BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79518_g1_i1 len=1341 path=[1319:0-1340]

Length=1341
                                                                      Score     E

ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    369   3e-121   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    364   2e-119   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    360   1e-117   
emb|CDP18641.1|  unnamed protein product                                359   2e-117   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                358   5e-117   
ref|XP_002523448.1|  cysteine protease, putative                        357   9e-117   Ricinus communis
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        355   1e-115   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    354   2e-115   
gb|AAL14199.1|  cysteine proteinase precursor                           353   5e-115   Ipomoea batatas [batate]
ref|XP_002523447.1|  cysteine protease, putative                        351   3e-114   Ricinus communis
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    350   4e-114   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    350   4e-114   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                350   4e-114   
gb|AAK27968.1|AF242372_1  cysteine protease                             349   1e-113   Ipomoea batatas [batate]
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                349   1e-113   
dbj|BAF46311.1|  cysteine proteinase precursor                          348   4e-113   Ipomoea nil [qian niu]
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            347   1e-112   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                    347   1e-112   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410          347   1e-112   Sorghum bicolor [broomcorn]
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             347   3e-112   Populus trichocarpa [western balsam poplar]
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             345   4e-112   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    346   5e-112   
ref|XP_006360707.1|  PREDICTED: vignain-like                            345   5e-112   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    344   8e-112   
emb|CDP18645.1|  unnamed protein product                                344   9e-112   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    345   9e-112   
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like              345   9e-112   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    344   1e-111   
ref|XP_006469011.1|  PREDICTED: vignain-like                            344   1e-111   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    344   1e-111   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        343   1e-111   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             344   2e-111   
emb|CDP18644.1|  unnamed protein product                                343   2e-111   
ref|XP_006469012.1|  PREDICTED: vignain-like                            343   4e-111   
gb|AGT16936.1|  vignain-like protein                                    343   4e-111   
ref|XP_007025398.1|  Senescence-associated gene 12                      343   5e-111   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like              343   5e-111   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             343   5e-111   Populus trichocarpa [western balsam poplar]
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g             343   6e-111   
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like              342   6e-111   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                342   6e-111   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             342   6e-111   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             342   7e-111   Populus trichocarpa [western balsam poplar]
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             342   7e-111   Populus trichocarpa [western balsam poplar]
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like              342   7e-111   
ref|XP_004975182.1|  PREDICTED: vignain-like                            342   8e-111   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        342   8e-111   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    342   9e-111   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             342   1e-110   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             342   1e-110   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like              342   1e-110   
ref|XP_002525124.1|  cysteine protease, putative                        342   1e-110   Ricinus communis
ref|XP_004975183.1|  PREDICTED: vignain-like                            342   1e-110   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                        342   1e-110   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             340   1e-110   Populus trichocarpa [western balsam poplar]
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        341   2e-110   
ref|XP_002522559.1|  cysteine protease, putative                        341   2e-110   Ricinus communis
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    341   2e-110   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     340   2e-110   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    341   3e-110   
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    342   3e-110   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        341   3e-110   
emb|CAH66275.1|  OSIGBa0147O06.5                                        340   3e-110   Oryza sativa [red rice]
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        340   3e-110   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                        340   3e-110   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    340   4e-110   
ref|XP_006360708.1|  PREDICTED: vignain-like                            340   4e-110   
ref|XP_006469128.1|  PREDICTED: vignain-like                            340   4e-110   
ref|XP_003540013.1|  PREDICTED: vignain-like                            340   4e-110   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        340   4e-110   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             340   5e-110   Populus trichocarpa [western balsam poplar]
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        340   5e-110   
ref|XP_006362426.1|  PREDICTED: vignain-like                            340   5e-110   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                    343   7e-110   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    340   7e-110   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...    340   9e-110   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         338   1e-109   
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             339   1e-109   
ref|XP_007048796.1|  Senescence-associated gene 12                      339   1e-109   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like              339   1e-109   
dbj|BAD29959.1|  cysteine protease                                      340   2e-109   Daucus carota [carrots]
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             338   2e-109   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        338   2e-109   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        338   2e-109   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    338   3e-109   Vitis vinifera
emb|CAN64655.1|  hypothetical protein VITISV_005140                     338   3e-109   Vitis vinifera
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    338   4e-109   Vitis vinifera
gb|KHN27806.1|  Vignain                                                 337   5e-109   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             338   5e-109   
emb|CAN70559.1|  hypothetical protein VITISV_032465                     338   5e-109   Vitis vinifera
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        338   5e-109   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        337   5e-109   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        338   5e-109   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             337   7e-109   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...    337   7e-109   Oryza sativa Indica Group [Indian rice]
gb|ADV74756.1|  cysteine protease                                       338   7e-109   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             337   7e-109   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        337   7e-109   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        337   8e-109   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like              337   9e-109   
gb|KHN28095.1|  Thiol protease                                          337   1e-108   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like              337   1e-108   
gb|AAT34987.1|  putative cysteine protease                              337   1e-108   Gossypium hirsutum [American cotton]
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             337   1e-108   
ref|XP_006582264.1|  PREDICTED: vignain-like                            336   2e-108   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        336   2e-108   
gb|EMT20796.1|  Vignain                                                 338   2e-108   
ref|XP_006582263.1|  PREDICTED: vignain-like                            336   2e-108   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         336   2e-108   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...    336   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        336   2e-108   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                335   2e-108   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   335   2e-108   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    336   2e-108   Vitis vinifera
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        335   3e-108   
ref|XP_002525123.1|  cysteine protease, putative                        336   4e-108   Ricinus communis
gb|KHN08873.1|  Vignain                                                 335   4e-108   
ref|XP_008228922.1|  PREDICTED: vignain-like                            335   4e-108   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    335   4e-108   
emb|CDP05747.1|  unnamed protein product                                335   4e-108   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        335   5e-108   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            335   6e-108   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        335   6e-108   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg                334   7e-108   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    335   7e-108   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        335   7e-108   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g             335   7e-108   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             334   9e-108   
ref|XP_006592475.1|  PREDICTED: vignain-like                            334   9e-108   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                        335   9e-108   
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        334   1e-107   
ref|XP_007048792.1|  Senescence-associated gene 12                      334   1e-107   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        334   1e-107   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    334   1e-107   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        333   1e-107   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...    333   2e-107   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        333   2e-107   
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...    334   2e-107   
ref|XP_007050065.1|  Senescence-associated gene 12                      333   2e-107   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             333   2e-107   
ref|XP_008780645.1|  PREDICTED: vignain-like                            332   2e-107   
gb|EMT15489.1|  Thiol protease SEN102                                   333   2e-107   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        333   2e-107   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        334   3e-107   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    333   3e-107   
gb|AAR92154.1|  putative cysteine protease 1                            333   3e-107   Iris x hollandica [Dutch iris]
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             333   4e-107   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             332   5e-107   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            333   5e-107   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        332   5e-107   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150          332   6e-107   Sorghum bicolor [broomcorn]
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    331   6e-107   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    332   6e-107   Vitis vinifera
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    332   6e-107   Vitis vinifera
ref|XP_006652104.1|  PREDICTED: vignain-like                            332   6e-107   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             332   7e-107   
ref|XP_007048674.1|  Senescence-associated gene 12                      332   1e-106   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         331   1e-106   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    331   1e-106   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    331   1e-106   
gb|EMT08019.1|  Vignain                                                 330   2e-106   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                             331   2e-106   
gb|AGT97048.1|  senescence-specific cysteine protease                   331   2e-106   
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...    330   2e-106   
ref|XP_006362428.1|  PREDICTED: vignain-like                            330   3e-106   
ref|XP_004290089.1|  PREDICTED: vignain-like                            330   4e-106   
dbj|BAD29955.1|  cysteine protease                                      331   5e-106   Daucus carota [carrots]
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170          330   6e-106   Sorghum bicolor [broomcorn]
gb|EMT29822.1|  Vignain                                                 330   6e-106   
ref|XP_004303175.1|  PREDICTED: vignain-like                            330   6e-106   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g             329   7e-106   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        330   8e-106   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...    329   8e-106   
ref|XP_006362420.1|  PREDICTED: vignain-like                            330   9e-106   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         329   1e-105   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        329   1e-105   
dbj|BAF56429.1|  cysteine proteinase                                    329   1e-105   Lotus japonicus
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160          328   1e-105   Sorghum bicolor [broomcorn]
gb|EAY93078.1|  hypothetical protein OsI_14879                          328   1e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_004975184.1|  PREDICTED: vignain-like                            328   2e-105   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like              328   2e-105   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        330   2e-105   
ref|XP_004306851.1|  PREDICTED: vignain-like                            328   2e-105   
emb|CAD40112.2|  OSJNBa0035O13.5                                        328   3e-105   Oryza sativa Japonica Group [Japonica rice]
dbj|BAF56430.1|  cysteine proteinase                                    328   3e-105   Lotus japonicus
gb|AHA62781.1|  RCR3-like cysteine protease                             328   3e-105   
gb|AHA62779.1|  RCR3-like cysteine protease                             328   4e-105   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             328   4e-105   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             328   4e-105   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        327   5e-105   
ref|XP_004306597.1|  PREDICTED: vignain-like                            327   6e-105   
gb|AHA62780.1|  RCR3-like cysteine protease                             327   7e-105   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...    327   7e-105   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          327   7e-105   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    327   8e-105   Vitis vinifera
ref|XP_006467666.1|  PREDICTED: vignain-like                            327   8e-105   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        327   8e-105   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             327   9e-105   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        327   9e-105   
ref|XP_003607647.1|  Cysteine proteinase                                326   1e-104   
gb|EMT08022.1|  Vignain                                                 326   1e-104   
ref|XP_009797968.1|  PREDICTED: vignain-like                            326   1e-104   
gb|AFK44139.1|  unknown                                                 326   1e-104   
gb|EMT20795.1|  Vignain                                                 326   1e-104   
gb|EAY97106.1|  hypothetical protein OsI_19029                          327   1e-104   Oryza sativa Indica Group [Indian rice]
dbj|BAF56428.1|  cysteine proteinase                                    326   1e-104   Lotus japonicus
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    326   2e-104   
ref|XP_003605890.1|  Cysteine proteinase                                326   2e-104   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g             326   2e-104   
ref|XP_004306813.1|  PREDICTED: vignain-like                            326   2e-104   
emb|CAH66233.1|  H0825G02.10                                            326   2e-104   Oryza sativa [red rice]
ref|XP_008340724.1|  PREDICTED: vignain-like                            326   2e-104   
ref|XP_003557016.1|  PREDICTED: vignain-like                            325   3e-104   
ref|XP_004505498.1|  PREDICTED: vignain-like                            325   4e-104   
emb|CDP18638.1|  unnamed protein product                                325   4e-104   
gb|KHN13721.1|  Vignain                                                 325   4e-104   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        325   4e-104   
gb|EMT29821.1|  Thiol protease SEN102                                   325   5e-104   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    325   5e-104   
gb|AFV30165.1|  cysteine proteinase                                     325   5e-104   
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...    325   5e-104   
ref|XP_004308524.1|  PREDICTED: vignain-like                            325   5e-104   
ref|XP_009359967.1|  PREDICTED: vignain-like                            325   5e-104   
gb|KHN12137.1|  Thiol protease                                          325   5e-104   
ref|XP_002531151.1|  cysteine protease, putative                        324   6e-104   Ricinus communis
emb|CDP18639.1|  unnamed protein product                                324   6e-104   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    325   7e-104   
gb|AHA62783.1|  RCR3-like cysteine protease                             324   7e-104   
ref|XP_009361500.1|  PREDICTED: vignain-like                            324   8e-104   
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        324   9e-104   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070          324   9e-104   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         324   1e-103   
ref|XP_007025415.1|  Senescence-associated gene 12, putative            324   1e-103   
ref|XP_002531152.1|  cysteine protease, putative                        324   1e-103   Ricinus communis
gb|AHA62782.1|  RCR3-like cysteine protease                             324   1e-103   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840          323   1e-103   Sorghum bicolor [broomcorn]
ref|XP_003599736.1|  Cysteine proteinase                                323   2e-103   
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                        323   2e-103   
ref|XP_003612210.1|  Cysteine proteinase                                323   2e-103   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        324   2e-103   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1                 323   2e-103   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                        323   2e-103   
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                  323   2e-103   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830          323   2e-103   Sorghum bicolor [broomcorn]
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like              323   2e-103   
ref|XP_006592465.1|  PREDICTED: vignain-like                            323   2e-103   
gb|ADV41672.1|  cysteine protease                                       323   2e-103   
emb|CAL64936.1|  putative cysteine protease 8                           323   2e-103   Trifolium pratense [peavine clover]
gb|EEC84514.1|  hypothetical protein OsI_31214                          323   2e-103   Oryza sativa Indica Group [Indian rice]
gb|KHN08187.1|  Thiol protease SEN102                                   322   2e-103   
gb|AAW78661.2|  senescence-specific cysteine protease                   323   2e-103   Nicotiana tabacum [American tobacco]
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                        323   3e-103   
gb|ABA97421.1|  Vignain precursor, putative                             323   3e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          323   3e-103   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg             323   3e-103   
gb|KHN27797.1|  Thiol protease SEN102                                   322   3e-103   
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                        322   4e-103   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...    322   4e-103   
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                        322   4e-103   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like              322   5e-103   
ref|XP_003526232.1|  PREDICTED: vignain-like                            322   5e-103   
gb|EMT33085.1|  Vignain                                                 322   5e-103   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230          322   6e-103   
ref|XP_003558756.1|  PREDICTED: senescence-specific cysteine prot...    322   6e-103   
dbj|BAF56427.1|  cysteine proteinase                                    322   6e-103   Lotus japonicus
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...    322   7e-103   
ref|XP_006421530.1|  hypothetical protein CICLE_v10005334mg             322   7e-103   
ref|XP_004306836.1|  PREDICTED: vignain-like                            322   8e-103   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...    322   9e-103   
ref|XP_004297571.1|  PREDICTED: vignain-like                            322   9e-103   
ref|NP_001052232.2|  Os04g0203500                                       321   9e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004506025.1|  PREDICTED: vignain-like                            322   9e-103   
ref|XP_006291442.1|  hypothetical protein CARUB_v10017578mg             321   1e-102   
gb|AAP32198.1|  cysteine protease 12                                    322   1e-102   Trifolium repens [creeping white clover]
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                        322   1e-102   
gb|AAP32195.1|  cysteine protease 5                                     321   1e-102   Trifolium repens [creeping white clover]
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    335   1e-102   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                        321   2e-102   
gb|AAP32196.1|  cysteine protease 8                                     321   2e-102   Trifolium repens [creeping white clover]
gb|EMT29823.1|  Vignain                                                 321   2e-102   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        321   2e-102   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    321   2e-102   
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                        321   2e-102   
ref|XP_004505502.1|  PREDICTED: vignain-like                            321   2e-102   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                        320   2e-102   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    320   3e-102   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                        320   3e-102   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                        320   3e-102   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        320   3e-102   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        320   3e-102   
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                     320   3e-102   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                        320   4e-102   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             320   4e-102   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                     319   4e-102   
gb|EMT12294.1|  Vignain                                                 320   4e-102   
ref|XP_006592467.1|  PREDICTED: vignain-like                            320   5e-102   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like              320   5e-102   
ref|XP_004294729.1|  PREDICTED: vignain-like                            320   5e-102   
gb|AAA50755.1|  cysteine proteinase                                     319   6e-102   
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                        319   7e-102   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             319   7e-102   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    319   8e-102   
ref|XP_003599735.1|  Cysteine proteinase                                319   8e-102   
ref|XP_006432601.1|  hypothetical protein CICLE_v10001718mg             319   9e-102   
ref|XP_006490014.1|  PREDICTED: xylem cysteine proteinase 1-like        319   9e-102   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g             319   9e-102   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                     319   1e-101   
ref|XP_004297572.1|  PREDICTED: vignain-like                            318   1e-101   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             318   1e-101   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                        318   1e-101   
ref|XP_006292980.1|  hypothetical protein CARUB_v10019256mg             318   1e-101   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g             318   2e-101   
ref|XP_010040202.1|  PREDICTED: zingipain-2-like                        318   2e-101   
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg             317   2e-101   
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                   318   2e-101   
ref|XP_003607571.1|  Cysteine proteinase EP-B                           318   2e-101   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                        318   2e-101   
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                     317   2e-101   
ref|XP_003607548.1|  Cysteine protease                                  318   2e-101   
ref|XP_010056876.1|  PREDICTED: zingipain-2-like                        318   2e-101   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        318   2e-101   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g             317   3e-101   
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             318   3e-101   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...    318   3e-101   
ref|XP_006432617.1|  hypothetical protein CICLE_v10001723mg             318   3e-101   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    330   4e-101   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                     316   4e-101   
ref|XP_003609015.1|  Cysteine proteinase                                318   4e-101   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    317   4e-101   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         317   4e-101   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g             317   4e-101   
gb|KFK31525.1|  hypothetical protein AALP_AA6G123900                    317   5e-101   
ref|XP_006432594.1|  hypothetical protein CICLE_v10001719mg             317   7e-101   
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                        317   7e-101   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g             317   8e-101   
ref|XP_010426443.1|  PREDICTED: ervatamin-B                             317   8e-101   
ref|XP_010058970.1|  PREDICTED: zingipain-2-like                        317   1e-100   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like              316   1e-100   
ref|NP_568651.1|  cysteine protease SAG12                               317   1e-100   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...    316   1e-100   
ref|XP_007132896.1|  hypothetical protein PHAVU_011G134100g             315   1e-100   
ref|XP_006421532.1|  hypothetical protein CICLE_v10005342mg             316   1e-100   
ref|XP_003596711.1|  Cysteine proteinase                                316   1e-100   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        316   1e-100   
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                        319   1e-100   
ref|XP_003527349.1|  PREDICTED: vignain-like                            316   1e-100   
ref|XP_003556992.1|  PREDICTED: vignain-like                            316   1e-100   
ref|XP_009128825.1|  PREDICTED: ervatamin-B                             316   2e-100   
ref|XP_003607574.1|  Cysteine protease                                  315   3e-100   
gb|EMT09279.1|  Thiol protease SEN102                                   313   3e-100   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        315   3e-100   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...    315   3e-100   
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                        315   4e-100   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease         315   5e-100   
gb|KHN33962.1|  Vignain                                                 313   5e-100   
gb|KHN32069.1|  Vignain                                                 314   5e-100   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             314   8e-100   
gb|KHN38752.1|  Vignain                                                 313   8e-100   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        314   9e-100   
dbj|BAB13759.1|  cysteine proteinase                                    314   1e-99    
ref|XP_004505500.1|  PREDICTED: vignain-like                            314   1e-99    
ref|XP_004489011.1|  PREDICTED: vignain-like                            313   1e-99    
ref|XP_009349242.1|  PREDICTED: vignain-like                            318   1e-99    
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg             313   1e-99    
ref|XP_003539970.1|  PREDICTED: vignain-like                            313   2e-99    
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1                 311   2e-99    
ref|XP_003527350.1|  PREDICTED: vignain-like                            313   2e-99    
emb|CDX87758.1|  BnaC02g31910D                                          313   3e-99    
ref|XP_009365508.1|  PREDICTED: vignain-like                            319   3e-99    
ref|XP_004505461.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    312   3e-99    
ref|XP_003538185.1|  PREDICTED: vignain-like                            312   4e-99    
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g             312   4e-99    
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                        312   4e-99    
gb|AAC49135.1|  SAG12 protein                                           312   4e-99    
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                        312   5e-99    
emb|CBI21976.3|  unnamed protein product                                311   5e-99    
ref|XP_010054324.1|  PREDICTED: ervatamin-B-like                        311   6e-99    
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                        312   6e-99    
ref|XP_002865220.1|  senescence-associated gene 12                      311   7e-99    
ref|XP_003539989.1|  PREDICTED: vignain-like                            311   7e-99    
emb|CBI21973.3|  unnamed protein product                                311   7e-99    
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                     312   7e-99    
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    311   9e-99    
ref|XP_003527388.1|  PREDICTED: vignain-like                            311   9e-99    
emb|CBI21972.3|  unnamed protein product                                310   1e-98    
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    311   1e-98    
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    311   1e-98    
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...    311   1e-98    
ref|XP_002877667.1|  hypothetical protein ARALYDRAFT_348033             311   1e-98    
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    310   2e-98    
ref|XP_004487577.1|  PREDICTED: vignain-like isoform X1                 310   2e-98    
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    310   2e-98    
ref|XP_010557424.1|  PREDICTED: ervatamin-B-like                        310   2e-98    
emb|CBI21977.3|  unnamed protein product                                308   2e-98    
ref|XP_004964022.1|  PREDICTED: cysteine proteinase EP-B 1-like         310   3e-98    
ref|XP_010054325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    315   3e-98    
ref|XP_002275891.1|  PREDICTED: zingipain-2                             310   4e-98    
ref|XP_010040207.1|  PREDICTED: ervatamin-B-like                        309   5e-98    
gb|KHN32068.1|  Vignain                                                 308   5e-98    
ref|XP_010057075.1|  PREDICTED: ervatamin-B-like                        309   7e-98    
ref|NP_566920.1|  putative cysteine proteinase                          309   7e-98    
ref|XP_002446131.1|  hypothetical protein SORBIDRAFT_06g002140          308   1e-97    
emb|CBI21941.3|  unnamed protein product                                309   1e-97    
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                        308   1e-97    
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    308   1e-97    
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                        308   1e-97    
gb|KHN13720.1|  Vignain                                                 307   1e-97    
ref|XP_010040203.1|  PREDICTED: ervatamin-B-like                        308   2e-97    
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg             308   2e-97    
gb|KDO77829.1|  hypothetical protein CISIN_1g037516mg                   307   2e-97    
gb|ACG36128.1|  vignain precursor                                       308   2e-97    
ref|XP_008340275.1|  PREDICTED: fruit bromelain-like                    318   2e-97    
ref|XP_006449484.1|  hypothetical protein CICLE_v10017947mg             308   2e-97    
emb|CAE03344.2|  OSJNBb0005B05.11                                       307   3e-97    
ref|XP_006468205.1|  PREDICTED: actinidain-like                         307   3e-97    
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850          306   3e-97    
ref|XP_004487579.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    306   4e-97    
gb|AAM73806.1|AF448505_1  cysteine proteinase                           307   5e-97    
ref|XP_002525147.1|  cysteine protease, putative                        307   6e-97    
gb|ADP02219.1|  Peptidase_C1 domain-containing protein                  309   6e-97    
ref|XP_006470296.1|  PREDICTED: xylem cysteine proteinase 1-like        306   7e-97    
ref|XP_008229136.1|  PREDICTED: zingipain-2                             306   8e-97    
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     305   8e-97    
ref|XP_004978889.1|  PREDICTED: cysteine proteinase EP-B 1-like         306   9e-97    
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g             306   9e-97    
ref|XP_010061449.1|  PREDICTED: zingipain-1-like                        306   1e-96    
gb|KHN33932.1|  KDEL-tailed cysteine endopeptidase CEP1                 305   1e-96    
ref|XP_008349211.1|  PREDICTED: zingipain-2-like                        306   1e-96    
ref|XP_003527331.1|  PREDICTED: vignain-like                            305   2e-96    
ref|XP_008669672.1|  PREDICTED: ervatamin-B-like                        304   2e-96    
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    305   3e-96    
ref|XP_010478268.1|  PREDICTED: ervatamin-B-like                        305   3e-96    
ref|XP_010460683.1|  PREDICTED: ervatamin-B-like                        305   4e-96    
ref|XP_009352792.1|  PREDICTED: zingipain-1-like                        304   5e-96    
ref|XP_009352948.1|  PREDICTED: ervatamin-B-like                        305   6e-96    
ref|XP_006410552.1|  hypothetical protein EUTSA_v10016878mg             304   6e-96    
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g             303   6e-96    
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                        304   6e-96    
ref|XP_004487578.1|  PREDICTED: vignain-like isoform X2                 303   7e-96    
ref|XP_003596314.1|  Cysteine proteinase                                303   1e-95    
gb|KHN07749.1|  Vignain                                                 302   1e-95    
ref|XP_010094328.1|  Fruit bromelain                                    303   1e-95    
gb|KDO63025.1|  hypothetical protein CISIN_1g018958mg                   303   1e-95    
ref|XP_006445658.1|  hypothetical protein CICLE_v10015798mg             303   2e-95    
gb|KHN33935.1|  KDEL-tailed cysteine endopeptidase CEP1                 302   2e-95    
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                        303   2e-95    
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                        303   2e-95    
ref|XP_009384829.1|  PREDICTED: xylem cysteine proteinase 1-like        303   2e-95    
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                     303   3e-95    
ref|XP_010499428.1|  PREDICTED: ervatamin-B-like                        302   3e-95    
ref|XP_010059331.1|  PREDICTED: zingipain-2-like                        302   3e-95    
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                        302   3e-95    
gb|KCW76141.1|  hypothetical protein EUGRSUZ_D00518                     300   4e-95    
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g             302   4e-95    
ref|XP_007050023.1|  Cysteine proteinases superfamily protein, pu...    302   4e-95    
ref|XP_006468204.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    303   4e-95    
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    301   4e-95    
gb|EAY93080.1|  hypothetical protein OsI_14881                          301   5e-95    
ref|XP_009149742.1|  PREDICTED: zingipain-2-like                        301   6e-95    
dbj|BAG16370.1|  cysteine protease                                      301   7e-95    
ref|XP_010059344.1|  PREDICTED: zingipain-2-like                        301   8e-95    
ref|XP_006303584.1|  hypothetical protein CARUB_v10011106mg             301   9e-95    
ref|XP_010091035.1|  KDEL-tailed cysteine endopeptidase CEP1            301   1e-94    
ref|XP_004487576.1|  PREDICTED: vignain-like                            301   1e-94    
gb|KHN34255.1|  KDEL-tailed cysteine endopeptidase CEP1                 300   1e-94    
gb|AEH26024.1|  cysteine peptidase                                      301   1e-94    
ref|XP_004963863.1|  PREDICTED: cysteine proteinase EP-B 2-like         301   1e-94    
ref|XP_006652103.1|  PREDICTED: cysteine protease 1-like                301   1e-94    
gb|AAX13273.1|  putative cysteine protease                              301   1e-94    
gb|KCW45396.1|  hypothetical protein EUGRSUZ_L00916                     300   1e-94    
gb|KCW74661.1|  hypothetical protein EUGRSUZ_E03389                     300   1e-94    
emb|CDY08128.1|  BnaA06g15980D                                          300   2e-94    
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        301   2e-94    
ref|NP_001057942.1|  Os06g0582600                                       301   2e-94    
emb|CAD40110.2|  OSJNBa0035O13.9                                        299   2e-94    
ref|XP_003540007.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    300   2e-94    
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g             300   2e-94    
ref|NP_001239703.1|  uncharacterized protein LOC100799247 precursor     300   2e-94    
emb|CDX75496.1|  BnaA01g02060D                                          300   3e-94    
ref|XP_003539770.1|  PREDICTED: vignain-like                            300   3e-94    
sp|O23791.1|BROM1_ANACO  RecName: Full=Fruit bromelain; AltName: ...    300   3e-94    
gb|KHN05669.1|  Vignain                                                 298   4e-94    
ref|NP_001233949.1|  phytophthora-inhibited protease 1                  299   5e-94    
ref|XP_006291447.1|  hypothetical protein CARUB_v10017584mg             299   6e-94    
ref|NP_001141984.1|  uncharacterized protein LOC100274134 precursor     300   7e-94    
emb|CDY05926.1|  BnaC08g21030D                                          299   7e-94    
ref|XP_006280797.1|  hypothetical protein CARUB_v10026767mg             298   8e-94    
dbj|BAA22546.1|  FB1035 precursor                                       298   9e-94    
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg             298   9e-94    
ref|XP_006493641.1|  PREDICTED: xylem cysteine proteinase 1-like        299   9e-94    
ref|XP_006362435.1|  PREDICTED: fruit bromelain-like                    298   1e-93    
ref|XP_008458487.1|  PREDICTED: ervatamin-B-like                        298   1e-93    
ref|XP_010437483.1|  PREDICTED: xylem cysteine proteinase 1-like ...    298   1e-93    
gb|ABF70145.1|  cysteine protease, putative                             299   1e-93    
ref|XP_002869093.1|  hypothetical protein ARALYDRAFT_491113             298   1e-93    
gb|AGS78388.1|  bromelain                                               298   1e-93    
ref|XP_009405198.1|  PREDICTED: zingipain-1-like                        298   2e-93    
ref|XP_006415613.1|  hypothetical protein EUTSA_v10009660mg             298   2e-93    
emb|CDY58055.1|  BnaA06g40240D                                          297   2e-93    
ref|XP_009102734.1|  PREDICTED: xylem cysteine proteinase 1             298   2e-93    



