+AI 
Sbjct  406   GYVAIAAVSIGVIPKIFHQMKWYYVLVIYIFAPVLAFCNAYGCGLTDWSLASTYGKLAIF  465

Query  985   IFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAM  806
                +W G  +GGVLAGLA+CGVMM+IVST SDLMQDFKTGY+TLASP +MF SQV GTAM
Sbjct  466   AIGAWAGESHGGVLAGLAACGVMMNIVSTASDLMQDFKTGYMTLASPRSMFVSQVIGTAM  525

Query  805   GCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFF  629
             GC ++P VFW+FYKA+  +G  +S YPAP A VYR +++LGV+GFGSLP +CL L    F
Sbjct  526   GCIISPCVFWLFYKAFVDIGSPDSDYPAPNALVYRNMSVLGVEGFGSLPDHCLTLCYILF  585

Query  628   VAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKN  449
               +I IN+  + + K   KY     IP PM MAIPFYLG YFAIDMCVGSLILF+W   +
Sbjct  586   AGSIVINLIRDTVAKKWAKY-----IPLPMAMAIPFYLGPYFAIDMCVGSLILFIWGKLD  640

Query  448   KQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAANAKLES  290
             K +A  FGPAVASGLICG+ +W +P++ILALAGV+ PICMKFLS   NA+++ 
Sbjct  641   KAKADAFGPAVASGLICGDGIWSLPSSILALAGVQPPICMKFLSRGTNARVDQ  693



>ref|XP_002449540.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor]
 gb|EES08528.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor]
Length=722

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/671 (58%), Positives = 497/671 (74%), Gaps = 11/671 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
              S ER F    +PSW+ QLT+RA   S  L+ +F+ IV KLNLTTG+IPSLN++AGLLGF
Sbjct  57    SSVERAFADQPVPSWREQLTVRAFVVSFFLAVMFSIIVMKLNLTTGIIPSLNISAGLLGF  116

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               ++ WT  +   GLL+QPFTRQENTVIQTCVVAS G+AFS G  SY+L MS  IAA   
Sbjct  117   FFVRLWTRAIESVGLLRQPFTRQENTVIQTCVVASYGLAFSGGFGSYLLAMSDKIAAMVT  176

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N   N+K   +GW++ FL++VSF+GLF +VPLRK+MI+ YKLTYPSGTATAYLIN FH
Sbjct  177   EANNAQNIKDPQLGWIIGFLFLVSFIGLFGLVPLRKIMIVDYKLTYPSGTATAYLINGFH  236

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaAD-DGCGFSSFPTFGLKAYAQRFYFDF  1580
             TP GA+LA++QV  L   F  SF++G FQWF+ A+ D CGF  FP+ GL+AY  +FYFDF
Sbjct  237   TPQGARLARKQVKKLGTFFVLSFVWGFFQWFYTANSDECGFQQFPSLGLQAYNNKFYFDF  296

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S TYVGVGM+C  +VNVS+L+GAI+SWGI+WP+I  K+GIW+  +L  +SL G+QGY+VF
Sbjct  297   SPTYVGVGMICSHIVNVSILLGAILSWGIMWPLIAKKKGIWFSADLDDTSLHGMQGYRVF  356

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             +AIA++LGDGL+NF  + ++T +S    R   K    S LP+ D+        +  +D +
Sbjct  357   IAIALILGDGLYNFLKIFILTVVSL---RSQIKKANVSTLPISDDGTVTNSTPIS-YDEE  412

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR   FLKD IP   A+GGY+A+AA++I  VP IFP L+WYHI VAY  APILAFCNAYG
Sbjct  413   RRNELFLKDQIPWYAALGGYVAIAAISIGTVPQIFPQLQWYHILVAYIFAPILAFCNAYG  472

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
              GLTDWSL + YGK+AI  F +WVG  NGGVLAGLA+CGVMM+IV T +DLM DFKTGYL
Sbjct  473   SGLTDWSLVTTYGKLAIFAFGAWVGASNGGVLAGLAACGVMMNIVGTAADLMGDFKTGYL  532

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQV GTAMGC + P VFW+FYKA+  +G + S YPAP A V+R++A+LGV
Sbjct  533   TLASPRSMFISQVIGTAMGCVIAPCVFWLFYKAFGNIGIAGSEYPAPNAVVFRSMAVLGV  592

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             DGF SLP +CL L   FF AAI IN+  +++ K     +V RFIP PM MAIPFY+G YF
Sbjct  593   DGFSSLPKHCLTLCYVFFAAAIVINLIRDLVPK-----KVSRFIPIPMAMAIPFYIGAYF  647

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             A+DM VG++ILFVW+  ++ +A  F PAVASG+ICG+ +W +P ++LALA VK PICM+F
Sbjct  648   AVDMFVGTVILFVWQRLDRAKADAFAPAVASGMICGDGIWVLPQSVLALAKVKPPICMRF  707

Query  322   LSAAANAKLES  290
             LS A N K+++
Sbjct  708   LSRAMNDKVDA  718



>ref|XP_010039025.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48662.1| hypothetical protein EUGRSUZ_K02318 [Eucalyptus grandis]
Length=707

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/671 (59%), Positives = 498/671 (74%), Gaps = 18/671 (3%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             ER+FE   +PSW+ QLT RA   S  L+ +F FIV KLNL TG+IPSLNV+AGLLGF  +
Sbjct  46    ERIFEGQGVPSWRRQLTFRAFAVSFALNVMFAFIVMKLNLMTGIIPSLNVSAGLLGFFFV  105

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             K+WT +L K+GLL+ PFTRQENTVIQTCVVASSGIAFS G  SY+  M+  +A Q+    
Sbjct  106   KTWTKVLEKSGLLRVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMNERVANQSTDTQ  165

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
               +  K  S+ WM+ FL+VVSF+GL ++VPLRK+MI+ +KLTYPSGTATA+LINSFHTP 
Sbjct  166   SAHVYKNPSLLWMIGFLFVVSFLGLLAVVPLRKIMIIDFKLTYPSGTATAHLINSFHTPE  225

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+QV AL K FSFSFL+G FQWF+ A D CGF+ FPT GLKA+  RFYFDFS+TY
Sbjct  226   GAKLAKKQVKALGKFFSFSFLWGFFQWFYRAGDDCGFAKFPTLGLKAFQNRFYFDFSTTY  285

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP ++N+S+L+G I+SWGI+WP+I T++G WYP   S +S++G+QGYKVF+AIA
Sbjct  286   VGVGMICPYIINISVLLGGILSWGIMWPLIETRKGHWYPAEESPTSMRGLQGYKVFIAIA  345

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLED----FDGQ  1220
              +LGDGL+NFF ++  T     ++ R  +     +LP  +      G+ L++    +D Q
Sbjct  346   TILGDGLYNFFKVLSRTLCDLYRQLRDREM--THVLPFTN------GSSLDNPQVSYDDQ  397

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IP   AV GY+ +AA++   +P IFP LKWY+I V Y  AP L FCNAYG
Sbjct  398   RRTQLFLKDQIPTWFAVAGYVTIAAISTATLPHIFPQLKWYYILVIYLSAPTLGFCNAYG  457

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSL S YGK+ I +  +W G  +GG+LAGLA+CGVMM+IVST SDL QDFKTGYL
Sbjct  458   CGLTDWSLPSTYGKLTIFMIGAWAGPSHGGILAGLAACGVMMNIVSTASDLTQDFKTGYL  517

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP +MF SQV GTAMGC ++P VFW+FYKA+  LG   S YP P   VYR+IA LGV
Sbjct  518   TLASPRSMFVSQVIGTAMGCVISPCVFWLFYKAFKDLGLPGSEYPVPNGIVYRSIAELGV  577

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF SLP +CL L   FF AA+ IN F ++L K     +  RFIP PM MAIPF++G +F
Sbjct  578   EGFSSLPKHCLTLCYCFFAAAVIINGFRDLLGK-----KWARFIPLPMAMAIPFFIGPFF  632

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +K +A  FGPAVASGLICG+ +W + ++ILALAG+  PICMKF
Sbjct  633   AIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTMASSILALAGINPPICMKF  692

Query  322   LSAAANAKLES  290
             LS A N ++++
Sbjct  693   LSRAMNKRVDT  703



>ref|XP_003581443.2| PREDICTED: probable metal-nicotianamine transporter YSL11 [Brachypodium 
distachyon]
Length=633

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/637 (61%), Positives = 489/637 (77%), Gaps = 8/637 (1%)
 Frame = -2

Query  2200  IFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCV  2021
             +F+ IV KL+LTTG+IPSLNV+A LLGF +++ WT+ + K GLLKQP TRQENTVIQTCV
Sbjct  1     MFSVIVMKLSLTTGIIPSLNVSASLLGFFLVRLWTSTIEKMGLLKQPITRQENTVIQTCV  60

Query  2020  VASSGIAFSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIV  1841
             V++ GIAF+ G  S++ GMS  IA QA   N   N+K   +GW++ FL++VSFVGLF++V
Sbjct  61    VSAYGIAFTGGFGSFLFGMSGNIAKQATEANDALNIKNPELGWIMGFLFLVSFVGLFALV  120

Query  1840  PLRKMMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwff  1661
             P+RK MI+ YKLTYPSGTATAYLIN FHTP GA+LAK+QV  L K FSFSF++  FQWF+
Sbjct  121   PMRKTMIVDYKLTYPSGTATAYLINGFHTPQGAELAKKQVWTLGKFFSFSFVWAFFQWFY  180

Query  1660  aADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpi  1481
              A D CGFSSFPT GL+A+  RFYFDFS+TYVGVGM+CP +VNVSLLIG ++SWG++WP+
Sbjct  181   TAGDNCGFSSFPTLGLEAFKNRFYFDFSATYVGVGMICPYIVNVSLLIGGVVSWGLMWPL  240

Query  1480  IHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEK  1301
             I TK+G WYP +L  SSL G+Q YKVF+ IA++LGDGL+NF  +   T ++ ++  + +K
Sbjct  241   ISTKKGSWYPESLPDSSLHGLQAYKVFITIAVILGDGLYNFLKVFGKTIIALIEMHK-KK  299

Query  1300  NGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpf  1121
             N  A  LPV D+   G   + E FD +RRT  FLKD IP  VA+GGY+ +AA+ II +P 
Sbjct  300   NSKA--LPVSDDGTPGATVEAESFDDKRRTELFLKDQIPKTVALGGYVVVAAITIICLPL  357

Query  1120  ifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLA  941
             I P LKWY+I VAY +AP+LAFCNAYG GLTDWSLAS YGK+ I +F +W G  +GGVL 
Sbjct  358   IIPQLKWYYILVAYIVAPVLAFCNAYGSGLTDWSLASTYGKLGIFVFGAWAGASHGGVLV  417

Query  940   GLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKA  761
             GLA+CGVMM+IV T SDLMQDFKTGYLTLASP +MF SQV GTAMGC ++P VFW+FYK+
Sbjct  418   GLAACGVMMNIVGTASDLMQDFKTGYLTLASPRSMFVSQVIGTAMGCVISPCVFWLFYKS  477

Query  760   YPLGDSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKY  581
             + +G S+SAYPAPY+ +YR +A+LGVDG   LP +CL L   FF AA A N+  +++   
Sbjct  478   FDIGASDSAYPAPYSIMYRNMAILGVDGLSVLPKHCLTLCYIFFAAAFATNLIKDLVPN-  536

Query  580   ETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLI  401
                 +V +FIP PM +AIPFYLG YFAIDM +GS+ILF W W NK +A+ F PAVASGL+
Sbjct  537   ----KVSKFIPIPMAVAIPFYLGPYFAIDMSIGSVILFCWEWMNKAEAQAFAPAVASGLM  592

Query  400   CGESLWGIPAAILALAGVKAPICMKFLSAAANAKLES  290
             CG+ +W +P AIL+LA V  PICMKFLS AANAK+++
Sbjct  593   CGDGIWALPQAILSLANVNPPICMKFLSRAANAKVDA  629



>gb|KDO52777.1| hypothetical protein CISIN_1g036864mg [Citrus sinensis]
Length=563

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/562 (70%), Positives = 465/562 (83%), Gaps = 4/562 (1%)
 Frame = -2

Query  1975  MLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYP  1796
             MLGMSP IA+QA+ GN P N+K+LSIGWM+AFL+ VSF+GLFSIVPLRK+MILKYKLTYP
Sbjct  1     MLGMSPKIASQADGGNTPANIKSLSIGWMMAFLFAVSFLGLFSIVPLRKVMILKYKLTYP  60

Query  1795  SGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFG  1616
             SGTATAYLINSFHTP GA+LAK+QVA LF+ F FSF++  FQWF+ A DGCGFSSFPTFG
Sbjct  61    SGTATAYLINSFHTPKGAQLAKKQVAMLFRSFGFSFVWAFFQWFYTAGDGCGFSSFPTFG  120

Query  1615  LKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSS  1436
             LKA+ Q+F+FDFSSTYVGVGM+CP MVN+SLLIGA++SWGI+WPII TK+GIWY   LS 
Sbjct  121   LKAFKQKFFFDFSSTYVGVGMICPYMVNISLLIGAVLSWGIMWPIIETKKGIWYKAELSD  180

Query  1435  SSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNK  1256
             S+L G+ GY+VF+AIAMMLGDG+++  YM+V T LS +++  S +   ++   V  E   
Sbjct  181   SNLHGMNGYRVFIAIAMMLGDGIYHVVYMIVTTSLSLVQQYSSRRKANST---VSSEVGN  237

Query  1255  GKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYA  1076
              + +Q+ +FD QRRT  FLKD IPN VAV GYI LA VAIIAVPFIF  LKWYHI VA++
Sbjct  238   -ESSQIVNFDDQRRTEFFLKDQIPNWVAVSGYILLAVVAIIAVPFIFHQLKWYHILVAFS  296

Query  1075  MAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTT  896
              APILAFCNAYGCGLTDWSLASNYGK AI+IFSSWVG ++GG++AGLASCGVMMS VST 
Sbjct  297   FAPILAFCNAYGCGLTDWSLASNYGKFAIIIFSSWVGLEHGGIIAGLASCGVMMSTVSTA  356

Query  895   SDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapya  716
             SDLMQDFKTGYLTL+SP +MFFSQV GT +G  L+PLVFW FY AYP+GD    YP+PY 
Sbjct  357   SDLMQDFKTGYLTLSSPRSMFFSQVFGTFLGVVLSPLVFWFFYNAYPIGDPEGTYPSPYG  416

Query  715   avyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMC  536
              +YR IA+LGV+G  SLP +CL LAI FF AAI +NI  EVL+  + K ++YRFIP+PMC
Sbjct  417   LLYRGIAILGVEGVSSLPKHCLTLAIAFFAAAIVLNIIREVLQHVDAKCKIYRFIPSPMC  476

Query  535   MAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILAL  356
             MAIPFYLGGYFAIDMCVGSLILFVW  K+K+ A DF PAVASGLICG+SLW +PAAIL+L
Sbjct  477   MAIPFYLGGYFAIDMCVGSLILFVWEMKDKRSAADFAPAVASGLICGDSLWSVPAAILSL  536

Query  355   AGVKAPICMKFLSAAANAKLES  290
             A + APICMKFLSAA N K+++
Sbjct  537   ANLNAPICMKFLSAATNNKVDA  558



>ref|XP_004978145.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like 
[Setaria italica]
Length=725

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/668 (57%), Positives = 490/668 (73%), Gaps = 9/668 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E  F  + +PSW+ QLT+RA     +L+ +FN I+ K++LTTG+ PSLNV A LL + 
Sbjct  62    SVEEAFADLPVPSWREQLTVRAFVVGSLLAVVFNVILMKIDLTTGINPSLNVCASLLSYF  121

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             +++ WT  +   GLL+QPFTRQENT+IQTCVV++ GI F+ G +SY+ GMS TIA +A  
Sbjct  122   LVRVWTKAIEGMGLLRQPFTRQENTMIQTCVVSAYGITFTGGFSSYLFGMSGTIANKATE  181

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GWM+ F+++VSFVGLF++VPLRK+MI+ YKLTYPSGTATAYLIN FH 
Sbjct  182   ANDAQNIKEPHLGWMIGFMFLVSFVGLFALVPLRKVMIVDYKLTYPSGTATAYLINGFHA  241

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P+G++ AK+QV  L K FS SFL+  FQWF+ A D CGF SFPT GL+AY  RF+FDFS 
Sbjct  242   PHGSERAKKQVRTLGKYFSLSFLWAFFQWFYTAGDHCGFGSFPTLGLEAYKNRFFFDFSP  301

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TY+GVGM+CP +VNVSLL+G IISWG++WP+I TK+G WYP  L  +SL G+QGY+VF+ 
Sbjct  302   TYIGVGMICPYIVNVSLLLGGIISWGVMWPLISTKKGSWYPETLPDNSLHGLQGYRVFIT  361

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             +A++LGDGL+N   ++     +F+ R R+      + LPV  +       + E FD +RR
Sbjct  362   VAVILGDGLYNILKVLGRMIEAFVSRYRNRNT---NTLPVSHDGTPVTTTETESFDDKRR  418

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                F+KD IP  VA GGY+ LAA+ I  +P I P LKWYHI  AY +AP LAFCNAYGCG
Sbjct  419   LELFVKDQIPKTVAFGGYVVLAAITIGCLPLIIPQLKWYHILAAYILAPALAFCNAYGCG  478

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LT+WS AS YGK+AI  F +W G  +GGVL GLA+CGVMMSIV T +DLMQDFKTGYLTL
Sbjct  479   LTNWSFASAYGKLAIFSFGAWAGASHGGVLVGLAACGVMMSIVGTAADLMQDFKTGYLTL  538

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGF  674
             ASP +MF SQV GTAMGC + P VFW+FYK++ +G SNSAYPAPY  +YR +A++GVDG 
Sbjct  539   ASPRSMFISQVIGTAMGCVIAPCVFWLFYKSFDIGASNSAYPAPYTIMYRNMAIMGVDGL  598

Query  673   GSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAID  494
              SLP +CL L   FF A+ AIN+  +++ K     +V +FIP PM +AIPFY+G YF ID
Sbjct  599   -SLPKHCLTLCYIFFAASFAINLIKDLMPK-----KVAKFIPIPMAVAIPFYVGAYFTID  652

Query  493   MCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSA  314
             M +G +ILF+W WKNK +A   GPAVASG +CG+ LW +P A+L+LA VK PICMKFLS 
Sbjct  653   MFLGCVILFIWEWKNKAEADSLGPAVASGFMCGDGLWALPEAVLSLANVKPPICMKFLSR  712