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   369 bits (947),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 240/338 (71%), Gaps = 9/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             I+F A ++VLEIW   +ATAR     D  MV+++EQWI ++GRVY ++ EK KRF+IFKE
Sbjct  8     ILFLAALVVLEIWGS-QATARTL--PDASMVEKHEQWIAQFGRVYKDDAEKAKRFNIFKE  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENVTEI  461
             NV +I SFN+AG   + + IN+FADLTN+EF++SR GYK   Y +++    F Y NVT +
Sbjct  65    NVEYIQSFNEAGARPYKLAINKFADLTNEEFQASRNGYKMGSYGKSSKVSSFRYANVTAV  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-S  638
             PA MDW KKGAVT VK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD    
Sbjct  125   PASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGNLISLSEQELVDCDTSED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC+GG +   F +++ NGGITTESNYPY    G C   K +   AKI G++ VP   ES
Sbjct  185   EGCNGGLMDNAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSES  244

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              L+KAVANQPVS AIDASG  FQFY  G++   +C T ++H +T VGYG+ SDG K+WL+
Sbjct  245   ALLKAVANQPVSVAIDASGSDFQFYTSGVF-TGQCGTELDHGVTAVGYGKTSDGTKYWLV  303

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENGY+++ +D   A+G CGIA + S+P A
Sbjct  304   KNSWGTSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  341



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 240/338 (71%), Gaps = 10/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             +VFAA+ LVLE+W   +ATAR     D  M++++EQW+ ++GRVY ++ EK KRF IFKE
Sbjct  9     LVFAAL-LVLEMWGS-QATARTL--PDAAMIEKHEQWMAQFGRVYKDDAEKSKRFRIFKE  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENVTEI  461
             NV +I+SFN+AG   +T+ IN+FADLTN+EF++SR GYK   Y +++    F Y NVT +
Sbjct  65    NVEYIESFNEAGARPYTLAINKFADLTNEEFQASRNGYKMGSYPKSSMFSSFRYANVTAV  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-S  638
             PA MDW KKGAVT VK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD    
Sbjct  125   PASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC+GG +   F +++ NGGITTESNYPY    G C   K +   AKI G++ VP   E 
Sbjct  185   EGCNGGLMDNAFEFIISNGGITTESNYPYEGVDGTCNTKKESSSAAKITGYEDVPANSEP  244

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              L+KAVANQPVS AIDASG  FQFY  G++  D C T ++H +T VGYG+ SDG K+WL+
Sbjct  245   ALLKAVANQPVSVAIDASGSDFQFYSSGVFTGD-CGTELDHGVTAVGYGKTSDGTKYWLV  303

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENGY+++ +D    +G CGIA + S+P A
Sbjct  304   KNSWGTSWGENGYIRMQRDIDAPEGLCGIAMQASYPTA  341



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 234/334 (70%), Gaps = 9/334 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++LVLE+W   +ATAR     D  M++R+E+W+ ++GR Y ++ EK KRF IFKENV +
Sbjct  12    AVLLVLEMWTY-QATARSL--PDASMIERHEEWMAQHGRAYKDDVEKAKRFKIFKENVEY  68

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPY---YENTPFMYENVTEIPADM  473
             I SFN+AG   + + +N+FADLTN+EF++SR GYK   Y    + + F Y NVT +P  M
Sbjct  69    IQSFNEAGTRPYKLAVNKFADLTNEEFQASRNGYKMGSYGKASKVSSFRYANVTAVPTSM  128

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGCH  650
             DW +KGAVT VK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD     GC+
Sbjct  129   DWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSEDEGCN  188

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F +++ NGGITTESNYPY    G C   K +   AKI G++ VP   ES L+K
Sbjct  189   GGLMDNAFEFIISNGGITTESNYPYEAVDGTCNSKKESSHAAKITGYEDVPANSESALLK  248

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSW  1007
             AVANQPVS AIDASG  FQFY  G++   +C T ++H +T VGYG+ SDG K+WL+KNSW
Sbjct  249   AVANQPVSVAIDASGSDFQFYTSGVF-TGQCGTELDHGVTAVGYGKTSDGTKYWLVKNSW  307

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGENGY+++ +D   A+G CGIA + S+P A
Sbjct  308   GTSWGENGYIRMQRDVDAAEGLCGIAMQASYPSA  341



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 240/346 (69%), Gaps = 12/346 (3%)
 Frame = +3

Query  84    MGSRKYTHLIVFAAIIL-VLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETE  260
             M S   + LI  A ++L VL   A C      R  ++  M++++EQW+ + GRVY NE E
Sbjct  1     MASIATSKLIFTAFLMLTVLASQAVC------RNLNEASMIEKHEQWMAQNGRVYKNEAE  54

Query  261   KVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFM  440
             K  R+ IFKENV FI+SFN+AG +++ +GIN+FADLTN EF+++R GYK P   + T F 
Sbjct  55    KGNRYKIFKENVEFIESFNKAGTKSYKLGINQFADLTNVEFRAARNGYK-PKECKGTLFR  113

Query  441   YENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLL  620
             YENV+ +PA MDW KKGAVT +K+Q QCGCCWAFSAVAA EGI Q++ G L SLSEQ+L+
Sbjct  114   YENVSAVPAAMDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGIHQLKTGKLISLSEQELV  173

Query  621   DCDII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQ  794
             DCD      GC+GG +   F +++ N G+TTE+NYPY    G C  +K A+  AKI GF+
Sbjct  174   DCDTAGEDQGCNGGLMDDAFTFIINNKGLTTEANYPYQAVDGTCNTNKEAKPAAKITGFE  233

Query  795   WVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-  971
              VP   E+ L+KAVANQPVS AIDASG AFQFY  G++  D C T ++H +T VGYG+S 
Sbjct  234   DVPANNEAALLKAVANQPVSVAIDASGSAFQFYSSGVFTGD-CGTELDHGVTAVGYGKSS  292

Query  972   DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             DG K+WL+KNSWG  WGENGY+ + +D    +G CGIA + S+P A
Sbjct  293   DGTKYWLVKNSWGTSWGENGYILMQRDIDAKEGLCGIAMQSSYPTA  338



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/335 (53%), Positives = 236/335 (70%), Gaps = 10/335 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++LVL++WA  +ATAR     +  MV+R+EQW+V+YGR Y N+ EK KR++IFK+NV +
Sbjct  13    AVVLVLQMWAS-QATAR--TLPNASMVERHEQWMVQYGRTYKNDAEKAKRYNIFKDNVEY  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK----NPPYYENTPFMYENVTEIPAD  470
             I S N+A   T+ + IN+FADLTN+EF++SR GYK    +    + + F Y NV+ +P  
Sbjct  70    IQSVNEAETRTYKLAINKFADLTNEEFQASRNGYKMRSLSKSSSKVSSFRYANVSAVPPS  129

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGC  647
             +DW KKGAVTPVK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD     GC
Sbjct  130   IDWTKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGC  189

Query  648   HGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELM  827
             +GG +   F +++ N G+TTESNYPY    G C   K +   A+I G++ VP   ES L+
Sbjct  190   NGGLMDNAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSESALL  249

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNS  1004
             KAVANQP+S AIDASG  FQFY GG++   +C T ++H +T VGYG  SDG K+WL+KNS
Sbjct  250   KAVANQPISVAIDASGSDFQFYSGGVF-TGQCGTELDHGVTAVGYGVTSDGTKYWLVKNS  308

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WG  WGENGY+++ +D   A+G CGIA + S+P A
Sbjct  309   WGTSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  343



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   357 bits (917),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 178/338 (53%), Positives = 234/338 (69%), Gaps = 10/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             ++F A+ LV+ +W    + A  R   D  M +R+E W+V+YGRVY + +EK +RF+IF+ 
Sbjct  9     LMFVAL-LVVGLWV---SQAWSRSLHDAAMNERHEMWMVKYGRVYKDNSEKERRFEIFRN  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK---NPPYYENTPFMYENVTEI  461
             NV FI+SFN+ GN  + + INEFADLTN+EFK+SR GYK   N    E + F Y NVT +
Sbjct  65    NVEFIESFNKPGNRPYKLDINEFADLTNEEFKASRNGYKRSSNVGLSEKSSFRYGNVTAV  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             P  MDW +KGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD    
Sbjct  125   PTSMDWRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGE  184

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F ++  NGG+TTE+NYPY    G C  +KA    AKI G++ VP   E
Sbjct  185   DQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTDGTCNTNKAGNDAAKITGYEDVPANSE  244

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLI  995
               L+KAVA+QPVS AIDASG AFQFY GG++  D C T ++H +T VGYG SDG K+WL+
Sbjct  245   DALLKAVASQPVSVAIDASGSAFQFYSGGVFTGD-CGTELDHGVTAVGYGTSDGTKYWLV  303

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGE+GY+++ +D    +G CGIA + S+P A
Sbjct  304   KNSWGTSWGEDGYIRMERDIEAKEGLCGIAMQSSYPTA  341



>ref|XP_008803660.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
 ref|XP_008812192.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=338

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 222/313 (71%), Gaps = 3/313 (1%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   D  M  R+E+W+V+YGRVY +  EK  RF IFK NV++I+S NQAG+  + + IN+
Sbjct  27    RTIGDSLMAARHERWMVQYGRVYKDAAEKEHRFQIFKANVDYIESTNQAGHRKYKLNINQ  86

Query  357   FADLTNDEFKSSRMGYKNPPYYEN-TPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCC  533
             FADLT +EF++S  G+K  P       F Y NVT++P  +DW  KGAVTP+K+Q QCGCC
Sbjct  87    FADLTTEEFRASYTGFKPKPMRATGQNFRYANVTDVPPSVDWRSKGAVTPIKDQGQCGCC  146

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIISLGCHGGWIGAGFLYVLFNGGITTES  713
             WAFSAV A EGI QI  G L+SLSEQQL+DCD ++ GC GG +   F Y++ N GITTE+
Sbjct  147   WAFSAVVATEGIAQISTGKLTSLSEQQLVDCDKVNGGCGGGIMDDAFKYIISNKGITTEA  206

Query  714   NYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFY  893
             NYPY  K+G C  +K++ + A I G++ VPR  ES L++AVA QPVS AI+ SG  FQFY
Sbjct  207   NYPYVAKEGTCDTNKSSSVAATISGYEDVPRNSESSLLQAVAKQPVSVAIEGSGKDFQFY  266

Query  894   KGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKG  1070
              G ++    C T ++HA+TVVGYG  +DG K+WL+KNSWG  WGE GY++L++D  DA+G
Sbjct  267   SGDVF-MGNCGTDLDHAVTVVGYGTATDGTKYWLLKNSWGTTWGEKGYMRLLRDIDDAEG  325

Query  1071  ACGIATKPSFPVA  1109
              CGIA +PS+P A
Sbjct  326   LCGIAMQPSYPTA  338



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/334 (54%), Positives = 231/334 (69%), Gaps = 9/334 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A +LVLE+W+  + TAR     D   V+ +EQW+ ++GRVY +E EK KRF IFKENV +
Sbjct  12    AALLVLEMWSS-QGTAR--TLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEY  68

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENVTEIPADM  473
             I SFN+A    + + IN+FADLTN+EF +SR GYK   Y ++T    F Y NV+ +PA M
Sbjct  69    IRSFNEAAARPYRLAINKFADLTNEEFVASRNGYKMGSYMKSTKVSSFRYANVSAVPASM  128

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGCH  650
             DW +KGAVT VK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD     GC+
Sbjct  129   DWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSEDEGCN  188

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F +++ NGGITTESNYPY    G C   K +   AKI G++ VP   E  L+K
Sbjct  189   GGLMDDAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHAAKITGYEDVPANSEPALLK  248

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSW  1007
             AVANQPVS AIDASG  FQFY  G++   +C T ++H +T VGYG+ SDG K+WL+KNSW
Sbjct  249   AVANQPVSVAIDASGSDFQFYSSGVF-TGECGTELDHGVTAVGYGKTSDGTKYWLVKNSW  307

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGENGY+++ +D   A+G CGIA + S+P A
Sbjct  308   GSSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  341



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   353 bits (906),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 225/318 (71%), Gaps = 5/318 (2%)
 Frame = +3

Query  168   ARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVG  347
             A  R   D  MV R+EQW+ +YGRVY NE EK KRF+IFKENV +I+SFN+AG + + +G
Sbjct  25    ATSRTLSDSLMVVRHEQWMAQYGRVYENEVEKTKRFNIFKENVEYIESFNKAGTKPYKLG  84

Query  348   INEFADLTNDEFKSSRMGYKNP-PYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQC  524
             IN FADLTN EFK+SR GYK P     NTPF YENV+ +P  +DW  KGAVTPVK+Q QC
Sbjct  85    INAFADLTNQEFKASRNGYKLPHDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQGQC  144

Query  525   GCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGG  698
             GCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+  I  GC GG +   F +++ N G
Sbjct  145   GCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFSFIINNKG  204

Query  699   ITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGM  878
             +TTESNYPY    G C++SK++   AKI G++ VP   ES L KAVANQPVS AIDA G 
Sbjct  205   LTTESNYPYQGTDGSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGS  264

Query  879   AFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDS  1055
              FQFY  G++   +C T ++H +T VGYG   DG K+WL+KNSWG  WGE GY+++ KD 
Sbjct  265   DFQFYSSGVF-TGECGTELDHGVTAVGYGIAEDGSKYWLVKNSWGTSWGEKGYIRMQKDI  323

Query  1056  GDAKGACGIATKPSFPVA  1109
                +G CGIA + S+P A
Sbjct  324   EAKEGLCGIAMQSSYPSA  341



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/339 (52%), Positives = 232/339 (68%), Gaps = 11/339 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             ++F A+ LV+ +WA   + A  R   D  M +R+E W+ +YGRVY + +EK +RF+IF+ 
Sbjct  9     LMFVAL-LVVGLWA---SQAWSRSLHDAAMNERHEMWMAKYGRVYKDNSEKERRFEIFRN  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPP---YYENTPFMYENVTEI  461
             NV FI+SFN+ GN  + + INEFADLTN+EFK S+ GYK        E + F Y NVT +
Sbjct  65    NVEFIESFNKLGNRPYKLDINEFADLTNEEFKVSKNGYKRSSGVGLTEKSSFRYANVTAV  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             P  MDW + GAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD    
Sbjct  125   PTSMDWRQNGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGE  184

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F ++  NGG+TTE+NYPY    G C  +KA    AKI G++ VP   E
Sbjct  185   DQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTDGTCNTNKAGNDAAKITGYEDVPANSE  244

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWL  992
               L+KAVA+QPVS AIDASG AFQFY GG++  D C T ++H +T VGYG SD G K+WL
Sbjct  245   DALLKAVASQPVSVAIDASGSAFQFYSGGVFTGD-CGTELDHGVTAVGYGTSDDGTKYWL  303

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE+GY+++ +D    +G CGIA +PS+P A
Sbjct  304   VKNSWGTSWGEDGYIRMERDIEAKEGLCGIAMQPSYPTA  342



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 230/334 (69%), Gaps = 9/334 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A +LVLE+W+  + TAR     D   V+ +EQW+ ++GRVY +E EK KRF IFKENV +
Sbjct  12    AALLVLEMWSS-QGTAR--TLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEY  68

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENVTEIPADM  473
             I SFN+A    + + IN+FADLTN+EF +SR GYK   Y ++T    F Y NV+ +PA M
Sbjct  69    IRSFNEAAARPYRLAINKFADLTNEEFVASRNGYKMGSYMKSTKVSSFRYANVSAVPASM  128

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGCH  650
             DW +KGAVT VK+Q QCGCCWAFSAVAA EGI Q+    L SLSEQ+L+DCD     GC+
Sbjct  129   DWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTRKLISLSEQELVDCDTSEDEGCN  188

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F +++ NGGITTESNYPY    G C   K +   AKI G++ VP   E  L+K
Sbjct  189   GGLMDDAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHAAKITGYEDVPANSEPALLK  248

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSW  1007
             AVANQPVS AIDASG  FQFY  G++   +C T ++H +T VGYG+ SDG K+WL+KNSW
Sbjct  249   AVANQPVSVAIDASGSDFQFYSSGVF-TGECGTELDHGVTAVGYGKTSDGTKYWLVKNSW  307

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGENGY+++ +D   A+G CGIA + S+P A
Sbjct  308   GSSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  341



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/338 (53%), Positives = 234/338 (69%), Gaps = 10/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             + F A +LV  +    +AT+R   +    MV+++EQW+  +GRVY N+ EK KRF IFK+
Sbjct  9     LAFVAALLVFGMQDF-QATSRGLYET--SMVQKHEQWMTRFGRVYKNDVEKAKRFKIFKD  65

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNP---PYYENTPFMYENVTEI  461
             N+++IDSFN+AG +++ + INEFADLTNDEF+++  GYK P      E T F YENVT  
Sbjct  66    NIDYIDSFNKAGTKSYKLDINEFADLTNDEFRATHNGYKMPFQKKSPEITSFKYENVT-A  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-  638
             PA MDW  KGAVT +KNQ QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD  S 
Sbjct  125   PATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
             +GC GG +   F +++ N G+TTESNYPY      C+  K +   AKI  ++ VP   ES
Sbjct  185   MGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSES  244

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              L+KAVANQPVS AIDASG  FQFY  G++   +C T ++H +T VGYGE SDG K+WL+
Sbjct  245   SLLKAVANQPVSVAIDASGSDFQFYSSGVF-TGECGTELDHGVTAVGYGEASDGTKYWLV  303

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENGY+++ ++    +G CGIA + S+P A
Sbjct  304   KNSWGTSWGENGYIRMQRNVDAEEGLCGIAMEASYPTA  341



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 229/332 (69%), Gaps = 10/332 (3%)
 Frame = +3

Query  132   LVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDS  311
             +VL+IWA  +ATAR     D  MV+R+EQW+V+YGR Y N+ EK  RF+IFK+NV +I S
Sbjct  1     MVLQIWAS-QATARTL--PDTSMVERHEQWMVQYGRTYKNDAEKANRFNIFKDNVEYIQS  57

Query  312   FNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP----FMYENVTEIPADMDW  479
              N+A   T+ + IN+FADL ++EF++SR GYK     +++     F Y NV+ +P  MDW
Sbjct  58    VNEAETRTYKLAINKFADLKHEEFQASRNGYKMRSQSKSSSKVLSFRYANVSGVPPSMDW  117

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGCHGG  656
              KKGAVTPVK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD     GC+GG
Sbjct  118   TKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGCNGG  177

Query  657   WIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAV  836
              +   F +++ N G+TTESNYPY    G C   K +   A+I G++ VP   ES L+KAV
Sbjct  178   LMDNAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSESALLKAV  237

Query  837   ANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGE  1013
             ANQP+S AIDASG   QFY  G++   +C T ++H +T VGYG + DG K+WL+KNSWG 
Sbjct  238   ANQPISVAIDASGPDIQFYSTGVF-TGQCGTELDHGVTAVGYGATNDGTKYWLVKNSWGT  296

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGENGY+++ +D   A+G CGIA + S+P A
Sbjct  297   SWGENGYIRMQRDIHAAEGLCGIAMQASYPTA  328



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/318 (56%), Positives = 223/318 (70%), Gaps = 5/318 (2%)
 Frame = +3

Query  168   ARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVG  347
             A  R   D  MV R+EQW+ +YGRVY  E EK KRF+IFKENV +I+SFN+AG + + +G
Sbjct  23    ATSRTLSDSLMVVRHEQWMAQYGRVYKTEAEKTKRFNIFKENVEYIESFNKAGTKPYKLG  82

Query  348   INEFADLTNDEFKSSRMGYKNP-PYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQC  524
             IN FADLTN EFK+SR GYK P     NTPF YENV+ +P  +DW  KGAVTPVK+Q QC
Sbjct  83    INAFADLTNQEFKASRNGYKLPHDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQGQC  142

Query  525   GCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGG  698
             GCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+     GC GG +   F +++ N G
Sbjct  143   GCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGTDQGCEGGLMDDAFSFIINNKG  202

Query  699   ITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGM  878
             +TTESNYPY    G C++SK++   AKI G++ VP   ES L KAVANQPVS AIDA G 
Sbjct  203   LTTESNYPYQGTDGSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGS  262

Query  879   AFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDS  1055
              FQFY  G++   +C T ++H +T VGYG   DG K+WL+KNSWG  WGE GY+++ KD 
Sbjct  263   DFQFYSSGVF-TGECGTELDHGVTAVGYGIAEDGSKYWLVKNSWGTSWGEKGYIRMQKDI  321

Query  1056  GDAKGACGIATKPSFPVA  1109
                +G CGIA + S+P A
Sbjct  322   EAKEGLCGIAMQSSYPSA  339



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/335 (52%), Positives = 230/335 (69%), Gaps = 10/335 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A +LVL++W   +ATAR     D  +V+R+EQW+V+YGR Y N+ EK KRF+IFK+NV +
Sbjct  17    AAVLVLQMWVS-QATAR--TLPDASIVERHEQWMVQYGRTYKNDAEKAKRFNIFKDNVEY  73

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK----NPPYYENTPFMYENVTEIPAD  470
             I S N+     + + IN+FADLTN+EF++SR GYK    +    + + +MY NV+ +P  
Sbjct  74    IQSVNETETRAYKLAINKFADLTNEEFQASRNGYKMRSQSKSSSKVSSYMYANVSAVPPS  133

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGC  647
             MDW KKGAVTPVK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD     GC
Sbjct  134   MDWTKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGC  193

Query  648   HGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELM  827
             +GG +   F +++ N G+TTESNYPY    G C   K +   AKI G++ VP   ES L+
Sbjct  194   NGGLMDYAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPSNSESALL  253

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNS  1004
             KAV NQP+S AIDASG  FQFY  G++   +C T ++H +TVVGYG  SD  K+WL+KNS
Sbjct  254   KAVVNQPISVAIDASGSDFQFYSSGVF-TGQCGTELDHGVTVVGYGVTSDETKYWLVKNS  312

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WG  WGENGY+++ +D    +G CGIA + S+P A
Sbjct  313   WGTSWGENGYIRMQRDIDTVEGLCGIAMQASYPTA  347



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 183/338 (54%), Positives = 233/338 (69%), Gaps = 8/338 (2%)
 Frame = +3

Query  108   LIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             L +  A+ LV    A   AT+R  LD    M  R+EQW+ +YGRVY NE EK KR++IFK
Sbjct  6     LKLLIALALVFATSAYL-ATSRTLLDS--LMAVRHEQWMAQYGRVYKNEVEKTKRYNIFK  62

Query  288   ENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPY-YENTPFMYENVTEIP  464
             ENV +I+SFN+AG + + +GIN FADLTN EF +SR GY  P     NTPF YENV+ +P
Sbjct  63    ENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYILPHECSSNTPFRYENVSAVP  122

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--IS  638
               +DW KKGAVTPVK+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+  I 
Sbjct  123   TTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGID  182

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ N G+TTESNYPY    G C++SK++   AKI G++ VP   ES
Sbjct  183   QGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGSCKKSKSSNSAAKISGYEDVPANSES  242

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLI  995
              L KAVANQPVS AIDA G  FQFY  G++   +C T ++H +T VGYG   DG K+WL+
Sbjct  243   ALEKAVANQPVSVAIDAGGSDFQFYSSGVF-TGECGTELDHGVTAVGYGIAEDGSKYWLV  301

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGE GY+++ KD    +G CGIA + S+P A
Sbjct  302   KNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  339



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/332 (52%), Positives = 225/332 (68%), Gaps = 7/332 (2%)
 Frame = +3

Query  129   ILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFID  308
             +LVL +WA   A  R   +D + M +R+EQW+  YGR Y +++EK KRF IFK NV +I+
Sbjct  14    LLVLGMWAAL-ANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIFKSNVEYIE  72

Query  309   SFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYE--NTPFMYENVTEIPADMDWV  482
             S N+AGN+ + +GINEFAD TN+EF++SR GYK  P     N  F YE+VT++P+ +DW 
Sbjct  73    SVNKAGNKPYKLGINEFADQTNEEFRASRNGYKRSPIPRPINPSFRYESVTKVPSSVDWR  132

Query  483   KKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGG  656
             KKGAVTPVK+Q QCGCCWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD      GC GG
Sbjct  133   KKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDTSGTDQGCEGG  192

Query  657   WIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAV  836
              +   F ++L N G+TTES YPY      C + KA+   A I G + VP   E  L KAV
Sbjct  193   LMDDAFDFILGNEGLTTESKYPYKGVDETCNKKKASSHAASITGHEDVPANSEKALQKAV  252

Query  837   ANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGE  1013
             ANQPVS AIDA G  FQ Y  G++   +C T ++H +T VGYG++ DG K+WL+KNSWG 
Sbjct  253   ANQPVSVAIDAGGSDFQLYSSGVF-TGECGTELDHGVTAVGYGKTEDGTKYWLVKNSWGS  311

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGE GY+++ +D    +G CGIA + S+P A
Sbjct  312   SWGEEGYIRMERDVDAEEGLCGIAMEASYPSA  343



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/337 (52%), Positives = 228/337 (68%), Gaps = 11/337 (3%)
 Frame = +3

Query  120   AAIILVLEI-WACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A+I+ VL   + C  A A   L++D  MV R+EQW+ +Y RVY +  EK +RF++FK NV
Sbjct  6     ASILAVLSFAFFCGAALAARDLNEDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIP  464
              FI+SFN  GN  F +GIN+FADLTNDEF++++   G+K      +T F YENV+   IP
Sbjct  66    KFIESFNTGGNRKFWLGINQFADLTNDEFRTTKTNKGFKPSLDKVSTGFRYENVSVDAIP  125

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW   GAVTP+K+Q QCGCCWAFSAVAA EGI +I  G L SLSEQ+L+DCD+    
Sbjct  126   ATIDWRTNGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGED  185

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTESNYPY    G C+    +   A IKG++ VP   E+
Sbjct  186   QGCEGGLMDDAFKFIIKNGGLTTESNYPYTAADGKCK--SGSNSAANIKGYEDVPTNDEA  243

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG K+WL+
Sbjct  244   ALMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGKTSDGTKYWLM  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             KNSWG  WGENGYL++ KD  D KG CG+A +PS+P 
Sbjct  303   KNSWGTTWGENGYLRMEKDISDKKGMCGLAMEPSYPT  339



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 226/333 (68%), Gaps = 11/333 (3%)
 Frame = +3

Query  129   ILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFID  308
             IL L ++ C  A A   L+DD  MV R+EQW+ +Y RVY + TEK +RF++FK NV FI+
Sbjct  11    ILGLALF-CGAALAARDLNDDSAMVARHEQWMAQYNRVYKDATEKAQRFEVFKANVKFIE  69

Query  309   SFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPADMD  476
             SFN  GN  F +G+N+FADLTNDEF++++   G+K  P    T F YENV+   +PA +D
Sbjct  70    SFNAGGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPVKVPTGFRYENVSVDALPASID  129

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCH  650
             W  KGAVTP+K+Q QCGCCWAFSAVAA EGI +I    L SLSEQ+L+DCD+     GC 
Sbjct  130   WRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTDKLISLSEQELVDCDVHGEDQGCE  189

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F +++ NGG+TTES+YPY    G C+    +   A IKGF+ VP   E+ LMK
Sbjct  190   GGLMDDAFKFIIKNGGLTTESSYPYTATDGKCKSGTNSA--ANIKGFEDVPANDEAALMK  247

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSW  1007
             AVANQPVS A+D   M FQ Y GG+     C T ++H I  +GYG+ SDG K+WL+KNSW
Sbjct  248   AVANQPVSVAVDGGDMTFQLYSGGVM-TGSCGTDLDHGIAAIGYGQTSDGTKYWLLKNSW  306

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             G  WGENGYL++ KD  D +G CG+A +PS+P 
Sbjct  307   GTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 230/336 (68%), Gaps = 15/336 (4%)
 Frame = +3

Query  123   AIILVLEIWACCEATARW-RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
             A++L+L +W     +  W R   +  M++R+E W+ +YGR Y    EK +R +IFK NV 
Sbjct  35    AVVLLLGLWT----SHVWSRSLYEASMMERHETWMAQYGRAYKGHVEKERRLNIFKNNVE  90

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENVTEIPAD  470
             FI+SFN+ G + + + +NEFADLTN+EF++SR GYK   +  ++   PF YENV+ +P+ 
Sbjct  91    FIESFNKVGKKPYKLSVNEFADLTNEEFQASRNGYKMSAHLSSSSTKPFRYENVSAVPST  150

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLG  644
             MDW KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      G
Sbjct  151   MDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLSTGKLISLSEQELVDCDTSGEDQG  210

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C+GG +   F +++ N G+TTE+NYPY    G C   KAA   AKI G++ VP   E+ L
Sbjct  211   CNGGLMDDAFDFIIQNKGLTTEANYPYQGADGACNSGKAA---AKITGYEDVPANSEAAL  267

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKN  1001
             +KAVANQPVS AIDA G AFQFY  G++  D C T ++H +T VGYG S DG K+WL+KN
Sbjct  268   LKAVANQPVSVAIDAGGSAFQFYSSGVFTGD-CGTDLDHGVTAVGYGMSDDGTKYWLVKN  326

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGENGY+++ +D    +G CGIA + S+P A
Sbjct  327   SWGTSWGENGYIRMERDIDAQEGLCGIAMEASYPTA  362



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/337 (51%), Positives = 226/337 (67%), Gaps = 10/337 (3%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F A IL+L  WA   A+   R   +  M  R+EQW+  YG+VYA+  EK +RF+IFK+NV
Sbjct  10    FFAFILILGTWAYEVAS---RELQEPSMSARHEQWMETYGKVYADAAEKERRFEIFKDNV  66

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYEN---TPFMYENVTEIPA  467
              +I+SFN AGN+ + + +N+FADLTN+E K +R GY+ P        T F YENVT +PA
Sbjct  67    EYIESFNTAGNKPYKLSVNKFADLTNEELKVARNGYRRPLQTRPMKVTSFKYENVTAVPA  126

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              MDW KKGAVTP+K+Q QCG CWAFS VAA EGI Q+  G L SLSEQ+L+DCD      
Sbjct  127   TMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQ  186

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +  GF +++ N GITTE+NYPY    G C   K A   AKI G++ VP   E+ 
Sbjct  187   GCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSRKEASRIAKITGYESVPANSEAA  246

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIK  998
             L+KAVA+QP+S +IDA G  FQFY  G++   +C T ++H +T VGYGE SDG K+WL+K
Sbjct  247   LLKAVASQPISVSIDAGGSDFQFYSSGVF-TGQCGTELDHGVTAVGYGETSDGTKYWLVK  305

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG  WGE GY+++ +D+   +G CGIA   S+P A
Sbjct  306   NSWGTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPTA  342



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 170/336 (51%), Positives = 231/336 (69%), Gaps = 15/336 (4%)
 Frame = +3

Query  123   AIILVLEIWACCEATARW-RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
             A++L+L +W     +  W R   +  M++R+E W+ +YGR Y +  EK +R + FK NV 
Sbjct  35    AVVLLLGLWT----SHVWSRSLYEASMMERHETWMAQYGRAYKDRVEKERRLNTFKNNVE  90

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENVTEIPAD  470
             FI+SFN+ G + + + +NEFADL N+EF++SR GYK P +  ++   PF YEN++ +P+ 
Sbjct  91    FIESFNKDGKKPYKLSVNEFADLMNEEFRASRNGYKMPAHLSSSSTNPFRYENISAVPST  150

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLG  644
             MDW KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      G
Sbjct  151   MDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLSTGKLISLSEQELVDCDTSGEDQG  210

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C+GG++   F +++ N G+TTE+NYPY    G C   KAA   AKI G++ VP   E+ L
Sbjct  211   CNGGFMDDAFEFIIQNKGLTTEANYPYQGADGTCNSGKAA---AKITGYEDVPANSEAAL  267

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKN  1001
             +KAVANQPVS AIDA G AFQFY  G++  D C T ++H +T VGYG S DG K+WL+KN
Sbjct  268   LKAVANQPVSVAIDAGGSAFQFYSSGVFTGD-CGTDLDHGVTAVGYGMSDDGTKYWLVKN  326

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGENGY+++ +D    +G CGIA + S+P A
Sbjct  327   SWGTSWGENGYIRMERDIDAKEGLCGIAMEASYPTA  362



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 178/338 (53%), Positives = 235/338 (70%), Gaps = 11/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             + F A+ LVL + A  +AT+R   +    MV+++EQW+  +GRVY ++ EK KRF+IFK+
Sbjct  9     LAFVAL-LVLGMQAS-QATSRGLYETS--MVQKHEQWMTHFGRVYKDDVEKAKRFNIFKD  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYY---ENTPFMYENVTEI  461
             N  +I+S N+AG + + + INEFADLTN+EF+++R GYK P      E T F YENVT  
Sbjct  65    NTKYINSVNKAGIKPYKLDINEFADLTNEEFRATRNGYKMPSQKKSPEITSFKYENVT-A  123

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-  638
             PA MDW  KGAVT +KNQ QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD  S 
Sbjct  124   PATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
             +GC GG +   F +++ N G+TTESNYPY    G C+  K +   AKI  ++ VP   ES
Sbjct  184   MGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESSHAAKITSYEDVPANSES  243

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              L+KAVANQPVS AIDASG  FQFY  G++   +C T ++H +T VGYGE SDG K+WL+
Sbjct  244   ALLKAVANQPVSVAIDASGSDFQFYSSGVF-TGECGTELDHGVTAVGYGEASDGTKYWLV  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENGY+++ ++    +G CGIA + S+P A
Sbjct  303   KNSWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  340



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   344 bits (882),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 218/309 (71%), Gaps = 7/309 (2%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             +VKR+EQW+  +GRVY ++ EK KRF IFK+N  +IDS N AG + + + +NEFADLTND
Sbjct  16    IVKRHEQWMARFGRVYKDDAEKAKRFKIFKDNTEYIDSVNMAGIKPYKLDVNEFADLTND  75

Query  378   EFKSSRMGYKNPPYY---ENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSA  548
             EF+ +R GY+ P +    E T F YENVT  PA MDW KKGAVT +K+Q QCGCCWAFSA
Sbjct  76    EFRVTRNGYRMPSHKKSPEITSFKYENVT-APATMDWRKKGAVTGIKDQGQCGCCWAFSA  134

Query  549   VAAIEGIKQIRAGILSSLSEQQLLDCDIIS-LGCHGGWIGAGFLYVLFNGGITTESNYPY  725
             VAA EGI +I+ G L SLSEQ+L+DCD  S +GC GG +   F +++ N G+TTESNYPY
Sbjct  135   VAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPY  194

Query  726   AMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGI  905
                   C+  K +   AKI  ++ VP   ES L+KAVANQPVS AIDASG  FQFY  G+
Sbjct  195   EGTDSTCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVAIDASGSDFQFYSSGV  254

Query  906   YGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGI  1082
             +   +C T ++H +T VGYGE SDG K+WL+KNSWG  WGENGY+++ ++    +G CGI
Sbjct  255   F-TGECGTELDHGVTAVGYGEASDGTKYWLVKNSWGTSWGENGYIRMQRNVDTEEGLCGI  313

Query  1083  ATKPSFPVA  1109
             A + S+P A
Sbjct  314   AMEASYPTA  322



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   344 bits (883),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/317 (52%), Positives = 223/317 (70%), Gaps = 7/317 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R  +D+ MV+R+EQW+  +GRVY ++ EK +RF IFK+NV FI++FNQAG   + +G+N+
Sbjct  22    RTLNDEAMVERHEQWMSLHGRVYTDDAEKERRFQIFKKNVEFIEAFNQAGKRPYKLGVNQ  81

Query  357   FADLTNDEFKSSRMGYKNPPYYE---NTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCG  527
             FADLTN+EFK+SR G+K     +      F YENVT +PA MDW KKGAV P+K+Q QCG
Sbjct  82    FADLTNEEFKASRNGFKASSSLKLIRGASFKYENVTAVPATMDWRKKGAVAPIKDQGQCG  141

Query  528   CCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS--LGCHGGWIGAGFLYVLFNGGI  701
              CWAFSA+AA EGI ++  G L SLSEQ+++DCD  S   GC+GG +   F +++ N GI
Sbjct  142   SCWAFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCNGGEMEDAFAFIVKNKGI  201

Query  702   TTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMA  881
              +E+ YPY    G C ++K A   AKI G++ VP   E+ L+KAVANQPVS +IDASGMA
Sbjct  202   ASEATYPYTAADGTCSKTKEASHAAKIAGYEKVPANNEAALLKAVANQPVSVSIDASGMA  261

Query  882   FQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSWGEGWGENGYLKLIKDSG  1058
             FQFY  G++  D C T ++H +T VGYG+ S+G K+WL+KNSWG  WGE+GY+++ +   
Sbjct  262   FQFYTSGVFTGD-CGTDLDHGVTAVGYGKASNGTKYWLVKNSWGTSWGESGYIRMQRGIS  320

Query  1059  DAKGACGIATKPSFPVA  1109
               +G CGIA   S+P A
Sbjct  321   AKEGLCGIAMDSSYPTA  337



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   345 bits (884),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 173/337 (51%), Positives = 225/337 (67%), Gaps = 10/337 (3%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F AI L+L  WAC + T R     +  M  R+EQW+  +G+VYA+  EK +RF+IFK+NV
Sbjct  10    FFAIFLILGTWAC-QVTPREL--QEPSMSARHEQWMATFGKVYADAAEKERRFEIFKDNV  66

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYEN---TPFMYENVTEIPA  467
              +I+SFN AGN+ + + +N+FADLTN+E K +R GY+ P        T F YENVT +PA
Sbjct  67    EYIESFNTAGNKPYKLSVNKFADLTNEELKIARNGYRRPLQTRPMKVTSFEYENVTAVPA  126

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              MDW KKGAVTP+K+Q QCG CWAFS VAA EGI Q+  G L SLSEQ+L+DCD      
Sbjct  127   TMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQ  186

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +  GF +++ N GIT+E+NYPY    G C   K A   AKI G++ VP   E+ 
Sbjct  187   GCEGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGYESVPANSEAA  246

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIK  998
             L+KAVANQP+S +IDA G  FQFY  G++   +C T ++H +T VGYGE SDG K+WL K
Sbjct  247   LLKAVANQPISVSIDAGGSDFQFYSSGVF-TGQCGTELDHGVTAVGYGETSDGTKYWLFK  305

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  306   NSWGTSWGEAGYIRMQRDIDAEEGLCGIAMDSSYPTA  342



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   345 bits (884),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 223/336 (66%), Gaps = 14/336 (4%)
 Frame = +3

Query  132   LVLEIWACC----EATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
              +L I  C      A A   L DD  MV R+EQW+ +Y RVY +  EK +RF++F  NV 
Sbjct  7     FLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFNANVK  66

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPA  467
             FI+SFN AGN  F +G+N+FADLTNDEF++++   G+K+ P    T F YENV+   +PA
Sbjct  67    FIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTGFRYENVSIDALPA  126

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +I  G L SLSEQ+L+DCD+     
Sbjct  127   TIDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQ  186

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F +++ NGG+TTES YPY    G C+    +   A IKG++ VP   E+ 
Sbjct  187   GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIK  998
             LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG  +WL+K
Sbjct  245   LMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGKASDGTNYWLMK  303

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             NSWG  WGENGYL++ KD  D +G CG+A +PS+P 
Sbjct  304   NSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 229/332 (69%), Gaps = 7/332 (2%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             I+L+L +WA  + T+R  + +   M++R+E+W+  YGRVY NE EK+ R+ IFK+NV FI
Sbjct  12    IVLILTLWAY-QTTSRL-VPERLAMLERHEEWMERYGRVYKNEEEKMMRYKIFKDNVEFI  69

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMG-YKNPPYYENTPFMYENVTEIPADMDWV  482
             ++FN AG   + +GIN FAD TN+EFK++R G +K     + TPF YENV+ +P+ MDW 
Sbjct  70    EAFNAAGTRPYKLGINAFADQTNEEFKAARNGLFKVQKLSKATPFKYENVSALPSSMDWR  129

Query  483   KKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS--LGCHGG  656
             KKGAVTPVK+Q QCG CWAFSA+AA EGI QI  G L SLSEQ+++DCD  S   GC GG
Sbjct  130   KKGAVTPVKDQGQCGSCWAFSAIAATEGINQISTGKLISLSEQEIVDCDKTSQDQGCEGG  189

Query  657   WIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAV  836
             ++   F +++ N GI +ES YPY+   G C + + + I AKI  ++ VP   E  L+KAV
Sbjct  190   YMEDAFEFIIDNKGIASESTYPYSATDGTCNKKEESPIAAKITSYEKVPENNEKALLKAV  249

Query  837   ANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSWGE  1013
             A QPVS +IDA GM FQFY  G++  D C T ++H +T VGYG+ SDG K+WL+KNSWG 
Sbjct  250   AKQPVSVSIDAGGMEFQFYSSGVFTGD-CGTDLDHGVTAVGYGKTSDGTKYWLVKNSWGT  308

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGE GY+ + +D    +G CGIA   S+P+A
Sbjct  309   SWGEEGYIMMERDVAAKEGLCGIAMDSSYPIA  340



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 215/315 (68%), Gaps = 5/315 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   D  M +RYEQW   YGRVY +  EK KRF IFK+NV  I++FN+A  + + + +NE
Sbjct  28    RTLQDAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKQNVAHIEAFNKASKKPYKLAVNE  87

Query  357   FADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCC  533
             FADLTN+EFK SR  +K     E T PF YENVT +P+ MDW KKGAVTPVK+Q QCGCC
Sbjct  88    FADLTNEEFKVSRNRFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCC  147

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITT  707
             WAFSAVAAIEGI Q+  G L+SLSEQ+L+DCD+     GC+GG +   F +V  N GITT
Sbjct  148   WAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITT  207

Query  708   ESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQ  887
             E+NYPY    G C   + A   AKI G + VP   E+ LMKAVANQPVS AIDA G  FQ
Sbjct  208   ETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQ  267

Query  888   FYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSWGEGWGENGYLKLIKDSGDA  1064
             FY  G++  D C T ++H +T VGYG +D G K+WL+KNSWG  WGE GY+++ +D    
Sbjct  268   FYSSGVFTGD-CGTELDHGVTAVGYGAADDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAK  326

Query  1065  KGACGIATKPSFPVA  1109
             +G CGIA + S+P A
Sbjct  327   QGLCGIAMQASYPTA  341



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 231/336 (69%), Gaps = 9/336 (3%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
              A I L++ +    +AT+R   +    MV++++QW+  +GRVY ++ EK KRF IFK+N 
Sbjct  9     LAFIALLVLVMQASQATSRGLYET--SMVQKHDQWMTRFGRVYKDDVEKAKRFKIFKDNT  66

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYY---ENTPFMYENVTEIPA  467
              +IDSFN+AG + + + INEFADLTN+EF+++  GY+ P      E T F YENVT  PA
Sbjct  67    EYIDSFNKAGTKPYKLDINEFADLTNEEFRATHNGYRMPSQKKSPEITSFKYENVT-APA  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-LG  644
              MDW KKGAVT +K+Q QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD  S +G
Sbjct  126   TMDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMG  185

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C GG +   F +++ N G+TTESNYPY      C+  K +   AKI  ++ VP   ES+L
Sbjct  186   CEGGLMDDAFKFIIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESDL  245

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKN  1001
             +KAVANQPVS AIDAS   FQFY  G++   +C T ++H +T VGYG+ SDG K+WL+KN
Sbjct  246   LKAVANQPVSVAIDASASDFQFYSSGVF-TGECGTELDHGVTAVGYGKASDGTKYWLVKN  304

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGENGY+++ ++    +G CGIA + S+P A
Sbjct  305   SWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  340



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 224/330 (68%), Gaps = 8/330 (2%)
 Frame = +3

Query  132   LVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDS  311
             +VL +W    ATA    D+   M +R+EQW+V+YGRVY +  EK +RF IF++N  +I+S
Sbjct  1     MVLGVWVS-GATAHGIADE--PMSRRHEQWMVQYGRVYMDAAEKERRFQIFRDNYEYIES  57

Query  312   FNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDWVKK  488
              N+AG+  + +G+N+FAD+TN EFK+S +G+K  P    T  F Y N+T+ P  MDW  +
Sbjct  58    VNRAGDRKYKLGLNQFADMTNGEFKASHLGFKPMPMESKTGSFQYANLTDAPHSMDWRTR  117

Query  489   GAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWI  662
             GAVT VKNQ+ CGCCWAFS+VAAIE I QI+ G L  LSEQQL+DCD    + GCHGG++
Sbjct  118   GAVTAVKNQRSCGCCWAFSSVAAIEAITQIKTGNLVYLSEQQLVDCDANDGNHGCHGGFM  177

Query  663   GAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVAN  842
                F YV+ NGGITTE+NYPY    G C  ++A+   A I G++ VP   ES L++AV N
Sbjct  178   TGAFQYVINNGGITTENNYPYRANDGTCDTNRASSSAATIGGYESVPANDESSLLQAVTN  237

Query  843   QPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGW  1019
             QPVS  ID SG  F+ YKGGI+    C T +NHA+T VGYG + DG K+WL+KNSWG  W
Sbjct  238   QPVSVGIDGSGQDFRHYKGGIF-TGACETNMNHAVTAVGYGTAEDGTKYWLVKNSWGTTW  296

Query  1020  GENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             GE GY+++ +D    +G CGIA   S+P A
Sbjct  297   GEMGYMRIQRDVAAPEGLCGIAKLASYPTA  326



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/332 (52%), Positives = 227/332 (68%), Gaps = 7/332 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ +L  W   ++TAR  LD    M +R+EQW+ +YGRVY ++TE+  R+ IFKENV  
Sbjct  13    ALLFILGAWPS-KSTARTLLDA--PMYERHEQWMTQYGRVYKDDTERATRYSIFKENVAR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDW  479
             ID+FN    +++ +G+N+FADLTN+EFK+SR  +K         PF YENV+ +P+ MDW
Sbjct  70    IDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPSTMDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              K+GAVTPVK+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+++DCD      GC+G
Sbjct  130   RKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPY    G C  +KAA   AKI GF+ VP   E+ LMKA
Sbjct  190   GLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAALMKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGE  1013
             VA QPVS AIDA G  FQFY  GI+    C T ++H +T VGYG SDG K+WL+KNSWG 
Sbjct  250   VAKQPVSVAIDAGGSDFQFYSSGIF-TGSCDTQLDHGVTAVGYGVSDGSKYWLVKNSWGA  308

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGE GY+++ KD    +G CGIA + S+P A
Sbjct  309   QWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  340



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/314 (53%), Positives = 221/314 (70%), Gaps = 7/314 (2%)
 Frame = +3

Query  186   DDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFAD  365
             +D+ MV+RYEQW+  +GRVY +  EK +RF IFK+NV FI+SFN+AGN  + +GIN+FAD
Sbjct  24    NDEAMVERYEQWMSLHGRVYKDSAEKERRFKIFKDNVEFIESFNRAGNRPYKLGINQFAD  83

Query  366   LTNDEFKSSRMGYK---NPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCW  536
             LTN+EF +S  G K   +P  + +T F YENVT +PA +DW  KGAVTP+K+Q QCG CW
Sbjct  84    LTNEEFVASHNGLKMSSSPRLFMSTSFKYENVTAVPATVDWRTKGAVTPIKDQGQCGSCW  143

Query  537   AFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS--LGCHGGWIGAGFLYVLFNGGITTE  710
             AFSA+AA EGI ++  G L SLSEQ+++DCD  S   GC GG++   F +++ N GI TE
Sbjct  144   AFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCSGGYMEDAFEFIVKNKGIATE  203

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             + YPY    G C ++K A   AKI  ++ VP   E+ L+KAVANQPVS +IDA GMAFQF
Sbjct  204   TTYPYTAADGTCSKTKEASHAAKIASYEKVPANSEAALLKAVANQPVSVSIDAGGMAFQF  263

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAK  1067
             Y  G++  D C T ++H +T VGYG+ S+G K+WL+KNSWG  WGE+GY+K+ +     +
Sbjct  264   YSSGVFTGD-CGTDLDHGVTAVGYGKTSNGTKYWLVKNSWGTSWGESGYIKMKRGIAAKE  322

Query  1068  GACGIATKPSFPVA  1109
             G CGIA   S+P A
Sbjct  323   GLCGIAMDSSYPTA  336



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 214/315 (68%), Gaps = 5/315 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   D  M +RYEQW   YGRVY +  EK KRF IFK NV  I++FN+A  + + + +NE
Sbjct  28    RALQDAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKRNVAHIEAFNKASKKPYKLAVNE  87

Query  357   FADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCC  533
             FADLTN+EFK SR  +K     E T PF YENVT +P+ MDW KKGAVTPVK+Q QCGCC
Sbjct  88    FADLTNEEFKVSRNRFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCC  147

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITT  707
             WAFSAVAAIEGI Q+  G L+SLSEQ+L+DCD+     GC+GG +   F +V  N GITT
Sbjct  148   WAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITT  207

Query  708   ESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQ  887
             E+NYPY    G C   + A   AKI G + VP   E+ LMKAVANQPVS AIDA G  FQ
Sbjct  208   ETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGSDFQ  267

Query  888   FYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSWGEGWGENGYLKLIKDSGDA  1064
             FY  G++  D C T ++H +T VGYG +D G K+WL+KNSWG  WGE GY+++ +D    
Sbjct  268   FYSSGVFTGD-CGTELDHGVTAVGYGAADDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAK  326

Query  1065  KGACGIATKPSFPVA  1109
             +G CGIA + S+P A
Sbjct  327   EGLCGIAMQASYPTA  341



>gb|AGT16936.1| vignain-like protein [Saccharum hybrid cultivar R570]
Length=341

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 232/334 (69%), Gaps = 13/334 (4%)
 Frame = +3

Query  132   LVLEIWACCEATARWRLDDDDE-MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFID  308
             +++  + C  A A   L+DDD  MV+R+EQW+ +Y RVY + TEK +RF++FK NV FI+
Sbjct  11    ILVGAFLCSAALAARDLNDDDSAMVERHEQWMAQYSRVYKDATEKAQRFEVFKVNVKFIE  70

Query  309   SFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPADMD  476
             SFN A N  F +G+N+FADLT DEF++++   G+K       T F YENV+   +PA +D
Sbjct  71    SFNAARNRKFWLGVNQFADLTIDEFRATKTNKGFKPSRVKVPTGFRYENVSVDVLPASVD  130

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCH  650
             W  KGAVTP+K+Q QCGCCWAFSAVAA EGI +I  G L+SLSEQ+L+DCD+     GC 
Sbjct  131   WRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLTSLSEQELIDCDVHGEDQGCE  190

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQ-RSKAAQIEAKIKGFQWVPRFRESELM  827
             GG +   F +++ NGG+TTES+YPY    G C+ RS +A   A IKG++ VP   E+ LM
Sbjct  191   GGLMDDAFKFIVKNGGLTTESSYPYTAADGKCKSRSNSA---ATIKGYEDVPANDEAALM  247

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNS  1004
             KAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG K+WL+KNS
Sbjct  248   KAVANQPVSVAVDGGDMTFQFYSGGVIA-GSCGTNLDHGIAAIGYGKTSDGTKYWLMKNS  306

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             WG  WGENGYL++ KD  D +G CG+A +PS+P+
Sbjct  307   WGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPI  340



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   343 bits (879),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 228/334 (68%), Gaps = 9/334 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ ++ IWAC    A  R   +  M  R+EQW+   GRVY + +EK KR  IFKENV +
Sbjct  9     ALLFIVGIWAC---QASSRSVPEVSMSDRFEQWLASCGRVYQDASEKEKRLQIFKENVEY  65

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYEN--TPFMYENVTEIPADMD  476
             I+S N   ++ + +G+NEF DLTN+EFK+ R GYK  P   +  + F YENV  +P+ MD
Sbjct  66    IESHNADTSKKYKLGVNEFTDLTNEEFKAMRNGYKLRPSTSSKKSSFRYENVAAVPSSMD  125

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCH  650
             W KKGAVT +K+Q QCGCCWAFSAVAA+EGI Q++ G L SLSEQ+L+DCDI     GC+
Sbjct  126   WRKKGAVTNIKDQGQCGCCWAFSAVAAMEGINQLKTGKLISLSEQELVDCDINGEDQGCN  185

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG++   F +++ N G+TTESNYPY    G C + KAA   A+I  F+ VP   E+ L+K
Sbjct  186   GGFMDNAFEFIISNKGLTTESNYPYEGVDGSCNKKKAANHAAQITSFEDVPSNSEAALLK  245

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSW  1007
             AVANQPVS AIDA G  FQ YK GI+   +C+T ++H +T VGYG + DG K+WL+KNSW
Sbjct  246   AVANQPVSVAIDAGGSDFQHYKSGIF-TGECSTFLDHGVTAVGYGTADDGTKYWLVKNSW  304

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGE+GY+++ +D    +G CGIA + S+P A
Sbjct  305   GTSWGEDGYIRMQRDIDAEEGLCGIAMEASYPTA  338



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   343 bits (879),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 222/336 (66%), Gaps = 14/336 (4%)
 Frame = +3

Query  132   LVLEIWACC----EATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
              +L I  C      A A   L DD  MV R+EQW+ +Y RVY +  EK +RF++FK NV 
Sbjct  7     FLLAILGCAFLFSGALAARTLSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVK  66

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPA  467
             FI+SFN AGN  F +G+N+FADLTNDEF++++   G+K  P    T F YENV+   +PA
Sbjct  67    FIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPMKVPTGFRYENVSIDALPA  126

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +I  G L SLSEQ+L+DCD+     
Sbjct  127   TIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQ  186

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F +++ NGG+TTES YPY    G C+    +   A IK ++ VP   E+ 
Sbjct  187   GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCK--SGSNSAATIKSYEDVPANNEAA  244

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIK  998
             LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG  +WL+K
Sbjct  245   LMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGKASDGTNYWLMK  303

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             NSWG  WGENGYL++ KD  D +G CG+A +PS+P 
Sbjct  304   NSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score =   343 bits (879),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 227/334 (68%), Gaps = 5/334 (1%)
 Frame = +3

Query  114   VFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKEN  293
             +F   +L+L  WA     A   LD+ + M+KR+E+W+ ++GRVY +  EK KR+ IFKEN
Sbjct  10    IFVPFLLILAAWAT--KIACRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKEN  67

Query  294   VNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPAD  470
             +  I++FN   +  + +G+N+FADLTN+EF++   GYK       ++ F YEN+++IP  
Sbjct  68    IERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMYHGYKRQSSKLMSSSFRYENLSDIPTS  127

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIISLGCH  650
             MDW   GAVTPVK+Q  CGCCWAFS VAAIEGI +++ G L SLSEQQL+DC   + GC 
Sbjct  128   MDWRNDGAVTPVKDQGTCGCCWAFSTVAAIEGIIKLQTGNLISLSEQQLVDCTAGNKGCQ  187

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F Y++ NGG+T+E NYPY    G C   KAA  EA+I G++ VP+  E+ L++
Sbjct  188   GGHMDTAFQYIIRNGGLTSEDNYPYQGVDGTCSSEKAASTEAQITGYEDVPQNNENALLQ  247

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSW  1007
             AVA QPVS A++  G  FQFYK G++  D C T +NHA+T +GYG +SDG  +WL+KNSW
Sbjct  248   AVAKQPVSVAVEGGGHDFQFYKSGVFEGD-CGTNLNHAVTAIGYGTDSDGTDYWLVKNSW  306

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGENGY+++ +  G ++G CG+A   S+P A
Sbjct  307   GTSWGENGYMRMRRGIGSSEGLCGVAMDASYPTA  340



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score =   343 bits (879),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 225/339 (66%), Gaps = 14/339 (4%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F A IL+L +WA   A+   R   +  M  R+EQW+  YG+VY +  EK +RF IFK NV
Sbjct  10    FFAFILILGMWAFEVAS---RELQESYMSARHEQWMATYGKVYVDAAEKERRFKIFKNNV  66