Query  313   AANAKLES  290
             + NAK++S
Sbjct  713   SVNAKVDS  720



>gb|AAD49762.2|AC007932_10 F11A17.8 [Arabidopsis thaliana]
Length=803

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/671 (58%), Positives = 485/671 (72%), Gaps = 45/671 (7%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E +FE  E+PSWK QLTIRA   S  LS +F+FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  167   SVEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFF  226

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K+GLLKQPFTRQENTVIQTCVVASSGIAFS G  +Y+  MS  IA Q  S
Sbjct  227   FVKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQ--S  284

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
             G++   VK  S+GWM+AFL+VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHT
Sbjct  285   GDVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHT  344

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLA                                 +FPTFGL+AY  +FYFDFS+
Sbjct  345   PQGAKLA---------------------------------NFPTFGLRAYQYKFYFDFSA  371

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N+SLL+G I+SWG++WP+I T++G W+P N+ SSS+ G+Q YKVF+A
Sbjct  372   TYVGVGMICPYIINISLLLGGILSWGLMWPLIETRKGDWFPSNVDSSSMNGLQAYKVFIA  431

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLE---DFDG  1223
             +A +LGDGL+NF  +++ T    + + R +    +SL   +D       + L     +D 
Sbjct  432   VATILGDGLYNFCKVLIRTFSGLISQIRGKAGSRSSLAHKEDP-PASPASPLTPRISYDD  490

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRRT  FLKD IP+  AVGGY+ ++AV+   +P +F  L+WY+I V Y  APILAFCNAY
Sbjct  491   QRRTRFFLKDQIPSWFAVGGYVVISAVSTAILPHMFSQLRWYYIIVIYIFAPILAFCNAY  550

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLAS YGK+AI    +W G D+GG+LAGLA+CGVMM+IVST SDL QDFKTGY
Sbjct  551   GAGLTDWSLASTYGKLAIFTIGAWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGY  610

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             LTL+SP AMF SQV GTAMGC ++P VFW+FYKA+  LG  NS YPAP+A VYR++A LG
Sbjct  611   LTLSSPRAMFVSQVIGTAMGCLVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLG  670

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G  SLP +CL L   FF  AI IN+  + L       R  RF+P PM MAIPF+LG Y
Sbjct  671   VEGVSSLPRDCLMLCYVFFGVAILINLIKDCLGN-----RWGRFVPLPMAMAIPFFLGPY  725

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGS ILFVW   +  +A+ F  AVASGLICG+ +W +P+++LA+AGVK PICMK
Sbjct  726   FAIDMCVGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPICMK  785

Query  325   FLSAAANAKLE  293
             FLSAA N +++
Sbjct  786   FLSAATNHRVD  796



>gb|KHG02257.1| putative metal-nicotianamine transporter YSL5 -like protein [Gossypium 
arboreum]
Length=696

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/672 (60%), Positives = 507/672 (75%), Gaps = 22/672 (3%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E++FEK E+P WK QLT+RA   S VLS +F FIV KLNLTTG+IPSLNV+AGLLGF 
Sbjct  37    SVEQIFEKREVPPWKKQLTMRAFAVSFVLSILFTFIVMKLNLTTGIIPSLNVSAGLLGFF  96

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA-E  1937
              +K+WT LL K+GLL+QPFTRQENTVIQTCVVASSGIAFS G  SY+ GMS  +A Q+ +
Sbjct  97    FVKTWTKLLSKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERVAKQSGD  156

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
             +G   N     S+GW++ FL+VVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LINSFH
Sbjct  157   NGGFKNP----SLGWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFH  212

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLAK+QV  L K FSFSFL+G FQWF+ A DGCGF +FPTFGLKAY   F+FDFS
Sbjct  213   TPQGAKLAKKQVKTLGKFFSFSFLWGFFQWFYTAGDGCGFINFPTFGLKAYENMFFFDFS  272

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP ++N+S+L+G I+SWG++WP+I  ++G W+  +L  +++ G++GY+VF+
Sbjct  273   ATYVGVGMICPYIINISVLLGGILSWGLMWPLIENRKGDWFNADLPKNNMHGLKGYQVFI  332

Query  1396  AIAMMLGDGLFNF--FYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDG  1223
             AIA++LGDGL+NF   +   +TGL +  R R         LPV ++ +     +L  +D 
Sbjct  333   AIALILGDGLYNFVKVFTRTLTGLFYQFRGRQS-------LPVANQHSSDTSDKLS-YDD  384

Query  1222  QRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAY  1043
             QRR   FLKD IP   +V GY+ +A ++ I +PFIFP LKWY++ V Y  AP LAFCNAY
Sbjct  385   QRRIQLFLKDQIPTWFSVAGYVTIATISTIVLPFIFPELKWYYVLVIYIFAPTLAFCNAY  444

Query  1042  GCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGY  863
             G GLTDWSLAS YGK+AI    +W G  NGGVLAGL +CGVMM+IVST SDLMQDFKTGY
Sbjct  445   GTGLTDWSLASTYGKLAIFTIGAWAG-PNGGVLAGLIACGVMMNIVSTASDLMQDFKTGY  503

Query  862   LTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLG  686
             LTLASP +MF SQV GTAMGC ++P VFW+FY A+  LG   S Y AP+  VYR +++LG
Sbjct  504   LTLASPRSMFVSQVIGTAMGCIVSPCVFWLFYNAFDDLGLPGSQYAAPFGIVYRNMSVLG  563

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V GF +LP +CL L   FF AAI IN   ++L K    Y     IP PM MAIPFYLG Y
Sbjct  564   VQGFSALPKDCLLLCYVFFGAAILINSIKDMLGKKWGSY-----IPLPMAMAIPFYLGPY  618

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             FAIDMCVGSLILFVW   NK++A  F PAVASGLICG+ +W +P++ILALAGV+ PICMK
Sbjct  619   FAIDMCVGSLILFVWEKLNKEKAAAFAPAVASGLICGDGIWTLPSSILALAGVQPPICMK  678

Query  325   FLSAAANAKLES  290
             FLS A NA++++
Sbjct  679   FLSRATNARVDN  690



>ref|XP_008669136.1| PREDICTED: probable metal-nicotianamine transporter YSL13 [Zea 
mays]
 tpg|DAA36870.1| TPA: hypothetical protein ZEAMMB73_694828 [Zea mays]
Length=725

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/666 (58%), Positives = 496/666 (74%), Gaps = 11/666 (2%)
 Frame = -2

Query  2284  RVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIK  2105
             R F    +PSW+ QLT+RA   S  L+ +F+ IV KLNLTTG+IPSLN++AGLLGF  ++
Sbjct  64    RAFADQPVPSWREQLTLRAFVVSFFLAVMFSVIVMKLNLTTGIIPSLNISAGLLGFFFVR  123

Query  2104  SWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNI  1925
              WT  +   GLL+QPFTRQENTVIQTCVVAS G++FS G  +Y+L MS  IAA     N 
Sbjct  124   LWTKAIESVGLLRQPFTRQENTVIQTCVVASYGLSFSGGFGNYLLAMSDKIAAMVTEANN  183

Query  1924  PNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNG  1745
               N+K   +GW++ FL++VSF+GLF +VPLRK+MI+ YKLTYPSGTATAYLIN FHTP G
Sbjct  184   AQNIKNPQLGWIIGFLFLVSFIGLFGLVPLRKIMIVDYKLTYPSGTATAYLINGFHTPQG  243

Query  1744  AKLAKQQVaalfkcfsfsflfggfqwffaAD-DGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             AKLA++QV  L   F  SF++G FQWF+ A+ D CGF  FP+ GL+A+  +F+FDFS TY
Sbjct  244   AKLARKQVKKLGTFFVLSFVWGFFQWFYTANPDECGFQKFPSLGLQAFDNKFFFDFSPTY  303

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+C  +VNVS+L+GAI+SWGI+WP+I  K+G+W+  +L  +SL G+QGY+VF+AIA
Sbjct  304   VGVGMICSHIVNVSILLGAILSWGIMWPLIAKKKGVWFSADLDDNSLHGMQGYRVFIAIA  363

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             ++LGDGL+NF  + ++T +S    R   +   AS LP+ D+      A    +D +RR  
Sbjct  364   LILGDGLYNFLKIFILTVVSL---RSQVRKANASTLPISDDGTVTSTAP-TSYDEERRNE  419

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
             +FLKD IP   A+GGY+A+AA++I  VP IFP LKWYHI VAY  APILAFCNAYG GLT
Sbjct  420   HFLKDQIPWYAALGGYVAIAAISIGTVPQIFPQLKWYHILVAYIFAPILAFCNAYGNGLT  479

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSL + YGK+AI  F +WVG  NGGVLAGLA+CGVMM+IV T +DLM DFKTGYLTLAS
Sbjct  480   DWSLVTTYGKLAIFAFGAWVGASNGGVLAGLAACGVMMNIVGTAADLMGDFKTGYLTLAS  539

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFG  671
             P +MF SQV GTAMGC + P VFW+FYKA+  +G + S YPAP A V+R++A+LGVDGF 
Sbjct  540   PRSMFISQVIGTAMGCVIAPCVFWLFYKAFGNIGVAGSEYPAPNAVVFRSMAVLGVDGFS  599

Query  670   SLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDM  491
             SLP NCL L   FF AAI IN+  +++ K     +V RFIP PM MAIPFY+G YFA+DM
Sbjct  600   SLPENCLTLCYVFFAAAIVINLIRDLVPK-----KVSRFIPIPMAMAIPFYIGAYFAVDM  654

Query  490   CVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAA  311
              VG++ILFVW+  ++ +A  F PA+ASG+ICG+ +W +P ++LALA VK PICMKFLS A
Sbjct  655   FVGTVILFVWQRLDRAKADTFAPAIASGMICGDGIWVLPQSVLALAKVKPPICMKFLSRA  714

Query  310   ANAKLE  293
              N K++
Sbjct  715   MNDKVD  720



>ref|XP_004978143.1| PREDICTED: probable metal-nicotianamine transporter YSL13-like 
[Setaria italica]
Length=733

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/670 (58%), Positives = 498/670 (74%), Gaps = 11/670 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER F    +PSW+ QLT+RA   S  L+ +F+ IV KLNLTTG+IPSLN++AGLLGF 
Sbjct  67    SVERAFAGQPVPSWREQLTVRAFVVSFFLAVLFSIIVMKLNLTTGIIPSLNISAGLLGFF  126

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WT  +   GLLKQPFTRQENTVIQTCVVAS G+AFS G  SY+L MS  IAA +  
Sbjct  127   FVRLWTKAIESVGLLKQPFTRQENTVIQTCVVASYGLAFSGGFGSYLLAMSDKIAAMSTE  186

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GW++ FL++VSF+GLF +VPLRK+MI+ YKLTYPSGTATAYLIN FHT
Sbjct  187   ANDAQNIKNPQLGWIIGFLFLVSFIGLFGLVPLRKVMIVDYKLTYPSGTATAYLINGFHT  246

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaAD-DGCGFSSFPTFGLKAYAQRFYFDFS  1577
             P GAKLA++QV  L   F  SF++G FQWF+ A+ + CGF  FP+ G++A+  RFYFDFS
Sbjct  247   PQGAKLARKQVKKLGTFFVLSFVWGFFQWFYTANIEECGFQKFPSLGMQAFDNRFYFDFS  306

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
              TYVGVGM+C  +VNVS+L+GAI+SWGI+WP+I  K+GIW+  +L+ ++L G+QGY+VF+
Sbjct  307   PTYVGVGMICSHIVNVSILLGAILSWGIMWPLIAKKKGIWFSADLADTNLHGMQGYRVFM  366

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             AIA++LGDG++N   + ++T +S    R   K   AS LP+ D+      A +  +D +R
Sbjct  367   AIALILGDGIYNVLKISILTAVSL---RSQLKKSNASTLPISDDAIVTDTAPVS-YDEER  422

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             R   F KD IP  VA+GGY+ +AA++I  VP IFP LKWYHI VAY  AP+LAFCNAYG 
Sbjct  423   RNELFTKDQIPWYVALGGYVVIAAISIGTVPQIFPQLKWYHILVAYIFAPLLAFCNAYGS  482

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSL + YGK+AI  F +WVG  +GGVLAGLA+CGVMM+IV T +DLM DFKTGYLT
Sbjct  483   GLTDWSLVTTYGKLAIFAFGAWVGASHGGVLAGLAACGVMMNIVGTAADLMGDFKTGYLT  542

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVD  680
             LASP +MF SQV GTAMGC + P VFW+FYKA+  +G   S YPAP AAV+R++A+LGVD
Sbjct  543   LASPRSMFISQVIGTAMGCVIAPCVFWLFYKAFGNIGVDRSEYPAPNAAVFRSMAILGVD  602

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP NCL L   FF AAI IN+  +++ K     +V RFIP PM MAIPFY+G YFA
Sbjct  603   GFSSLPKNCLTLCYVFFAAAIVINLIRDLVPK-----KVSRFIPIPMAMAIPFYIGAYFA  657

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             +DM VG++ILFVW+  ++ +A  F PAVASG+ICG+ +W +P ++LALA VK PICMKFL
Sbjct  658   VDMFVGTVILFVWQRLDRAKADAFAPAVASGMICGDGIWVLPQSLLALAKVKPPICMKFL  717

Query  319   SAAANAKLES  290
             S   N K+++
Sbjct  718   SRTMNDKVDA  727



>emb|CAI44637.1| OSJNBb0065J09.17 [Oryza sativa Japonica Group]
Length=672

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/669 (58%), Positives = 474/669 (71%), Gaps = 56/669 (8%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
              S ER F    +PSW+ QLT+RA   S  LS +F+ IV KLNLTTG+IPSLNV+AGLLGF
Sbjct  54    SSVERAFVDRAVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGF  113

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               ++ WTA + + GLL+QPFTRQENTVIQTCVVA+ GIAFS G  +Y+ GMS TIA QA 
Sbjct  114   FFVRLWTAAIERVGLLRQPFTRQENTVIQTCVVAAYGIAFSGGFGTYLFGMSETIAKQAT  173

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N   NVK   IGWM+ FL++VSF+GL ++VPLRK+MI+ YKLTYPSGTATAYLIN FH
Sbjct  174   EANNAQNVKNPHIGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFH  233

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP GAKLAK                                             FYFDFS
Sbjct  234   TPEGAKLAK---------------------------------------------FYFDFS  248

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
              TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K+G WY  +LS +SL G+QGY+VF+
Sbjct  249   PTYVGVGMICPHIVNVSVLLGGILSWGIMWPLIRNKKGSWYAASLSETSLHGLQGYRVFI  308

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             +IA++LGDGL+NF  +++ T   F+   +  KN   S LPV +  +     +   FD +R
Sbjct  309   SIALILGDGLYNFVKVLIRTTAGFVVMMK--KN---STLPVSNNGSPMVATEAISFDDER  363

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP  VA GGY+A+AAV+I  +P IFP LKWY+I VAY  AP+LAFCNAYG 
Sbjct  364   RTELFLKDQIPKTVAFGGYVAVAAVSIGTLPQIFPQLKWYYILVAYVFAPVLAFCNAYGA  423

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSLAS YGK+AI IF +W G  NGGVL GLA+CGVMMSIVST SDLMQDFKTGYLT
Sbjct  424   GLTDWSLASTYGKLAIFIFGAWAGASNGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLT  483

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVD  680
             LASP +MF SQV GTAMGC + P VFW+FYKA+  +G S + YPAPYA VYR +A+LGVD
Sbjct  484   LASPRSMFVSQVIGTAMGCVIAPCVFWLFYKAFADIGVSGTEYPAPYAIVYRNMAILGVD  543

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             GF SLP +CL L   FF AAIAIN+  ++        +V RFIP PM MAIPFY+G YFA
Sbjct  544   GFSSLPKHCLTLCYIFFAAAIAINLARDL-----APSKVARFIPLPMAMAIPFYIGSYFA  598

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDM +G++ILFVW   NK +A+ F PAVASGLICG+ +W +P +ILALA VK PICMKFL
Sbjct  599   IDMFIGTVILFVWEMVNKAKAEAFAPAVASGLICGDGIWTLPQSILALAKVKPPICMKFL  658

Query  319   SAAANAKLE  293
             S + NA+++
Sbjct  659   SRSVNAQVD  667



>ref|XP_007146944.1| hypothetical protein PHAVU_006G083800g [Phaseolus vulgaris]
 gb|ESW18938.1| hypothetical protein PHAVU_006G083800g [Phaseolus vulgaris]
Length=680

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/663 (60%), Positives = 499/663 (75%), Gaps = 14/663 (2%)
 Frame = -2

Query  2278  FEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIKSW  2099
             FE   +P W+ Q+T+RAM  SLVL+ +F FIV KLNLTTG+IPSLN++AGLLGF  +K W
Sbjct  26    FEGKVVPRWEKQITLRAMVVSLVLAVLFTFIVMKLNLTTGIIPSLNISAGLLGFFFVKIW  85

Query  2098  TALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIPN  1919
             T+LL K G+L QPFTRQENTVIQTCVVASSGIAFS G  SY+  MS  IA Q+   N P 
Sbjct  86    TSLLTKMGMLVQPFTRQENTVIQTCVVASSGIAFSGGFGSYIFAMSSEIANQSPEANGPL  145

Query  1918  NVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGAK  1739
             ++K  ++GWM+AF+ VVSF+GLFS+VPLRK+MI+ +KL YPSGTATA+LINSFHT  GAK
Sbjct  146   DIKNPTLGWMIAFVSVVSFLGLFSVVPLRKIMIVDFKLIYPSGTATAHLINSFHTTEGAK  205

Query  1738  LAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGV  1559
             LAK+QV+ L K FSFSFL+G FQWF+ A D CGF+SFPTFGL+AY  +F+FDFS+TYVGV
Sbjct  206   LAKKQVSVLGKFFSFSFLWGFFQWFYTASDDCGFNSFPTFGLEAYRNKFFFDFSTTYVGV  265

Query  1558  GMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMML  1379
             GM+CP ++N+SLL+G I+SWGI+WPII+ ++G WY  +L SSSL G+QGYKVF+AIAM+L
Sbjct  266   GMICPYIINISLLVGGILSWGIMWPIINARKGDWYSADLKSSSLHGLQGYKVFIAIAMIL  325

Query  1378  GDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNFL  1199
             GDGL+NF  ++  T +        +K         +   N    +  + +D + RT  FL
Sbjct  326   GDGLYNFVKVLGRTLIGLYNEFFKKKT--------EASSNDPDSSSSDSYDDRCRTDMFL  377

Query  1198  KDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWS  1019
             +D IP   A+ GY+ +A ++II VP IF  LKWY+I V Y +AP+LAFCNAYGCGLTDWS
Sbjct  378   RDQIPAWFAITGYVVIAIISIIVVPIIFHQLKWYYIVVIYVIAPVLAFCNAYGCGLTDWS  437