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP-----FMYENVTEI  461
              +I+SFN AGN+ + + +N+FAD TN++FK +R GY+ P  ++  P     F YENVT +
Sbjct  67    EYIESFNTAGNKPYKLSVNKFADQTNEKFKGARNGYRRP--FQTRPMKVTSFKYENVTAV  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             PA MDW KKGAVTP+K+Q QCG CWAFS VAA EGI Q+  G L SLSEQ+L+DCD    
Sbjct  125   PATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDNQGE  184

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +  GF +++ N GITTE+NYPY    G C   K A   AKI G++ VP   E
Sbjct  185   DQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKKQASHIAKITGYESVPANSE  244

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWL  992
             +EL+K VANQP+S +IDA G  FQFY  G++   KC T ++H +T VGYGE SDG K+WL
Sbjct  245   AELLKVVANQPISVSIDAGGSDFQFYSSGVF-TGKCGTELDHGVTAVGYGETSDGTKYWL  303

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  304   VKNSWGTSWGEEGYIRMQRDIDTEEGLCGIAMDSSYPTA  342



>ref|XP_004974539.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   342 bits (878),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 222/336 (66%), Gaps = 14/336 (4%)
 Frame = +3

Query  132   LVLEIWACC----EATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
              +L I  C      A A   L DD  MV R+EQW+ +Y RVY +  EK +R ++F  NV 
Sbjct  7     FLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEVFNANVK  66

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPA  467
             FI+SFN AGN  F +G+N+FADLTNDEF++++   G+K+ P    T F YENV+   +PA
Sbjct  67    FIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTGFRYENVSIDALPA  126

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +I  G L SLSEQ+L+DCD+     
Sbjct  127   TIDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQ  186

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F +++ NGG+TTES YPY    G C+    +   A IKG++ VP   E+ 
Sbjct  187   GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIK  998
             LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG  +WL+K
Sbjct  245   LMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGKASDGTNYWLMK  303

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             NSWG  WGENGYL++ KD  D +G CG+A +PS+P 
Sbjct  304   NSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/329 (51%), Positives = 228/329 (69%), Gaps = 11/329 (3%)
 Frame = +3

Query  144   IWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQA  323
             +WA  ++TAR        M++++EQW+++YGR Y ++ EK  R+ IFK+NV +I S ++A
Sbjct  1     MWAS-QSTARTL--PHKSMIEKHEQWMLQYGRTYKDDAEKAFRYKIFKQNVEYIQSVDEA  57

Query  324   GNETFTVGINEFADLTNDEFKSSRMGYKN-----PPYYENTPFMYENVTEIPADMDWVKK  488
              N T+ + IN+FADLT+DEFK+SR G+K         +E + F Y NV+ +P  +DW KK
Sbjct  58    ENRTYKLAINKFADLTSDEFKASRNGFKMGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKK  117

Query  489   GAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGCHGGWIG  665
             GAVTPVK+Q QCGCCWAFSAVAA EG+ Q++ G L SLSEQ+L+DCD     GC+GG + 
Sbjct  118   GAVTPVKDQGQCGCCWAFSAVAATEGLNQLKTGKLISLSEQELVDCDTSEDQGCNGGLMD  177

Query  666   AGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQ  845
               F +++ N G+TTESNYPY    G C   K +   AKI G++ VP   ES L+KAVANQ
Sbjct  178   NAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQ  237

Query  846   PVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWG  1022
             P+S AIDASG  FQFY GG++   +C T ++H +T VGYG  SDG K+WL+KNSWG  WG
Sbjct  238   PISVAIDASGSDFQFYSGGVF-SGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWG  296

Query  1023  ENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             ENGY+++ +D   A+G CGIA + S+P A
Sbjct  297   ENGYIRMQRDIDAAEGLCGIAMQASYPTA  325



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   342 bits (878),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 215/315 (68%), Gaps = 5/315 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   D  M +RYEQW   YGRVY +  EK KRF IFK+NV  I++FN+A  + + + +NE
Sbjct  28    RTLQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNVANIEAFNKASEKPYKLAVNE  87

Query  357   FADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCC  533
             FADLTN+EFK+SR  +K     E T PF YENVT +P+ MDW KKGAVTPVK+Q QCGCC
Sbjct  88    FADLTNEEFKASRNRFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCC  147

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITT  707
             WAFSAVAAIEGI Q+  G L+SLSEQ+L+DCD+     GC+GG +   F +V  N GITT
Sbjct  148   WAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITT  207

Query  708   ESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQ  887
             E NYPY    G C   + A   AKI G + VP   E+ LMKAVANQPVS AIDA G  FQ
Sbjct  208   EINYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQ  267

Query  888   FYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSWGEGWGENGYLKLIKDSGDA  1064
             FY  G++  D C T ++H +T VGYG +D G K+WL+KNSWG  WGE GY+++ +D    
Sbjct  268   FYSSGVFTGD-CGTELDHGVTAVGYGAADDGTKYWLVKNSWGATWGEEGYIRMQRDIDAK  326

Query  1065  KGACGIATKPSFPVA  1109
             +G CGIA + S+P A
Sbjct  327   QGLCGIAMQASYPTA  341



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score =   342 bits (878),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 227/334 (68%), Gaps = 5/334 (1%)
 Frame = +3

Query  114   VFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKEN  293
             +F   +L+L  WA     A   LD+ + M+KR+E+W+ ++GRVY +  EK KR+ IFKEN
Sbjct  10    IFLPFLLILAAWAT--KIACRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKEN  67

Query  294   VNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPAD  470
             +  I++FN   +  + +G+N+FADLTN+EF++   GYK       ++ F YEN+++IP  
Sbjct  68    IERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMYHGYKRQSSKLMSSSFRYENLSDIPTS  127

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIISLGCH  650
             MDW   GAVTPVK+Q  CGCCWAFS VAAIEGI +++ G L SLSEQQL+DC   + GC 
Sbjct  128   MDWRNDGAVTPVKDQGTCGCCWAFSTVAAIEGIIKLQTGNLISLSEQQLVDCTAGNKGCQ  187

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F Y++ NGG+T+E NYPY    G C   KAA  EA+I G++ VP+  E+ L++
Sbjct  188   GGLMDTAFQYIIRNGGLTSEDNYPYQGVDGTCSSEKAASTEAQITGYEDVPQNNENALLQ  247

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSW  1007
             AVA QPVS A++  G  FQFYK G++  D C T +NHA+T +GYG +SDG  +WL+KNSW
Sbjct  248   AVAKQPVSVAVEGGGHDFQFYKSGVFEGD-CGTNLNHAVTAIGYGTDSDGTDYWLVKNSW  306

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGENGY+++ +  G ++G CG+A   S+P A
Sbjct  307   GTSWGENGYMRMRRGIGSSEGLCGVAKDASYPTA  340



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   342 bits (878),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 172/332 (52%), Positives = 221/332 (67%), Gaps = 7/332 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ VL  W    A    R   D  M +R+EQW+ +YGRVY ++ EK  R++IFKENV  
Sbjct  13    ALLFVLGAWPSKSAA---RTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVAR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDW  479
             ID+FN    +++ +G+N+FADL+N+EFK+SR  +K         PF YENV+ +PA MDW
Sbjct  70    IDAFNSQTGKSYKLGVNQFADLSNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPATMDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA+EGI Q+  G L SLSEQ+++DCD      GC+G
Sbjct  130   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPY    G C   K A   AKI GF+ VP   E+ LMKA
Sbjct  190   GLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEATHAAKITGFEDVPANSEAALMKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGE  1013
             VA QPVS AIDA G  FQFY  GI+    C T ++H +T VGYG SDG K+WL+KNSWG 
Sbjct  250   VAKQPVSVAIDAGGFEFQFYSSGIF-TGSCGTQLDHGVTAVGYGISDGTKYWLVKNSWGA  308

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGE GY+++ KD    +G CGIA + S+P A
Sbjct  309   QWGEEGYIRMQKDISAKEGLCGIAMQASYPSA  340



>ref|XP_004974541.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   342 bits (878),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 222/336 (66%), Gaps = 14/336 (4%)
 Frame = +3

Query  132   LVLEIWACC----EATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
              +L I  C      A A   L DD  MV R+EQW+ +Y RVY +  EK +R ++F  NV 
Sbjct  7     FLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEVFNANVK  66

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPA  467
             FI+SFN AGN  F +G+N+FADLTNDEF++++   G+K+ P    T F YENV+   +PA
Sbjct  67    FIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTGFRYENVSIDALPA  126

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +I  G L SLSEQ+L+DCD+     
Sbjct  127   TIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQ  186

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F +++ NGG+TTES YPY    G C+    +   A IKG++ VP   E+ 
Sbjct  187   GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIK  998
             LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG  +WL+K
Sbjct  245   LMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGKASDGTNYWLMK  303

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             NSWG  WGENGYL++ KD  D +G CG+A +PS+P 
Sbjct  304   NSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_004975182.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score =   342 bits (877),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 232/342 (68%), Gaps = 14/342 (4%)
 Frame = +3

Query  108   LIVFAAIILVLEIWAC-CEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             ++   A +L +   AC C +    R   D  MV+R+E+W+VEYGRVY +  EK +RF++F
Sbjct  1     MVSSKAFLLAILGCACLCSSILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEVF  60

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYEN--V  452
             K+NV FI+SFN AGN  F + +N+FADLTNDEF++++      P   + P  F YEN  V
Sbjct  61    KDNVAFIESFN-AGNTKFWLAVNQFADLTNDEFRATKANKGFKPISTSVPTGFKYENLSV  119

Query  453   TEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI  632
               +P  +DW  KGAVTP+KNQ QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD 
Sbjct  120   NALPTTVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTGSLISLSEQELVDCDT  179

Query  633   ISL--GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQ-RSKAAQIEAKIKGFQWVP  803
              S+  GC GGW+ + F +V+ NGG+TTESNYPY    G C+  SK+A   A IKG + VP
Sbjct  180   HSMDEGCEGGWMDSAFEFVIKNGGLTTESNYPYKAVDGKCKGGSKSA---ATIKGHEDVP  236

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGR  980
                E+ LMKAVANQPVS A+DA    F FY GG+     C T ++H I  +GYG ESDG 
Sbjct  237   VNNEAALMKAVANQPVSVAVDAGDRTFMFYSGGVM-TGTCGTELDHGIAAIGYGVESDGT  295

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             K+WL+KNSWG  WGE G+L++ KD  D +G CG+A KPS+P+
Sbjct  296   KYWLLKNSWGTTWGEKGFLRMEKDISDKRGMCGLAMKPSYPI  337



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   342 bits (878),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 177/341 (52%), Positives = 226/341 (66%), Gaps = 8/341 (2%)
 Frame = +3

Query  108   LIVFAAIILVLEIWACCEATARW-RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             L V    ILV  +     A+  W R   +  M +R+EQW+  +GRVY  + EK +RF IF
Sbjct  3     LFVDRKFILVAAMVLGLYASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIF  62

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENVT  455
             K NV FI+SFN+     + +GIN FADLTNDEFK++R GYK      ++    F YENVT
Sbjct  63    KNNVEFIESFNENNTRPYKLGINGFADLTNDEFKATRNGYKRSSSVSSSGPKSFRYENVT  122

Query  456   EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII  635
              +P+ +DW +KGAVTPVK Q QCGCCWAFSAVAA EGI Q+  G L SLS QQL+DCD  
Sbjct  123   AVPSTVDWRQKGAVTPVKEQGQCGCCWAFSAVAATEGIHQLTTGNLVSLSVQQLVDCDTK  182

Query  636   --SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRF  809
               + GC GG++ A F +++ N G+TTE NYPY   KG C   +A    AKI G++ VP  
Sbjct  183   GDNRGCAGGFVNAAFKFIIDNDGLTTEDNYPYEAVKGTCDAGQAESPAAKITGYEDVPSN  242

Query  810   RESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKF  986
              ES L +AVANQPVS AIDA G  FQFY GG++  D C T ++H +TVVGYG SD G K+
Sbjct  243   SESALSQAVANQPVSVAIDADGSHFQFYSGGVFTGD-CQTDLDHGVTVVGYGTSDDGTKY  301

Query  987   WLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WL+KNSWG GWGENGY+++ +D    +G CGIA + ++P A
Sbjct  302   WLVKNSWGAGWGENGYIRMKRDIDAVEGLCGIAIRAAYPTA  342



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   342 bits (877),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 229/337 (68%), Gaps = 11/337 (3%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F   ++VL +W    ATAR   D    +  R+EQW+  YGRVY +  EK +RF IFK+N 
Sbjct  8     FVLKLIVLGVWVSA-ATARGIADV--PISTRHEQWMARYGRVYKDAVEKERRFQIFKDNH  64

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENVTEIPA  467
             N+I+S N+AGN  + +G+N+FAD+TN+EFK+S +G+K P +   +    F Y N+T++  
Sbjct  65    NYIESVNRAGNRKYKLGLNQFADMTNEEFKASHLGFK-PMHLAKSATGSFQYANLTDVSD  123

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              MDW  +GAVTP+KNQK CGCCWAFS+VAAIEGI QI  G L SLSEQQL++CD+     
Sbjct  124   SMDWRTRGAVTPIKNQKSCGCCWAFSSVAAIEGITQINTGNLVSLSEQQLVNCDVNDGDN  183

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG++   F YV+ NGGIT+E+NYPY    G C  +KA+   A I G++ VP   ES 
Sbjct  184   GCQGGFMTRAFHYVINNGGITSEANYPYKAADGTCDTNKASSSVATISGYENVPANDESS  243

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIK  998
             L++AV+ QPVS  ID  G  FQ+Y  GI+    CTT ++HA+T +GYG++ DG K+WL+K
Sbjct  244   LLQAVSKQPVSVGIDGGGKDFQYYSSGIF-TGACTTDMDHAVTAIGYGKAKDGTKYWLLK  302

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG  WGE GY++L +D G ++G CGIA   S+P A
Sbjct  303   NSWGTTWGEKGYMRLQRDVGASEGLCGIAKLASYPTA  339



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 214/315 (68%), Gaps = 5/315 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   D  M +RYEQW   YGRVY +  EK KRF IFK+NV  I++FN+A  + + + +NE
Sbjct  28    RALQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNVAHIEAFNKASKKPYKLAVNE  87

Query  357   FADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCC  533
             FADLTN+EFK SR  +K     E T PF YENVT +P+ MDW KKGAVTPVK+Q QCGCC
Sbjct  88    FADLTNEEFKVSRNRFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCC  147

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITT  707
             WAFSAVAAIEGI Q+  G L+SLSEQ+L+DCD+     GC+GG +   F +V  N GITT
Sbjct  148   WAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITT  207

Query  708   ESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQ  887
             E+NYPY    G C   + A   AKI G + VP   E+ LM AVANQPVS AIDA G  FQ
Sbjct  208   ETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMNAVANQPVSVAIDAGGSDFQ  267

Query  888   FYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSWGEGWGENGYLKLIKDSGDA  1064
             FY  G++  D C T ++H +T VGYG +D G K+WL+KNSWG  WGE GY+++ +D    
Sbjct  268   FYSSGVFTGD-CGTELDHGVTAVGYGAADDGTKYWLVKNSWGTSWGEEGYIRMQRDIDAK  326

Query  1065  KGACGIATKPSFPVA  1109
             +G CGIA + S+P A
Sbjct  327   EGLCGIAMQASYPTA  341



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 222/334 (66%), Gaps = 7/334 (2%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             + L+  I+A   +    R   +  + +++EQW+ +YG+VY N  EK KRF IFK+NV FI
Sbjct  11    LALIFLIFATATSQVTSRKLQEASLSEKHEQWMSKYGKVYKNPEEKEKRFRIFKDNVEFI  70

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNP---PYYENTPFMYENVTEIPADMD  476
             +S N AGN+ + + +NEFAD TN EFK+ R GY+ P      + T F YENV ++PA MD
Sbjct  71    ESLNAAGNKPYKLSVNEFADQTNQEFKAFRNGYRRPNGLASRKGTSFKYENVIDVPATMD  130

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCH  650
             W K GAVTP+KNQ  CG CWAFSAVAA EGI Q+  G L SLSEQ+L+ CD   +  GC 
Sbjct  131   WRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCE  190

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F +++ N GITTE+NYPY    G C ++K A   AKIKG++ VP   E  L+K
Sbjct  191   GGEMEDAFKFIIHNDGITTEANYPYQAADGTCNKTKEASHVAKIKGYETVPANSEEALLK  250

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSW  1007
             AVANQPV+ +IDASG AFQFY  G++  D C T ++H +T VGYG + +G K+WL+KNSW
Sbjct  251   AVANQPVAVSIDASGSAFQFYSSGVFTGD-CGTELDHGVTAVGYGATANGTKYWLVKNSW  309

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  310   GTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPTA  343



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 222/336 (66%), Gaps = 14/336 (4%)
 Frame = +3

Query  132   LVLEIWACC----EATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
              +L I  C      A A   L DD  MV R+EQW+ +Y RVY +  EK +RF++FK NV 
Sbjct  7     FLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVK  66

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPA  467
             FI+SFN AGN  F +G+N+FADLTNDEF++++   G+K  P    T F YENV+   +PA
Sbjct  67    FIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPMKVPTGFRYENVSIDALPA  126

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +I  G L SLSEQ+L+DCD+     
Sbjct  127   TIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQ  186

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F +++ NGG+TTES YPY      C+    +   A IKG++ VP   E+ 
Sbjct  187   GCEGGLMDDAFKFIIKNGGLTTESGYPYTAADDKCK--SGSNSAATIKGYEDVPANNEAA  244

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIK  998
             LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG  +WL+K
Sbjct  245   LMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGKASDGTNYWLMK  303

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             NSWG  WGENGYL++ KD  D +G CG+A +PS+P 
Sbjct  304   NSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 227/338 (67%), Gaps = 9/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
              +  A+  VL +WA   +T   R   +  MV+R+E+W+ ++G+VY ++ EK++RF IFK 
Sbjct  9     FLLIALFFVLAMWADQAST---RELHESTMVERHEKWMAKHGKVYKDDEEKLRRFQIFKN  65

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYEN--TPFMYENVTEIP  464
             NV FI+S N AGN ++ +GIN FADLTN+EF++S  GYK P       TPF YENVT +P
Sbjct  66    NVEFIESSNAAGNNSYMLGINRFADLTNEEFRASWNGYKRPLDASRIVTPFKYENVTALP  125

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
               MDW +KGAVT +K+Q++CG CWAFSAVAA EG+ ++R G L SLSEQ+L+DCD+    
Sbjct  126   YSMDWRRKGAVTSIKDQRECGSCWAFSAVAATEGVHKLRTGKLVSLSEQELVDCDVKGED  185

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F ++  NGGITTE+NY Y  + G C   K A   AKI G+Q VP   E+
Sbjct  186   KGCQGGLMEDAFKFIKRNGGITTEANYAYRGRDGKCDTKKEASHVAKITGYQVVPENSEA  245

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLI  995
              L+KAVA+QPVS +IDA  M+FQFY+ GIY    C + +NH +  VGYG  S G K+W++
Sbjct  246   ALLKAVAHQPVSVSIDAGSMSFQFYQSGIYA-GSCGSDLNHGVAAVGYGTSSSGSKYWIV  304

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGE GY+++ +D    KG CGIA   S+P A
Sbjct  305   KNSWGPEWGERGYVRMKRDITSRKGLCGIAMDCSYPTA  342



>ref|XP_004975183.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 231/342 (68%), Gaps = 14/342 (4%)
 Frame = +3

Query  108   LIVFAAIILVLEIWAC-CEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             ++   A +L +   AC C +    R   D  MV+R+E+W+VEYGRVY +  EK +RF++F
Sbjct  1     MVSSKAFLLAILGCACLCSSILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEVF  60

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYEN--V  452
             K+NV FI+SFN AGN  F + +N+FADLTNDEF++++      P   + P  F YEN  V
Sbjct  61    KDNVAFIESFN-AGNTKFWLAVNQFADLTNDEFRATKANKGFKPISTSVPTGFKYENLSV  119

Query  453   TEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI  632
               +P  +DW  KGAVTP+KNQ QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD 
Sbjct  120   NALPTTVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTGSLISLSEQELVDCDT  179

Query  633   ISL--GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQ-RSKAAQIEAKIKGFQWVP  803
              S+  GC GGW+ + F +V+ NGG+TTESNYPY    G C+  SK+A   A IKG + VP
Sbjct  180   HSMDEGCEGGWMDSAFEFVIKNGGLTTESNYPYKAVDGKCKGGSKSA---ATIKGHEDVP  236

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGR  980
                E+ LMKAVANQPVS A+DA    F FY GG+     C T ++H I  +GYG ESDG 
Sbjct  237   VNNEAALMKAVANQPVSVAVDAGDRTFMFYSGGVM-TGTCGTELDHGIAAIGYGVESDGT  295

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             K+WL+KNSWG  WGE G+L++ KD  D +G CG+A KPS+P 
Sbjct  296   KYWLLKNSWGTTWGEKGFLRMEKDISDKRGMCGLAMKPSYPT  337



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 220/325 (68%), Gaps = 10/325 (3%)
 Frame = +3

Query  153   CCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNE  332
             C  A A   L DD  MV R+EQW+ +Y RVY + +EK +RF++FK NV FI+SFN  GN 
Sbjct  18    CGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASEKARRFEVFKANVQFIESFNAGGNN  77

Query  333   TFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPADMDWVKKGAVT  500
              F +G+N+FADLTNDEF+S++   G K+      T F YENV+   +P  +DW  KGAVT
Sbjct  78    KFWLGVNQFADLTNDEFRSTKTNKGLKSSNMKIPTGFRYENVSADALPTTIDWRTKGAVT  137

Query  501   PVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGF  674
             P+K+Q QCGCCWAFSAVAA EGI +I  G L SL+EQ+L+DCD+     GC GG +   F
Sbjct  138   PIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQELVDCDVHGEDQGCEGGLMDDAF  197

Query  675   LYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVS  854
              +++ NGG+TTES+YPY    G C+    +   A IKG++ VP   E+ LMKAVANQPVS
Sbjct  198   KFIIKNGGLTTESSYPYTAADGKCK--SGSNSAATIKGYEDVPANDEAALMKAVANQPVS  255

Query  855   AAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSWGEGWGENG  1031
              A+D   M FQFY GG+     C T ++H I  +GYG+ SDG K+WL+KNSWG  WGENG
Sbjct  256   VAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGKTSDGTKYWLMKNSWGTTWGENG  314

Query  1032  YLKLIKDSGDAKGACGIATKPSFPV  1106
             YL++ KD  D +G CG+A +PS+P 
Sbjct  315   YLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 212/310 (68%), Gaps = 4/310 (1%)
 Frame = +3

Query  189   DDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADL  368
             D  M +R+EQW+ +YGRVY ++ EK  R++IFKENV  ID+FN    +++ +G+N+FADL
Sbjct  1     DVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGKSYNLGVNQFADL  60

Query  369   TNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFS  545
             TN+EFK+SR  +K         PF YENV+ +PA MDW KKGAVTPVK+Q QCGCCWAFS
Sbjct  61    TNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAFS  120

Query  546   AVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESNY  719
             AVAA+EGI Q+  G L SLSEQ+++DCD      GC+GG +   F ++  N G+TTE+NY
Sbjct  121   AVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANY  180

Query  720   PYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKG  899
             PY    G C   K     AKI GFQ VP   E+ LMKAVA QPVS AIDA G  FQFY  
Sbjct  181   PYTGTDGTCNTQKEVSHAAKITGFQDVPANSEAALMKAVAKQPVSVAIDAGGFEFQFYSS  240

Query  900   GIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACG  1079
             GI+    C T ++H +T VGYG SDG K+WL+KNSWG  WGE GY+++ KD    +G CG
Sbjct  241   GIF-TGSCGTELDHGVTAVGYGGSDGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLCG  299

Query  1080  IATKPSFPVA  1109
             IA + S+P A
Sbjct  300   IAMQASYPTA  309



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 224/334 (67%), Gaps = 10/334 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             ++ VL +WA   + AR R   +  M +R++QW+  +GRVY ++ EK +RF IFK NV+ +
Sbjct  13    MVAVLGLWA---SQARSRELHEATMRERHDQWMARHGRVYQDDAEKERRFSIFKNNVDLV  69

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGY---KNPPYYENTPFMYENVTEIPADMD  476
             +SFN+ GN+ +T+ IN FADLT +EFK+SR GY    +P      PF YENVT +P+ MD
Sbjct  70    ESFNKNGNKPYTLAINAFADLTIEEFKASRNGYMRSSSPRQVSTKPFRYENVTAVPSSMD  129

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCH  650
             W KKGAVTP+KNQ QCG CWAFSAV A+EGI Q+  G L SLSEQ+L+DCD      GC 
Sbjct  130   WRKKGAVTPIKNQGQCGSCWAFSAVGAMEGIIQLTTGKLISLSEQELVDCDTSGKDHGCE  189

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG++   F +++   G+TTE+NYPY    G C   KA    AKI G+  VP   ES L+K
Sbjct  190   GGYMDDAFKFIIGRHGLTTETNYPYQAVDGTCNARKANSSAAKITGYADVPANNESALLK  249

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSW  1007
             AV +QPVS AIDA   AFQFY  GI+   +C T ++H +T VGYG S+ G K+WL+KNSW
Sbjct  250   AVGHQPVSVAIDAGEWAFQFYSSGIF-TGECGTNLDHGVTAVGYGTSENGTKYWLVKNSW  308

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G GWGE GY+++ +D    +G CGIA   SFP+A
Sbjct  309   GTGWGEKGYIRMKRDIDAKEGLCGIAMMASFPIA  342



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 223/343 (65%), Gaps = 10/343 (3%)
 Frame = +3

Query  108   LIVFAAIILVLEIWACCEATARW-RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             L++   ++L+  +     A+  W R   +  M  R++ W+ +YGRVY    EK KRF IF
Sbjct  3     LLLHNKLVLMAMLLVTLWASQSWSRSLHEASMELRHKTWMTQYGRVYKGNVEKEKRFKIF  62

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGY-----KNPPYYENTPFMYEN  449
             KENV FI+SFN  GN+ + +GIN F DLTN+EF++S  GY      +   Y    F YEN
Sbjct  63    KENVEFIESFNNNGNKPYKLGINAFTDLTNEEFRASHNGYTMSMSSHQSSYRTKSFRYEN  122

Query  450   VTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
             VT +P  +DW  KGAVT +K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD
Sbjct  123   VTAVPPSLDWRTKGAVTHIKDQGQCGCCWAFSAVAAMEGITKLSTGTLISLSEQELVDCD  182

Query  630   IISL--GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
                +  GC GG +   F +++ N G+TTE+NYPY    G C   KAA   AKI G++ VP
Sbjct  183   TSGMDQGCEGGLMDDAFEFIIENNGLTTEANYPYEGVDGSCNTRKAANHAAKITGYENVP  242

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESD-GR  980
              + E  L KAVANQPVS AIDA   AFQ Y  GI+  D C T ++H +TVVGYG SD G 
Sbjct  243   AYDEEALRKAVANQPVSVAIDAGESAFQHYSSGIFTGD-CGTELDHGVTVVGYGTSDDGT  301

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             K+WL+KNSWG  WGE+GY+++ +D    +G CGIA +PS+P A
Sbjct  302   KYWLVKNSWGTSWGEDGYIRMERDIDAKEGLCGIAMEPSYPTA  344



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 225/336 (67%), Gaps = 7/336 (2%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
              V  A++ +   W   ++TAR  LD    M +R+EQW+ +YGRVY ++ E+  R+ IFKE
Sbjct  9     FVCLALLFISGAWPS-KSTARTLLDA--PMYERHEQWMTQYGRVYKDDNERATRYSIFKE  65

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPA  467
             NV  ID+FN    +++ +G+N+FADLTN+EFK+SR  +K         PF YENV+ +P+
Sbjct  66    NVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPS  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              MDW K+GAVTPVK+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+++DCD      
Sbjct  126   TMDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQ  185

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC+GG +   F ++  N G+TTE+NYPY    G C   KAA   AKI GF+ VP   E+ 
Sbjct  186   GCNGGLMDDAFKFIEKNKGLTTEANYPYKGTHGTCNTKKAANHAAKITGFEDVPANSEAA  245

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKN  1001
             LMKAVA QPVS AIDA G  FQFY  GI+    C T ++H +T VGYG SDG K+WL+KN
Sbjct  246   LMKAVAKQPVSVAIDAGGYDFQFYSSGIF-TGSCGTQLDHGVTAVGYGVSDGSKYWLVKN  304