Query  1018  LASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLA  839
             LAS YGK+AI    +W G  +GGV+AGLA+CGVMM+IVST SDLMQDFKTGY+T+ASP +
Sbjct  438   LASTYGKLAIFTIGTWAGASHGGVIAGLAACGVMMNIVSTASDLMQDFKTGYMTMASPRS  497

Query  838   MFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGSLP  662
             MF SQV GT MGC ++P VFW+FYKA+  LG + S YPAPYA VYR +A+LGVDG  +LP
Sbjct  498   MFVSQVFGTIMGCIISPCVFWLFYKAFGNLGVAGSPYPAPYALVYRNMAILGVDGLSALP  557

Query  661   TNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVG  482
               CL     FF  AI IN+  +++ K     +  RFIP PM MA+PFY+G YFAIDMCVG
Sbjct  558   QYCLIFCYVFFGVAIVINLIRDLVGK-----KWARFIPVPMAMAVPFYIGSYFAIDMCVG  612

Query  481   SLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAANA  302
             SLILF+WR  +K  A  FG AVASGLICG+ +W +P++ LALAGVK PICMKFLS A N 
Sbjct  613   SLILFIWRKLDKVGADTFGSAVASGLICGDGIWTLPSSFLALAGVKPPICMKFLSRAENT  672

Query  301   KLE  293
             K++
Sbjct  673   KVD  675



>gb|KHM99726.1| Putative metal-nicotianamine transporter YSL7 [Glycine soja]
Length=623

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/633 (62%), Positives = 482/633 (76%), Gaps = 18/633 (3%)
 Frame = -2

Query  2179  KLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIA  2000
             KLNLTTG+IPSLNV+AGLLGF  +K+WT  L K+ +L+QPFTRQENTVIQTCVVASSGIA
Sbjct  2     KLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSNMLRQPFTRQENTVIQTCVVASSGIA  61

Query  1999  FSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMI  1820
             FS G  SY+ GMS  IA Q+       + K   +GW++ FL+VVSF+GLFS+VPLRK+M+
Sbjct  62    FSGGFGSYLFGMSEEIAKQSSD---TGHFKDPKLGWIIGFLFVVSFLGLFSVVPLRKIMV  118

Query  1819  LKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCG  1640
             + +KLTYPSGTATA+LINSFHTP GAKLAK+QV  L K FSFSFL+G FQWF+ A D CG
Sbjct  119   IDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVKMLGKFFSFSFLWGFFQWFYTATDQCG  178

Query  1639  FSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGI  1460
             F +FP+ GLKAY  +F+FDF++ YVGVGM+CP ++N+S+L+G I+SWGI+WP+I TKEG 
Sbjct  179   FQAFPSLGLKAYNNKFFFDFAAIYVGVGMICPYIINISVLLGGILSWGIMWPLIKTKEGD  238

Query  1459  WYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVT--GLSFMKRRRSEKNGPAS  1286
             WY   L   +L GIQGY+VF+AIA++LGDGL+NF  ++  T  GL    R +  +N    
Sbjct  239   WYDKGLGEGNLHGIQGYRVFIAIALILGDGLYNFIKVLTHTLWGLYHQVRVKQRENA---  295

Query  1285  LLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppL  1106
              LPV D+ +      L  +D QRRT  FLKD IP   A+ GY+A+AA++   +P IFP L
Sbjct  296   -LPVADQ-DSPSNPHLS-YDDQRRTQLFLKDQIPTWFAIAGYVAIAAISTATLPHIFPQL  352

Query  1105  KWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASC  926
             KWY+I V Y +AP LAFCNAYGCGLTDWSLAS YGK+AI    +W G  +GGVLAGLA+C
Sbjct  353   KWYYIIVIYLIAPTLAFCNAYGCGLTDWSLASTYGKLAIFTIGAWAGSSHGGVLAGLAAC  412

Query  925   GVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LG  749
             GVMM+IVST SDLMQDFKTGYLTLASP +MF SQ+ GT MGC ++P VFWIFYKA+P LG
Sbjct  413   GVMMNIVSTASDLMQDFKTGYLTLASPRSMFVSQIIGTTMGCVISPSVFWIFYKAFPDLG  472

Query  748   DSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKY  569
              S S YPAPYA +YR +A+LGV GFG+LP NCL L   FF AA+AIN+  + +       
Sbjct  473   RSTSEYPAPYAIIYRNMAILGVQGFGNLPKNCLLLCYIFFAAAVAINLIKDFIGNKG---  529

Query  568   RVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGES  389
                RFIP PM MAIPFY+G YFAIDMCVGSLIL+VW   NK +A  F PAVASGLICG+ 
Sbjct  530   ---RFIPLPMAMAIPFYIGPYFAIDMCVGSLILYVWERINKAKADAFAPAVASGLICGDG  586

Query  388   LWGIPAAILALAGVKAPICMKFLSAAANAKLES  290
             +W +PA+ILALAGVK PICMKFLS AANA++++
Sbjct  587   IWTLPASILALAGVKPPICMKFLSRAANARVDT  619



>ref|XP_011072202.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=691

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/668 (58%), Positives = 498/668 (75%), Gaps = 11/668 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+ E  E+PSW+ QLT+RA   S +LS +F F+V KL+LTTG+IPS NV+AGLLGF 
Sbjct  29    SVERISEG-EVPSWRKQLTLRAFAVSFLLSVMFCFVVMKLSLTTGIIPSFNVSAGLLGFF  87

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              I++WT L+ ++G+L+QPFT QENTVIQTCV+ASSG+AFS G  SY+ GMS  IA Q+E 
Sbjct  88    FIQTWTKLIAQSGMLRQPFTCQENTVIQTCVIASSGVAFSGGFGSYLFGMSERIAEQSED  147

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  + K  ++GWM++FL+VVSF+GLF++VP+RK++IL +KL Y  GT TA+LINSFHT
Sbjct  148   RKDAFDYKNPALGWMISFLFVVSFIGLFAVVPMRKIIILDFKLKYARGTETAHLINSFHT  207

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWFF A + CGF+SFPTFGL+AY  +F+FDFS+
Sbjct  208   PEGAKLAKKQVRALGKFFSFSFLWGFFQWFFTAGEDCGFTSFPTFGLQAYEHKFFFDFSA  267

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++NVS L+G I+SWGI+WP+I  ++G WYP +L  +SLKG+QGYK+F+ 
Sbjct  268   TYVGVGMICPHIINVSALVGGILSWGIMWPLIENRKGHWYPADLPPNSLKGLQGYKIFIG  327

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IAM+LGDG +NF      T    + +    K    S +PV    +    +Q   +D QRR
Sbjct  328   IAMILGDGSYNFVKARARTLAGLLIKLLETK--AKSQIPVKQHSSPSIKSQ--SYDDQRR  383

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
             +  FLKD IP   A+GGY+A AA++   +P+IF   KWYHIAV Y  AP LAFCNA+GCG
Sbjct  384   SQLFLKDQIPKWFAIGGYLATAAISTAILPYIFNHHKWYHIAVIYIFAPTLAFCNAFGCG  443

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LT WS AS YGK+AIL   +W G  +GGV+A L +CGV+MSI +  SDLMQDFKTGY+TL
Sbjct  444   LTGWSSASMYGKLAILTIGAWGGASHGGVMAPLVACGVIMSITAPASDLMQDFKTGYMTL  503

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP ++F SQV GTAMGC ++P VFW+FYKA+P +G + S YPAP+A VY  +A LGV+G
Sbjct  504   ASPRSIFVSQVIGTAMGCVISPCVFWMFYKAFPDIGYTTSEYPAPFATVYYTMARLGVEG  563

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F  LP +CLNL   FF AA+ IN+  ++L K  +      FIP PM M IPF+LG YFAI
Sbjct  564   FSPLPKHCLNLCYVFFAAAVLINLIRDILGKKRS-----WFIPLPMAMGIPFFLGSYFAI  618

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSLIL++W+  NK +A  FGP VASGLICG+ +W +P+AILALAGV+ PICMKF+S
Sbjct  619   DMCVGSLILYIWQKVNKAKADAFGPVVASGLICGDGMWTLPSAILALAGVRPPICMKFIS  678

Query  316   AAANAKLE  293
              A N++++
Sbjct  679   RATNSRVD  686



>ref|XP_002448760.1| hypothetical protein SORBIDRAFT_06g032720 [Sorghum bicolor]
 gb|EES13088.1| hypothetical protein SORBIDRAFT_06g032720 [Sorghum bicolor]
Length=688

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/677 (57%), Positives = 498/677 (74%), Gaps = 17/677 (3%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             ES ERVFE  E+P W+ Q+T+RA+  S +L A+F+ IV KLNLTTG+IPSLNV+AGLLGF
Sbjct  17    ESVERVFEGWEVPGWREQVTVRALMVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGF  76

Query  2116  AVIKSWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQA  1940
              ++ SWT LL +AG    +PFTRQENTV+QTCVVA SGIAFS G  SYM  MS  I+ Q+
Sbjct  77    FLLTSWTKLLAQAGFTGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYMFAMSDRISEQS  136

Query  1939  ESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                  P+N+K   +GWM+ FL++VSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LINSF
Sbjct  137   GETWDPHNIKNPGLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSF  196

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GAKLAK+QV  L K F+ SF +G FQWF+ A +GCGF SFPT GL+AY Q+F+FDF
Sbjct  197   HTPQGAKLAKRQVKTLGKFFAGSFAWGFFQWFYTAGEGCGFMSFPTLGLEAYRQKFFFDF  256

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP +VN S+L+G ++SWGI+WP+I  K+G WYP +L  SSL+GI GY+VF
Sbjct  257   SATYVGVGMICPYLVNASVLLGGVVSWGIMWPLIEQKKGDWYPADLKPSSLRGIVGYRVF  316

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             ++IA++LGDGL+NF  +M  T  + + + R   +GP   LP+     +   A+ E FD +
Sbjct  317   VSIALILGDGLYNFLKVMTRTVTALVVQVRGMMSGPT--LPISG--GESLPAEEETFDDK  372

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IPN +A+  Y+ +A V+I  VP IF  L+WYH+A +Y +AP+LAFCNAYG
Sbjct  373   RRTELFLKDQIPNTLALSAYMVIAVVSIATVPHIFHQLRWYHVATSYVIAPVLAFCNAYG  432

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGG------VLAGLASCGVMMSIVSTTSDLMQD  878
             CGLTDWSLA+ YGK+AI    +W    +        ++AGLA+CGVM+ IVST SDL QD
Sbjct  433   CGLTDWSLATTYGKLAIFTVGAWAAASDPDGSGSGGIIAGLAACGVMIGIVSTASDLTQD  492

Query  877   FKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyra  701
             FKTGY+TLASP +MF SQV GTAMGC + P VFW+FY A+  +G   S YP+P A VYR 
Sbjct  493   FKTGYMTLASPRSMFVSQVIGTAMGCVVAPSVFWLFYNAFRDIGMPGSEYPSPNALVYRN  552

Query  700   iALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPF  521
             +A+LGV G GSLP +CL+L I FF AAIAIN+  ++        R   +IP PM MAIPF
Sbjct  553   MAILGVQGLGSLPRHCLDLCIAFFAAAIAINLARDL-----AGARAAAYIPLPMAMAIPF  607

Query  520   YLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKA  341
             YLG YF IDMC+GSL+  VW   +  ++K F P VASGLICG+ +W +P ++LALAGVK 
Sbjct  608   YLGPYFGIDMCIGSLVRLVWDRLDPARSKAFAPPVASGLICGDGIWTVPQSVLALAGVKP  667

Query  340   PICMKFLSAAANAKLES  290
             PICMKFLS   NAK+++
Sbjct  668   PICMKFLSRTTNAKVDA  684



>ref|XP_008669135.1| PREDICTED: probable metal-nicotianamine transporter YSL11 [Zea 
mays]
Length=727

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/670 (56%), Positives = 490/670 (73%), Gaps = 11/670 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
              S E+ F    +PSW+ QLT+RA     +LS +FN I+ K++LTTG+ PSLNV A LL +
Sbjct  64    SSVEQAFADQPVPSWREQLTVRAFVVGALLSVVFNVILMKIDLTTGINPSLNVCASLLSY  123

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
              ++++WT  +   GLL+QPFTRQENT+IQTCVV++ GI F+ G +SY+ GMS  IA + E
Sbjct  124   FLLRTWTRAIGCMGLLRQPFTRQENTMIQTCVVSAYGITFTGGFSSYLFGMSAKIANKTE  183

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N P ++K   +GWM+ F+++VSF+GLF++VPLRK+MI+ YKLTYPSG ATAYLIN FH
Sbjct  184   V-NDPQDIKDPHLGWMMGFMFLVSFLGLFALVPLRKVMIVDYKLTYPSGAATAYLINGFH  242

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
              P G++ AK+QV  L K FS SFL+  FQWF+ A + CGF SFPT GL+AY  RF+FDFS
Sbjct  243   APEGSERAKKQVRTLGKYFSLSFLWAFFQWFYTAGNHCGFGSFPTLGLEAYKNRFFFDFS  302

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
              TY+GVGM+CP +VNVSLL+G I+SWGI+WP+I TK+G WYP  L  SSL G+ GY+VFL
Sbjct  303   PTYIGVGMICPYIVNVSLLLGGIMSWGIMWPLISTKKGSWYPETLPDSSLHGLHGYRVFL  362

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGA-QLEDFDGQ  1220
              I+++LGDGL+N   ++  T  +F+ R R+ K   A+ LPV ++        + E FD +
Sbjct  363   TISVILGDGLYNILKVLYSTIEAFVSRYRNRK---ANTLPVSNDGTPADATTETESFDDK  419

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RR   F KD IP  VA+GGY+ LAA+ I  +P I P LKWYHI VAY ++P LAFCNAYG
Sbjct  420   RRLELFTKDQIPKTVALGGYVVLAAITIGCLPLIIPQLKWYHILVAYIVSPALAFCNAYG  479

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLT+WS AS YGK+AI  F +W G  + GV+  LA+CGVMMSIV T +DLMQDFKTGYL
Sbjct  480   CGLTNWSFASAYGKLAIFSFGAWAGASHSGVIVALAACGVMMSIVGTAADLMQDFKTGYL  539

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVD  680
             TLASP +MF SQV GTAMGC + P VFW+FYK++ +G +N AYPAPY  +YR +A++GVD
Sbjct  540   TLASPRSMFISQVIGTAMGCVIAPCVFWLFYKSFDVGATNGAYPAPYTFMYRNMAIMGVD  599

Query  679   GFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFA  500
             G  SLP +CL L+  FF AA A+N+  +++ K     +V +FIP PM +AIPFY+G YF 
Sbjct  600   GL-SLPKHCLTLSYIFFAAAFAVNMVKDLVPK-----KVAKFIPIPMAVAIPFYVGAYFT  653

Query  499   IDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFL  320
             IDM +G  ILF+W  +NK +A  FGPAVASG +CG+ LW +P AIL+LA VK PICMKFL
Sbjct  654   IDMFLGCTILFIWEMRNKAEADSFGPAVASGCMCGDGLWALPEAILSLANVKPPICMKFL  713

Query  319   SAAANAKLES  290
             S + NA+++S
Sbjct  714   SRSVNARVDS  723



>gb|EMT17260.1| Putative metal-nicotianamine transporter YSL11 [Aegilops tauschii]
Length=645

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/648 (58%), Positives = 474/648 (73%), Gaps = 26/648 (4%)
 Frame = -2

Query  2179  KLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIA  2000
             KL LTTG+IPSLNV+A LLGF +++ WT+ + + G LKQPFTRQENTVIQTCVV++ GIA
Sbjct  2     KLGLTTGIIPSLNVSASLLGFFLVRLWTSAIERMGFLKQPFTRQENTVIQTCVVSAYGIA  61

Query  1999  FSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRK---  1829
             FS G  SY+  +S TIA QA   N   N+K   +GW++ FL++VSFVGLF++VP+RK   
Sbjct  62    FSGGFGSYLFALSETIAKQATEANDALNIKNPHLGWIIGFLFLVSFVGLFALVPMRKYIQ  121

Query  1828  ---------------MMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsf  1694
                             MI+ YKLTYPSGTATAYLIN FHTP GA+LAK+QV  L K FS 
Sbjct  122   NSFAKAVANWNTWLQTMIVDYKLTYPSGTATAYLINGFHTPQGAELAKKQVRTLGKYFSM  181

Query  1693  sflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVsllig  1514
             SF++  FQWF+ A + CGFSSFP+ GL+AY  RFYFDFS+TYVGVGM+CP +VNVSLLIG
Sbjct  182   SFVWAFFQWFYTAGNDCGFSSFPSLGLEAYKNRFYFDFSATYVGVGMICPYIVNVSLLIG  241

Query  1513  aiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTG  1334
              ++SWGI+WP+I +K+G WYP +L  SSL G+Q Y+VF+ IA++LGDGL+NF  +   T 
Sbjct  242   GVLSWGIMWPLISSKKGSWYPDSLPESSLHGLQAYRVFITIAVILGDGLYNFLKVFGKTV  301

Query  1333  LSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyia  1154
              +F +  + +K+     LPV +        + E FD +RRT  FLKD IP  VA+GGY+ 
Sbjct  302   KAFYEMYKEKKSKS---LPVSNNGAPVAAEEAESFDDKRRTELFLKDQIPKRVAIGGYVI  358

Query  1153  laavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSS  974
             +AA+    +P I P LKWYHI VAY  APILAFCNAYGCGLTDWSLAS YGK+ I +F +
Sbjct  359   IAAITTGCLPLIIPQLKWYHILVAYVFAPILAFCNAYGCGLTDWSLASTYGKLGIFVFGA  418

Query  973   WVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTL  794
             W G  +GGVL GLA+CGVMM+IV T +DLMQDFKTGYLTLASP +MF SQVAGTAMGC +
Sbjct  419   WAGASHGGVLVGLAACGVMMNIVGTAADLMQDFKTGYLTLASPRSMFISQVAGTAMGCVI  478

Query  793   TPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIA  614
              P VFW+FYK++ +G S+SAYPAPYA +YR +A+LGVDG   LP NCL L   FF AA A
Sbjct  479   APCVFWLFYKSFDIGVSDSAYPAPYAIMYRNMAILGVDGLSVLPKNCLMLCYIFFAAAFA  538

Query  613   INIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAK  434
             +N+  + +       +V +FIP PM +AIPFYLG YFA+DMC+GS ILF W W NK +A+
Sbjct  539   VNLLKDCVPA-----KVAKFIPIPMAVAIPFYLGPYFAMDMCIGSAILFCWEWMNKAEAQ  593