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE GY+++ KD    +G CGIA + S+P A
Sbjct  305   SWGAQWGEEGYIRMQKDVSAKEGLCGIAMQASYPTA  340



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 215/310 (69%), Gaps = 7/310 (2%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             M +R+EQW+  +GRVY  + EK +RF IFK NV FI+SFN+     + +GIN FADLTND
Sbjct  20    MRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIESFNENNTRPYKLGINGFADLTND  79

Query  378   EFKSSRMGYKNPPYYENT---PFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSA  548
             EFK++R GYK      ++    F YENVT +P+ +DW +KGAVTPVK Q QCGCCWAFSA
Sbjct  80    EFKATRNGYKRSSSVSSSGPKSFRYENVTAVPSTVDWRQKGAVTPVKEQGQCGCCWAFSA  139

Query  549   VAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESNYP  722
             VAA EGI Q+  G L SLS QQL+DCD    + GC GG++ A F +++ N G+TTE NYP
Sbjct  140   VAATEGIHQLTTGNLVSLSVQQLVDCDTKGDNRGCAGGFVNAAFKFIIDNDGLTTEDNYP  199

Query  723   YAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGG  902
             Y   KG C   +A    AKI G++ VP   ES L +AVANQPVS AIDA G  FQFY GG
Sbjct  200   YEAVKGTCDAGQAESPAAKITGYEDVPSNSESALSQAVANQPVSVAIDADGSHFQFYSGG  259

Query  903   IYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACG  1079
             ++  D C T ++H +TVVGYG SD G K+WL+KNSWG GWGENGY+++ +D    +G CG
Sbjct  260   VFTGD-CQTDLDHGVTVVGYGTSDDGTKYWLVKNSWGAGWGENGYIRMKRDIDAVEGLCG  318

Query  1080  IATKPSFPVA  1109
             IA + ++P A
Sbjct  319   IAIRAAYPTA  328



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/335 (51%), Positives = 224/335 (67%), Gaps = 10/335 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A IL+L  WA   A+   R   +  M  R+EQW+  +G+VYA+  EK +RF+IFK+NV +
Sbjct  12    AFILILGTWAYEVAS---RELQEPSMSARHEQWMATFGKVYADAAEKERRFEIFKDNVEY  68

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPY---YENTPFMYENVTEIPADM  473
             I+SFN AGN+ + + +N+FADLT +E K +R GY+ P      + T F YENVT +PA M
Sbjct  69    IESFNTAGNKPYKLSVNKFADLTTEELKVARNGYRRPLQTRPMKVTSFEYENVTAVPATM  128

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGC  647
             DW KKGAVTP+K+Q QCG CWAFS VAA EGI Q+  G L SLSEQ+L+DCD      GC
Sbjct  129   DWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQGC  188

Query  648   HGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELM  827
              GG +  GF +++ N GIT+E+NYPY    G C   K A   AKI G++ VP   E+ L+
Sbjct  189   EGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGYESVPANSEAALL  248

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNS  1004
             KAVANQP+S +IDA G  FQFY  G++   +C T ++H +T VGYGE SDG K+WL+KNS
Sbjct  249   KAVANQPISVSIDAGGSDFQFYSSGVF-TGQCGTELDHGVTAVGYGETSDGTKYWLVKNS  307

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  308   WGTSWGEEGYIRMQRDVDAEEGLCGIAMDSSYPTA  342



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/332 (51%), Positives = 222/332 (67%), Gaps = 7/332 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ VL  W    + +  R   D  M +R+EQW+ +YGRVY ++ EK  R++IFKENV  
Sbjct  38    ALLFVLVAWP---SKSVARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVAR  94

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDW  479
             ID+FN    +++ +G+N+FADL+N+EFK+SR  +K         PF YENV+ +PA MDW
Sbjct  95    IDAFNSQTGKSYKLGVNQFADLSNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPATMDW  154

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA+EGI Q+  G L SLSEQ+++DCD      GC+G
Sbjct  155   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNG  214

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPY    G C   K A   AKI GF+ VP   E+ L+KA
Sbjct  215   GLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEANHAAKITGFEDVPANSEAALIKA  274

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGE  1013
             VA QPVS AIDA G  FQFY  GI+    C T ++H +T VGYG SDG K+WL+KNSWG 
Sbjct  275   VAKQPVSVAIDAGGFEFQFYSSGIF-TGSCGTELDHGVTAVGYGGSDGTKYWLVKNSWGA  333

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGE GY+++ KD    +G CGIA + S+P A
Sbjct  334   QWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  365



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 225/334 (67%), Gaps = 10/334 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             ++ +L +WA   +  R R      M +R+EQW+  +G VY ++ EK +RF IFK NV+FI
Sbjct  13    MVAILGLWA---SQVRSRELHKATMRQRHEQWMARHGWVYQDDAEKERRFSIFKNNVDFI  69

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK---NPPYYENTPFMYENVTEIPADMD  476
             +SFN+ GN+ +T+ IN FADLT +EFK+SR GYK   +P      PF YE+VT +P+ MD
Sbjct  70    ESFNKDGNKPYTLAINAFADLTIEEFKASRNGYKRSSSPRQVSTKPFRYEHVTAVPSSMD  129

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCH  650
             W KKGAVTP+K+Q QCG CWAFSAV A+EG  Q+  G L SLSEQ+L+DCD      GC 
Sbjct  130   WRKKGAVTPIKDQGQCGSCWAFSAVGAMEGNNQLTTGKLISLSEQELVDCDTSGEDQGCE  189

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG++   F +++ N G+TTE+NYPY    G C   K A   AKI G++ VP   ES L+K
Sbjct  190   GGFMDNAFEFIIGNHGLTTETNYPYQAVDGTCNARKEASSAAKITGYEDVPANSESALLK  249

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSW  1007
             AVA+QPVS AIDA   AFQFY  GI+   +C T ++H +T VGYG S DG K+WL+KNSW
Sbjct  250   AVAHQPVSVAIDAGESAFQFYSSGIF-TGECGTNLDHGVTAVGYGTSEDGTKYWLVKNSW  308

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G GWGE GY+++ +D    +G CGIA + S+P A
Sbjct  309   GTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPTA  342



>emb|CAH66275.1| OSIGBa0147O06.5 [Oryza sativa Indica Group]
Length=339

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/338 (51%), Positives = 225/338 (67%), Gaps = 12/338 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWR-LDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A +  +L     C A    R L DD  M  R+E+W+ +YGR+Y ++ EK +RF++FK NV
Sbjct  6     ALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--EIP  464
              FI+SFN AGN  F +G+N+FADLTNDEF+S++      P     P  F YENV    +P
Sbjct  66    AFIESFN-AGNHKFWLGVNQFADLTNDEFRSTKTNKGFIPSTTRVPTGFRYENVNIDALP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A MDW  KG VTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   ATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTESNYPYA     C+    +   A IKG++ VP   E+
Sbjct  185   QGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKCK--SVSNSVASIKGYEDVPANNEA  242

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFYKGG+     C T ++H I  +GYG+ SDG K+WL+
Sbjct  243   ALMKAVANQPVSVAVDGGDMTFQFYKGGVM-TGSCGTDLDHGIVAIGYGKASDGTKYWLL  301

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENG+L++ KD  D +G CG+A +PS+P A
Sbjct  302   KNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  339



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/338 (51%), Positives = 233/338 (69%), Gaps = 11/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             + F A+ LVL +WA    +   R  ++  MV+++E W+  +GRVY ++ EK KR  IFK 
Sbjct  9     LAFVAL-LVLGMWASQTTS---RDLNEASMVQKHEYWMARFGRVYRDDAEKAKRLKIFKN  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENVTEI  461
             NV++I+S N+AG   + +GINEFADLTN+EF+++  GYK   + +++    F YENVT  
Sbjct  65    NVDYIESVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMSSHQKSSKTISFRYENVT-A  123

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-  638
             PA +DW  KGAVT VK+Q QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD  S 
Sbjct  124   PATIDWRTKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
             +GC GG +   F +++ N G+TTESNYPY    G C+  K +   AKI G++ VP   ES
Sbjct  184   MGCEGGLMDDAFTFIIKNHGLTTESNYPYEGTDGTCKTRKESNHVAKITGYEDVPANSES  243

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              L+ AVANQPVS AIDASG  FQFY  G++   +C T ++H +T +GYG+ SDG K+WL+
Sbjct  244   ALLSAVANQPVSVAIDASGSDFQFYSSGVF-TGECGTELDHGVTAIGYGKTSDGTKYWLV  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENGY+++ +D   A+G CGIA + S+P A
Sbjct  303   KNSWGTSWGENGYIRMQRDIDAAEGTCGIAMQASYPTA  340



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 171/337 (51%), Positives = 226/337 (67%), Gaps = 11/337 (3%)
 Frame = +3

Query  120   AAIILVLEI-WACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A+I+ +L   + C  A A   L DD  MV R+EQW+ +Y RVY + +EK +RF++FK NV
Sbjct  6     ASILAILGFAFFCGAALAARDLSDDSAMVARHEQWMAQYSRVYKDASEKARRFEVFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKS--SRMGYKNPPYYENTPFMYENVT--EIP  464
              FI+SFN  GN  F +G+N+FADLTNDEF+S  +  G+K+      T F YENV+   +P
Sbjct  66    KFIESFNAGGNNKFWLGVNQFADLTNDEFRSIKTNKGFKSSNMKIPTGFRYENVSVDALP  125

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
               +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +I  G L SL+EQ+L+DCD+    
Sbjct  126   TTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQELVDCDVHGED  185

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTES+YPY    G C+    +   A IKG++ VP   E+
Sbjct  186   QGCEGGLMDDAFKFIINNGGLTTESSYPYTAADGKCK--SGSNSAATIKGYEDVPANDEA  243

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFY  G+     C T ++H I  +GYG+ SDG K+WL+
Sbjct  244   ALMKAVANQPVSVAVDGGDMTFQFYSSGVM-TGSCGTDLDHGIAAIGYGKTSDGTKYWLM  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             KNSWG  WGENGYL++ KD  D +G CG+A +PS+P 
Sbjct  303   KNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/336 (50%), Positives = 226/336 (67%), Gaps = 9/336 (3%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F   ++VL +W    ATAR   D    M  R+EQW+ +YGRVY +  EK +RF IFK+N 
Sbjct  8     FVLKLIVLGVWVS-GATARGIADV--PMSTRHEQWMAQYGRVYKDAVEKERRFQIFKDNS  64

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT--PFMYENVTEIPAD  470
             N+I+S N+AGN  + +G+N+FAD+TN+EFK+S +G+K     ++T   F Y N+T++   
Sbjct  65    NYIESVNRAGNRKYKLGLNQFADMTNEEFKASHLGFKPMRLTKSTTGSFQYANLTDVSDS  124

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLG  644
             MDW  +GAVTPVK+Q  CGCCWAFS++AAIEGI QI  G L SLSEQQL+DCD+   + G
Sbjct  125   MDWRTRGAVTPVKDQGSCGCCWAFSSIAAIEGITQINTGNLVSLSEQQLVDCDVKDGNNG  184

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C+GG +   F YV+ NGGITTE+NYPY    G C   +A+   A I G++ VP   ES L
Sbjct  185   CNGGLMTRAFQYVIDNGGITTENNYPYMAADGTCDTDRASSSAATISGYENVPVNDESSL  244

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKN  1001
             ++AV+NQPVS  ID  G  FQ Y  GI+    C T ++HA+T +GYG + DG K+WLIKN
Sbjct  245   LQAVSNQPVSVGIDGGGQDFQHYSSGIF-TGPCKTNMDHAVTAIGYGTAEDGTKYWLIKN  303

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE GY+++ +D G  +G CGIA   S+P A
Sbjct  304   SWGTTWGEKGYMRIQRDVGAPEGLCGIAKLASYPTA  339



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 175/338 (52%), Positives = 232/338 (69%), Gaps = 11/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             + F A+ LVL + A  +AT+R   +    +VK++EQW+  +GRVY ++ EK KRF IFK+
Sbjct  9     LAFVAL-LVLGMQAS-QATSRGLYET--SIVKKHEQWMARFGRVYKDDVEKAKRFKIFKD  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPP---YYENTPFMYENVTEI  461
             N  +IDS N AG + + + +NEF+DLTN+EF+++  GY+ P    Y E T F YENVT  
Sbjct  65    NTEYIDSVNMAGIKPYKLDVNEFSDLTNEEFRATHNGYRMPSQKKYPEITSFKYENVT-A  123

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-  638
             PA MDW  KGAVT +KNQ QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD  S 
Sbjct  124   PATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
             +GC GG +   F +++ N G+TTESNYPY      C+  K +   AKI  ++ VP   ES
Sbjct  184   MGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDNTCKTGKESNHAAKITSYEDVPANSES  243

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              L+KAVANQPVS AIDASG  FQFY  G++   +C T ++H +T VGYGE SDG K+WL+
Sbjct  244   ALLKAVANQPVSVAIDASGSDFQFYSSGVF-TGECGTELDHGVTAVGYGEASDGTKYWLV  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENGY+++ ++    +G CGIA + S+P A
Sbjct  303   KNSWGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  340



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 173/340 (51%), Positives = 227/340 (67%), Gaps = 10/340 (3%)
 Frame = +3

Query  108   LIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             L   A I L+L I A  + T+R +L +   + +++EQW+ +YG+VY N  EK KRF IFK
Sbjct  8     LCKLALIFLILAI-AASQVTSR-KLQEAS-LSEKHEQWMSKYGKVYKNPEEKEKRFRIFK  64

Query  288   ENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNP---PYYENTPFMYENVTE  458
             +NV FI+S N AGN+ + + INEFAD TN EFK+ R GY+ P      + T F YENV +
Sbjct  65    DNVEFIESLNAAGNKPYKLSINEFADQTNQEFKAFRNGYRRPDGLTSRKGTSFKYENVID  124

Query  459   IPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--  632
             +PA MDW K GAVTP+KNQ  CG CWAFSAVAA EGI Q+  G L SLSEQ+L+ CD   
Sbjct  125   VPATMDWRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISLSEQELVSCDTSG  184

Query  633   ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFR  812
             +  GC GG +   F +++ N GITTE+NYPY    G C ++  A   AKIKG++ VP   
Sbjct  185   VDHGCEGGEMEDAFKFIIHNDGITTEANYPYQAVDGTCNKTNEASHVAKIKGYETVPANS  244

Query  813   ESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFW  989
             E  L+KAVANQPV+ +IDASG AFQFY  G++  D C T ++H +T VGYG + +G K+W
Sbjct  245   EEALLKAVANQPVAVSIDASGSAFQFYSSGVFTGD-CGTELDHGVTAVGYGATANGTKYW  303

Query  990   LIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             L+KNSWG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  304   LVKNSWGTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPTA  343



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 165/339 (49%), Positives = 224/339 (66%), Gaps = 8/339 (2%)
 Frame = +3

Query  96    KYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRF  275
             K  H++   A++L+L I   C +    R   +  M +R+EQW+ +YG+VY +  EK KR 
Sbjct  6     KKQHIL---ALVLLLSI---CTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRL  59

Query  276   DIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFMYENVT  455
              IFK+NV FI+SFN AGN  + + IN  AD TN+EF +S  GYK+   +  TPF YENVT
Sbjct  60    LIFKDNVEFIESFNAAGNRPYKLSINHLADQTNEEFVASHNGYKHKGSHSQTPFKYENVT  119

Query  456   EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII  635
              +P  +DW + GAVT VK+Q QCG CWAFS VAA EGI QI   +L SLSEQ+L+DCD +
Sbjct  120   GVPNAVDWRENGAVTAVKDQGQCGSCWAFSTVAATEGIYQITTSMLMSLSEQELVDCDSV  179

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG++  GF +++ NGGI++E+NYPY    G C  +K A   A+IKG++ VP   E
Sbjct  180   DHGCDGGYMEGGFEFIIKNGGISSEANYPYTAVDGTCDANKEASPAAQIKGYETVPANSE  239

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWL  992
               L KAVANQPVS  IDA G AFQFY  G++   +C T ++H +T VGYG + DG ++W+
Sbjct  240   DALQKAVANQPVSVTIDAGGSAFQFYSSGVF-TGQCGTQLDHGVTAVGYGSTDDGTQYWI  298

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE GY+++ + +   +G CGIA   S+P A
Sbjct  299   VKNSWGTQWGEEGYIRMQRGTDAQEGLCGIAMDASYPTA  337



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 232/338 (69%), Gaps = 10/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             + FAA+++++      +AT+R  L +   MV+++EQW+  +GRVY ++ EK KRF IF+ 
Sbjct  10    LAFAALLVLVSF--ASQATSR-DLYEAASMVQKHEQWMSHFGRVYKDDVEKAKRFKIFQH  66

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYE---NTPFMYENVTEI  461
             NV +I+  N+AG   + +GINEFADL+N+EF+ +R GYK   + +    T F Y NVT  
Sbjct  67    NVEYIEFVNKAGTRPYKLGINEFADLSNEEFRDTRNGYKMTSHQQLSKTTSFKYANVT-A  125

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-  638
             PA MDW  KGAVT +K+Q QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD  S 
Sbjct  126   PATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  185

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
             +GC GG +   F +++ N G+TTESNYPY      C+  K +   AKI G++ VP   ES
Sbjct  186   MGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTNATCKTGKESNHAAKITGYEDVPANSES  245

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              L+KAVANQP+S AIDASG  FQFY  G++   +C T ++H +T +GYG+ SDG ++WL+
Sbjct  246   ALLKAVANQPISVAIDASGSDFQFYSTGVF-TGECGTELDHGVTAIGYGKTSDGTQYWLV  304

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENGY+++ +D    +G CGIA + S+P A
Sbjct  305   KNSWGTSWGENGYIRMQRDVDAEEGLCGIAMQASYPTA  342



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 227/336 (68%), Gaps = 7/336 (2%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
              V  A++ +L  W   ++TAR  LD    M +R+EQW+ +YGRVY ++ E+  R+ IFKE
Sbjct  9     FVCLALLFILGAWPS-KSTARTLLDA--PMYERHEQWMTQYGRVYKDDNERATRYSIFKE  65

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPA  467
             NV  ID+FN    +++ +G+N+FADLTN+EFK+SR  +K         PF YENV+ +P+
Sbjct  66    NVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPS  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW K+GAVTPVK+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+++DCD      
Sbjct  126   TVDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQ  185

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC+GG +   F ++  N G+TTE+NYPY    G C  +KAA   AKI GF+ VP   E+ 
Sbjct  186   GCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAA  245

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKN  1001
             LMKAVA QPVS AIDA G  FQFY  GI+    C T ++H +T VGYG SDG K+WL+KN
Sbjct  246   LMKAVAKQPVSVAIDAGGSDFQFYSSGIF-TGSCDTQLDHGVTAVGYGVSDGSKYWLVKN  304

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE GY+++ KD    +G CGIA + S+P A
Sbjct  305   SWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  340



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score =   340 bits (871),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/330 (51%), Positives = 222/330 (67%), Gaps = 8/330 (2%)
 Frame = +3

Query  132   LVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDS  311
             +VL +W    + A  R   D+ M++R+EQW+ +YGRVY +  EK +RF IF+ N  +I+S
Sbjct  1     MVLGVWV---SGAMARGIADEPMLRRHEQWMAQYGRVYKDAAEKERRFQIFRGNYEYIES  57

Query  312   FNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDWVKK  488
              N+AG+  + +G+N+FAD+TN+EFK+SR+G+K  P    T  F Y N+++ P  MDW  K
Sbjct  58    INRAGDRKYKLGLNQFADMTNEEFKASRLGFKPMPTESTTGSFQYANLSDAPDSMDWRTK  117

Query  489   GAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWI  662
             GAVT VKNQ+ CGCCWAFS+VAAIE I +I+ G L SLSEQQL+DCD    + GC GG +
Sbjct  118   GAVTAVKNQRSCGCCWAFSSVAAIEAITEIKTGNLVSLSEQQLVDCDTNDGNKGCDGGLM  177

Query  663   GAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVAN  842
                F YV+ NGGITTE NYPY    G C  ++A+   A I G++ VP   ES L++AVAN
Sbjct  178   TRAFQYVIDNGGITTEDNYPYKAADGTCDTNRASSSAATISGYETVPANDESSLLQAVAN  237

Query  843   QPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGW  1019
             QPVS  ID SG  FQ Y  GI+    C T + HA+T VGYG + DG K+WL+KNSWG  W
Sbjct  238   QPVSVGIDGSGPDFQHYSSGIF-TGPCETEMTHAVTAVGYGTAEDGTKYWLVKNSWGTTW  296

Query  1020  GENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             GE GY+++ +D G  +G CGIA   S+P A
Sbjct  297   GEMGYMRIQRDVGAPEGLCGIAKLASYPTA  326



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 234/332 (70%), Gaps = 10/332 (3%)
 Frame = +3

Query  129   ILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFID  308
             +LVL +WA  EAT+R    ++  MV+++E+W+  +GRVY ++TEK KRF+IFK+N ++I+
Sbjct  14    LLVLGMWAN-EATSRDL--NEASMVQKHEKWMAHFGRVYRDDTEKAKRFNIFKDNFDYIE  70

Query  309   SFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYY--ENTPFMYENVTEIPADMDW  479
             S N+AG   + + IN FADLTN+EF+++  GYK + P+   + T F YENVT  PA MDW
Sbjct  71    SINKAGMRPYKLRINGFADLTNEEFRATHNGYKMSSPHMSSKTTFFRYENVT-APATMDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-LGCHGG  656
              KKGAVT VK+Q QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD  S +GC GG
Sbjct  130   RKKGAVTGVKDQGQCGCCWAFSAVAATEGINEIKTGKLISLSEQELVDCDTSSDMGCEGG  189

Query  657   WIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAV  836
              +   F +++ N G+TTESNYPY    G C+  K +   AKI G++ VP   ES L+ AV
Sbjct  190   LMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESNDAAKITGYEDVPANSESALLNAV  249

Query  837   ANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGE  1013
             ANQPVS AIDASG  FQFY  G++   +C T ++H +T VGYG  SDG K+WLIKNSWG 
Sbjct  250   ANQPVSVAIDASGSDFQFYSSGVF-TGECGTELDHGVTAVGYGITSDGTKYWLIKNSWGT  308

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGENGY+++ +     +G CGIA + S+P A
Sbjct  309   SWGENGYIRMQRGVVPEEGLCGIAMQASYPTA  340



>gb|AFW86317.1| hypothetical protein ZEAMMB73_339067 [Zea mays]
Length=433

 Score =   343 bits (880),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 220/325 (68%), Gaps = 10/325 (3%)
 Frame = +3

Query  153   CCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNE  332
             C  A A   L DD  MV R+EQW+ +Y RVY + +EK +RF++FK NV FI+SFN  GN 
Sbjct  111   CGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASEKARRFEVFKANVQFIESFNAGGNN  170

Query  333   TFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPADMDWVKKGAVT  500
              F +G+N+FADLTNDEF+S++   G K+      T F YENV+   +P  +DW  KGAVT
Sbjct  171   KFWLGVNQFADLTNDEFRSTKTNKGLKSSNMKIPTGFRYENVSADALPTTIDWRTKGAVT  230

Query  501   PVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGF  674
             P+K+Q QCGCCWAFSAVAA EGI +I  G L SL+EQ+L+DCD+     GC GG +   F
Sbjct  231   PIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQELVDCDVHGEDQGCEGGLMDDAF  290

Query  675   LYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVS  854
              +++ NGG+TTES+YPY    G C+    +   A IKG++ VP   E+ LMKAVANQPVS
Sbjct  291   KFIIKNGGLTTESSYPYTAADGKCK--SGSNSAATIKGYEDVPANDEAALMKAVANQPVS  348

Query  855   AAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSWGEGWGENG  1031
              A+D   M FQFY GG+     C T ++H I  +GYG+ SDG K+WL+KNSWG  WGENG
Sbjct  349   VAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGKTSDGTKYWLMKNSWGTTWGENG  407

Query  1032  YLKLIKDSGDAKGACGIATKPSFPV  1106
             YL++ KD  D +G CG+A +PS+P 
Sbjct  408   YLRMEKDISDKRGMCGLAMEPSYPT  432



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score =   340 bits (872),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 167/327 (51%), Positives = 222/327 (68%), Gaps = 8/327 (2%)
 Frame = +3

Query  144   IWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQA  323
             IW   +A AR  L  +  M++R+EQW+  +G +Y +  EK KRF IFK+NV  I++FN A
Sbjct  22    IWVS-QAAAR-TLPAEASMLERHEQWMASHGVLYEDAVEKEKRFTIFKDNVERIEAFNMA  79

Query  324   GNETFTVGINEFADLTNDEFKSSRMGYKNP--PYYENTPFMYENVTEIPADMDWVKKGAV  497
             GN+ + + +N FAD TN+EFK+SR GYK    P    T F YEN+T +   MDW  KGAV
Sbjct  80    GNKPYKLSVNRFADQTNEEFKASRNGYKRSTQPSSSKTSFRYENMTSVLPSMDWRSKGAV  139

Query  498   TPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAG  671
             TP+K+Q  CGCCWAFSAVAA+EGI +++AG L SLSEQ+L+DCD      GC GG++   
Sbjct  140   TPIKDQGDCGCCWAFSAVAAMEGITKLKAGKLISLSEQELVDCDTAGGDYGCEGGFMDNA  199

Query  672   FLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPV  851
             F ++  NGG+TTE+NYPY    G C + K+A   AKI G++ VP   E  L+KAV+NQPV
Sbjct  200   FQFIQHNGGLTTEANYPYKQTDGTCDKRKSALSAAKISGYEDVPANNEVALLKAVSNQPV  259

Query  852   SAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWGEN  1028
             S AIDA G  FQFY  GI+   +C T ++H +T VGYG  SDG K+WL+KNSWG  WGE 
Sbjct  260   SVAIDAGGFDFQFYSSGIF-TGECGTNLDHGVTAVGYGTSSDGTKYWLVKNSWGTTWGEK  318

Query  1029  GYLKLIKDSGDAKGACGIATKPSFPVA  1109
             GY+++ +D    +G CGIA + S+P+A
Sbjct  319   GYIRMKRDVASKEGLCGIAMQASYPIA  345



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   340 bits (871),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 172/339 (51%), Positives = 225/339 (66%), Gaps = 14/339 (4%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F A IL+L +WA   A+   R   +  M  R+EQW+  YG+VY +  E  +RF IFK+NV
Sbjct  10    FFAFILILGMWAFEVAS---RELQESSMSARHEQWMATYGKVYVDAAEIERRFKIFKDNV  66

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP-----FMYENVTEI  461
              +I+SFN AGN+ + + +N+FAD TN+EFK +  GY+ P  ++  P     F YENVT I
Sbjct  67    EYIESFNTAGNKPYKLSVNKFADQTNEEFKGAHNGYRRP--FQTRPMKVKSFKYENVTAI  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             PA MDW KKGAVTP+K+Q QCG CWAFS VAA EGI Q+  G L SLSEQ+L+DCD    
Sbjct  125   PAAMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGE  184

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +  GF +++ N GITTE+NYPY    G C   K A   AKI G++ VP   E
Sbjct  185   DQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNPEKRASHIAKITGYESVPANSE  244

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWL  992
             +EL+KAVANQP+S +IDA G  FQFY  G++   +C T ++H +T VGYG+ SDG K+WL
Sbjct  245   AELLKAVANQPISVSIDAGGSDFQFYSSGVF-TGECGTELDHGVTAVGYGKTSDGTKYWL  303

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  304   VKNSWGTSWGEEGYIRMQRDIDAEEGLCGIAMDSSYPTA  342



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 221/312 (71%), Gaps = 9/312 (3%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             M+KR+E+W  ++GRVY +  EK K++ +FK+N+  I+SFN   +  + +G+N+FADLT++
Sbjct  1     MLKRHEEWRAQHGRVYKDTAEKQKKYLVFKDNLERIESFNNGVDRGYKLGLNKFADLTDE  60

Query  378   EFKSSRMGYKNPP-----YYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAF  542
             EF++  +GYK+PP       ++  F Y NVT +P  +DW K GAVTPVK+Q  CG CWAF
Sbjct  61    EFQAMHLGYKSPPSKLMSTSKSRSFRYRNVTSVPTTIDWRKAGAVTPVKDQGSCGSCWAF  120