Query  433   DFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAANAKLES  290
              F PAVASGL+CG+ +W +P A L+LA V  PICMKFLS A NAK+++
Sbjct  594   AFAPAVASGLMCGDGIWALPQAFLSLANVNPPICMKFLSRATNAKVDA  641



>ref|XP_004978146.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Setaria italica]
Length=705

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/676 (58%), Positives = 495/676 (73%), Gaps = 16/676 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             +S E VFE   +PSW+ Q+T RA+  SL+L+ +F+ IV KL+LTTG+IPSLNV+AGLLGF
Sbjct  33    DSIEWVFESEPVPSWREQVTPRALAVSLLLAVVFSLIVMKLSLTTGIIPSLNVSAGLLGF  92

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               ++ WTA +   G  ++PFTRQENTV+QTCVVA+ GIAFS G  SY+ GMS TIAAQA 
Sbjct  93    FFLRVWTAPVKNPG--RRPFTRQENTVVQTCVVAAYGIAFSGGFGSYLFGMSETIAAQAA  150

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N  +NVK   + WM+ FL++VSFVGLF++VPLRK+MI+ YKLTYPSGTATA+LIN FH
Sbjct  151   EENNADNVKEPRLSWMIGFLFLVSFVGLFALVPLRKVMIVDYKLTYPSGTATAHLINGFH  210

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP+G++ A+ QV  L KC   SFL+G FQWF+ A +GCGF  FP  GL AY  RFYFDFS
Sbjct  211   TPDGSERAESQVRTLIKCSVASFLWGFFQWFYTAGEGCGFGQFPALGLTAYQNRFYFDFS  270

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TY+G GM+CP +VN+S+L+G I+SWG++WP+I  K G W+   LS SSL+G+QGY+VF+
Sbjct  271   TTYIGAGMICPHIVNISVLLGGILSWGVMWPLIAEKRGSWFGAELSDSSLEGMQGYRVFI  330

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPV--DDEFNKGKGAQLE---D  1232
             AIA++LGDGL+ F   MV+T         +EK      LPV  DD    G GA  E    
Sbjct  331   AIAIILGDGLYKF--AMVLTCTVAAIAASTEKRKFFGALPVNSDDRTISGSGAAPETPPS  388

Query  1231  FDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifp-pLKWYHIAVAYAMAPILAF  1055
             FD  RRT  FLKD IP  VA+GGY+A+AAV+IIAVP +    LKW+H+   Y MAP+LAF
Sbjct  389   FDDARRTEFFLKDQIPTPVAIGGYVAVAAVSIIAVPHLIFPQLKWHHVLAVYLMAPVLAF  448

Query  1054  CNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDF  875
             CNAYG GLTDWSLAS YGK+AI +F +W G  + GVL GLA+CG+MMSIVST +DLMQDF
Sbjct  449   CNAYGMGLTDWSLASTYGKLAIFVFGAWAGKPHSGVLVGLAACGIMMSIVSTAADLMQDF  508

Query  874   KTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyrai  698
             KTGY+TLASP +MF SQV GTAMGC + P VFW+FY+A+  +G   SAYPAPYA VYR +
Sbjct  509   KTGYMTLASPRSMFVSQVVGTAMGCVVGPSVFWLFYRAFDGVGTERSAYPAPYAIVYRNM  568

Query  697   ALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFY  518
             A+LGVDGF  LP +CL L   FFV AIA+N+  ++  +     +V R IP PM M IPFY
Sbjct  569   AILGVDGFSKLPKHCLTLCCVFFVGAIALNMAKDLAPR-----KVARLIPLPMAMGIPFY  623

Query  517   LGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAP  338
             +G YFAIDM +GS+ILF W W +K QA  FG AVASGLICG+ +W +P A+L+L  VK P
Sbjct  624   IGSYFAIDMFLGSVILFAWEWVDKAQADAFGYAVASGLICGDGVWTLPQAVLSLFNVKPP  683

Query  337   ICMKFLSAAANAKLES  290
             ICMKFLS   N K++ 
Sbjct  684   ICMKFLSRGVNYKVDD  699



>emb|CDX82356.1| BnaA03g34650D [Brassica napus]
Length=628

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/632 (60%), Positives = 476/632 (75%), Gaps = 14/632 (2%)
 Frame = -2

Query  2179  KLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIA  2000
             KLNLTTG+IPSLNV+AGLLGF  +K+WT +L K+G LKQPFTRQENTVIQTCVVASSGIA
Sbjct  2     KLNLTTGIIPSLNVSAGLLGFFFVKTWTKVLYKSGYLKQPFTRQENTVIQTCVVASSGIA  61

Query  1999  FSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMI  1820
             FS G  +Y+ GMS  IA Q  SG+     K  S+GW++ FL+VVSF+GLFS+VPLRK+M+
Sbjct  62    FSGGFGTYLFGMSERIAKQ--SGDASRGFKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMV  119

Query  1819  LKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCG  1640
             + +KLTYPSGTATA+LINSFHTP GAKLAK+QV  L K FS SFL+  FQWFF   D CG
Sbjct  120   IDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRMLGKFFSLSFLWSFFQWFFTGGDNCG  179

Query  1639  FSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGI  1460
             FS+FPTFGLKAY  +FYFDFS+TYVGVGM+CP ++N+S+L+G I+SWGI+WP+I TK+G 
Sbjct  180   FSNFPTFGLKAYQYKFYFDFSATYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKGD  239

Query  1459  WYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPAS  1286
             W+P ++ SSS+ G+Q YKVF+A+A++LGDGL+NF  ++   ++GL    R  S +     
Sbjct  240   WFPADVESSSMHGLQAYKVFIAVAIILGDGLYNFCKVLSRTLSGLFVQLRGTSSRAS---  296

Query  1285  LLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppL  1106
                V+++      +  + +D QRRT  FLKD IP   A+GGYI +AA +   +P +F  L
Sbjct  297   -FTVEEDPTASPYSPKQSYDDQRRTRFFLKDQIPTWFAMGGYIIIAATSTAILPHMFHQL  355

Query  1105  KWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASC  926
             +WY+I V Y  AP+LAFCNAYG GLTDWSLAS YGK+AI    +W G ++GG+LAGLA+C
Sbjct  356   RWYYILVIYICAPVLAFCNAYGAGLTDWSLASTYGKLAIFTIGAWAGSEHGGMLAGLAAC  415

Query  925   GVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLG  749
             GVMM+IVST SDL QDFKTGYLTL+SP +MF SQV GTAMGC ++P VFW+FY A+  LG
Sbjct  416   GVMMNIVSTASDLTQDFKTGYLTLSSPRSMFISQVIGTAMGCVVSPCVFWLFYNAFDDLG  475

Query  748   DSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKY  569
               NS YPAP+A VYR++A LGV+G  SLP  CL L   FF  AI +NI  + L       
Sbjct  476   LPNSEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFGVAILVNIVKDSLPS-----  530

Query  568   RVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGES  389
             R  RF+P PM MAIPF+LG YFAIDMCVGSL+LFVW   +  +A  FG AVASGLICG+ 
Sbjct  531   RWGRFVPLPMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAGAFGTAVASGLICGDG  590

Query  388   LWGIPAAILALAGVKAPICMKFLSAAANAKLE  293
             +W +P+++LA+AGV  P+CMKFL AA N+K++
Sbjct  591   IWSLPSSVLAIAGVSPPVCMKFLDAATNSKVD  622



>ref|XP_007153095.1| hypothetical protein PHAVU_003G006500g [Phaseolus vulgaris]
 gb|ESW25089.1| hypothetical protein PHAVU_003G006500g [Phaseolus vulgaris]
Length=565

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/564 (66%), Positives = 446/564 (79%), Gaps = 6/564 (1%)
 Frame = -2

Query  1981  SYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLT  1802
             SY+LGMSP I AQ   GN P N K LS+GWM AFL+VVSFVGLFSIVPLRK+MILKYKLT
Sbjct  3     SYLLGMSPYIGAQLNGGNTPINTKGLSLGWMFAFLFVVSFVGLFSIVPLRKLMILKYKLT  62

Query  1801  YPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPT  1622
             YPSGTATA L+NS HTP GAKLAK+QVA LFK FS SF+FG FQWFF A D CGFSSFPT
Sbjct  63    YPSGTATALLVNSLHTPKGAKLAKKQVAVLFKSFSGSFVFGFFQWFFTAGDDCGFSSFPT  122

Query  1621  FGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNL  1442
             FGLKAY++ FYFDFS TYVGVGM+CP ++N SLL+GA+ISWGI+WP I  K+GIWY  +L
Sbjct  123   FGLKAYSKMFYFDFSPTYVGVGMICPYVINASLLLGAVISWGILWPWIEHKKGIWYSADL  182

Query  1441  SSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEF  1262
              +SSL G+QGY++F AIAMMLGDGL++   M++    S + +   +K   ++     D+ 
Sbjct  183   PTSSLNGVQGYRIFTAIAMMLGDGLYHCIIMLLRVAYSLISQYIQKKESSSANHEDADQN  242

Query  1261  NKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVA  1082
                     +D D Q RT  F KD IP+ VA  GYI LA ++II V  IFP LKWYH+ + 
Sbjct  243   TS------DDLDSQLRTEYFSKDQIPSWVAFSGYIVLAVISIITVSHIFPQLKWYHVLIT  296

Query  1081  YAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVS  902
             Y +AP+LAFCNAYGCGLTDWSLASNYGK+AI+IFSSWVG +NGG++AGLASCGVMMSIVS
Sbjct  297   YLIAPVLAFCNAYGCGLTDWSLASNYGKVAIIIFSSWVGLENGGIIAGLASCGVMMSIVS  356

Query  901   TTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypap  722
             T SDLMQDFKTGYLTLASP +MF SQV GT  GC ++PL+FW F+KAY LGD   +YPAP
Sbjct  357   TASDLMQDFKTGYLTLASPRSMFASQVLGTFTGCLVSPLMFWFFHKAYTLGDPQGSYPAP  416

Query  721   yaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNP  542
             Y  VYR +ALLG  GF SLP +CL LAI FF +A+ INI  ++L  YET+Y+++RF+PNP
Sbjct  417   YGEVYRGMALLGAKGFSSLPQHCLQLAIIFFFSAMLINIVHDLLLHYETRYKLHRFVPNP  476

Query  541   MCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAIL  362
             M +AIPFYLGGYFAIDMC+GSLILF+W  +NKQ+A DFGP +ASGLICG+SLW +PAAIL
Sbjct  477   MALAIPFYLGGYFAIDMCIGSLILFLWEKRNKQKANDFGPVLASGLICGDSLWSVPAAIL  536

Query  361   ALAGVKAPICMKFLSAAANAKLES  290
             +LAGV  PICMKFLS+A N ++++
Sbjct  537   SLAGVNPPICMKFLSSAMNKRVDT  560



>gb|EAZ31384.1| hypothetical protein OsJ_15512 [Oryza sativa Japonica Group]
Length=724

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/669 (57%), Positives = 484/669 (72%), Gaps = 11/669 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ERVF    +PSW+       +   L+          +  LTTG+IPSLNV+AGLLGF 
Sbjct  59    SVERVFADRPVPSWRGAADGARVRGELLPGHHVQRHRDEAELTTGIIPSLNVSAGLLGFF  118

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              ++ WTA + + GLL+QPFTRQENTVIQTCVVA   IAFS G  +Y+L MS  IA     
Sbjct  119   FVRLWTAAIERVGLLRQPFTRQENTVIQTCVVAGYDIAFSGGFGNYILSMSERIAGLGTE  178

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   N+K   +GW++ FL++VSF+GLF +VPLRK+MI+ YKLTYPSGTATA+LIN FHT
Sbjct  179   ANNAQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKVMIIDYKLTYPSGTATAFLINGFHT  238

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P+GAK+A +QV  L   F  SF +G FQWF+ A D CGF  FP+ GL+A+  +F+FDFS 
Sbjct  239   PHGAKIAAKQVKKLGIFFILSFFWGFFQWFYTATDDCGFHKFPSLGLQAFQHKFFFDFSP  298

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K G W+  +L   SL G+QGY+VF+A
Sbjct  299   TYVGVGMICPHIVNVSVLLGGILSWGIMWPLIAKKRGDWFSADLPDGSLHGMQGYRVFIA  358

Query  1393  IAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRR  1214
             IA++LGDGL+NF  M+++T  S ++ +  +KN  AS LPV D+      A +  +D +RR
Sbjct  359   IALILGDGLYNFLKMIILTAFS-LRSQIKKKN--ASTLPVSDDGMVTTTAAVS-YDEERR  414

Query  1213  THNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCG  1034
                F+KD IP  VA GGY  +AA++I  VP I P LKWY I VAY +APILAFCNAYG G
Sbjct  415   NELFVKDQIPWYVAYGGYAVVAAISIGTVPQIIPQLKWYQILVAYIVAPILAFCNAYGTG  474

Query  1033  LTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTL  854
             LTDWSL + YGK+AI  F +W G  +GGVLAGLA+CGVMM+IVST +DLMQDFKTGYLTL
Sbjct  475   LTDWSLVTTYGKLAIFAFGAWTGASHGGVLAGLAACGVMMNIVSTAADLMQDFKTGYLTL  534

Query  853   ASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGVDG  677
             ASP +MF SQV GTAMGC + P VFW+FYKA+  +G S S YPAP AAV+R+IA+LGVDG
Sbjct  535   ASPRSMFVSQVIGTAMGCVIAPCVFWLFYKAFDNIGISGSDYPAPNAAVFRSIAILGVDG  594

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             F SLP NCLNL   FF AAI +N+  +++ K      V RFIP PM MAIPFY+G YFAI
Sbjct  595   FSSLPKNCLNLCYAFFAAAIVVNLIRDLVPK------VSRFIPIPMAMAIPFYIGSYFAI  648

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DM +G++ILFVW+  ++ +A  +GPAVASG+ICG+ +W +P ++LALA VK PICMKFLS
Sbjct  649   DMFIGTVILFVWQRVDRAKADTYGPAVASGMICGDGIWVLPQSVLALAKVKPPICMKFLS  708

Query  316   AAANAKLES  290
                N K+++
Sbjct  709   RRTNDKVDA  717



>gb|AFW58894.1| hypothetical protein ZEAMMB73_605066 [Zea mays]
Length=737

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/673 (56%), Positives = 475/673 (71%), Gaps = 14/673 (2%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             +S ERVFE   +P W  Q+T RA+ TSL L+ +F+ IV KL+LTTG+IPSLNV+AGLLGF
Sbjct  69    DSIERVFEAEPVPPWPQQVTPRALVTSLFLAVLFSVIVMKLSLTTGIIPSLNVSAGLLGF  128

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
              +++ WTA +      ++PFTRQENTV+QTCVV++ GIAFS G  SY+ GMS TIA+QA 
Sbjct  129   FLLRVWTAAVKDP---RRPFTRQENTVVQTCVVSAYGIAFSGGFGSYLFGMSETIASQAA  185

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N   NVK   + WM+ FL++VSFVGLF++VPLRK+MI+ Y+LTYPSGTATA+LIN FH
Sbjct  186   EENNAGNVKEPRLAWMIGFLFLVSFVGLFALVPLRKVMIIDYRLTYPSGTATAHLINGFH  245

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             TP+G++ AK QV  L K    SF +G FQWF+ A DGCGF  FP  GL AY  RFYFDFS
Sbjct  246   TPDGSERAKSQVLTLIKSSVASFFWGFFQWFYTAGDGCGFGQFPALGLAAYQNRFYFDFS  305

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVG GM+CP  VNVS+L+G I+SWG++WP+I  K G W+   L  SSL+G+QGY+VF+
Sbjct  306   TTYVGAGMICPHTVNVSVLLGGILSWGLLWPLIAQKRGSWFDAKLPDSSLEGMQGYRVFI  365

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKG--KGAQLEDFDG  1223
             AIA++LGDGL+ F  +++ T  S      +EK      LPV+ + + G    A    FD 
Sbjct  366   AIAIILGDGLYKFATVLLRTVASIAA--STEKRKFFGALPVNGDGSNGAAAPAPPPSFDD  423

Query  1222  QRRTHNFLKDSIP-NavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              RRT  F KD IP      G  +  A         IFP L+WYH+   Y MAP+LAFCNA
Sbjct  424   ARRTEFFTKDQIPVPVAIGGYVVIAAVSVAAVPRLIFPQLEWYHVLAVYLMAPVLAFCNA  483

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YG GLTDWSLAS YGK+AI  F +W G  + GVL GLA+CG+MM+IVST +DLMQD KTG
Sbjct  484   YGMGLTDWSLASTYGKLAIFAFGAWAGKPHSGVLVGLATCGIMMNIVSTAADLMQDLKTG  543

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALL  689
             Y+TLASP +MF SQV GTAMGC + P VFW+FY+A+P +G   SAYPAPYA +YR +A+L
Sbjct  544   YMTLASPRSMFVSQVVGTAMGCVVGPSVFWLFYRAFPGVGTHRSAYPAPYALIYRNMAIL  603

Query  688   GVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGG  509
             GVDGF  LP NCL L   FFV AIA+++  ++  +     +V +F+P PM MAIPFY+G 
Sbjct  604   GVDGFSKLPDNCLTLCCVFFVGAIAVDMARDMAPE-----KVAKFVPLPMAMAIPFYIGP  658

Query  508   YFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICM  329
             YFAIDM +GS++LF W W +K QA  F  AVASGLICG+ +W +P A+L+L  VK PICM
Sbjct  659   YFAIDMFLGSVVLFAWEWVDKDQANFFAYAVASGLICGDGVWSLPQALLSLFNVKPPICM  718

Query  328   KFLSAAANAKLES  290
             KFLS   N K++ 
Sbjct  719   KFLSRHMNDKVDD  731



>ref|XP_009402082.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=719

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/664 (56%), Positives = 482/664 (73%), Gaps = 13/664 (2%)
 Frame = -2

Query  2296  ESTERVFEKVE----IPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAG  2129
                E   EK E     P W+ QLT+RAM  S  LS +F+ IV KLNLTTG+IPSLN AAG
Sbjct  61    RREELTMEKEEGQQPPPPWREQLTVRAMVVSFALSVMFSVIVMKLNLTTGIIPSLNAAAG  120

Query  2128  LLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIA  1949
             LLGF ++K WT  L   GLL+ PFTRQEN VIQTCV+A+ G+ FS G  +Y+ GMS  IA
Sbjct  121   LLGFFLVKLWTKALEHVGLLRTPFTRQENAVIQTCVIAAYGLVFSGGFGNYLFGMSSKIA  180

Query  1948  AQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLI  1769
             +QA   N  +N+K  S+GWM+ +++++ F+GLFS+VPLRK++I+ YKL YPSGTA AYLI
Sbjct  181   SQAAEANDSDNIKDPSLGWMIGYMFIIGFLGLFSLVPLRKILIIDYKLIYPSGTAAAYLI  240