Query  543   SAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESN  716
             SAVAA+EGI +++ G L SLSEQ+L+DCD+     GC GG++   F Y+L NGG+T+E+N
Sbjct  121   SAVAAMEGITKLKTGNLISLSEQELVDCDVAGEDYGCDGGFMDTAFQYILKNGGLTSEAN  180

Query  717   YPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYK  896
             YPY  + G C + K A   AKI G++ VP   E  L++AVANQPVS AIDASG  F+FY 
Sbjct  181   YPYQGEDGICSKKKTATSMAKITGYEDVPSNSEKALLQAVANQPVSVAIDASGYDFRFYS  240

Query  897   GGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGA  1073
              G++  D C T +NHA+TV+GYG S DG K+WL+KNSWG GWGENGY+++ ++    +G 
Sbjct  241   SGVFKGD-CPTDLNHAVTVIGYGSSSDGTKYWLLKNSWGTGWGENGYMRMQREISANEGL  299

Query  1074  CGIATKPSFPVA  1109
             CGIA K S+P A
Sbjct  300   CGIAMKASYPTA  311



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/336 (51%), Positives = 226/336 (67%), Gaps = 7/336 (2%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
              V  A++ +L  W   ++TAR  LD    M +R+EQW+ +YGRVY ++ E+  R+ IFKE
Sbjct  9     FVCLALLFILGAWPS-KSTARTLLDA--PMYERHEQWMTQYGRVYKDDNERATRYSIFKE  65

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPA  467
             NV  ID+FN    +++ +G+N+FADLTN+EFK+SR  +K         PF YENV+ +P+
Sbjct  66    NVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPS  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW K+GAVTPVK+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+++DCD      
Sbjct  126   TVDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQ  185

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC+GG +   F ++  N G+TTE+NYPY    G C   K+A   AKI GF+ VP   E+ 
Sbjct  186   GCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTKKSAIHAAKITGFEDVPANSEAA  245

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKN  1001
             LMKAVA QPVS AIDA G  FQFY  GI+    C T ++H +T VGYG SDG K+WL+KN
Sbjct  246   LMKAVAKQPVSVAIDAGGSDFQFYSSGIF-TGSCDTQLDHGVTAVGYGVSDGSKYWLVKN  304

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE GY+++ KD    +G CGIA + S+P A
Sbjct  305   SWGAQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  340



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 227/338 (67%), Gaps = 8/338 (2%)
 Frame = +3

Query  105   HLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             H  +  A I ++    C EAT+R     D  M +R+EQW+  YGRVY +  E+ +RF+IF
Sbjct  9     HQCICLAFIFIVGALVC-EATSRTL--QDASMYERHEQWMARYGRVYHDNNEREQRFNIF  65

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEI  461
             KENV  IDSFN+A ++ + +G+N+FADLTN+EF +SR  +K +    + T F YEN+T +
Sbjct  66    KENVAHIDSFNRAKDKPYKLGVNQFADLTNEEFTASRNRFKGHMCSNKATTFKYENLTAL  125

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             P+ +DW KKGAVTP+K+Q QCGCCWAFSAVAA+EG+ ++  G L SLSEQ+L+DCD    
Sbjct  126   PSTVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGVTKLTTGKLISLSEQELVDCDTKGE  185

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F ++  N G+TTES+YPY    G C  +K A   AKI GF+ VP   E
Sbjct  186   DQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVDGTCNTNKEANHAAKINGFEDVPANSE  245

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWL  992
               L KAVANQPVS AIDA G  FQFY GG++  D C T ++H +T VGYG + DG K+WL
Sbjct  246   DALQKAVANQPVSVAIDAGGFKFQFYSGGVFTGD-CGTALDHGVTAVGYGVDDDGTKYWL  304

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             +KNSWG  WGE GY+++ +D    +G CGIA + S+P 
Sbjct  305   VKNSWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPT  342



>ref|XP_004975180.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/320 (52%), Positives = 221/320 (69%), Gaps = 10/320 (3%)
 Frame = +3

Query  168   ARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVG  347
             A   L DD  MV R+EQW+ ++GR+Y ++ EK +RF++FK NV FI++FN AGN  F +G
Sbjct  23    AARELSDDSAMVARHEQWMAQHGRLYKDDAEKARRFEVFKTNVKFIETFNAAGNRKFWLG  82

Query  348   INEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVTE--IPADMDWVKKGAVTPVKNQ  515
             +N+FADLTNDEF++++      P     P  F Y NV+   +PA +DW  KGAVTP+K+Q
Sbjct  83    VNQFADLTNDEFRATKTNKGFNPNAVKVPTGFRYANVSTDALPATVDWRTKGAVTPIKDQ  142

Query  516   KQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLF  689
              QCGCCWAFSAVAA+EGI +I  G L SLSEQ+L+DCD+     GC+GG +   F +++ 
Sbjct  143   GQCGCCWAFSAVAAMEGIVKISTGKLISLSEQELVDCDVHGEDQGCNGGEMDDAFTFIIK  202

Query  690   NGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDA  869
             NGG+TTES+YPYA + G C+    +   A IKG++ VP   E+ LMKAVANQPVS A+D 
Sbjct  203   NGGLTTESSYPYAAQDGQCK--AGSNSAATIKGYEDVPANDEAALMKAVANQPVSVAVDG  260

Query  870   SGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSWGEGWGENGYLKLI  1046
               M FQFY GG+     C T ++H I  +GYG  SDG K+WL+KNSWG  WGENG+L++ 
Sbjct  261   GDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGTASDGTKYWLLKNSWGTTWGENGFLRME  319

Query  1047  KDSGDAKGACGIATKPSFPV  1106
             KD  D +G CG+A +PS+P 
Sbjct  320   KDISDKRGMCGLAMQPSYPT  339



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 235/350 (67%), Gaps = 12/350 (3%)
 Frame = +3

Query  78    TKMGSRKYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANET  257
             T   +  + H ++  A +++L  WAC +AT+R     +  M +R+EQW+++YGRVY +E 
Sbjct  18    TSTTNMAFKHFMI--AALILLGAWAC-QATSRTL--PEASMFERHEQWMIQYGRVYKDEA  72

Query  258   EKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK---NPPYYEN  428
             EK  RF IF +NV FI+ FN+ G +++ + +NEFAD TN+EF++SR GYK   +    + 
Sbjct  73    EKSVRFQIFMDNVKFIEEFNKDGRQSYKLAVNEFADQTNEEFQASRNGYKMAVSSRPSQT  132

Query  429   TPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSE  608
             T F YENVT +P+ MDW KKGAVTPVK+Q QCG CWAFS +AA EGI +++ G L SLSE
Sbjct  133   TLFRYENVTAVPSSMDWRKKGAVTPVKDQGQCGSCWAFSTIAATEGITKLKTGKLISLSE  192

Query  609   QQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKI  782
             Q+L+DCD      GC GG++  GF +++ N GI  E++YPY    G C   + A   AKI
Sbjct  193   QELVDCDKTGEDQGCEGGYMEDGFEFIVKNKGIALEASYPYTAADGTCNSKEEASRAAKI  252

Query  783   KGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGY  962
              G++ VP   E+ L+KAVANQPVS +IDASG+AFQFY  G++   +C T ++H +T VGY
Sbjct  253   SGYEKVPANSETALLKAVANQPVSVSIDASGVAFQFYSSGVF-TGECGTDLDHGVTAVGY  311

Query  963   GE-SDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G+ SDG K+WL+KNSWG  WG++GY+ + +      G CGIA   S+P A
Sbjct  312   GKTSDGTKYWLVKNSWGASWGDSGYIMMQRGVAAKGGLCGIAMDASYPTA  361



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/333 (53%), Positives = 223/333 (67%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+   W CCEAT+R     D  M  RYEQW+  YGR+Y +  EK  RF IFKENV FI
Sbjct  11    LILMFGAW-CCEATSRSL--QDASMYGRYEQWMTRYGRIYNDVNEKENRFKIFKENVAFI  67

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENV-TEIPADMDW  479
             +S N   N+ + +G+N+FADLTN+EFK+SR G+K +    + T F YENV   +PA MDW
Sbjct  68    ESSNNDVNKPYKLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAPVPATMDW  127

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  128   RKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEG  187

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G++TE+NYPY    G C   KAA I AKI G++ VP   E  L+ A
Sbjct  188   GLMDDAFQFIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTA  247

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDA G  FQFY  G++    C T+++H +T VGYG S DG KFWL+KNSWG
Sbjct  248   VAHQPVSVAIDAGGSDFQFYSSGVF-TGACGTSLDHGVTAVGYGVSDDGTKFWLVKNSWG  306

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D    +G CGIA + S+P A
Sbjct  307   TEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  339



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/333 (52%), Positives = 220/333 (66%), Gaps = 8/333 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             ++IL+L  W+   + A  R   D  M  RYEQW+  YGR+Y +  EK  RF IFKENV F
Sbjct  15    SLILMLGAWS---SGATSRTLQDARMYGRYEQWLTRYGRIYNDVNEKETRFKIFKENVAF  71

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFMYENVT-EIPADMDW  479
             I+S N+  N+ + + +N+FADLTN+EFK+SR G+K       T F YEN+T  +PA MDW
Sbjct  72    IESSNKDANKPYRLSVNQFADLTNEEFKTSRNGFKGHECSTKTSFKYENLTASLPATMDW  131

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  132   RKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEG  191

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N GI+TE+NYPY    G C   K A   AKI GF+ VP   E  L+ A
Sbjct  192   GLMDDAFQFIQQNRGISTEANYPYDGVDGTCNAKKEASRAAKITGFEDVPANSEKALLTA  251

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  252   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  310

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  311   AEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  343



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 225/343 (66%), Gaps = 13/343 (4%)
 Frame = +3

Query  96    KYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRF  275
             KYT L    ++IL+L  W+   + A  R   D  +  RYEQW+  YGRVY +  EK  RF
Sbjct  10    KYTCL----SLILMLGAWS---SGATSRTLQDASIYGRYEQWLTRYGRVYNDVNEKETRF  62

Query  276   DIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP-FMYENV  452
              IFKENV FI+S N+  N+   + +N+FADLTN+EFK+SR G+K       T  F YENV
Sbjct  63    KIFKENVAFIESSNKDANKPCRLSVNQFADLTNEEFKASRNGFKGHECSTKTSSFKYENV  122

Query  453   T-EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
             T  +PA MDW KKGAVTPVK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD
Sbjct  123   TASLPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGTLISLSEQELVDCD  182

Query  630   IIS--LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
               S   GC GG +   F ++  N GI+TE+NYPY    G C   K A   AKI GF+ VP
Sbjct  183   TASEDQGCEGGLMDDAFQFIQQNHGISTEANYPYEGVDGTCNAKKEASHAAKITGFEDVP  242

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGR  980
                E +L+ AVA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG 
Sbjct  243   ANSEKDLLAAVAHQPVSVAIDASGSDFQFYSSGVF-SGTCGTSLDHGVTAVGYGVSEDGT  301

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             K+WL+KNSWG  WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  302   KYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  344



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   338 bits (867),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 171/333 (51%), Positives = 229/333 (69%), Gaps = 8/333 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ VL  WA  +ATAR     +  M +R+E W+V+YGR Y +  EK KR+ IFK+NV  
Sbjct  13    ALLFVLAAWAS-QATARNL--HEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVAR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDW  479
             I+SFN+A ++++ + INEFADLTN+EF++SR  +K +    E T F YENVT +P+ +DW
Sbjct  70    IESFNKAMDKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYENVTAVPSTVDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCG CWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  130   RKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPYA   G C R KAA   AKI G++ VP   E  L KA
Sbjct  190   GLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QP++ AIDA G  FQFY  G++   +C T ++H ++ VGYG S DG K+WL+KNSWG
Sbjct  250   VAHQPIAVAIDAGGSEFQFYSSGVF-TGQCGTELDHGVSAVGYGTSDDGMKYWLVKNSWG  308

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              GWGE GY+++ +D    +G CGIA + S+P A
Sbjct  309   TGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   338 bits (867),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/333 (50%), Positives = 228/333 (68%), Gaps = 8/333 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ VL  WA   + A+ R   +  M +R+E W+ +YGRVY +  EK KR+ IFK+NV  
Sbjct  13    ALLFVLAAWA---SHAKARNLHEASMYERHEDWMAQYGRVYKDAGEKSKRYKIFKDNVAR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDW  479
             I+SFN+A N+++ + INEFADLTN+EF++SR  +K +    E T F YE+V  +P+ +DW
Sbjct  70    IESFNKAMNKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYEHVXAVPSTVDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCG CWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  130   RKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPYA   G C R KAA   AKI G++ VP   E  L KA
Sbjct  190   GLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QP++ AIDA G  FQFY  G++   +C T ++H ++ VGYG S DG K+WL+KNSWG
Sbjct  250   VAHQPIAVAIDAGGFEFQFYSSGVF-TGQCGTELDHGVSAVGYGTSDDGMKYWLVKNSWG  308

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              GWGE GY+++ +D  + +G CGIA + S+P A
Sbjct  309   TGWGEEGYIRMQRDVTEKEGLCGIAMQASYPTA  341



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   338 bits (866),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/333 (51%), Positives = 228/333 (68%), Gaps = 8/333 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ VL  WA  +ATAR     +  M +R+E W+V+YGR Y +  EK KR+ IFK+NV  
Sbjct  13    ALLFVLAAWAS-QATARSL--HEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVAR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDW  479
             I+SFN+A ++++ + INEFADLTN+EF++SR  +K +    E T F YENVT +P+ +DW
Sbjct  70    IESFNKAMDKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYENVTAVPSTVDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCG CWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  130   RKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPYA   G C R KAA   AKI G++ VP   E  L KA
Sbjct  190   GLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QP++ AIDASG  FQFY  G++   +C T ++H +  VGYG S DG K+WL+KNSW 
Sbjct  250   VAHQPIAVAIDASGSEFQFYSSGVF-TGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWS  308

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              GWGE GY+++ +D    +G CGIA + S+P A
Sbjct  309   TGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>gb|KHN27806.1| Vignain [Glycine soja]
Length=313

 Score =   337 bits (863),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 211/305 (69%), Gaps = 2/305 (1%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             M +R+EQW+ +YG+VY +  EK KR  IFK+NV FI+SFN AGN+ + +GIN  AD TN+
Sbjct  10    MSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFIESFNAAGNKPYKLGINHLADQTNE  69

Query  378   EFKSSRMGYKNPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAA  557
             EF +S  GYK+   +  TPF YENVT +P  +DW + GAVT VK+Q QCG CWAFS VAA
Sbjct  70    EFVASHNGYKHKASHSQTPFKYENVTGVPNAVDWRENGAVTAVKDQGQCGSCWAFSTVAA  129

Query  558   IEGIKQIRAGILSSLSEQQLLDCDIISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKK  737
              EGI QI   +L SLSEQ+L+DCD +  GC GG++  GF +++ NGGI++E+NYPY    
Sbjct  130   TEGIYQITTSMLMSLSEQELVDCDSVDHGCDGGYMEGGFEFIIKNGGISSEANYPYTAVD  189

Query  738   GFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKD  917
             G C  +K A   A+IKG++ VP   E  L KAVANQPVS  IDA G AFQFY  G++   
Sbjct  190   GTCDANKEASPAAQIKGYETVPANSEDALQKAVANQPVSVTIDAGGSAFQFYSSGVF-TG  248

Query  918   KCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKP  1094
             +C T ++H +T VGYG + DG ++W++KNSWG  WGE GY+++ + +   +G CGIA   
Sbjct  249   QCGTQLDHGVTAVGYGSTDDGTQYWIVKNSWGTQWGEEGYIRMQRGTDAQEGLCGIAMDA  308

Query  1095  SFPVA  1109
             S+P A
Sbjct  309   SYPTA  313



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 172/338 (51%), Positives = 229/338 (68%), Gaps = 10/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             + FAA+ LVL + A   + A  R   +  MV+++ QW+  +GR Y ++ EK KR  IFKE
Sbjct  9     LAFAAL-LVLGMHA---SRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKE  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYY---ENTPFMYENVTEI  461
             N  +IDS N+AG   + +GIN+FADLTN+EF+++  GY+ P +    E T F YENVT +
Sbjct  65    NAEYIDSVNKAGIRPYKLGINDFADLTNEEFRATHNGYRMPSHQKSSETTSFKYENVTAL  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-S  638
              A MDW KKGAVT VKNQ QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD    
Sbjct  125   AASMDWRKKGAVTGVKNQGQCGCCWAFSAVAATEGINKIKNGKLISLSEQELVDCDTSWD  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
             +GC GG +   F Y++ N G+TTESNYPY    G C+  K ++  AKI G++ VP   ES
Sbjct  185   MGCQGGLMDYAFKYIIKNHGLTTESNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSES  244

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              L KAVA+QPVS AIDASG  FQFY  G++   +C T ++H +T +GYG+ SDG  +WL+
Sbjct  245   ALQKAVAHQPVSVAIDASGPDFQFYSSGVF-TGECGTELDHGVTAIGYGKTSDGTDYWLV  303

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGE GY+++ ++    +G CGIA + S+P A
Sbjct  304   KNSWGTSWGEKGYIRMQRNIDAEEGLCGIAMEASYPTA  341



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 171/333 (51%), Positives = 228/333 (68%), Gaps = 8/333 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ VL  WA  +ATAR     +  M +R+E W+V+YGR Y +  EK KR+ IFK+NV  
Sbjct  13    ALLFVLAAWAS-QATARXL--HEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVAR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDW  479
             I+SFN+A ++++ + INEFADLTN+EF++SR  +K +    E T F YENVT +P+ +DW
Sbjct  70    IESFNKAMDKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYENVTAVPSTVDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCG CWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  130   RKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCSG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPYA   G C R KAA   AKI G++ VP   E  L KA
Sbjct  190   GLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QP++ AIDASG  FQFY  G++   +C T ++H +  VGYG S DG K+WL+KNSW 
Sbjct  250   VAHQPIAVAIDASGSEFQFYSSGVF-TGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWS  308

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              GWGE GY+++ +D    +G CGIA + S+P A
Sbjct  309   TGWGEEGYIRMQRDVTVKEGLCGIAMQASYPTA  341



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 221/334 (66%), Gaps = 9/334 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             ++IL++  W+   + A  R   D  M  RYEQW+  YGRVY N  EK  RF IF ENV F
Sbjct  15    SLILMMGAWS---SGATSRTLQDASMYGRYEQWLTRYGRVYNNVNEKETRFKIFNENVAF  71

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVT-EIPADMD  476
             I+S N+  N+ + + +N+FADLTN+EFK+SR G+K +    E T F YENVT  +PA MD
Sbjct  72    IESSNKYANKPYKLSVNQFADLTNEEFKASRNGFKGHECSTETTSFKYENVTASLPATMD  131

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCH  650
             W KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC 
Sbjct  132   WRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCE  191

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F ++  N GI+TE+NYPY    G C   K A   AKI GF+ VP   E  L+ 
Sbjct  192   GGLMDDAFQFIQQNHGISTEANYPYDGVDGACNAKKEASHAAKITGFEDVPANSEKALLA  251

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSW  1007
             AVA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSW
Sbjct  252   AVAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  310

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  311   GAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  344



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score =   337 bits (865),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 222/336 (66%), Gaps = 9/336 (3%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F   ++VL +W      A  R   D  M  R+EQW+ +YGRVY +  EK +RF IFK+N 
Sbjct  6     FVLALIVLGVWV---FGAMARGIADVPMSTRHEQWMAQYGRVYKDAAEKERRFQIFKDNC  62

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT--PFMYENVTEIPAD  470
             N+I+S N+AGN  + +G+N+FAD+TN+EFK+S +G+K     ++T   F Y N+T++   
Sbjct  63    NYIESVNRAGNRKYKLGLNQFADMTNEEFKASHLGFKPMRLTKSTTGSFQYANLTDVSDS  122

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLG  644
             +DW  +GAVTPVKNQ  CGCCWAFS VAAIEGI QI  G L SLSEQQ++DCD+   + G
Sbjct  123   VDWRTRGAVTPVKNQGSCGCCWAFSTVAAIEGITQINNGNLVSLSEQQVVDCDVKDGNRG  182

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             CHGG++   F YV+ NGGITTE NYPY    G C  +KA+   A I G+Q VP   ES L
Sbjct  183   CHGGFMTRAFQYVIDNGGITTEENYPYMAADGTCDTNKASSSAATISGYQNVPVNDESSL  242

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKN  1001
             ++AV+ QPVS  ID  G  FQ Y  GI+    C T ++HA+T +GYG + DG K+WL+KN
Sbjct  243   LQAVSKQPVSVGIDGGGQDFQHYSSGIFA-GPCETNMDHAVTAIGYGTAEDGTKYWLLKN  301

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  302   SWGTTWGEKGYMRIQRDVSAPEGLCGIAKLASYPTA  337



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 173/333 (52%), Positives = 219/333 (66%), Gaps = 8/333 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             ++IL+L  W+   + A  R   D  M  RYEQW+  YGRVY +  EK  RF IFKENV F
Sbjct  15    SLILMLGAWS---SGATSRTLQDASMYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAF  71

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFMYENVT-EIPADMDW  479
             I+S N+  N+ + + +N+FADLTN+EFK+SR G+K       T F YEN+T  +PA MDW
Sbjct  72    IESSNKDANKPYRLSVNQFADLTNEEFKASRNGFKGHECSTKTSFKYENLTASLPATMDW  131

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  132   RKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEG  191

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N GI+TE+NYPY    G C   K A   AKI GF+ VP   E  L+ A
Sbjct  192   GLMDDAFQFIQQNRGISTEANYPYDGVDGTCNAKKEASRAAKITGFEDVPANSEKALLTA  251

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  252   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  310

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D    +G CGIA   S+P A
Sbjct  311   TEWGEAGYIRMQRDVAAGEGLCGIAMAASYPTA  343



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score =   337 bits (864),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 226/334 (68%), Gaps = 9/334 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A +LVL + A   + A  R   +  MV+++ QW+  +GR Y ++ EK KR  IFKEN  +
Sbjct  2     APLLVLGMHA---SRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEY  58

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYY---ENTPFMYENVTEIPADM  473
             IDS N+AG   + +GIN+FADLTN+EF+++  GY+ P +    E T F YENVT + A M
Sbjct  59    IDSVNKAGIRPYKLGINDFADLTNEEFRATHNGYRMPSHQKSSETTSFKYENVTALAASM  118

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGCH  650
             DW KKGAVT VKNQ QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD    +GC 
Sbjct  119   DWRKKGAVTGVKNQGQCGCCWAFSAVAATEGINKIKNGKLISLSEQELVDCDTSWDMGCQ  178

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F Y++ N G+TTESNYPY    G C+  K ++  AKI G++ VP   ES L K
Sbjct  179   GGLMDYAFKYIIKNHGLTTESNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESALQK  238

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSW  1007
             AVA+QPVS AIDASG  FQFY  G++   +C T ++H +T +GYG+ SDG  +WL+KNSW
Sbjct  239   AVAHQPVSVAIDASGPDFQFYSSGVF-TGECGTELDHGVTAIGYGKTSDGTDYWLVKNSW  297

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGE GY+++ ++    +G CGIA + S+P A
Sbjct  298   GTSWGEKGYIRMQRNIDAEEGLCGIAMEASYPTA  331



>sp|A2XQE8.1|SAG39_ORYSI RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EAY93058.1| hypothetical protein OsI_14861 [Oryza sativa Indica Group]
Length=339

 Score =   337 bits (864),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/338 (51%), Positives = 225/338 (67%), Gaps = 12/338 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWR-LDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A +  +L     C A    R L DD  M  R+E+W+ +YGRVY ++ EK +RF++FK NV
Sbjct  6     ALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--EIP  464
              FI+SFN AGN  F +G+N+FADLTNDEF+ ++      P     P  F YENV    +P
Sbjct  66    AFIESFN-AGNHNFWLGVNQFADLTNDEFRWTKTNKGFIPSTTRVPTGFRYENVNIDALP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW  KGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   ATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTESNYPYA     C+    +   A IKG++ VP   E+
Sbjct  185   QGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKCK--SVSNSVASIKGYEDVPANNEA  242

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFYKGG+     C T ++H I  +GYG+ SDG K+WL+
Sbjct  243   ALMKAVANQPVSVAVDGGDMTFQFYKGGVM-TGSCGTDLDHGIVAIGYGKASDGTKYWLL  301

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENG+L++ KD  D +G CG+A +PS+P A
Sbjct  302   KNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  339



>gb|ADV74756.1| cysteine protease [Lactuca sativa]
Length=363

 Score =   338 bits (867),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 219/322 (68%), Gaps = 8/322 (2%)
 Frame = +3

Query  162   ATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFT  341
             + A  R  +D  M+ R+EQW+  +GR+Y +E EK  RF IFK NV +ID+ N   ++++T
Sbjct  39    SRATSRTLNDPTMIARHEQWMAHHGRIYTDENEKQLRFQIFKNNVAYIDAHNARSDQSYT  98

Query  342   VGINEFADLTNDEFKSSRMGYKNPP----YYENTPFMYENVTEIPADMDWVKKGAVTPVK  509
             + +N+FADLTNDEF++SR GYK  P    +  +  F Y NV+ +P ++DW K+GAVTPVK
Sbjct  99    LEVNKFADLTNDEFRASRNGYKKQPDSDSHVVSGLFRYANVSAVPDEVDWRKEGAVTPVK  158

Query  510   NQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYV  683
             +Q  CGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCDI  I  GC GG +   F ++
Sbjct  159   DQGDCGCCWAFSAVAAMEGINKLENGKLVSLSEQELVDCDIDGIDQGCEGGLMENAFQFI  218

Query  684   LFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAI  863
                 G+  ES YPY  + G C   KAA   AKI G + VP   E  L++AVANQPVS AI
Sbjct  219   EKRKGLAAESVYPYTGEDGICNTKKAAIPAAKISGHEKVPANNEKALLQAVANQPVSIAI  278

Query  864   DASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLK  1040
             DASG  FQFY GG++    C T ++HAIT VGYG + DG K+WL+KNSWG  WGENGY++
Sbjct  279   DASGYEFQFYSGGVF-TGSCGTELDHAITAVGYGATMDGTKYWLMKNSWGASWGENGYIR  337

Query  1041  LIKDSGDAKGACGIATKPSFPV  1106
             + +DS   +G CGIA  PS+PV
Sbjct  338   IKRDSLAKEGLCGIAMDPSYPV  359



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score =   337 bits (863),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 215/309 (70%), Gaps = 6/309 (2%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             MV+++ QW+  +GR Y ++ EK KR  IFKEN  +IDS N+AG   + +GIN+FADLTN+
Sbjct  16    MVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPYKLGINDFADLTNE  75

Query  378   EFKSSRMGYKNPPYY---ENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSA  548
             EF+++  GY+ P +    E T F YENVT + A MDW KKGAVT VKNQ QCGCCWAFSA
Sbjct  76    EFRATHNGYRMPSHQKSSETTSFKYENVTALAASMDWRKKGAVTGVKNQGQCGCCWAFSA  135

Query  549   VAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGCHGGWIGAGFLYVLFNGGITTESNYPY  725
             VAA EGI +I+ G L SLSEQ+L+DCD    +GC GG +   F Y++ N G+TTESNYPY
Sbjct  136   VAATEGINKIKNGKLISLSEQELVDCDTSWDMGCQGGLMDYAFKYIIKNHGLTTESNYPY  195

Query  726   AMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGI  905
                 G C+  K ++  AKI G++ VP   ES L KAVA+QPVS AIDASG  FQFY  G+
Sbjct  196   EGIDGTCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQFYSSGV  255

Query  906   YGKDKCTTTVNHAITVVGYGE-SDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGI  1082
             +   +C T ++H +T +GYG+ SDG  +WL+KNSWG  WGE GY+++ ++    +G CGI
Sbjct  256   F-TGECGTELDHGVTAIGYGKTSDGTDYWLVKNSWGTSWGEKGYIRMQRNIDAEEGLCGI  314

Query  1083  ATKPSFPVA  1109
             A + S+P A
Sbjct  315   AMEASYPTA  323



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   337 bits (865),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 224/343 (65%), Gaps = 13/343 (4%)
 Frame = +3