Query  1768  NSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFY  1589
             N FHTP G K AK+QV  L K    SFL+G FQWF+ A D CGF +FPTFGLKAY   F+
Sbjct  241   NGFHTPQGEKQAKKQVWTLGKSLICSFLWGFFQWFYTAGDACGFKAFPTFGLKAYENTFF  300

Query  1588  FDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGY  1409
             FDFS+TYVGVGM+CP +VN S L+GAI+SWGI+WP++  + G WYP ++ S+SL+ +QGY
Sbjct  301   FDFSATYVGVGMICPHIVNASFLLGAILSWGIMWPLVSNQRGDWYPADIPSTSLQSLQGY  360

Query  1408  KVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDF  1229
             KVF+A+AM+LGDGL+N   ++  T  SF     +    P S+LP+ D+ ++   +     
Sbjct  361   KVFIAVAMILGDGLYNLLKVLRRTTSSFFA---AVWRSPESVLPIVDDDDRPAESPPVSP  417

Query  1228  DGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCN  1049
             + QRR   FLK+ IP  +A GGY+ALA ++I+ +P +FPPLKWY+I VAY +AP+LAFCN
Sbjct  418   EDQRRAEVFLKEEIPGWIAYGGYVALAVLSIVTLPHVFPPLKWYYILVAYVVAPVLAFCN  477

Query  1048  AYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKT  869
             AYGCGLTDW++AS YGK+AI IF +W G  + GVLAGLASCGV+M  V T SDLMQDF+T
Sbjct  478   AYGCGLTDWNMASTYGKLAIFIFGAWAGASHSGVLAGLASCGVVMCTVCTASDLMQDFRT  537

Query  868   GYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiAL  692
             GYLT++SP ++F SQV G AMGC + P VFW+FY A+  +G   S YPAP+A +YR +A+
Sbjct  538   GYLTMSSPRSIFVSQVIGIAMGCVIAPCVFWLFYNAFTDIGVPGSQYPAPFALMYRNMAI  597

Query  691   LGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLG  512
             LGVDGF SLP +CL L   FF  AIAIN+  ++  K     +V R IP PM MAIPFY+G
Sbjct  598   LGVDGFSSLPKHCLALCYSFFALAIAINLAKDLSPK-----KVARLIPIPMAMAIPFYIG  652

Query  511   GYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPIC  332
                A+DMCVGS+IL+VW   +++ A   GPAVASGLICG+ +WG+P A+LALA V+ P+C
Sbjct  653   SSVAVDMCVGSVILYVWAKIDQEAADASGPAVASGLICGDGMWGLPQAVLALAQVRPPMC  712

Query  331   MKFL  320
             M+F+
Sbjct  713   MQFV  716



>gb|AFW59877.1| hypothetical protein ZEAMMB73_955581 [Zea mays]
Length=695

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/677 (57%), Positives = 496/677 (73%), Gaps = 19/677 (3%)
 Frame = -2

Query  2284  RVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIK  2105
             RVFE  E+P W+ Q+T RA+  S +L A+F+ IV KLNLTTG+IPSLNV+AGLLGF ++ 
Sbjct  22    RVFEGREVPGWREQVTARALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFLLT  81

Query  2104  SWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             SWT LL KAGL   +PFTRQENTV+QTCVVA SGIAFS G  SYM  MS  I+ Q+    
Sbjct  82    SWTKLLAKAGLTGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYMFAMSERISEQSGETW  141

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
               +N+K   +GWM+ FL++VSF+GLFS+VPLRK+MI+ YKL YPSGTATA+LINSFHTP 
Sbjct  142   DAHNIKNPGLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHTPQ  201

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+QV  L K F+ SF +G FQWF+ A +GCGF SFPT GL+AY Q+F+FDFS+TY
Sbjct  202   GAKLAKRQVKTLGKFFAGSFTWGFFQWFYTAGEGCGFMSFPTLGLEAYRQKFFFDFSATY  261

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP +VN S+L+G ++SWGI+WP+I  K+G WYP +L  SSL+GI GY+VF++IA
Sbjct  262   VGVGMICPYLVNASVLLGGVVSWGIMWPLIEQKKGDWYPADLKPSSLRGIVGYRVFVSIA  321

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQL----EDFDGQ  1220
             ++LGDGL+NF  +M  T  + + + R   + P   LP+     +G G  L    E FD +
Sbjct  322   LILGDGLYNFLKVMTRTVTALVVQVRRMMSEPT--LPISGGGGEGGGIPLPAPEETFDDR  379

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             RRT  FLKD IPN +A+G Y+ +A V+I+ VP IF  L+WYH+A +Y +AP+LAFCNAYG
Sbjct  380   RRTELFLKDQIPNTLALGAYLVIAVVSIVTVPHIFHQLRWYHVAASYVVAPVLAFCNAYG  439

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGG------VLAGLASCGVMMSIVSTTSDLMQD  878
             CGLTDWSLA+ YGK+AI    +W    +        ++AGLA+CGVM+ IVST SDL QD
Sbjct  440   CGLTDWSLATTYGKLAIFTVGAWAAATDDSGGGGGGIIAGLAACGVMIGIVSTASDLTQD  499

Query  877   FKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyra  701
             FKTGY+TLASP +MF SQV GTAMGC + P VFW+FY A+  +G   S YP+P A VYR 
Sbjct  500   FKTGYMTLASPRSMFVSQVIGTAMGCVVAPSVFWLFYNAFRDIGMPGSEYPSPNALVYRN  559

Query  700   iALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPF  521
             +A+LGV G GSLP +CL+L I FF AAIAIN+  ++        R   +IP PM MAIPF
Sbjct  560   MAILGVQGLGSLPRHCLDLCIAFFAAAIAINLARDL-----AGARAAAYIPLPMAMAIPF  614

Query  520   YLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKA  341
             YLG YF IDMC+GSL+  VW   +  +AK F P VASGLICG+ +W +P ++LALAGVK 
Sbjct  615   YLGPYFGIDMCIGSLVRLVWDRLDPARAKAFAPPVASGLICGDGIWTLPQSVLALAGVKP  674

Query  340   PICMKFLSAAANAKLES  290
             PICMKFLS + N K+++
Sbjct  675   PICMKFLSRSTNVKVDA  691



>ref|XP_010032362.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=688

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/671 (57%), Positives = 488/671 (73%), Gaps = 16/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S ER+FE   +PSW+ QL  RA   S  LS +  F+  KLNLTTG+ PSLNV+AGLLGF 
Sbjct  27    SVERIFEGQGVPSWRRQLKFRAFAVSFALSVMLAFM--KLNLTTGINPSLNVSAGLLGFF  84

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
              +K+WT +L K GLL+ PFT QENTVIQTCVVASSG  FS G  SY+  MS  +A Q+  
Sbjct  85    FVKTWTKVLEKFGLLRVPFTWQENTVIQTCVVASSGSTFSGGFGSYLFAMSERVANQSTD  144

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                    K  S+ WM+ FL+VVSF+GLF++VPLRK+MI+ +KL YPSGTATA+L NSFHT
Sbjct  145   PQSAYVYKNPSLPWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLMYPSGTATAHLRNSFHT  204

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GAKLAK+QV AL K FSFSFL+G FQWF+ A+D CGF+ FPT GLKA   RFYFDFS+
Sbjct  205   PEGAKLAKKQVKALGKFFSFSFLWGFFQWFYRAEDDCGFARFPTLGLKALQYRFYFDFSA  264

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             T+VGVGM+CP + N+S+L+G I+SWG++WP+I T++G WYP ++S++S++G+QGYKVF+A
Sbjct  265   THVGVGMICPYITNISVLLGGILSWGLMWPLIETRKGQWYPADVSNTSMRGLQGYKVFIA  324

Query  1393  IAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQ  1220
             IAM+LGDG++NFF  +   ++GL + + R  E    + +LP+ +            +D Q
Sbjct  325   IAMILGDGIYNFFKALGRTLSGL-YHQLRDGEM---SHVLPIAN--GSSPDNHQVSYDDQ  378

Query  1219  RRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYG  1040
             R+T  FLKD IP   AV GY+ +A ++I  +P++FP LK YHI V Y  A  L FCNAYG
Sbjct  379   RQTQLFLKDQIPTWFAVVGYVTIATISIATLPYMFPQLKRYHILVIYLFASTLGFCNAYG  438

Query  1039  CGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYL  860
             CGLTDWSLAS YGK+AI +  +W    +GG+LA LA+CGV+ ++VST SDL QDFKTGYL
Sbjct  439   CGLTDWSLASAYGKLAIFVIGAWANASHGGILANLAACGVITNLVSTASDLTQDFKTGYL  498

Query  859   TLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGDSNSaypapyaavyraiALLGV  683
             TLASP ++F SQV GTAMGC ++P VFW+FYKA+  L      Y  PY  VYR++A LGV
Sbjct  499   TLASPRSVFVSQVIGTAMGCVISPCVFWLFYKAFKDLELPGKEYVVPYGIVYRSMAELGV  558

Query  682   DGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYF  503
             +GF SLP +CL L  GF VAA+ IN F +++ K     +  RFIP PM MAIPFY+G  F
Sbjct  559   EGFTSLPKHCLTLCCGFLVAAMIINGFRDLVGK-----KWARFIPLPMAMAIPFYIGPSF  613

Query  502   AIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKF  323
             AIDMCVGSLILF+W   +K +A  FGPAVASGLICG+ LW +P++IL LAGV  PICMKF
Sbjct  614   AIDMCVGSLILFIWEKTDKAKADAFGPAVASGLICGDGLWTLPSSILTLAGVNPPICMKF  673

Query  322   LSAAANAKLES  290
             LS A N +L++
Sbjct  674   LSRATNKRLDA  684



>dbj|BAE91888.1| hypothetical protein [Oryza sativa Japonica Group]
Length=694

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/671 (55%), Positives = 491/671 (73%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             STE+ FE   +P+W  Q+T+R++  S VL    +FIV KLNLT+G++PSLNV+AGLL F 
Sbjct  21    STEKAFEGKALPAWSEQITVRSLVVSAVLGTFLSFIVMKLNLTSGIVPSLNVSAGLLAFF  80

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IA   + 
Sbjct  81    LMKTWTSALERCGVFPKPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSKKIAEGFDE  140

Query  1933  GNIPN--NVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                    NV+  S+G ++AFL++VSFVGLFSIVPLRK+MI+ YKLTYPSG+ATA+LINSF
Sbjct  141   AEAKTSINVEEPSLGRLIAFLFLVSFVGLFSIVPLRKIMIISYKLTYPSGSATAHLINSF  200

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA  AK QV+ LFK F  SFL+  FQWF+AA  GCGFSSFPTFG+ AY++RFYFDF
Sbjct  201   HTPQGAIQAKHQVSILFKSFVGSFLWSLFQWFYAAGPGCGFSSFPTFGMVAYSRRFYFDF  260

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++N SLL+G+++SWGI+WP I +K+G WY   L  SSL G+ GY+VF
Sbjct  261   SATYVGVGMICPYIINFSLLVGSVVSWGIMWPYIESKKGSWYDAGLPKSSLHGLNGYQVF  320

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGA--QLEDFD  1226
             ++IAM++GDGLFNFF +++ T      +RR    G AS  P +  F    G   Q+  FD
Sbjct  321   ISIAMIVGDGLFNFFSIVLRTAYDLYLKRR----GGASKQPQETPFAGATGTERQVLSFD  376

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              +RRT  FLKD IP  +A   Y+ LAA++++A+P IF  L+  H+  AY +AP+ AFCNA
Sbjct  377   DRRRTQVFLKDQIPTTIAAAAYVLLAAISVVAIPHIFRQLRPKHVVWAYVVAPLFAFCNA  436

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YG GLTDWSL+S+YGK+AI IF + +G  +GGV+AGLA+CG+MM IVST SDL+QDFKTG
Sbjct  437   YGTGLTDWSLSSSYGKLAIFIFGANIGAKDGGVVAGLAACGLMMGIVSTASDLVQDFKTG  496

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLG  686
             YLTL SP +MF SQV GT MGC ++P+VFW+FYKA  +G     +PAPYA +YR IALLG
Sbjct  497   YLTLTSPRSMFVSQVLGTGMGCIISPMVFWMFYKANNIGMEEG-FPAPYAKIYRGIALLG  555

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G+  LP  CL   + FF+ AIAI    EV +  +  + +  FIP+ + MA+PF+LG +
Sbjct  556   VNGWDQLPRYCLRFCLAFFLLAIAICALKEVAK--QRGWWIQDFIPSALGMAVPFFLGSF  613

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             F IDMCVGSL+LF+W   +  +A  F PAVASGLICG+ +W +P++IL+LA V  P+CM+
Sbjct  614   FTIDMCVGSLVLFLWSRSDPVRAHTFAPAVASGLICGDGIWSLPSSILSLANVNPPMCMR  673

Query  325   FLSAAANAKLE  293
               S A N K++
Sbjct  674   VFSTATNDKVQ  684



>ref|NP_001045678.1| Os02g0116400 [Oryza sativa Japonica Group]
 sp|Q0E4J6.1|YSL8_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL8; 
AltName: Full=Protein YELLOW STRIPE LIKE 8; Short=OsYSL8 [Oryza 
sativa Japonica Group]
 dbj|BAF07592.1| Os02g0116400 [Oryza sativa Japonica Group]
Length=694

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/671 (55%), Positives = 491/671 (73%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             STE+ FE   +P+W  Q+T+R++  S VL    +FIV KLNLT+G++PSLNV+AGLL F 
Sbjct  21    STEKAFEGKALPAWSEQITVRSLVVSAVLGTFLSFIVMKLNLTSGIVPSLNVSAGLLAFF  80

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IA   + 
Sbjct  81    LMKTWTSALERCGVFPKPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSKKIAEGFDE  140

Query  1933  GNIPN--NVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                    NV+  S+G ++AFL++VSFVGLFSIVPLRK+MI+ YKLTYPSG+ATA+LINSF
Sbjct  141   AEAKTSINVEEPSLGRLIAFLFLVSFVGLFSIVPLRKIMIISYKLTYPSGSATAHLINSF  200

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA  AK QV+ LFK F  SFL+  FQWF+AA  GCGFSSFPTFG+ AY++RFYFDF
Sbjct  201   HTPQGAIQAKHQVSILFKSFVGSFLWSLFQWFYAAGPGCGFSSFPTFGMVAYSRRFYFDF  260

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++N SLLIG+++SWGI+WP I +K+G WY   L  SSL G+ GY+VF
Sbjct  261   SATYVGVGMICPYIINFSLLIGSVVSWGIMWPYIESKKGSWYDAGLPKSSLHGLNGYQVF  320

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGA--QLEDFD  1226
             ++IAM++GDGLFNFF +++ T      +RR    G AS  P +  F    G   Q+  FD
Sbjct  321   ISIAMIVGDGLFNFFSIVLRTAYDLYLKRR----GGASKQPQETPFAGATGTERQVLSFD  376

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              +RRT  FLKD IP  +A   Y+ LAA++++A+P IF  L+  H+  AY +AP+ AFCNA
Sbjct  377   DRRRTQVFLKDQIPTTIAAAAYVLLAAISVVAIPHIFRQLRPKHVVWAYVVAPLFAFCNA  436

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YG GLTDWSL+S+YGK+AI IF + +G  +GGV+AGLA+CG+MM IVST SDL+QDFKTG
Sbjct  437   YGTGLTDWSLSSSYGKLAIFIFGANIGAKDGGVVAGLAACGLMMGIVSTASDLVQDFKTG  496

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLG  686
             YLTL SP +MF SQV GT MGC ++P+VFW+FYKA  +G     +PAPYA +YR IALLG
Sbjct  497   YLTLTSPRSMFVSQVLGTGMGCIISPMVFWMFYKANNIGMEEG-FPAPYAKIYRGIALLG  555

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G+  LP  CL   + FF+ AIAI    EV +  +  + +  FIP+ + MA+PF+LG +
Sbjct  556   VNGWDQLPRYCLRFCLAFFLLAIAICALKEVAK--QRGWWIQDFIPSALGMAVPFFLGSF  613

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             F IDMCVGSL+LF+W   +  +A  F PAVASGLICG+ +W +P++IL+LA V  P+CM+
Sbjct  614   FTIDMCVGSLVLFLWSRSDPVRAHTFAPAVASGLICGDGIWSLPSSILSLANVNPPMCMR  673

Query  325   FLSAAANAKLE  293
               S A N K++
Sbjct  674   VFSTATNDKVQ  684



>dbj|BAD07718.1| putative iron-phytosiderophore transporter protein yellow stripe 
1 [Oryza sativa Japonica Group]
 gb|EAZ21496.1| hypothetical protein OsJ_05119 [Oryza sativa Japonica Group]
Length=693

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/671 (55%), Positives = 491/671 (73%), Gaps = 11/671 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             STE+ FE   +P+W  Q+T+R++  S VL    +FIV KLNLT+G++PSLNV+AGLL F 
Sbjct  20    STEKAFEGKALPAWSEQITVRSLVVSAVLGTFLSFIVMKLNLTSGIVPSLNVSAGLLAFF  79

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IA   + 
Sbjct  80    LMKTWTSALERCGVFPKPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSKKIAEGFDE  139

Query  1933  GNIPN--NVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                    NV+  S+G ++AFL++VSFVGLFSIVPLRK+MI+ YKLTYPSG+ATA+LINSF
Sbjct  140   AEAKTSINVEEPSLGRLIAFLFLVSFVGLFSIVPLRKIMIISYKLTYPSGSATAHLINSF  199

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA  AK QV+ LFK F  SFL+  FQWF+AA  GCGFSSFPTFG+ AY++RFYFDF
Sbjct  200   HTPQGAIQAKHQVSILFKSFVGSFLWSLFQWFYAAGPGCGFSSFPTFGMVAYSRRFYFDF  259

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++N SLLIG+++SWGI+WP I +K+G WY   L  SSL G+ GY+VF
Sbjct  260   SATYVGVGMICPYIINFSLLIGSVVSWGIMWPYIESKKGSWYDAGLPKSSLHGLNGYQVF  319

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGA--QLEDFD  1226
             ++IAM++GDGLFNFF +++ T      +RR    G AS  P +  F    G   Q+  FD
Sbjct  320   ISIAMIVGDGLFNFFSIVLRTAYDLYLKRR----GGASKQPQETPFAGATGTERQVLSFD  375

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              +RRT  FLKD IP  +A   Y+ LAA++++A+P IF  L+  H+  AY +AP+ AFCNA
Sbjct  376   DRRRTQVFLKDQIPTTIAAAAYVLLAAISVVAIPHIFRQLRPKHVVWAYVVAPLFAFCNA  435