Query  96    KYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRF  275
             KYT L    ++IL+L  W+     A  R   D  +  RYEQW+  YGRVY +  EK  RF
Sbjct  10    KYTCL----SLILMLGAWS---XGATSRTLQDASIYGRYEQWLTRYGRVYNDVNEKETRF  62

Query  276   DIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENV  452
              IFKENV FI+S N   N+ + + +N+FADLTN+EFK SR G+K +    + T F YENV
Sbjct  63    KIFKENVAFIESSNXDANKPYKLSVNQFADLTNEEFKVSRNGFKGHECSTKTTSFKYENV  122

Query  453   T-EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
             T  +PA MDW KKGAVTPVK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD
Sbjct  123   TASLPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGTLISLSEQELVDCD  182

Query  630   IIS--LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
               S   GC GG +   F ++  N GI TE+NYPY    G C   K A   AKI GF+ VP
Sbjct  183   TASEDQGCEGGLMDDAFQFIQQNHGIGTEANYPYEGVDGTCNSKKEASHAAKITGFEDVP  242

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGR  980
                E +L+ AVA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG 
Sbjct  243   ANSEKDLLAAVAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGT  301

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             K+WL+KNSWG  WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  302   KYWLVKNSWGAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  344



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   337 bits (864),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 169/334 (51%), Positives = 224/334 (67%), Gaps = 10/334 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             ++ +L +WA   + AR R      M +R+EQ +  +GRVY ++ EK +RF IFK NV+FI
Sbjct  13    MVAILGLWA---SQARSRELHGATMWERHEQRMARHGRVYQDDAEKERRFSIFKNNVDFI  69

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK---NPPYYENTPFMYENVTEIPADMD  476
             +SFN+ GN+ +T+ IN F DLT +EFK+SR GYK   +P      PF YE+VT +P+ MD
Sbjct  70    ESFNKDGNKPYTLAINAFVDLTIEEFKASRNGYKRSSSPRQVSTKPFRYEHVTAVPSSMD  129

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCH  650
             W KKGAV P+K+Q QCG CWAFSAV A+EG  Q+  G L SLSEQ+L+DCD      GC 
Sbjct  130   WRKKGAVMPIKDQGQCGSCWAFSAVGAMEGNNQLTTGKLISLSEQELVDCDTSGEDQGCE  189

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG++   F +++ N G+TTE+NYPY    G C   K A   AKI G++ VP   ES L+K
Sbjct  190   GGFMDNAFEFIIGNHGLTTETNYPYQAVDGTCNARKEASSAAKINGYEDVPANSESALLK  249

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSW  1007
             AVA+QPVS AIDA   AFQFY  GI+   +C T ++H +T VGYG S DG K+WL+KNSW
Sbjct  250   AVAHQPVSVAIDAGESAFQFYSSGIF-TGECGTNLDHGVTAVGYGTSEDGTKYWLVKNSW  308

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G GWGE GY+++ +D    +G CGIA + S+P A
Sbjct  309   GTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPTA  342



>ref|XP_006582267.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 213/313 (68%), Gaps = 5/313 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   +  M +R+EQW+ EYG+VY +  EK KRF IFK+NV FI+SFN  GN+ + +G+N 
Sbjct  27    RKLHETSMRERHEQWMTEYGKVYKDAAEKEKRFQIFKDNVEFIESFNADGNKPYKLGVNH  86

Query  357   FADLTNDEFKSSRMGYKNPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCW  536
              ADLT +EFK+SR G+K P  +  T F YENVT IPA +DW  KGAVTP+K+Q QCG CW
Sbjct  87    LADLTVEEFKASRNGFKRPHEFSTTTFKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSCW  146

Query  537   AFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTE  710
             AFS +AA EGI QI  G L SLSEQ+L+DCD   +  GC GG++  GF +++ NGGIT+E
Sbjct  147   AFSTIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFIIKNGGITSE  206

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             +NYPY    G C  +KA    A+IKG++ VP   E+ L KAVANQPVS +IDA G  F F
Sbjct  207   TNYPYKAVDGKC--NKATSPVAQIKGYEKVPPNSETTLQKAVANQPVSVSIDADGAGFMF  264

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKG  1070
             Y  GIY  + C T ++H +T VGYG ++G  +W++KNSWG  WGE GY+++ +      G
Sbjct  265   YSSGIYNGE-CGTELDHGVTAVGYGTANGTDYWIVKNSWGTQWGEKGYVRMQRGIAAKHG  323

Query  1071  ACGIATKPSFPVA  1109
              CGIA   S+P +
Sbjct  324   LCGIALDSSYPTS  336



>gb|KHN28095.1| Thiol protease [Glycine soja]
Length=336

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 213/313 (68%), Gaps = 5/313 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   +  M +R+EQW+ EYG+VY +  EK KRF IFK+NV FI+SFN  GN+ + +G+N 
Sbjct  27    RKLHETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYKLGVNH  86

Query  357   FADLTNDEFKSSRMGYKNPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCW  536
              ADLT +EFK+SR G+K P  +  T F YENVT IPA +DW  KGAVTP+K+Q QCG CW
Sbjct  87    LADLTVEEFKASRNGFKRPHEFSTTTFKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSCW  146

Query  537   AFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTE  710
             AFS +AA EGI QI  G L SLSEQ+L+DCD   +  GC GG++  GF +++ NGGIT+E
Sbjct  147   AFSTIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFIIKNGGITSE  206

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             +NYPY    G C  +KA    A+IKG++ VP   E+ L KAVANQPVS +IDA G  F F
Sbjct  207   TNYPYKAVDGKC--NKATSPVAQIKGYEKVPPNSETTLQKAVANQPVSVSIDADGAGFMF  264

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKG  1070
             Y  GIY  + C T ++H +T VGYG ++G  +W++KNSWG  WGE GY+++ +      G
Sbjct  265   YSSGIYNGE-CGTELDHGVTAVGYGTANGTDYWIVKNSWGTQWGEKGYVRMQRGIAAKHG  323

Query  1071  ACGIATKPSFPVA  1109
              CGIA   S+P +
Sbjct  324   LCGIALDSSYPTS  336



>ref|XP_003526207.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 213/313 (68%), Gaps = 5/313 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   +  M +R+EQW+ EYG+VY +  EK KRF IFK+NV FI+SFN  GN+ + +G+N 
Sbjct  27    RKLHETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYKLGVNH  86

Query  357   FADLTNDEFKSSRMGYKNPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCW  536
              ADLT +EFK+SR G+K P  +  T F YENVT IPA +DW  KGAVTP+K+Q QCG CW
Sbjct  87    LADLTVEEFKASRNGFKRPHEFSTTTFKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSCW  146

Query  537   AFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTE  710
             AFS +AA EGI QI  G L SLSEQ+L+DCD   +  GC GG++  GF +++ NGGIT+E
Sbjct  147   AFSTIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFIIKNGGITSE  206

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             +NYPY    G C  +KA    A+IKG++ VP   E+ L KAVANQPVS +IDA G  F F
Sbjct  207   TNYPYKAVDGKC--NKATSPVAQIKGYEKVPPNSETALQKAVANQPVSVSIDADGAGFMF  264

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKG  1070
             Y  GIY  + C T ++H +T VGYG ++G  +W++KNSWG  WGE GY+++ +      G
Sbjct  265   YSSGIYNGE-CGTELDHGVTAVGYGTANGTDYWIVKNSWGTQWGEKGYVRMQRGIAAKHG  323

Query  1071  ACGIATKPSFPVA  1109
              CGIA   S+P +
Sbjct  324   LCGIALDSSYPTS  336



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 231/346 (67%), Gaps = 17/346 (5%)
 Frame = +3

Query  105   HLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETE--KVKRFD  278
              + +F A++L           +R  LD+D     R+E+W+ ++GRVYA+E E  K KRF+
Sbjct  5     QIFLFVALVLSFCFSIQLAGLSRPLLDEDS---MRHEEWMSQHGRVYADEQEDHKNKRFN  61

Query  279   IFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYEN-----TPFMY  443
             +FKENV  I+ FN    +TF + IN+FADLTN+EF++S  G+K P    +     TPF Y
Sbjct  62    VFKENVERIEEFNDG--KTFKLAINQFADLTNEEFRASYNGFKGPMVLSSQITKPTPFRY  119

Query  444   ENVTE-IPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLL  620
             ENV+  +P  +DW KKGAVTPVKNQ QCGCCWAFSAVAAIEGI QI  G L SLSEQ+L+
Sbjct  120   ENVSSALPVSVDWRKKGAVTPVKNQGQCGCCWAFSAVAAIEGITQISTGKLISLSEQELV  179

Query  621   DCDI--ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQ  794
             DCD   I  GC GG +   F +++ NGG+TTESNYPY  + G C  +K   I   I G++
Sbjct  180   DCDTKGIDHGCEGGLMDTAFEFIINNGGLTTESNYPYKGEDGTCNFNKTNPIAVSITGYE  239

Query  795   WVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-  971
              VP   E  LMKAVA+QPVS AI+A G  FQFY  G++   +C T ++HA+T VGYGES 
Sbjct  240   DVPANDEQALMKAVAHQPVSVAIEAGGSDFQFYSSGVF-TGECGTELDHAVTAVGYGESE  298

Query  972   DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             DG K+W++KNSWG  WGE+GY+++ KD    +G CGIA + S+P A
Sbjct  299   DGSKYWIVKNSWGTKWGESGYIEMQKDIKVKQGLCGIAMQASYPTA  344



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 229/344 (67%), Gaps = 11/344 (3%)
 Frame = +3

Query  93    RKYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKR  272
             RK + +++    +LVL +WA  +A  R  LD    M+ R+EQW+  Y  +Y ++ E+ KR
Sbjct  6     RKSSSILL---TLLVLGVWAS-QANCRTLLDAHTSMLDRHEQWMARYVPIYKDDEEREKR  61

Query  273   FDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNP--PYYENTPFMYE  446
             F IFK+NV FI+SFN A N+ + + IN FAD +++EF++SR  Y+         TPF YE
Sbjct  62    FQIFKDNVEFIESFNYASNQPYKLNINGFADQSHEEFQASRNRYRTSLNTMSSKTPFRYE  121

Query  447   NVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDC  626
             NVT IP+ MDW KKGAVTP+K+Q +CGCCWAFSAVAA EG  ++++G L SLSEQ+L+DC
Sbjct  122   NVTAIPSSMDWRKKGAVTPIKDQGECGCCWAFSAVAATEGTTKLKSGKLVSLSEQELVDC  181

Query  627   DII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWV  800
             D    + GC GG +   F +V+ N G+  E+NYPY    G C ++K A   AKI G++ V
Sbjct  182   DTQGENQGCEGGLMDDAFKFVMRNKGLAAEANYPYRGIDGICNKNKVAYHAAKITGYEDV  241

Query  801   PRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDG  977
             P   E  L+KAVANQPVS AIDA G  FQFY  GI   D C T +NH +TVVGYG  +DG
Sbjct  242   PA-NELALLKAVANQPVSVAIDAGGYEFQFYSRGILTGD-CGTHLNHGVTVVGYGTGADG  299

Query  978   RKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              K+WL+KNSWG  WGE GY+++ +D    +G CGIA K S+P A
Sbjct  300   TKYWLVKNSWGAEWGEGGYVRIQRDVHTRQGLCGIAMKASYPTA  343



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 226/345 (66%), Gaps = 10/345 (3%)
 Frame = +3

Query  84    MGSR-KYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETE  260
             MGS  K  H++   A++L+L I   C +    R   +  M +R+EQW+ +YG+VY +  E
Sbjct  1     MGSMGKKQHIL---ALVLLLSI---CTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAE  54

Query  261   KVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFM  440
             K KR  IFK+NV FI+SFN AGN+ + + IN  AD TN+EF +S  GYK    +  TPF 
Sbjct  55    KQKRLLIFKDNVEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGSHSQTPFK  114

Query  441   YENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLL  620
             Y NVT+IP  +DW + GAVT VK+Q QCG CWAFS VAA EGI QI  G+L SLSEQ+L+
Sbjct  115   YGNVTDIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELV  174

Query  621   DCDIISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWV  800
             DCD +  GC GG +  GF +++ NGGI++E+NYPY    G C  SK A   A+IKG++ V
Sbjct  175   DCDSVDHGCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETV  234

Query  801   PRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDG-  977
             P   E  L +AVANQPVS +IDA G  FQFY  G++   +C T ++H +TVVGYG +D  
Sbjct  235   PANSEEALQQAVANQPVSVSIDAGGSGFQFYSSGVF-TGQCGTQLDHGVTVVGYGTTDDG  293

Query  978   -RKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               ++W++KNSWG  WGE GY+++ +     +G CGIA   S+P A
Sbjct  294   THEYWIVKNSWGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYPTA  338



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 224/333 (67%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+   W+C EAT+R     D  M  +YEQW+  YGRVY +  EK  RF IFKENV FI
Sbjct  11    LILMFGAWSC-EATSRSL--QDASMYGKYEQWMTRYGRVYNDVNEKENRFKIFKENVAFI  67

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENV-TEIPADMDW  479
             +S N   N+ + +G+N+FADLTN+EFK+SR G+K +    + T F YENV   +PA MDW
Sbjct  68    ESSNNDVNKPYKLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAPVPAAMDW  127

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHG  653
              KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD   +  GC G
Sbjct  128   RKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEG  187

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G++TE+NYPY    G C   KAA I AKI G++ VP   E  L+ A
Sbjct  188   GLMDDAFQFIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTA  247

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDA G  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  248   VAHQPVSVAIDAGGSDFQFYSSGVF-TGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  306

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D    +G CGIA + S+P A
Sbjct  307   TEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  339



>gb|EMT20796.1| Vignain [Aegilops tauschii]
Length=394

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 228/348 (66%), Gaps = 12/348 (3%)
 Frame = +3

Query  90    SRKYTHLIVFAAIILVLEIWACCEATARWR-LDDDDEMVKRYEQWIVEYGRVYANETEKV  266
             S K+T  I  A I+ +L     C +    R L+DD  MV R+E+W+V+Y RVY + TEK 
Sbjct  51    SIKHTMAISKALILSILGCLCFCSSVLAARELNDDLSMVARHERWMVQYNRVYKDTTEKA  110

Query  267   KRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FM  440
              RF++FK NV FI+SFN A N  F +GIN+F DLTN+EFK+++      P  E  P  F 
Sbjct  111   HRFEVFKANVGFIESFN-AENRKFYLGINQFTDLTNEEFKATKANKGYRPSLERVPTGFR  169

Query  441   YENVT--EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQ  614
             YENV+   +P  +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +++ G L SLSEQ+
Sbjct  170   YENVSLDALPETIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKLKTGKLISLSEQE  229

Query  615   LLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKG  788
             L+DCD+     GC GG +   F +++ NGG+TTESNYPY      C+        A IK 
Sbjct  230   LVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYTAADDKCK--SGTNDAATIKS  287

Query  789   FQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE  968
             ++ VP   E  LM+AVA+QPVS A+D   M FQFYKGG+     C T ++H I  +GYG+
Sbjct  288   YEDVPANNEGALMQAVASQPVSVAVDGGDMTFQFYKGGVM-TGSCGTDLDHGIAAIGYGK  346

Query  969   -SDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              SDG K+WL+KNSWG  WGENGYL++ KD  D +G CG+A +PS+P A
Sbjct  347   TSDGTKYWLLKNSWGTTWGENGYLRMEKDITDKRGMCGLAMEPSYPTA  394



>ref|XP_006582263.1| PREDICTED: vignain-like [Glycine max]
Length=338

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 226/345 (66%), Gaps = 10/345 (3%)
 Frame = +3

Query  84    MGSR-KYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETE  260
             MGS  K  H++   A++L+L I   C +    R   +  M +R+EQW+ +YG+VY +  E
Sbjct  1     MGSMGKKQHIL---ALVLLLSI---CTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAE  54

Query  261   KVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFM  440
             K KR  IFK+NV FI+SFN AGN+ + + IN  AD TN+EF +S  GYK    +  TPF 
Sbjct  55    KQKRLLIFKDNVEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGSHSQTPFK  114

Query  441   YENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLL  620
             Y NVT+IP  +DW + GAVT VK+Q QCG CWAFS VAA EGI QI  G+L SLSEQ+L+
Sbjct  115   YGNVTDIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELV  174

Query  621   DCDIISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWV  800
             DCD +  GC GG +  GF +++ NGGI++E+NYPY    G C  SK A   A+IKG++ V
Sbjct  175   DCDSVDHGCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETV  234

Query  801   PRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDG-  977
             P   E  L +AVANQPVS +IDA G  FQFY  G++   +C T ++H +TVVGYG +D  
Sbjct  235   PANSEEALQQAVANQPVSVSIDAGGSGFQFYSSGVF-TGQCGTQLDHGVTVVGYGTTDDG  293

Query  978   -RKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               ++W++KNSWG  WGE GY+++ +     +G CGIA   S+P A
Sbjct  294   THEYWIVKNSWGTQWGEEGYIRMQRGIDALEGLCGIAMDASYPTA  338



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/340 (50%), Positives = 225/340 (66%), Gaps = 11/340 (3%)
 Frame = +3

Query  105   HLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             H  +F A+I +L   A   + A  R   D  M +R+E W+ + GRVY +  EK  R+ IF
Sbjct  7     HQCIFLALIFIL---AALASQAIARSLQDASMYERHEDWMAQNGRVYKDANEKEIRYKIF  63

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKN---PPYYENTPFMYENVT  455
             KENV  I+SFN+AG +++ +GIN+FADLTN+EFK+SR  +K     P  +  PF YENVT
Sbjct  64    KENVERIESFNKAGGKSYKLGINQFADLTNEEFKTSRNRFKGHMCSP--QEGPFRYENVT  121

Query  456   EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII  635
              +P+ MDW KKGAVTP+K+Q QCG CWAFSAVAA+EGI Q+ +  L SLSEQ+L+DCD  
Sbjct  122   AVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTSHKLISLSEQELVDCDTK  181

Query  636   --SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRF  809
                 GC GG +   F ++  N G+TTE+NYPY    G C  +K A   AKI G++ VP  
Sbjct  182   GEDQGCQGGLMDDAFKFIENNQGLTTETNYPYEGSDGTCNANKEANHAAKITGYEDVPAN  241

Query  810   RESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFW  989
              E+ L+KAVA QPVS AIDA G  FQFY  GI+  D C T ++H +  VGYG S+G K+W
Sbjct  242   DEAALLKAVAQQPVSVAIDAGGFQFQFYSSGIFTGD-CGTELDHGVAAVGYGVSNGMKYW  300

Query  990   LIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             L+KNSWG  WGE GY+++ +D    +G CGIA + S+P A
Sbjct  301   LVKNSWGTQWGEVGYIRMQRDIEAKEGLCGIAMQASYPTA  340



>sp|Q7XWK5.2|SAG39_ORYSJ RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa Japonica Group]
 gb|EAZ29764.1| hypothetical protein OsJ_13822 [Oryza sativa Japonica Group]
Length=339

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/338 (51%), Positives = 224/338 (66%), Gaps = 12/338 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWR-LDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A +  +L     C A    R L DD  M  R+E+W+ +YGRVY ++ EK +RF++FK NV
Sbjct  6     ALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--EIP  464
              FI+SFN AGN  F +G+N+FADLTNDEF+  +      P     P  F YENV    +P
Sbjct  66    AFIESFN-AGNHNFWLGVNQFADLTNDEFRWMKTNKGFIPSTTRVPTGFRYENVNIDALP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW  KGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   ATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTESNYPYA     C+    +   A IKG++ VP   E+
Sbjct  185   QGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKCK--SVSNSVASIKGYEDVPANNEA  242

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFYKGG+     C T ++H I  +GYG+ SDG K+WL+
Sbjct  243   ALMKAVANQPVSVAVDGGDMTFQFYKGGVM-TGSCGTDLDHGIVAIGYGKASDGTKYWLL  301

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENG+L++ KD  D +G CG+A +PS+P A
Sbjct  302   KNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  339



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 221/334 (66%), Gaps = 9/334 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             ++IL+L  W+   + A  R   D  M  RYEQW+  YGRVY +  EK  RF IFKENV F
Sbjct  4     SLILMLGTWS---SGATSRTLQDAPMYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAF  60

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVT-EIPADMD  476
             I+S N+  N+ + + +N+FADLTN+EFK+S+ G+K +    + T F YENVT  +PA MD
Sbjct  61    IESSNKYANKPYKLSVNQFADLTNEEFKASKNGFKGHECSTKTTSFKYENVTASLPATMD  120

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCH  650
             W KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC 
Sbjct  121   WRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLMSLSEQELVDCDTAGEDQGCE  180

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F ++  N GI+TE+NYPY    G C   K     AKI GF+ VP   E  L+ 
Sbjct  181   GGLMDDAFQFIQQNHGISTEANYPYEGVDGTCNTKKETSHAAKITGFEDVPANSEKALLA  240

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSW  1007
             AVA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSW
Sbjct  241   AVAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  299

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  300   GAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  333



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 220/318 (69%), Gaps = 8/318 (3%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   +  M++++EQW+V+ GR Y ++ EK  R+ IFK+NV +I S ++A N T+ + IN+
Sbjct  9     RTLPNKSMIEKHEQWMVQCGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAQNWTYKLAINK  68

Query  357   FADLTNDEFKSSRMGYKN-----PPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQ  521
             FADLTN+EF++SR G+K         +E + F Y NV+ +P  +DW KKGAVTPVK+Q Q
Sbjct  69    FADLTNEEFQASRNGFKKGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKKGAVTPVKDQGQ  128

Query  522   CGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGCHGGWIGAGFLYVLFNGG  698
             CGCCWAFSAVAA EG+ QI+ G L SLSEQ+L+DCD     GC+ G +   F +++ N G
Sbjct  129   CGCCWAFSAVAATEGLNQIKTGNLISLSEQELVDCDTSEDQGCNDGLMDNAFEFIISNNG  188

Query  699   ITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGM  878
             +TTESNYPY    G C   K +   AKI G++ VP   ES L+KAVANQP+S AIDASG 
Sbjct  189   LTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGS  248

Query  879   AFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDS  1055
              FQFY GG++   +C T ++H +T VGYG  SDG K+WL+KNSWG  WGENGY+++ +D 
Sbjct  249   DFQFYSGGVF-SGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQRDI  307

Query  1056  GDAKGACGIATKPSFPVA  1109
               A+G CGIA + S+P A
Sbjct  308   DAAEGLCGIAMQASYPTA  325



>gb|KDO63329.1| hypothetical protein CISIN_1g047793mg, partial [Citrus sinensis]
Length=324

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/310 (53%), Positives = 212/310 (68%), Gaps = 7/310 (2%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             + +++EQW+ +YG+VY N  EK KRF IFK+NV FI+S N AGN+ + + INEFAD TN 
Sbjct  16    LSEKHEQWMSKYGKVYKNPEEKEKRFRIFKDNVEFIESLNAAGNKPYKLSINEFADQTNQ  75

Query  378   EFKSSRMGYKNP---PYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSA  548
             EFK+ R GY+ P      + T F YENV ++PA MDW K GAVTP+KNQ  CG CWAFSA
Sbjct  76    EFKAFRNGYRRPDGLTSRKGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPCGSCWAFSA  135

Query  549   VAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTESNYP  722
             VAA EGI Q+  G L SLSEQ+L+ CD   +  GC GG +   F +++ N GITTE+NYP
Sbjct  136   VAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEANYP  195

Query  723   YAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGG  902
             Y    G C ++  A   AKIKG++ VP   E  L+KAVANQPV+ +IDASG AFQFY  G
Sbjct  196   YQAVDGTCNKTNEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQFYSSG  255

Query  903   IYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACG  1079
             ++  D C T ++H +T VGYG + +G K+WL+KNSWG  WGE GY+++ +D    +G CG
Sbjct  256   VFTGD-CGTELDHGVTAVGYGATANGTKYWLVKNSWGTSWGEEGYIRMKRDIDAKEGLCG  314

Query  1080  IATKPSFPVA  1109
             IA   S+P A
Sbjct  315   IAMDSSYPTA  324



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 227/333 (68%), Gaps = 8/333 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ VL  WA  +ATAR     +  M +R+E W+ +YGRVY +  EK KR+ IFK+NV  
Sbjct  13    ALLFVLAAWAS-QATARNL--HEASMYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVAR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDW  479
             I+SFN+A ++++ + INEFADLTN+EF +SR  +K +    E T F YENVT +P+ +DW
Sbjct  70    IESFNKAMDKSYKLSINEFADLTNEEFGTSRNRFKAHICSTEATSFKYENVTAVPSTIDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCG CWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD      GC+G
Sbjct  130   RKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCNG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPYA   G C R KAA   AKI G++ VP   E  L KA
Sbjct  190   GLMDDAFKFIKQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             V +QP++ AIDA G  FQFY  G++   +C T ++H +  VGYG S DG K+WL+KNSWG
Sbjct  250   VVHQPIAVAIDAGGFEFQFYSSGVF-TGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWG  308

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              GWGE GY+++ +D    +G CGIA + S+P A
Sbjct  309   TGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>ref|XP_009798361.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=339

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/333 (51%), Positives = 229/333 (69%), Gaps = 9/333 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             AI+LVL +   C +    R   +  + +++EQW+ +YGRVY ++TEK +R + FK+N+ +
Sbjct  12    AILLVLGL---CVSLVTSRALYEASITEKHEQWMTQYGRVYTDDTEKTERLETFKQNLEY  68

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK--NPPYYENTPFMYENVTEIPADMD  476
             I+S N+    T+ +GIN+FAD+TN+EFK+SR GY+  +    + T F YENVT +   MD
Sbjct  69    IESINKDVTRTYKLGINQFADMTNEEFKASRNGYRISSQQKIKTTFFQYENVT-VAYSMD  127

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-LGCHG  653
             W KKGAVT +K+Q QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD  S  GC G
Sbjct  128   WRKKGAVTKIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSNQGCEG  187

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F Y++ N G+T+ESNYPY    G C+  K +   AKI+G++ VP   E  L+KA
Sbjct  188   GLMDDAFKYIIKNHGLTSESNYPYKGIDGTCKTEKESNHVAKIRGYKDVPENSELALLKA  247

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VANQPVS AIDASG  FQFY  GI+   KC T ++H +T VGYG + DG K+W++KNSWG
Sbjct  248   VANQPVSVAIDASGSDFQFYSSGIF-TGKCGTELDHGVTTVGYGATKDGTKYWIVKNSWG  306

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGENGY+++ +D     G CGIA K S+P+A
Sbjct  307   VSWGENGYIRMKRDIVAKTGLCGIAMKASYPIA  339



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 226/332 (68%), Gaps = 6/332 (2%)
 Frame = +3

Query  129   ILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFID  308
             I +  + A C   A  R   + EM  R+E+W+ ++G+VY ++ EK++RF IFK NV FI+
Sbjct  12    IALFFVLAMCADQAASRELHELEMTGRHEKWMAKHGKVYKDDKEKLRRFQIFKSNVVFIE  71

Query  309   SFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNP--PYYENTPFMYENVTEIPADMDWV  482
             SFN AGN+++ +GIN+FADLTN+EF++   GYK P     + TPF YENVT +P+ +DW 
Sbjct  72    SFNTAGNKSYMLGINKFADLTNEEFRAFWNGYKRPLGASRKITPFKYENVTALPSSIDWR  131

Query  483   KKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIISL--GCHGG  656
              KGAVTP+K+Q  CG CWAFSAVAA EGI ++R G L SLSEQ+L+DCD+     GC GG
Sbjct  132   SKGAVTPIKDQGVCGSCWAFSAVAATEGIHKLRTGKLVSLSEQELVDCDVKGQDKGCQGG  191

Query  657   WIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAV  836
              +   F ++  +GG+T+E+NYPY  + G C   K A    KI G+Q VP+  E+ L+KAV
Sbjct  192   LMVDAFKFIKRHGGMTSEANYPYQGRDGKCDTKKEASRAVKITGYQAVPKNSEAALLKAV  251

Query  837   ANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSWGE  1013
             ANQPVS AIDA  ++FQFY+ GI+    C   +NH +  VGYG S+ G K+W++KNSWG 
Sbjct  252   ANQPVSVAIDAGSLSFQFYRSGIF-TGICGKDINHGVAAVGYGRSNSGSKYWIVKNSWGT  310

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGE GY+++ +D    +G CGIA + S+P A
Sbjct  311   EWGEKGYIRMKRDVRSKEGLCGIAMECSYPTA  342