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YG GLTDWSL+S+YGK+AI IF + +G  +GGV+AGLA+CG+MM IVST SDL+QDFKTG
Sbjct  436   YGTGLTDWSLSSSYGKLAIFIFGANIGAKDGGVVAGLAACGLMMGIVSTASDLVQDFKTG  495

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLG  686
             YLTL SP +MF SQV GT MGC ++P+VFW+FYKA  +G     +PAPYA +YR IALLG
Sbjct  496   YLTLTSPRSMFVSQVLGTGMGCIISPMVFWMFYKANNIGMEEG-FPAPYAKIYRGIALLG  554

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G+  LP  CL   + FF+ AIAI    EV +  +  + +  FIP+ + MA+PF+LG +
Sbjct  555   VNGWDQLPRYCLRFCLAFFLLAIAICALKEVAK--QRGWWIQDFIPSALGMAVPFFLGSF  612

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             F IDMCVGSL+LF+W   +  +A  F PAVASGLICG+ +W +P++IL+LA V  P+CM+
Sbjct  613   FTIDMCVGSLVLFLWSRSDPVRAHTFAPAVASGLICGDGIWSLPSSILSLANVNPPMCMR  672

Query  325   FLSAAANAKLE  293
               S A N K++
Sbjct  673   VFSTATNDKVQ  683



>ref|XP_007153093.1| hypothetical protein PHAVU_003G006400g [Phaseolus vulgaris]
 gb|ESW25087.1| hypothetical protein PHAVU_003G006400g [Phaseolus vulgaris]
Length=550

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/547 (68%), Positives = 433/547 (79%), Gaps = 6/547 (1%)
 Frame = -2

Query  2287  ERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVI  2108
             E  F K  +P W  Q+T+R++ TS VLS +FNFIVCKLN TTG+IPSLNVAAGLLGFAVI
Sbjct  10    EEAFRKTRVPPWTKQITVRSVVTSFVLSLVFNFIVCKLNFTTGIIPSLNVAAGLLGFAVI  69

Query  2107  KSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             KS+T LL + G LKQPFTRQENTVIQT VVASSGIAFSSG  SY+LGMSP IAAQ + GN
Sbjct  70    KSYTTLLNRCGFLKQPFTRQENTVIQTFVVASSGIAFSSGMGSYLLGMSPYIAAQVDGGN  129

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPN  1748
              P N K+LS+GWM  FL+VVSFVGLFSIVPLRKMMILKYKLTYPSGTATA L+NS HTP 
Sbjct  130   TPINTKSLSLGWMFGFLFVVSFVGLFSIVPLRKMMILKYKLTYPSGTATALLLNSLHTPK  189

Query  1747  GAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTY  1568
             GAKLAK+QVA LFK F  SF FG FQWFF A DGCGFS+FPTFGL AY++RFYFDFSSTY
Sbjct  190   GAKLAKKQVALLFKSFCGSFAFGFFQWFFTAGDGCGFSTFPTFGLHAYSKRFYFDFSSTY  249

Query  1567  VGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIA  1388
             VGVGM+CP ++NVSLL+GAIISWGI+WP I  K+GIWY  ++ +SSL  IQGY++F AIA
Sbjct  250   VGVGMICPYLINVSLLLGAIISWGILWPWIEHKKGIWYSADIPASSLSSIQGYRIFTAIA  309

Query  1387  MMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTH  1208
             MMLGDGL++   M++    S +K+   +K+   SL    +  +        D D Q RT 
Sbjct  310   MMLGDGLYHCVIMLIRVAYSLIKQYLEKKD---SLYLNPENVDTSPSG---DLDTQLRTE  363

Query  1207  NFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLT  1028
              FLKD IP+ VA  GYI LA ++II V  IFP LKWYH+ + Y +AP+LAFCNAYGCGLT
Sbjct  364   YFLKDQIPSWVAFSGYIVLAVISIITVSHIFPQLKWYHVLITYLIAPVLAFCNAYGCGLT  423

Query  1027  DWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLAS  848
             DWSLASNYGK+AI+IFSSWVG +NGG++AGLASCGVMMSIVST SDLMQDFKTGYLTLAS
Sbjct  424   DWSLASNYGKVAIIIFSSWVGLENGGIIAGLASCGVMMSIVSTASDLMQDFKTGYLTLAS  483

Query  847   PLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDGFGS  668
             P +MF SQV GTA GC ++PL+FW F+KAY LGD   +YPAPY  VYR +ALLG  GF S
Sbjct  484   PRSMFVSQVLGTATGCLVSPLMFWFFHKAYTLGDPKGSYPAPYGEVYRGMALLGAKGFSS  543

Query  667   LPTNCLN  647
             LP +CL+
Sbjct  544   LPKHCLH  550



>ref|XP_002446812.1| hypothetical protein SORBIDRAFT_06g023040 [Sorghum bicolor]
 gb|EES11140.1| hypothetical protein SORBIDRAFT_06g023040 [Sorghum bicolor]
Length=753

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/698 (54%), Positives = 480/698 (69%), Gaps = 40/698 (6%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
             +S ERVFE   +P W+ Q+T+RA+ TSL L+ +F+ IV KL+LTTG+IPSLNV+AGLLGF
Sbjct  59    DSIERVFESEPVPPWREQVTVRALVTSLFLAVLFSVIVMKLSLTTGIIPSLNVSAGLLGF  118

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
              +++ WTA +      K+PFTRQENTV+QTCVVA+ GIAFS G  SY+ GMS TIA+QA 
Sbjct  119   FLLRVWTAAVKDP---KRPFTRQENTVVQTCVVAAYGIAFSGGFGSYLFGMSETIASQAA  175

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
               N  +NVK   + WM+ FL++VSFVGLF++VPLRK+MI+ Y+LTYPSGTATA+LIN FH
Sbjct  176   EENNADNVKEPRLAWMIGFLFLVSFVGLFALVPLRKVMIIDYRLTYPSGTATAHLINGFH  235

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQ-------  1598
             TP+G++ AK QV AL KC   SFL+G FQWF+ A D CGF  FP  GL AY         
Sbjct  236   TPDGSERAKSQVRALAKCSVASFLWGFFQWFYTAGDDCGFGHFPALGLVAYQNSSYNASA  295

Query  1597  ------------------RFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHT  1472
                               RFYFDFS+TY+G GM+CP +VNVS+L+G I+SWG++WP+I  
Sbjct  296   ARHMETIQCLCFWGVDNARFYFDFSTTYIGAGMICPHIVNVSVLLGGILSWGVLWPLIAK  355

Query  1471  KEGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGP  1292
             K G W+   L  +SL+G+QGY+VF+AIA++LGDGL+ F  ++  T  S       +K   
Sbjct  356   KRGSWFDAELPDTSLEGMQGYRVFIAIAIILGDGLYKFAMVLFRTVASIAASIEKKKFFG  415

Query  1291  ASLLPVDDEFNKGKG---AQLEDFDGQRRTHNFLKDSIP-Navavggyialaavaiiavp  1124
             A  LPV+ + +KG     A    FD  RRT  F KD IP      G  +  A        
Sbjct  416   A--LPVNSDDSKGPNPATATPPSFDDARRTDFFTKDQIPMRVAIGGYVVIAAVSVATVPR  473

Query  1123  fifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVL  944
              IFP ++WYH+   Y MAP+LAFCNAYG GLTDWSLAS YGK+AI  F +W G  + GVL
Sbjct  474   LIFPQVEWYHVLAVYLMAPVLAFCNAYGMGLTDWSLASTYGKLAIFTFGAWAGKSHSGVL  533

Query  943   AGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYK  764
              GLA+CG+MM+IVST +DLMQDFKTGY+TLASP +MF SQV GTA+GC + P VFW+FY+
Sbjct  534   VGLATCGIMMNIVSTAADLMQDFKTGYMTLASPRSMFISQVVGTAIGCVVGPSVFWLFYR  593

Query  763   AYP-LGDSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLR  587
             A+  +G   SAYPAPYA +YR +A+LGVDGF  LP NCL L   FFV AIA+N+  +++ 
Sbjct  594   AFAGVGTHKSAYPAPYALIYRNMAILGVDGFSKLPGNCLTLCCVFFVGAIAVNMAKDMVP  653

Query  586   KYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASG  407
             +     +V +FIP PM MAIPFY+G YF IDM +GS+ILF W W +K QA  F  AVASG
Sbjct  654   E-----KVAKFIPLPMAMAIPFYIGPYFTIDMFLGSVILFAWEWVDKDQANAFAYAVASG  708

Query  406   LICGESLWGIPAAILALAGVKAPICMKFLSAAANAKLE  293
             LICG+ +W +P A L+L  VK PICMKFLS   N K++
Sbjct  709   LICGDGVWSLPQAFLSLFNVKPPICMKFLSRNLNDKVD  746



>ref|XP_008680017.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Zea 
mays]
 gb|AFW66782.1| hypothetical protein ZEAMMB73_792166 [Zea mays]
Length=684

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/669 (54%), Positives = 490/669 (73%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             STE+ FE   +P+W  Q+T+R++  S  L    +FIV KLNLT+G++PSLN++AGLL F 
Sbjct  13    STEKAFEGERLPAWSEQITVRSVVVSTALGLFLSFIVMKLNLTSGIVPSLNMSAGLLAFF  72

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IA   + 
Sbjct  73    LMKTWTSALERCGVFPKPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSKKIAEGFDE  132

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  NV+  S+G ++AFL++VSFVGLFSIVPLRK+MI+ YKLTYPSG+ATA+LINSFHT
Sbjct  133   AKTSINVEEPSLGRIIAFLFLVSFVGLFSIVPLRKIMIISYKLTYPSGSATAHLINSFHT  192

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA  AKQQV+ LFK F  SFL+  FQWF++A  GCGFSSFPTFG++AY +RF+FDFS+
Sbjct  193   PQGAIQAKQQVSILFKSFVGSFLWSLFQWFYSAGPGCGFSSFPTFGMEAYRRRFFFDFSA  252

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N SLL+G+++SWG++WP I +K G+WY   L  SSL G+ GY++F++
Sbjct  253   TYVGVGMICPYIINFSLLLGSVVSWGLMWPYIESKRGLWYDAELPRSSLHGLNGYQIFIS  312

Query  1393  IAMMLGDGLFNFFYMMVVTGLS-FMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             IAM++GDGLFNF  ++V T    ++KR R  +        VD         Q   FD +R
Sbjct  313   IAMIIGDGLFNFLSILVRTSYDMYLKRTRPAEAAAKPFAGVDV-----TERQALSFDDRR  367

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP ++A G Y+ LAA++++A+P IF  L+  H+  AY +AP+ AFCNAYG 
Sbjct  368   RTQVFLKDQIPTSIAAGAYVLLAAISVVAIPHIFRQLQPRHVVWAYVVAPVFAFCNAYGT  427

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSL+S+YGK+AI IF + VG  +GGV+AGLA+CG+MM IVST SDL+QDFKTGYLT
Sbjct  428   GLTDWSLSSSYGKLAIFIFGANVGAADGGVVAGLAACGLMMGIVSTASDLIQDFKTGYLT  487

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L SP +MF SQV GT +GC ++P+VFWIFYKAY +G     YPAPYA +YR IALLGV+G
Sbjct  488   LTSPRSMFVSQVMGTGLGCVISPVVFWIFYKAYDIGMEEG-YPAPYAKIYRGIALLGVNG  546

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             +  LP  CL   + FF+ A+AI    EV +    ++ V  +IP+ + MA+PF+LG +F I
Sbjct  547   WNQLPKYCLRFCLAFFLLAVAICALKEVAKA--RRWWVQDYIPSALGMAVPFFLGSFFTI  604

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGS++L++W   ++ +A  F PAVASGLICG+ +W +P++IL+L  V  P+C++  S
Sbjct  605   DMCVGSIVLYLWSKSDRVRAHMFAPAVASGLICGDGIWSLPSSILSLINVNPPMCLRVFS  664

Query  316   AAANAKLES  290
             A  N ++E 
Sbjct  665   ADTNYQVEE  673



>gb|EMS54492.1| putative metal-nicotianamine transporter YSL14 [Triticum urartu]
Length=592

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/596 (61%), Positives = 450/596 (76%), Gaps = 11/596 (2%)
 Frame = -2

Query  2077  GLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSI  1898
             GL+  PFTRQENTVIQTCVV++ GIAFS G  SY+ GMS TIA QA   N P N+K   +
Sbjct  2     GLVGHPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIAKQATEANDPWNIKEPHL  61

Query  1897  GWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVa  1718
             GWM+ FL++VSF+G+F++VP+RK+MI+ YKLTYPSGTATAYLIN FHTP GAKLAK+QV 
Sbjct  62    GWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHTPEGAKLAKKQVK  121

Query  1717  alfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIM  1538
              L + F  SF +G FQWFF+  D CGF +FPT GL+AY  RFYFDFS TY+GVGM+CP +
Sbjct  122   ILGRYFMVSFFWGFFQWFFSGGDDCGFKNFPTLGLEAYKNRFYFDFSPTYIGVGMICPHI  181

Query  1537  VNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNF  1358
             VNVS+++G IISWGI+WP+I  K+G WYP +L  SSL G+Q Y+VF++IA++LGDGL+NF
Sbjct  182   VNVSVMLGGIISWGIMWPLIGKKKGSWYPASLPESSLHGLQAYRVFISIALILGDGLYNF  241

Query  1357  FYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNa  1178
               +++ T   F+      KN  A +LPV D  N    A+   FD +RRT  FLKD IP A
Sbjct  242   VKVLIRTIAGFISM--VHKNSKA-MLPVSD--NGSPTAEAMSFDDERRTELFLKDQIPMA  296

Query  1177  vavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGK  998
             VA GGY  +A+++I  +P IFP LKWY+I VAY +AP+LAFCNAYG GLTDWSLAS YGK
Sbjct  297   VAYGGYAVVASISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSGLTDWSLASTYGK  356

Query  997   IAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVA  818
             +AI +F +W G  NGGVL GLA+CGVMMSIVST SDLMQDFKTGYLTLASP +MF SQV 
Sbjct  357   LAIFVFGAWAGLANGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTLASPKSMFISQVI  416

Query  817   GTAMGCTLTPLVFWIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGSLPTNCLNLA  641
             GT+MGC ++P VFW+FYKA+  +G S S YPAPYA VYR +A+LGVDGF +LP NCL L 
Sbjct  417   GTSMGCVISPCVFWLFYKAFSDIGISGSEYPAPYAIVYRNMAILGVDGFNTLPENCLTLC  476

Query  640   IGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVW  461
               FF AAI IN+  ++     T ++  RFIP PM MAIPFY+G YFAIDM +GS ILFVW
Sbjct  477   YIFFAAAIVINLIRDL-----TPHKFSRFIPLPMAMAIPFYIGSYFAIDMFLGSFILFVW  531

Query  460   RWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAANAKLE  293
                NK +A  +GPAVASGLICG+ +W +P +ILALA V  PICMKFL+   N K++
Sbjct  532   EKMNKAKADAYGPAVASGLICGDGIWTLPQSILALAKVNPPICMKFLTRGDNVKVD  587



>ref|XP_008663726.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL10 [Zea mays]
Length=722

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/704 (55%), Positives = 490/704 (70%), Gaps = 46/704 (7%)
 Frame = -2

Query  2284  RVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFAVIK  2105
             RVFE  E+P W+ Q+T RA+  S +L A+F+ IV KLNLTTG+IPSLNV+AGLLGF ++ 
Sbjct  22    RVFEGREVPGWREQVTARALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFLLT  81

Query  2104  SWTALLLKAGLLK-QPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAESGN  1928
             SWT LL KAGL   +PFTRQENTV+QTCVVA SGIAFS G  SYM  MS  I+ Q+    
Sbjct  82    SWTKLLAKAGLTGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYMFAMSERISEQSGETW  141

Query  1927  IPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRK---------------------------  1829
               +N+K   +GWM+ FL++VSF+GLFS+VPLRK                           
Sbjct  142   DAHNIKNPGLGWMIGFLFIVSFLGLFSVVPLRKVRTHAHPNSVSDVYSSHHDMMPAGCVQ  201

Query  1828  MMILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADD  1649
             +MI+ YKL YPSGTATA+LINSFHTP GAKLAK+QV  L K F+ SF +G FQWF+ A +
Sbjct  202   IMIIDYKLIYPSGTATAHLINSFHTPQGAKLAKRQVKTLGKFFAGSFTWGFFQWFYTAGE  261

Query  1648  GCGFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTK  1469
             GCGF SFPT GL+AY Q+F+FDFS+TYVGVGM+CP +VN S+L+G ++SWGI+WP+I  K
Sbjct  262   GCGFMSFPTLGLEAYRQKFFFDFSATYVGVGMICPYLVNASVLLGGVVSWGIMWPLIEQK  321

Query  1468  EGIWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPA  1289
             +G WYP +L  SSL+GI GY+VF++IA++LGDGL+NF  +M  T  + + + R   + P 
Sbjct  322   KGDWYPADLKPSSLRGIVGYRVFVSIALILGDGLYNFLKVMTRTVTALVVQVRRMMSEPT  381

Query  1288  SLLPVDDEFNKGKGAQL----EDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpf  1121
               LP+     +G G  L    E FD +RRT  FLKD IPN +A+G Y+ +A V+I+ VP 
Sbjct  382   --LPISGGGGEGGGIPLPAPEETFDDRRRTELFLKDQIPNTLALGAYLVIAVVSIVTVPH  439

Query  1120  ifppLKWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLA  941
             IF  L+WYH+A +Y +AP+LAFCNAYGCGLTDWSLA+ YGK+AI    +W    +     
Sbjct  440   IFHQLRWYHVAASYVVAPVLAFCNAYGCGLTDWSLATTYGKLAIFTVGAWAAATDDSGGG  499

Query  940   GLAS------CGVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVF  779
             G         CGVM+ IVST SDL QDFKTGY+TLASP +MF SQV GTAMGC + P VF
Sbjct  500   GGGIIAGLAACGVMIGIVSTASDLTQDFKTGYMTLASPRSMFVSQVIGTAMGCVVAPSVF  559

Query  778   WIFYKAY-PLGDSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIF  602
             W+FY A+  +G   S YP+P A VYR +A+LGV G GSLP +CL+L I FF AAIAIN+ 
Sbjct  560   WLFYNAFRDIGMPGSEYPSPNALVYRNMAILGVQGLGSLPRHCLDLCIAFFAAAIAINLA  619

Query  601   SEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGP  422
              ++        R   +IP PM MAIPFYLG YF IDMC+GSL+  VW   +  +AK F P
Sbjct  620   RDL-----AGARAAAYIPLPMAMAIPFYLGPYFGIDMCIGSLVRLVWDRLDPARAKAFAP  674

Query  421   AVASGLICGESLWGIPAAILALAGVKAPICMKFLSAAANAKLES  290
              VASGLICG+ +W +P ++LALAGVK PICMKFLS + N K+++
Sbjct  675   PVASGLICGDGIWTLPQSVLALAGVKPPICMKFLSRSTNVKVDA  718



>gb|EAY84201.1| hypothetical protein OsI_05581 [Oryza sativa Indica Group]
Length=692

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/662 (55%), Positives = 483/662 (73%), Gaps = 11/662 (2%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             STE+ FE   +P+W  Q+T+R++  S VL    +FIV KLNLT+G++PSLNV+AGLL F 
Sbjct  20    STEKAFEGKALPAWSEQITVRSLVVSAVLGMFLSFIVMKLNLTSGIVPSLNVSAGLLAFF  79

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IA   + 
Sbjct  80    LMKTWTSALERCGVFPKPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSKKIAEGFDE  139

Query  1933  GNIPN--NVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSF  1760
                    NV+  S+G ++AFL++VSFVGLFSIVPLRK+MI+ YKLTYPSG+ATA+LINSF
Sbjct  140   AEAKTSINVEEPSLGRLIAFLFLVSFVGLFSIVPLRKIMIISYKLTYPSGSATAHLINSF  199

Query  1759  HTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDF  1580
             HTP GA  AK QV+ LFK F  SFL+  FQWF+AA  GCGFSSFPTFG+ AY++RFYFDF
Sbjct  200   HTPQGAIQAKHQVSILFKSFVGSFLWSLFQWFYAAGPGCGFSSFPTFGMVAYSRRFYFDF  259

Query  1579  SSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVF  1400
             S+TYVGVGM+CP ++N SLL+G+++SWGI+WP I +K+G WY   L  SSL G+ GY+VF
Sbjct  260   SATYVGVGMICPYIINFSLLVGSVVSWGIMWPYIESKKGSWYDAGLPKSSLHGLNGYQVF  319

Query  1399  LAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGA--QLEDFD  1226
             ++IAM++GDGLFNFF +++ T      +RR    G AS  P +  F    G   Q+  FD
Sbjct  320   ISIAMIVGDGLFNFFSIVLRTAYDLYLKRR----GGASKQPQETPFAGATGTERQVLSFD  375

Query  1225  GQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNA  1046
              +RRT  FLKD IP  +A   Y+ LAA++++A+P IF  L+  H+  AY +AP+ AFCNA
Sbjct  376   DRRRTQVFLKDQIPTTIAAAAYVLLAAISVVAIPHIFRQLRPKHVVWAYVVAPLFAFCNA  435

Query  1045  YGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTG  866
             YG GLTDWSL+S+YGK+AI IF + +G  +GGV+AGLA+CG+MM IVST SDL+QDFKTG
Sbjct  436   YGTGLTDWSLSSSYGKLAIFIFGANIGAKDGGVVAGLAACGLMMGIVSTASDLVQDFKTG  495

Query  865   YLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLG  686
             YLTL SP +MF SQV GT MGC ++P+VFW+FYKA  +G     +PAPYA +YR IALLG
Sbjct  496   YLTLTSPRSMFVSQVLGTGMGCIISPMVFWMFYKANNIGMEEG-FPAPYAKIYRGIALLG  554

Query  685   VDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGY  506
             V+G+  LP  CL   + FF+ AIAI    EV +  +  + +  FIP+ + MA+PF+LG +
Sbjct  555   VNGWDQLPRYCLRFCLAFFLLAIAICALKEVAK--QRGWWIQDFIPSALGMAVPFFLGSF  612

Query  505   FAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMK  326
             F IDMCVGSL+LF+W   +  +A  F PAVASGLICG+ +W +P++IL+LA V  P   +
Sbjct  613   FTIDMCVGSLVLFLWSRSDPVRAHTFAPAVASGLICGDGIWSLPSSILSLANVTRPCAWR  672

Query  325   FL  320
              L
Sbjct  673   LL  674



>ref|XP_004954766.1| PREDICTED: probable metal-nicotianamine transporter YSL8-like 
[Setaria italica]
Length=686

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/669 (54%), Positives = 492/669 (74%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             STE+ FE+ ++P+W  Q+T+R++  S  L    +FIV KLNLT+G++PSLN++AGLL F 
Sbjct  15    STEKAFEREKLPAWSEQITVRSVVVSTALGLFLSFIVMKLNLTSGIVPSLNMSAGLLAFF  74

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IA   + 
Sbjct  75    LMKTWTSALERCGIFPKPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSKKIAEGFDE  134

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  NV+  S+G ++AFL++VSFVGLFSIVPLRK+MI+ YKLTYPSG+ATA+LINSFHT
Sbjct  135   AKTSINVEEPSLGRIIAFLFLVSFVGLFSIVPLRKIMIISYKLTYPSGSATAHLINSFHT  194

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA  AKQQV+ LFK F+ SFL+  FQWF++A  GCGFSSFPTFG++AY +RF+FDFS+
Sbjct  195   PQGAIQAKQQVSILFKSFAGSFLWSLFQWFYSAGPGCGFSSFPTFGMEAYRRRFFFDFSA  254

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N SLL+G+++SWG++WP I +K G+WY   L  SSL G+ GY++F++
Sbjct  255   TYVGVGMICPYIINFSLLLGSVVSWGLMWPYIESKRGLWYDAELPRSSLHGLNGYQIFIS  314

Query  1393  IAMMLGDGLFNFFYMMVVTGLS-FMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             IAM++GDGLFNF  ++V T    ++KR +  +        VD         Q   FD +R
Sbjct  315   IAMIIGDGLFNFLSILVRTSYDMYLKRTKPAEAAAKPFAGVDISER-----QALSFDDRR  369

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP ++A G YI LAA++++A+P IF  LK  H+  AY +AP+ AFCNAYG 
Sbjct  370   RTQVFLKDQIPTSIAAGAYILLAAISVVAIPHIFRQLKPKHVVWAYVVAPVFAFCNAYGT  429

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSL+S+YGK+AI IF + +G  +GGV+AGLA+CG+MM IVST SDL+QDFKTGYLT
Sbjct  430   GLTDWSLSSSYGKLAIFIFGASIGSQDGGVVAGLAACGLMMGIVSTASDLIQDFKTGYLT  489

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L SP +MF SQV GT +GC ++P+VFWIFYKAY +G     YPAPYA +YR IALLGV+G
Sbjct  490   LTSPRSMFVSQVMGTGLGCIISPVVFWIFYKAYDVGLEEG-YPAPYAKIYRGIALLGVNG  548

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             +  LP  CL   + FF+ A+AI    EV +     + V  +IP+ + MA+PF+LG +F I
Sbjct  549   WNQLPKYCLRFCLAFFLLAVAICALKEVAKA--RGWWVQDYIPSALGMAVPFFLGSFFTI  606

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGS++L++W   ++ +A  F PAVASGLICG+ +W +P++IL+L  +  P+C++  S
Sbjct  607   DMCVGSIVLYLWSKSDRVRAHTFAPAVASGLICGDGIWSLPSSILSLLNINPPMCLRVFS  666

Query  316   AAANAKLES  290
             A  N ++E 
Sbjct  667   ADTNYQVEE  675



>ref|XP_003573299.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Brachypodium 
distachyon]
Length=708

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/669 (54%), Positives = 483/669 (72%), Gaps = 5/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE   +P W  Q+T+R+M  S  L    +FIV KLNLT+G++PSLNV+AGLL F 
Sbjct  32    SMEKAFESKALPPWNEQITLRSMVVSAFLGLFLSFIVMKLNLTSGIVPSLNVSAGLLAFF  91

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IA   + 
Sbjct  92    LMKTWTSALERCGVFPRPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSRKIAEGFDE  151

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  NV+  S+G ++A+L++VSFVGLFSIVPLRK+MI+ Y+LTYPSG+ATA+LINSFHT
Sbjct  152   ARTSVNVEEPSLGRLIAYLFLVSFVGLFSIVPLRKIMIISYRLTYPSGSATAHLINSFHT  211

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA  AKQQV+ LFK F  SF++  FQWF+ A +GCGF SFPTFG++AY +RFYFDFS+
Sbjct  212   PQGAIQAKQQVSILFKSFVGSFMWSLFQWFYTAGNGCGFGSFPTFGMEAYQRRFYFDFSA  271

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N SLLIG+IISWGI+WP I +K+G+WY   L  SSL G+ GY+VF++
Sbjct  272   TYVGVGMICPYIINFSLLIGSIISWGIMWPYIESKKGLWYDEKLPKSSLHGLNGYQVFIS  331

Query  1393  IAMMLGDGLFNFFYMMVVTGLS-FMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             IAM++GDGLFNFF +++ T    ++KR    K  P          N  +  Q   FD +R
Sbjct  332   IAMIVGDGLFNFFSILLRTSYDMYLKRTGRSKASPMPFAGAGVAINATE-RQALSFDDRR  390

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLK+ IP +VA G Y+ LA ++++A+P IF  LK  H+  AY  API AFCNAYG 
Sbjct  391   RTQIFLKEQIPTSVAAGAYMLLAGISVVAMPHIFRQLKPKHVVWAYVAAPIFAFCNAYGT  450

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSL+S+YGK+AI IF + +G  +GGV+AGLA+CG+MM IVST SDL+QDFKTGYLT
Sbjct  451   GLTDWSLSSSYGKLAIFIFGANIGAKDGGVIAGLAACGLMMGIVSTASDLIQDFKTGYLT  510

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L SP AMF SQV GT +GC ++P+VFWIFY+AY +G  +  YPAPYA +YR IALLGV+G
Sbjct  511   LTSPRAMFVSQVVGTGLGCLISPIVFWIFYQAYDIG-LDEGYPAPYAKIYRGIALLGVNG  569

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             +  LP  CL     FF+ A+AI    E        + +  +IP+ + MA+PF+LG +F I
Sbjct  570   WNQLPKYCLRFCAAFFLLAVAICALKETAS--NKGWWIRDYIPSALGMAVPFFLGSFFTI  627

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGS+IL++W+  +   A+ F PAVASGLICG+ +W +P+++L+L  V  P+CM+   
Sbjct  628   DMCVGSVILWMWQRSDAVHAQMFAPAVASGLICGDGIWSLPSSVLSLGNVNPPMCMRVFD  687

Query  316   AAANAKLES  290
             A  + K++ 
Sbjct  688   ADTSFKVDQ  696



>ref|XP_002453180.1| hypothetical protein SORBIDRAFT_04g001180 [Sorghum bicolor]
 gb|EES06156.1| hypothetical protein SORBIDRAFT_04g001180 [Sorghum bicolor]
Length=684

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/669 (54%), Positives = 490/669 (73%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             STE+ FE   +P+W  Q+T+R+M  S  L    +FIV KLNLT+G++PSLN++AGLL F 
Sbjct  13    STEKAFEGERLPAWSEQITVRSMVVSSGLGLFLSFIVMKLNLTSGIVPSLNMSAGLLAFF  72

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IA   + 
Sbjct  73    LMKTWTSALERCGVFPKPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSKKIAEGFDE  132

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  NV+  S+G ++AFL++VSFVGLFSIVPLRK+MI+ YKLTYPSG+ATA+LINSFHT
Sbjct  133   AKTSINVEEPSLGRIIAFLFLVSFVGLFSIVPLRKIMIISYKLTYPSGSATAHLINSFHT  192

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA  AKQQV+ LFK F+ SFL+  FQWF++A  GCGFSSFPTFG+ AY +RF+FDFS+
Sbjct  193   PQGAIQAKQQVSILFKSFAGSFLWSLFQWFYSAGPGCGFSSFPTFGMDAYRRRFFFDFSA  252

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N SLL+G+++SWG++WP I +K G+WY   L  SSL G+ GY++F++
Sbjct  253   TYVGVGMICPYIINFSLLLGSVVSWGLMWPYIESKRGLWYDAELPRSSLHGLNGYQIFIS  312

Query  1393  IAMMLGDGLFNFFYMMVVTGLS-FMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             IAM++GDGLFNF  ++V T    ++KR R  +        VD         Q   FD +R
Sbjct  313   IAMIIGDGLFNFLSILVRTSYDMYLKRTRPAEAAAKPFAGVDVTER-----QALSFDDRR  367

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP ++A G Y+ LAA++++A+P IF  L+  H+  AY +AP+ AFCNAYG 
Sbjct  368   RTQVFLKDQIPTSIAAGAYVLLAAISVVAIPHIFRQLQPKHVVWAYVVAPVFAFCNAYGT  427

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSL+S+YGK+AI IF + VG  +GGV+AGLA+CG+MM IVST SDL+QDFKTGYLT
Sbjct  428   GLTDWSLSSSYGKLAIFIFGASVGSADGGVVAGLAACGLMMGIVSTASDLIQDFKTGYLT  487

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L SP +MF SQV GT +GC ++P+VFWIFYKAY +G     YPAPYA +YR IALLGV+G
Sbjct  488   LTSPRSMFVSQVMGTGLGCIISPVVFWIFYKAYDVGLEEG-YPAPYAKIYRGIALLGVNG  546

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             +  LP  CL   + FF+ A+AI    EV +    ++ V  +IP+ + MA+PF+LG +F I
Sbjct  547   WNQLPKYCLRFCLAFFLLAVAICALKEVAKA--RRWWVQDYIPSALGMAVPFFLGSFFTI  604

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGS++L++W   +K +A  F PAVASGLICG+ +W +P++IL+L  +  P+C++  S
Sbjct  605   DMCVGSIVLYLWSKSDKVRAHTFAPAVASGLICGDGIWSLPSSILSLLNINPPMCLRVFS  664

Query  316   AAANAKLES  290
             A  N ++E 
Sbjct  665   ADTNYQVEE  673



>ref|XP_004158539.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=678

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/688 (55%), Positives = 472/688 (69%), Gaps = 38/688 (6%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
              S E+ +E  E+  W+ QLT RA   SL LSA+F FIV  +NLTTG+IP LNV+A LLG+
Sbjct  6     SSVEKSYESEELLPWRXQLTARAFVVSLFLSALFTFIVMNINLTTGLIPPLNVSAALLGY  65

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               +K WT    K+     PFTRQENTVIQTCVVAS  +AF+ G  SY+L MS  I   +E
Sbjct  66    VFLKIWTKFHHKS----LPFTRQENTVIQTCVVASVSVAFTGGFGSYLLAMSQRINELSE  121

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
             + +  N+ K  S+GWM+ FL++VSF+G F ++  RK MI+ +KLTYPSGTATA+LINSFH
Sbjct  122   AKD--NDFKNPSLGWMIGFLFIVSFLGPFLVLLFRKRMIMDFKLTYPSGTATAHLINSFH  179

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             T  GAKLAK+QV  L K FSFSFL+G FQWFF A   CGF+SFPTFGLKAY   FYFDFS
Sbjct  180   TSRGAKLAKKQVRTLGKFFSFSFLWGFFQWFFTAGKDCGFNSFPTFGLKAYQNEFYFDFS  239

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP  +N+SLL+GAI+SWG++WP+I  K+G W+   L +SS  G+Q YKVF 
Sbjct  240   ATYVGVGMICPYTINISLLLGAILSWGLMWPLIEXKKGDWFSAELHASSFHGLQSYKVFF  299

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
              IA+ LGDG++NF  ++  T L      + + N  +     +       G     FD   
Sbjct  300   FIALTLGDGIYNFVKVLATTILHLFSELKKDVNAVS-----NPSLRSTSGV---SFDDNL  351

Query  1216  RTHNFLKD------------------SIPNavavggyialaavaiiavpfifppLKWYHI  1091
             RT +FLK+                  SI         + L  +    +P IFP LKWY+I
Sbjct  352   RTQHFLKELQIPSRFAIGGYVILAVISITTLPRFLPLLKLYYMLGDTLPHIFPQLKWYYI  411

Query  1090  AVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMS  911
              V Y +AP+LAFCNAYG GLTDWSLAS YGK+AI I  +W G  +GG +AGLA+CGVM++
Sbjct  412   LVLYVIAPVLAFCNAYGTGLTDWSLASAYGKLAIFIIGAWAGATHGGAVAGLAACGVMIN  471

Query  910   IVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSa  734
             IV+T SDLMQDFKTGY+TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  +G   SA
Sbjct  472   IVATASDLMQDFKTGYMTLSSPRSMFVSQVVGTAMGCVISPCVFWLFYKAFDDIGQPESA  531

Query  733   ypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRF  554
             YPAPYA VYR +ALL V+G  SLP NCL L+  FF AAI +N+  ++L K     +V ++
Sbjct  532   YPAPYATVYRNMALLAVEGVSSLPKNCLYLSYLFFAAAIVLNLIRDLLEK-----KVSQY  586

Query  553   IPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIP  374
             IP P  MAIPFY+G YFAIDMC+GSLILFVW   NK +A  F PAVASGLICG+ +W +P
Sbjct  587   IPIPTAMAIPFYIGPYFAIDMCLGSLILFVWEKINKAKADAFAPAVASGLICGDGIWTLP  646

Query  373   AAILALAGVKAPICMKFLSAAANAKLES  290
             ++ILALAGVK PICMKFLS  AN K+ +
Sbjct  647   SSILALAGVKPPICMKFLSRTANVKVST  674



>gb|AGT16058.1| metal-nicotianamine transporter [Saccharum hybrid cultivar R570]
Length=684

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/669 (54%), Positives = 491/669 (73%), Gaps = 9/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             STE+ FE   +P+W  Q+T+R++  S  L    +FIV KLNLT+G++PSLN++AGLL F 
Sbjct  13    STEKAFEGERLPAWSEQITVRSVVVSSGLGLFLSFIVMKLNLTSGIVPSLNMSAGLLAFF  72

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IA   + 
Sbjct  73    LMKTWTSALERCGVFPKPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSKKIAEDFDE  132

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
                  NV+  S+G ++AFL++VSFVGLFSIVPLRK+MI+ YKLTYPSG+ATA+LINSFHT
Sbjct  133   AKTSINVEEPSLGRIIAFLFLVSFVGLFSIVPLRKIMIISYKLTYPSGSATAHLINSFHT  192

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA  AKQQV+ LFK F+ SFL+  FQWF++A  GCGFSSFPTFG++AY +RF+FDFS+
Sbjct  193   PQGAIQAKQQVSILFKSFAGSFLWSLFQWFYSAGPGCGFSSFPTFGMEAYRRRFFFDFSA  252

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N SLL+G+++SWG++WP I +K G+WY   L  SSL G+ GY++F++
Sbjct  253   TYVGVGMICPYIINFSLLLGSVVSWGLMWPYIESKRGLWYDAELPRSSLHGLNGYQIFIS  312

Query  1393  IAMMLGDGLFNFFYMMVVTGLS-FMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             IAM++GDGLFNF  ++V T    ++KR R  +        VD         Q   FD +R
Sbjct  313   IAMIIGDGLFNFLSILVRTSYDMYLKRTRPAEAAAKPFAGVDV-----TERQALSFDDRR  367

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP ++A G Y+ LAA++++A+P IF  L+  H+  AY +AP+ AFCNAYG 
Sbjct  368   RTQVFLKDQIPTSIAAGAYVLLAAISVVAIPHIFRQLQPKHVVWAYVVAPVFAFCNAYGT  427

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSL+S+YGK+AI IF + VG ++GGV+AGLA+CG+MM IVST SDL+QDFKTGYLT
Sbjct  428   GLTDWSLSSSYGKLAIFIFGASVGSEDGGVVAGLAACGLMMGIVSTASDLIQDFKTGYLT  487

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L SP +MF SQV GT +GC ++P+VFWIFYKAY +G     YPAPYA +YR IALLGV+G
Sbjct  488   LTSPRSMFVSQVMGTGLGCVISPVVFWIFYKAYDVGLEEG-YPAPYAKIYRGIALLGVNG  546

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             +  LP  CL   + FF+ A+AI    EV +    ++ V  +IP+ + MA+PF+LG +F I
Sbjct  547   WNQLPKYCLRFCLAFFLLAVAICALKEVAKA--RRWWVVDYIPSALGMAVPFFLGSFFTI  604

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGS++L++W   ++ +A  F PAVASGLICG+ +W +P++IL+L  +  P+C++   
Sbjct  605   DMCVGSIVLYLWSKSDRVRAHMFAPAVASGLICGDGIWSLPSSILSLLNINPPMCLRVFG  664

Query  316   AAANAKLES  290
             A  N ++E 
Sbjct  665   ADTNYQVEE  673



>ref|NP_001053350.1| Os04g0524500 [Oryza sativa Japonica Group]
 dbj|BAF15264.1| Os04g0524500, partial [Oryza sativa Japonica Group]
Length=629

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/632 (57%), Positives = 462/632 (73%), Gaps = 17/632 (3%)
 Frame = -2

Query  2182  CKLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGI  2003
             CK N  + + P L      LGF  ++ WTA + + GLL+QPFTRQENTVIQTCVVA   I
Sbjct  7     CKWNRDSQLQPLL------LGFFFVRLWTAAIERVGLLRQPFTRQENTVIQTCVVAGYDI  60

Query  2002  AFSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMM  1823
             AFS G  +Y+L MS  IA      N   N+K   +GW++ FL++VSF+GLF +VPLRK+M
Sbjct  61    AFSGGFGNYILSMSERIAGLGTEANNAQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKVM  120

Query  1822  ILKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGC  1643
             I+ YKLTYPSGTATA+LIN FHTP+GAK+A +QV  L   F  SF +G FQWF+ A D C
Sbjct  121   IIDYKLTYPSGTATAFLINGFHTPHGAKIAAKQVKKLGIFFILSFFWGFFQWFYTATDDC  180

Query  1642  GFSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEG  1463
             GF  FP+ GL+A+  +F+FDFS TYVGVGM+CP +VNVS+L+G I+SWGI+WP+I  K G
Sbjct  181   GFHKFPSLGLQAFQHKFFFDFSPTYVGVGMICPHIVNVSVLLGGILSWGIMWPLIAKKRG  240

Query  1462  IWYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASL  1283
              W+  +L   SL G+QGY+VF+AIA++LGDGL+NF  M+++T  S ++ +  +KN  AS 
Sbjct  241   DWFSADLPDGSLHGMQGYRVFIAIALILGDGLYNFLKMIILTAFS-LRSQIKKKN--AST  297

Query  1282  LPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppLK  1103
             LPV D+      A +  +D +RR   F+KD IP  VA GGY  +AA++I  VP I P LK
Sbjct  298   LPVSDDGMVTTTAAVS-YDEERRNELFVKDQIPWYVAYGGYAVVAAISIGTVPQIIPQLK  356

Query  1102  WYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCG  923
             WY I VAY +APILAFCNAYG GLTDWSL + YGK+AI  F +W G  +GGVLAGLA+CG
Sbjct  357   WYQILVAYIVAPILAFCNAYGTGLTDWSLVTTYGKLAIFAFGAWTGASHGGVLAGLAACG  416

Query  922   VMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LGD  746
             VMM+IVST +DLMQDFKTGYLTLASP +MF SQV GTAMGC + P VFW+FYKA+  +G 
Sbjct  417   VMMNIVSTAADLMQDFKTGYLTLASPRSMFVSQVIGTAMGCVIAPCVFWLFYKAFDNIGI  476

Query  745   SNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYR  566
             S S YPAP AAV+R+IA+LGVDGF SLP NCLNL   FF AAI +N+  +++ K      
Sbjct  477   SGSDYPAPNAAVFRSIAILGVDGFSSLPKNCLNLCYAFFAAAIVVNLIRDLVPK------  530

Query  565   VYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESL  386
             V RFIP PM MAIPFY+G YFAIDM +G++ILFVW+  ++ +A  +GPAVASG+ICG+ +
Sbjct  531   VSRFIPIPMAMAIPFYIGSYFAIDMFIGTVILFVWQRVDRAKADTYGPAVASGMICGDGI  590

Query  385   WGIPAAILALAGVKAPICMKFLSAAANAKLES  290
             W +P ++LALA VK PICMKFLS   N K+++
Sbjct  591   WVLPQSVLALAKVKPPICMKFLSRRTNDKVDA  622



>ref|XP_004138639.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=678

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/688 (54%), Positives = 471/688 (68%), Gaps = 38/688 (6%)
 Frame = -2

Query  2296  ESTERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGF  2117
              S E+ +E  E+  W+ QLT RA   SL LSA+F FIV  +NLTTG+IP LNV+A LLG+
Sbjct  6     SSVEKSYESEELLPWRKQLTARAFVVSLFLSALFTFIVMNINLTTGLIPPLNVSAALLGY  65

Query  2116  AVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAE  1937
               +K WT    K+     PFTRQENTVIQTCVVAS  +AF+ G  SY+L MS  I   +E
Sbjct  66    VFLKIWTKFHHKS----LPFTRQENTVIQTCVVASVSVAFTGGFGSYLLAMSQRINELSE  121

Query  1936  SGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFH  1757
             + +  N+ K  S+GW++ FL++VSF+G F ++  RK MI+ +KLTYPSGTATA+LINSFH
Sbjct  122   AKD--NDFKNPSLGWIIGFLFIVSFLGPFLVLLFRKRMIMDFKLTYPSGTATAHLINSFH  179

Query  1756  TPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFS  1577
             T  GAKLAK+QV  L K FSFSFL+G FQWFF A   CGF+SFPTFGLKAY   FYFDFS
Sbjct  180   TSRGAKLAKKQVRTLGKFFSFSFLWGFFQWFFTAGKDCGFNSFPTFGLKAYQNEFYFDFS  239

Query  1576  STYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFL  1397
             +TYVGVGM+CP  +N+SLL+GAI+SWG++WP+I  K+G W+   L +SS  G+Q YKVF 
Sbjct  240   ATYVGVGMICPYTINISLLLGAILSWGLMWPLIEKKKGDWFSAELHASSFHGLQSYKVFF  299

Query  1396  AIAMMLGDGLFNFFYMMVVTGLSFMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
              IA+ LGDG++NF  ++  T L      + + N  +     +       G     FD   
Sbjct  300   FIALTLGDGIYNFVKVLATTILHLFSELKKDVNAVS-----NPSLRSTSGV---SFDDNL  351

Query  1216  RTHNFLKD------------------SIPNavavggyialaavaiiavpfifppLKWYHI  1091
             RT +FLK+                  SI         + L  +    +P IFP LKWY+I
Sbjct  352   RTQHFLKELQIPSRFAIGGYVILAVISITTLPRFLPLLKLYYMLGDTLPHIFPQLKWYYI  411

Query  1090  AVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMS  911
              V Y +AP+LAFCNAYG GLTDWSLAS YGK+AI I  +W G  +GG +AGLA+CGVM++
Sbjct  412   LVLYVIAPVLAFCNAYGTGLTDWSLASAYGKLAIFIIGAWAGATHGGAVAGLAACGVMIN  471

Query  910   IVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAY-PLGDSNSa  734
             IV+T SDLMQDFKTGY+TL+SP +MF SQV GTAMGC ++P VFW+FYKA+  +G   SA
Sbjct  472   IVATASDLMQDFKTGYMTLSSPRSMFVSQVVGTAMGCVISPCVFWLFYKAFDDIGQPESA  531

Query  733   ypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRF  554
             YPAPYA VYR +ALL V+G  SLP NCL L+  FF AAI +N+  ++L K     +V ++
Sbjct  532   YPAPYATVYRNMALLAVEGVSSLPKNCLYLSYLFFAAAIVLNLIRDLLEK-----KVSQY  586

Query  553   IPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIP  374
             IP P  MAIPFY+G YFAIDMC+GSLILFVW   NK +A  F PAVASGLICG+ +W +P
Sbjct  587   IPIPTAMAIPFYIGPYFAIDMCLGSLILFVWEKINKAKADAFAPAVASGLICGDGIWTLP  646

Query  373   AAILALAGVKAPICMKFLSAAANAKLES  290
              +ILALAGVK PICMKFLS  AN K+ +
Sbjct  647   RSILALAGVKPPICMKFLSRTANVKVTT  674



>dbj|BAK06445.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=704

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/669 (55%), Positives = 487/669 (73%), Gaps = 4/669 (1%)
 Frame = -2

Query  2293  STERVFEKVEIPSWKNQLTIRAMFTSLVLSAIFNFIVCKLNLTTGVIPSLNVAAGLLGFA  2114
             S E+ FE   +P+W  Q+T+R+M  S  L    +FIV KLN+T+G++PSLNV+AGLL F 
Sbjct  29    SMEKAFEGKTLPTWNEQITLRSMVVSAGLGTFLSFIVMKLNITSGIVPSLNVSAGLLAFF  88

Query  2113  VIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPTIAAQAES  1934
             ++K+WT+ L + G+  +PFTRQENTV+QTCV++ S IAFS G  +Y+LGMS  IAA  + 
Sbjct  89    LMKTWTSALERCGVFPRPFTRQENTVVQTCVISCSSIAFSGGFGTYILGMSRKIAAGFDE  148

Query  1933  GNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHT  1754
              N   NV+  S+  ++A+L++VSFVGLFSIVPLRK+MI+ Y+LTYPSG+ATA+LINSFHT
Sbjct  149   ANSSLNVEEPSLWRVMAYLFLVSFVGLFSIVPLRKIMIISYRLTYPSGSATAHLINSFHT  208

Query  1753  PNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCGFSSFPTFGLKAYAQRFYFDFSS  1574
             P GA  AKQQV+ LFK F  SFL+  FQWF+ A D CGF SFPTFG++AY +RFYFDFS+
Sbjct  209   PQGAIQAKQQVSILFKSFLGSFLWSLFQWFYTAGDSCGFGSFPTFGMEAYNRRFYFDFSA  268

Query  1573  TYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGIWYPPNLSSSSLKGIQGYKVFLA  1394
             TYVGVGM+CP ++N SLLIG+IISWGI+WP I +K+G WY  NL +SSL G+ GY+VF++
Sbjct  269   TYVGVGMICPYIINFSLLIGSIISWGIMWPFIESKKGDWYDANLPNSSLHGLNGYQVFIS  328

Query  1393  IAMMLGDGLFNFFYMMVVTGLS-FMKRRRSEKNGPASLLPVDDEFNKGKGAQLEDFDGQR  1217
             IAM++GDGLFNFF ++  T    ++KR    K   A +             Q   FD +R
Sbjct  329   IAMIMGDGLFNFFSILFRTSYDMYLKRTGRAKANTAGVPFAGAGLAGANERQALSFDDRR  388

Query  1216  RTHNFLKDSIPNavavggyialaavaiiavpfifppLKWYHIAVAYAMAPILAFCNAYGC  1037
             RT  FLKD IP +VAVG Y+ALA ++++A+P IF  LK  H+  AY  API AFCNAYG 
Sbjct  389   RTQIFLKDQIPTSVAVGAYVALAGISVLAIPHIFRQLKPKHVVWAYVAAPIFAFCNAYGT  448

Query  1036  GLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASCGVMMSIVSTTSDLMQDFKTGYLT  857
             GLTDWSL+S+YGK+AI IF + +G  +GGV+AGLA+CG+MM IVST SDL+QDFKTGYLT
Sbjct  449   GLTDWSLSSSYGKLAIFIFGANIGAKDGGVIAGLAACGLMMGIVSTASDLIQDFKTGYLT  508

Query  856   LASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYPLGDSNSaypapyaavyraiALLGVDG  677
             L SP AMF SQV GT +GC ++P VFWIFY+AY +G+ +  YPAPYA +YR IALLG +G
Sbjct  509   LTSPRAMFVSQVIGTGLGCIISPTVFWIFYQAYDIGN-DEGYPAPYAKIYRGIALLGTNG  567

Query  676   FGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKYRVYRFIPNPMCMAIPFYLGGYFAI  497
             +  LP  CL     FF+ AIAI    EV       + +  +IP+ + MA+PF+LG +F I
Sbjct  568   WDQLPKYCLRFCAAFFLLAIAICALKEVAN--NKTWWIRDYIPSALGMAVPFFLGSFFTI  625

Query  496   DMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGESLWGIPAAILALAGVKAPICMKFLS  317
             DMCVGSL+L++W   +K  A+ F PAVASGLICG+ +W +P+++L+LA V+ P+CM+   
Sbjct  626   DMCVGSLVLYMWSKSDKLHAQMFAPAVASGLICGDGIWSLPSSLLSLANVEPPMCMRVFD  685

Query  316   AAANAKLES  290
             A  N ++E 
Sbjct  686   ADTNFEVEQ  694



>gb|KCW83950.1| hypothetical protein EUGRSUZ_B00835 [Eucalyptus grandis]
Length=631

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/633 (58%), Positives = 467/633 (74%), Gaps = 14/633 (2%)
 Frame = -2

Query  2179  KLNLTTGVIPSLNVAAGLLGFAVIKSWTALLLKAGLLKQPFTRQENTVIQTCVVASSGIA  2000
             KLNLTTG+ PSLNV+AGLLGF  +K+WT +L K GLL+ PFT QENTVIQTCVVASSG  
Sbjct  6     KLNLTTGINPSLNVSAGLLGFFFVKTWTKVLEKFGLLRVPFTWQENTVIQTCVVASSGST  65

Query  1999  FSSGTASYMLGMSPTIAAQAESGNIPNNVKTLSIGWMLAFLYVVSFVGLFSIVPLRKMMI  1820
             FS G  SY+  MS  +A Q+         K  S+ WM+ FL+VVSF+GLF++VPLRK+MI
Sbjct  66    FSGGFGSYLFAMSERVANQSTDPQSAYVYKNPSLPWMIGFLFVVSFLGLFAVVPLRKIMI  125

Query  1819  LKYKLTYPSGTATAYLINSFHTPNGAKLAKQQVaalfkcfsfsflfggfqwffaADDGCG  1640
             + +KL YPSGTATA+L NSFHTP GAKLAK+QV AL K FSFSFL+G FQWF+ A+D CG
Sbjct  126   IDFKLMYPSGTATAHLRNSFHTPEGAKLAKKQVKALGKFFSFSFLWGFFQWFYRAEDDCG  185

Query  1639  FSSFPTFGLKAYAQRFYFDFSSTYVGVGMLCPIMVNVslligaiiswgiiwpiIHTKEGI  1460
             F+ FPT GLKA   RFYFDFS+T+VGVGM+CP + N+S+L+G I+SWG++WP+I T++G 
Sbjct  186   FARFPTLGLKALQYRFYFDFSATHVGVGMICPYITNISVLLGGILSWGLMWPLIETRKGQ  245

Query  1459  WYPPNLSSSSLKGIQGYKVFLAIAMMLGDGLFNFFYMM--VVTGLSFMKRRRSEKNGPAS  1286
             WYP ++S++S++G+QGYKVF+AIAM+LGDG++NFF  +   ++GL + + R  E    + 
Sbjct  246   WYPADVSNTSMRGLQGYKVFIAIAMILGDGIYNFFKALGRTLSGL-YHQLRDGEM---SH  301

Query  1285  LLPVDDEFNKGKGAQLEDFDGQRRTHNFLKDSIPNavavggyialaavaiiavpfifppL  1106
             +LP+ +            +D QR+T  FLKD IP   AV GY+ +A ++I  +P++FP L
Sbjct  302   VLPIAN--GSSPDNHQVSYDDQRQTQLFLKDQIPTWFAVVGYVTIATISIATLPYMFPQL  359

Query  1105  KWYHIAVAYAMAPILAFCNAYGCGLTDWSLASNYGKIAILIFSSWVGHDNGGVLAGLASC  926
             K YHI V Y  A  L FCNAYGCGLTDWSLAS YGK+AI +  +W    +GG+LA LA+C
Sbjct  360   KRYHILVIYLFASTLGFCNAYGCGLTDWSLASAYGKLAIFVIGAWANASHGGILANLAAC  419

Query  925   GVMMSIVSTTSDLMQDFKTGYLTLASPLAMFFSQVAGTAMGCTLTPLVFWIFYKAYP-LG  749
             GV+ ++VST SDL QDFKTGYLTLASP ++F SQV GTAMGC ++P VFW+FYKA+  L 
Sbjct  420   GVITNLVSTASDLTQDFKTGYLTLASPRSVFVSQVIGTAMGCVISPCVFWLFYKAFKDLE  479

Query  748   DSNSaypapyaavyraiALLGVDGFGSLPTNCLNLAIGFFVAAIAINIFSEVLRKYETKY  569
                  Y  PY  VYR++A LGV+GF SLP +CL L  GF VAA+ IN F +++ K     
Sbjct  480   LPGKEYVVPYGIVYRSMAELGVEGFTSLPKHCLTLCCGFLVAAMIINGFRDLVGK-----  534

Query  568   RVYRFIPNPMCMAIPFYLGGYFAIDMCVGSLILFVWRWKNKQQAKDFGPAVASGLICGES  389
             +  RFIP PM MAIPFY+G  FAIDMCVGSLILF+W   +K +A  FGPAVASGLICG+ 
Sbjct  535   KWARFIPLPMAMAIPFYIGPSFAIDMCVGSLILFIWEKTDKAKADAFGPAVASGLICGDG  594

Query  388   LWGIPAAILALAGVKAPICMKFLSAAANAKLES  290
             LW +P++IL LAGV  PICMKFLS A N +L++
Sbjct  595   LWTLPSSILTLAGVNPPICMKFLSRATNKRLDA  627



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7528102488016