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score =   335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/340 (49%), Positives = 223/340 (66%), Gaps = 9/340 (3%)
 Frame = +3

Query  96    KYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRF  275
             K  H++   A++L+L I   C +    R   +  M +R+EQW+ +YG+VY +  EK KR 
Sbjct  3     KKQHIL---ALVLLLSI---CTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRL  56

Query  276   DIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFMYENVT  455
              IFK+NV FI+SFN AGN+ + + IN  AD TN+EF +S  GYK    +  TPF Y NVT
Sbjct  57    LIFKDNVEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGSHSQTPFKYGNVT  116

Query  456   EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII  635
             +IP  +DW + GAVT VK+Q QCG CWAFS VAA EGI QI  G+L SLSEQ+L+DCD +
Sbjct  117   DIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDSV  176

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +  GF +++ NGGI++E+NYPY    G C  SK A   A+IKG++ VP   E
Sbjct  177   DHGCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSE  236

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDG--RKFW  989
               L +AVANQPVS +IDA G  FQFY  G++   +C T ++H +TVVGYG +D    ++W
Sbjct  237   EALQQAVANQPVSVSIDAGGSGFQFYSSGVF-TGQCGTQLDHGVTVVGYGTTDDGTHEYW  295

Query  990   LIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             ++KNSWG  WGE GY+++ +     +G CGIA   S+P A
Sbjct  296   IVKNSWGTQWGEEGYIRMQRGIDAQEGLCGIAMDASYPTA  335



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 218/323 (67%), Gaps = 8/323 (2%)
 Frame = +3

Query  156   CEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNET  335
             CEAT+R     D  M  RYEQW+  YGRVY +  EK  RF IFKENV FI+S N   N+ 
Sbjct  7     CEATSRSL--QDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVNKP  64

Query  336   FTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENV-TEIPADMDWVKKGAVTPVK  509
             + +G+N+FADLTN+EFK+SR G+K +    + T F YENV   +PA MDW KKGAVTP+K
Sbjct  65    YKLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAPVPAAMDWRKKGAVTPIK  124

Query  510   NQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYV  683
             +Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD   +  GC GG +   F ++
Sbjct  125   DQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFI  184

Query  684   LFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAI  863
               N G++TE+NYPY    G C   KAA I AKI G++ VP   E  L+ AVA+QPVS AI
Sbjct  185   QQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAI  244

Query  864   DASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLK  1040
             DA G  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG  WGE GY++
Sbjct  245   DAGGSDFQFYSSGVF-TGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIR  303

Query  1041  LIKDSGDAKGACGIATKPSFPVA  1109
             + +D    +G CGIA + S+P A
Sbjct  304   MQRDVEAKEGLCGIAMEASYPTA  326



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/333 (52%), Positives = 219/333 (66%), Gaps = 7/333 (2%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             + L+L +   C + A  R   D  M  R+EQW+  YGR Y +  EK KRF+IFKENV  I
Sbjct  15    LALILIMLGACSSEATSRSLQDASMYGRHEQWMARYGRTYNDIREKEKRFNIFKENVX-I  73

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVT-EIPADMDW  479
             +S N   N+ + + +N+FADLTNDEFK+SR  +K +    + T F YENVT  +P  MDW
Sbjct  74    ESSNDDANKLYKLSVNQFADLTNDEFKASRNRFKGHECSTKTTSFKYENVTASVPTTMDW  133

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  134   RKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTNGEDQGCEG  193

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G++TE+NYPY+   G C   K A I AKI G++ VP   E  L+KA
Sbjct  194   GLMDDAFQFIQQNHGLSTEANYPYSGVDGTCNTKKEASIAAKITGYEDVPTNSEQALLKA  253

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWG  1010
             VANQPVS AIDASG  FQFY  G++    C T+++H +T VGYG   DG KFWL+KNSWG
Sbjct  254   VANQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVGDDGTKFWLVKNSWG  312

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  313   TEWGEEGYIRMQRDVDAAEGLCGIAMSASYPTA  345



>emb|CDP05747.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 232/336 (69%), Gaps = 8/336 (2%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDE-MVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             I+ +  +LV+      +AT+R   ++D+  MV+ +E+W+  YGRVY ++ EK KRF IFK
Sbjct  10    ILVSFFVLVI---GASQATSRLLHENDEAAMVEEHEKWMATYGRVYKDDAEKAKRFQIFK  66

Query  288   ENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFMYENVTEIPA  467
             +N  +I+SFN+AG +T+++ IN FAD+TN+EF++ R GYK     ++  F YENVT++P+
Sbjct  67    KNFEYIESFNKAGTKTYSLSINRFADMTNEEFRA-RNGYKPFTSSKSASFRYENVTDVPS  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLG  644
              +DW ++GAVTPVKNQ  CGCCWAFSAVAA EG+ Q++ G L SLSEQ+L+DCD     G
Sbjct  126   SLDWREEGAVTPVKNQGDCGCCWAFSAVAATEGVHQLKTGELISLSEQELVDCDTDEDRG  185

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C GG + + F +++ N G+TTES+YPY    G C  ++     A IK ++ VP   ES L
Sbjct  186   CEGGLMDSAFSFIIKNHGLTTESHYPYLGIDGSCSANEEHPPAATIKSYEDVPENNESAL  245

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKN  1001
             +KAVANQPVS AIDA G  F FY  G++   +C T ++H  T VGYG S DG K+WL+KN
Sbjct  246   LKAVANQPVSVAIDAGGQDFAFYSSGVF-TGECGTHLDHGATAVGYGISEDGIKYWLVKN  304

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE+GY+++ +D  D +G CGIA   S+P+A
Sbjct  305   SWGVDWGEDGYIRMQRDIHDVQGLCGIAMNASYPIA  340



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 223/333 (67%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+L  W+  +AT+R     D  M  RYEQW+  YGRVY +  EK  RF IFKENV FI
Sbjct  16    LILMLGAWSS-QATSRSL--QDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAFI  72

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTE-IPADMDW  479
             +S N+  N+ + + +N+FADLTN+EFK+SR G+K +    + T F Y+NVT  +PA MDW
Sbjct  73    ESSNKDANKPYKLSVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYKNVTAALPATMDW  132

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
               KGAVTPVK+Q QCGCCWAFSAVAA EG+ Q+  G L SLSEQ+L+DCD      GC G
Sbjct  133   RTKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGRLISLSEQELVDCDTAGEDQGCEG  192

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N GI+TE+NYPY    G C   K A I AKI GF+ VP   E  L+ A
Sbjct  193   GLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTA  252

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  253   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  312   XEWGEXGYIRMQRDVAAAEGLCGIAMSASYPTA  344



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   335 bits (860),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 225/348 (65%), Gaps = 23/348 (7%)
 Frame = +3

Query  129   ILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFID  308
             +LVL +WA   A  R   +D + M +R+EQW+  YGR Y +++EK KRF IFK NV +I+
Sbjct  14    LLVLGMWAAL-ANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIFKSNVEYIE  72

Query  309   SFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYE--NTPFMYENVTEIPADMDWV  482
             S N+AGN+ + +GINEFAD TN+EF++SR GYK  P     N  F YE+VT++P+ +DW 
Sbjct  73    SVNKAGNKPYKLGINEFADQTNEEFRASRNGYKRSPIPRPINPSFRYESVTKVPSSVDWR  132

Query  483   KKGAVTPVKNQKQC----------------GCCWAFSAVAAIEGIKQIRAGILSSLSEQQ  614
             KKGAVTPVK+Q QC                GCCWAFSAVAA+EGI Q+  G L SLSEQ+
Sbjct  133   KKGAVTPVKDQGQCGCCWAFSAVAAMEGLYGCCWAFSAVAAMEGITQLTTGKLISLSEQE  192

Query  615   LLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKG  788
             L+DCD      GC GG +   F ++L N G+TTES YPY      C + KA+   A I G
Sbjct  193   LVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTTESKYPYKGVDETCNKKKASSHAASITG  252

Query  789   FQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE  968
              + VP   E  L KAVANQPVS AIDA G  FQ Y  G++   +C T ++H +T VGYG+
Sbjct  253   HEDVPANSEKALQKAVANQPVSVAIDAGGSDFQLYSSGVF-TGECGTELDHGVTAVGYGK  311

Query  969   S-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             + DG K+WL+KNSWG  WGE GY+++ +D    +G CGIA + S+P A
Sbjct  312   TEDGTKYWLVKNSWGSSWGEEGYIRMERDVDAEEGLCGIAMEASYPSA  359



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   335 bits (858),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 176/333 (53%), Positives = 222/333 (67%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+L  W+  +AT+R     D  M  RYEQW+  YGRVY +  EK  RF IFKENV FI
Sbjct  16    LILMLGAWSS-QATSRSL--QDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAFI  72

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTE-IPADMDW  479
             +S N+  N  + + +N+FADLTN+EFK+SR G+K +    + T F YENVT  +PA MDW
Sbjct  73    ESSNKDANTPYKLRVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDW  132

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA EG+ Q+  G L SLSEQ+L+DCD      GC G
Sbjct  133   RKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEG  192

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N GI+TE+NYPY    G C   K A I AKI GF+ VP   E  L+ A
Sbjct  193   GLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTA  252

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  253   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D    +G CGIA   S+P A
Sbjct  312   AEWGEAGYIRMQRDVAAPEGLCGIAMSASYPTA  344



>gb|EYU43350.1| hypothetical protein MIMGU_mgv1a021555mg [Erythranthe guttata]
Length=325

 Score =   334 bits (857),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 172/329 (52%), Positives = 221/329 (67%), Gaps = 11/329 (3%)
 Frame = +3

Query  144   IWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQA  323
             +WAC  ATAR     D  MVK +E+W+V+ GRVY N+ EK  R+ IFK NV +I S N A
Sbjct  1     MWACDRATAR--TTPDASMVKMHEKWMVQNGRVYKNDAEKAFRYKIFKANVEYIQSSNNA  58

Query  324   GNETFTVGINEFADLTNDEFKSSRMGYK-----NPPYYENTPFMYENVTEIPADMDWVKK  488
                 + + +N+FADLTN+EF++SR GYK       P  + + F Y NVT +P  +DW KK
Sbjct  59    ETRPYKLAVNKFADLTNEEFQASRNGYKMGSRSKSPSSKVSSFRYGNVT-VPTSIDWTKK  117

Query  489   GAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-SLGCHGGWIG  665
             GAVTPVK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD     GC+GG + 
Sbjct  118   GAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLISLSEQELVDCDTSEDQGCNGGLMD  177

Query  666   AGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQ  845
               F +++ N G+TTESNYPY    G C   K +   AKI G++ VP   ES L+KAVA Q
Sbjct  178   NAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVAKQ  237

Query  846   PVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWG  1022
             P+S AIDASG  FQFY GG++   +C T ++H +T VGYG  SDG K+WL+KNSWG  WG
Sbjct  238   PISVAIDASGSDFQFYSGGVF-TGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWG  296

Query  1023  ENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             ENGY+++ +D    +G CGIA + S+P A
Sbjct  297   ENGYIRMQRDIDAEEGLCGIAMQASYPTA  325



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score =   335 bits (860),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 168/339 (50%), Positives = 226/339 (67%), Gaps = 13/339 (4%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
              V  A++ ++  W   ++ AR  LD    M +R+EQW+ +YGRVY ++ E+  R+ IFKE
Sbjct  29    FVCLALLFIVGAWPS-KSIARTLLDA--PMYERHEQWMTQYGRVYKDDNERATRYSIFKE  85

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK----NPPYYENTPFMYENVTE  458
             NV  +D+FN    +++ +G+N+FADLTN+EFK+SR  +K    +P   +  PF YENV+ 
Sbjct  86    NVARVDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFKGHMCSP---QAGPFRYENVSA  142

Query  459   IPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-  635
             +P+ MDW K+GAVTP K+Q QCGCCWAFSAVAAIEGI ++  G L  LSEQ+++DCD   
Sbjct  143   VPSTMDWRKEGAVTPAKDQGQCGCCWAFSAVAAIEGINKLTTGKLIFLSEQEVVDCDTKG  202

Query  636   -SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFR  812
                GC+GG +   F ++  N G+TTE+NYPY    G C   KA    AKI GF++VP   
Sbjct  203   EDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTKKATNHAAKITGFEYVPANS  262

Query  813   ESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWL  992
             E+ LMKAVA QPVS AIDA G  FQFY  GI+    C T ++H +T VGYG SDG K+WL
Sbjct  263   EAALMKAVAEQPVSVAIDAGGYDFQFYSSGIF-TGSCDTQLDHGVTAVGYGVSDGSKYWL  321

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE GY+++ KD    +G CGIA + S+P A
Sbjct  322   VKNSWGAQWGEEGYIRMQKDIPAKEGLCGIAMQASYPTA  360



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   335 bits (858),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 235/347 (68%), Gaps = 11/347 (3%)
 Frame = +3

Query  84    MGSRKYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEK  263
             M S  +   + F A+ LVLE++   +AT+R   +    + ++++QW+  +GRVY ++ EK
Sbjct  1     MASLTFNWKVAFGAL-LVLEMFVS-QATSRDLYEA--SIFQKHKQWMSLFGRVYKDDIEK  56

Query  264   VKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK---NPPYYENTP  434
              KRF IFK+N  +I+  N+ G   + +GINEFADL+N+EFK+SR GYK   +    ++T 
Sbjct  57    AKRFKIFKDNFEYIEFVNKVGTRPYILGINEFADLSNEEFKASRNGYKMYSHQQLSKSTS  116

Query  435   FMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQ  614
             F YENVT  PA MDW  KGAVT +K+Q QCGCCWAFSAVAA EGI +I+ G L SLSEQ+
Sbjct  117   FKYENVT-APATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQE  175

Query  615   LLDCDIIS-LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGF  791
             L+DCD  S +GC GG +   F +++ N G+TTESNYPY      C+  K +   AKI G+
Sbjct  176   LVDCDTRSDMGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTDATCKTGKESNHAAKITGY  235

Query  792   QWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-  968
             + VP   ES L+KAVANQP+S AIDASG  FQFY  G++   KC T ++H +T VGYG+ 
Sbjct  236   EDVPDNSESALLKAVANQPISVAIDASGSDFQFYSSGVF-TGKCGTELDHGVTAVGYGKI  294

Query  969   SDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              DG K+WL+KNSWG  WGENGY+++ +D    +G CGIA + S+P A
Sbjct  295   GDGTKYWLVKNSWGTSWGENGYIRMQRDVDAEEGLCGIAMQASYPSA  341



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score =   335 bits (858),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 169/339 (50%), Positives = 224/339 (66%), Gaps = 10/339 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             + F A IL+L +WA   A+   R   +  M  R+EQW+  +G+VYA+  E  +RF+IFK+
Sbjct  8     LCFFAFILILGMWAYEVAS---RELQEPSMSARHEQWMATFGKVYADAAETERRFEIFKD  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPY---YENTPFMYENVTEI  461
             NV +I+SFN  GN+ + + +N+FAD TN+E K +R GY+ P      + T F YENVT +
Sbjct  65    NVEYIESFNTTGNKPYKLSVNKFADQTNEELKVARNGYRRPLQTRPMKVTSFKYENVTAV  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             PA MDW KKGAVT +K+Q QCG CWAFS VAA EGI Q+  G L SLSEQ+L+DCDI   
Sbjct  125   PATMDWRKKGAVTLIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDIQGE  184

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +  GF +++ N GITTE+NYPY    G C     A   AKI G++ VP   E
Sbjct  185   DQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKIEASRIAKITGYESVPANSE  244

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWL  992
             + L+KAVANQP+S +IDA G  FQFY  G +   +C T ++H +T VGYGE SDG K+WL
Sbjct  245   AALLKAVANQPISVSIDAGGSDFQFYSSGDF-TGQCGTELDHGVTAVGYGETSDGTKYWL  303

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE GY+++ +D+   +G CGIA   S+P A
Sbjct  304   VKNSWGTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPTA  342



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score =   334 bits (857),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 228/342 (67%), Gaps = 10/342 (3%)
 Frame = +3

Query  96    KYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRF  275
             K   + +F   +L+L     C       LD+ + M+KR+E+W+ ++GRVY +  EK KR+
Sbjct  4     KKCSIHIFLPFLLILATKIVCRP-----LDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRY  58

Query  276   DIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENV  452
              IFKEN+  I++FN   +  + +G+N+FADLTN+EF++   GYK       ++ F +EN+
Sbjct  59    LIFKENIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMHHGYKRQSSKLMSSSFRHENL  118

Query  453   TEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI  632
             + IP  MDW K GAVTPVK+Q  CGCCWAFSAVAAIEGI +++ G L SLSEQQL+DCD+
Sbjct  119   SAIPTSMDWRKAGAVTPVKDQGTCGCCWAFSAVAAIEGIIKLKTGKLISLSEQQLVDCDV  178

Query  633   --ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPR  806
               +  GC GG +   F ++L NGG+T+E+ YPY    G C+  K A IEAKI G++ VP 
Sbjct  179   KGVDQGCGGGLMDNAFQFILRNGGLTSEATYPYQGVDGTCKSKKTASIEAKITGYEDVPV  238

Query  807   FRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRK  983
               E+ L++AVA QPVS A++  G  FQFYK G++ K  C T ++HA+T +GYG  SDG  
Sbjct  239   NNENALLQAVAKQPVSVAVEGGGYDFQFYKSGVF-KGDCGTYLDHAVTAIGYGTNSDGTN  297

Query  984   FWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +WL+KNSWG  WGE+GY+++ +  G  +G CG+A   S+P A
Sbjct  298   YWLVKNSWGTSWGESGYMRMQRGIGAREGLCGVAMDASYPTA  339



>ref|XP_006592475.1| PREDICTED: vignain-like [Glycine max]
Length=336

 Score =   334 bits (857),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 210/313 (67%), Gaps = 5/313 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   +  M +R+EQW+ EYG+VY +  EK KRF IFK NV FI+SFN A N+ + +G+N 
Sbjct  27    RKLHETSMRERHEQWMAEYGKVYKDAAEKEKRFLIFKHNVEFIESFNAAANKPYKLGVNH  86

Query  357   FADLTNDEFKSSRMGYKNPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCW  536
              ADLT +EFK+SR G K P     TPF YENVT IPA +DW  KGAVT +K+Q QCG CW
Sbjct  87    LADLTVEEFKASRNGLKRPYELSTTPFKYENVTAIPAAIDWRTKGAVTSIKDQGQCGSCW  146

Query  537   AFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTE  710
             AFS VAA EGI QI  G L SLSEQ+L+DCD   +  GC GG++  GF +++ NGGIT+E
Sbjct  147   AFSTVAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFIIKNGGITSE  206

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             +NYPY    G C  +KA    A+IKG++ VP   E  L KAVANQPVS +IDA+G  F F
Sbjct  207   ANYPYKAVDGKC--NKATSPVAQIKGYEKVPPNSEKTLQKAVANQPVSVSIDANGEGFMF  264

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKG  1070
             Y  GIY  + C T ++H +T VGYG ++G  +WL+KNSWG  WGE GY+++ +      G
Sbjct  265   YSSGIYNGE-CGTELDHGVTAVGYGIANGTDYWLVKNSWGTQWGEKGYVRMQRGVAAKHG  323

Query  1071  ACGIATKPSFPVA  1109
              CGIA   S+P A
Sbjct  324   LCGIALDSSYPTA  336



>ref|XP_008669676.1| PREDICTED: ervatamin-B-like [Zea mays]
 tpg|DAA38581.1| TPA: hypothetical protein ZEAMMB73_156486 [Zea mays]
Length=347

 Score =   335 bits (858),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 230/344 (67%), Gaps = 21/344 (6%)
 Frame = +3

Query  132   LVLEIWAC----CEAT--ARWRLDDDDE--MVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             L+L I  C    C A   A   L  DDE  MV R+EQW+V++GRVY +ET+K  RF +FK
Sbjct  7     LLLAILGCGVCLCSAAVLAARELGGDDELAMVARHEQWMVQHGRVYKDETDKAHRFLVFK  66

Query  288   ENVNFIDSFNQA---GNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENV  452
              NV FI+SFN A   GN  F +G+N+FADLTNDEF++++      P     P  F Y+N+
Sbjct  67    ANVKFIESFNAAAAAGNRKFWLGVNQFADLTNDEFRATKTNKGFNPNVVKVPTGFRYQNL  126

Query  453   T--EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDC  626
             +   +P  +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +I  G L+SLSEQ+L+DC
Sbjct  127   SIDALPQTVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLTSLSEQELVDC  186

Query  627   DII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWV  800
             D+     GC+GG +   F +++ NGG+TTESNYPY  + G C+    +   A IKG++ V
Sbjct  187   DVHGEDQGCNGGEMDDAFKFIIKNGGLTTESNYPYTAQDGQCK--SGSNGAATIKGYEDV  244

Query  801   PRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDG  977
             P   E+ LMKAVA+QPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG
Sbjct  245   PANDEAALMKAVASQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGKTSDG  303

Query  978   RKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              K+WL+KNSWG  WGENG+L++ KD  D KG CG+A +PS+P A
Sbjct  304   TKYWLMKNSWGTTWGENGFLRMEKDIADKKGMCGLAMQPSYPTA  347



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 220/333 (66%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+L  W+  +AT+R     D  M  RYEQW+  YGRVY +  EK  RF IFKENV FI
Sbjct  5     LILMLXAWSS-QATSRSL--QDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAFI  61

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTE-IPADMDW  479
             +S N+  N+ + + +N+F DLTN+EFK+SR G+K +    + T F YENVT  +PA MDW
Sbjct  62    ESSNKDANKPYKLSVNQFXDLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDW  121

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA EG+ Q+  G L SLSEQ+L+DCD      GC G
Sbjct  122   RKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGCEG  181

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F +   N GI+TE NYPY    G C   K A I AKI GF+ VP   E  L+ A
Sbjct  182   GLMDDAFQFXQQNHGISTEXNYPYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTA  241

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  242   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  300

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D    +G CGIA   S+P A
Sbjct  301   AEWGEXGYIRMQRDVAAPEGLCGIAMSASYPTA  333



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   334 bits (857),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 224/339 (66%), Gaps = 8/339 (2%)
 Frame = +3

Query  105   HLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             H  +  A I ++    C EAT+R     D  M +R+EQW+  YGRVY +  E+ +RF+IF
Sbjct  9     HQCICLAFIFIVGALVC-EATSRTL--QDASMYERHEQWMARYGRVYQDNNEREQRFNIF  65

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEI  461
             KENV  IDSFN+A ++ + +G+N+FADLTNDEF +SR  +K +    + T F YENVT +
Sbjct  66    KENVARIDSFNRAKDKPYKLGVNQFADLTNDEFTASRNRFKGHMCSNQATTFKYENVTAL  125

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             P+ MDW KKGAVTP+K+Q QCG CWAFSAVAA+EG+ ++  G L SLSEQ+L+DCD    
Sbjct  126   PSTMDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGVTKLTTGKLISLSEQELVDCDTKGD  185

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F ++  N G+TTES+YPY    G C  +K A   A I G + VP   E
Sbjct  186   DQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVDGKCNTNKEANHAANINGHEDVPANNE  245

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWL  992
               L KAVANQPVS AIDA G  FQFY  G++  D C T ++H +T VGYG + DG K+WL
Sbjct  246   EALHKAVANQPVSVAIDAGGYEFQFYSSGVFTGD-CGTDLDHGVTAVGYGADDDGTKYWL  304

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE GY+++ +D    +G CGIA + S+P A
Sbjct  305   VKNSWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPTA  343



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/333 (51%), Positives = 228/333 (68%), Gaps = 9/333 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A +LVL +   C +    R   +  + +++EQW+ +YGRVY ++T+K KR + FK+N+ +
Sbjct  12    ATLLVLGL---CISLVTSRTLYEASITEKHEQWMSQYGRVYKDDTKKAKRLETFKQNLEY  68

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK--NPPYYENTPFMYENVTEIPADMD  476
             I+S N+    T+ +GIN+FAD+TN+EFK+ R GY+  +    +NT F YENVT +P  MD
Sbjct  69    IESTNKDVTRTYKLGINQFADMTNEEFKAIRNGYRISSQQKIKNTSFQYENVT-VPYSMD  127

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-LGCHG  653
             W KKGAVT +K+Q QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD  S  GC G
Sbjct  128   WRKKGAVTKIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTNSNQGCEG  187

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F Y++ N G+T+ESNYPY    G C+  K +   AKI G++ VP   ES L+KA
Sbjct  188   GLMDDAFKYIIKNHGLTSESNYPYKGIDGTCKTEKESNHIAKISGYKDVPENSESALLKA  247

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VANQPVS AIDASG  FQFY  GI+   KC T ++H +  VGYG + DG K+W++KNSWG
Sbjct  248   VANQPVSVAIDASGSDFQFYSSGIF-TGKCGTELDHGVVAVGYGATKDGTKYWIVKNSWG  306

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGENGY+++ +D     G CGIA K S+P+A
Sbjct  307   VSWGENGYIRMKRDIVAKTGLCGIAMKASYPIA  339



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/332 (51%), Positives = 218/332 (66%), Gaps = 7/332 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++ VL  W    + +  R   D  M +R+EQW+ +YGRVY +  EK  R++IFK NV  
Sbjct  12    ALLFVLVAWP---SKSVARTLQDVSMYERHEQWMAQYGRVYKDNAEKETRYNIFKANVAR  68

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDW  479
             ID FN    +++ +G+N+FADL+N+EFK+SR  +K         PF YENV+ +P  MDW
Sbjct  69    IDEFNSQTGKSYKLGVNQFADLSNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPDSMDW  128

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA+EGI Q+  G L SLSEQ+++DCD      GC+G
Sbjct  129   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNG  188

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPY    G C   K A   AKI GF+ VP   E+ L+KA
Sbjct  189   GLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEANHAAKITGFEDVPANSEAALIKA  248

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGE  1013
             VA QPVS AIDA G  FQFY  GI+    C T ++H +T VGYG SDG K+WL+KNSWG 
Sbjct  249   VAKQPVSVAIDAGGFEFQFYSSGIF-TGSCGTQLDHGVTAVGYGISDGTKYWLVKNSWGA  307

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGE GY+++ KD    +G CGIA + S+P A
Sbjct  308   QWGEGGYIRMQKDISAKEGLCGIAMQASYPSA  339



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 222/333 (67%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+L  W+  +AT+R     D  +  RYEQW+  YGRVY +  EK  RF IFKENV FI
Sbjct  5     LILMLGAWSS-QATSRSL--QDASIYARYEQWLARYGRVYNDVDEKEIRFKIFKENVAFI  61

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTE-IPADMDW  479
             +S N+  N+   + +N+FADLTN+EFK+SR G+K +    + T F YENVT  +PA MDW
Sbjct  62    ESSNKDANKPHKLSVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDW  121

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA EG+ Q+  G L SLSEQ+L+DCD      GC G
Sbjct  122   RKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEG  181

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N GI+TE+NYPY    G C   K A I AKI GF+ VP   E  L+ A
Sbjct  182   GLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTA  241

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  242   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  300

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D    +G CGIA   S+P A
Sbjct  301   AEWGEAGYIRMQRDVAAPEGLCGIAMSASYPTA  333



>ref|XP_003578808.1| PREDICTED: senescence-specific cysteine protease SAG39 [Brachypodium 
distachyon]
Length=339

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 228/338 (67%), Gaps = 12/338 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWR-LDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A+++ +L     C +    R L+DD  MV R+E W+++YGRVY +  EK ++F++FK N 
Sbjct  6     ASLLAILGCLCLCGSVLAARELNDDLSMVARHENWMLQYGRVYKDAAEKAQKFEVFKANA  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIP  464
              FI+SFN AGN  F +GIN+FAD+TN+EFK+++   G+ +      T FMYEN++   +P
Sbjct  66    EFINSFN-AGNHKFWLGINQFADITNEEFKATKTNKGFISNKVRVPTGFMYENMSFDALP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW  KGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   ATIDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLVSLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+T ESNYPY    G C+   ++   A IK ++ VP   E 
Sbjct  185   QGCEGGLMDDAFKFIIKNGGLTQESNYPYDAADGKCKSGSSSA--ATIKSYEDVPANNEG  242

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG  SDG KFW++
Sbjct  243   ALMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGTTSDGTKFWIM  301

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENG+L++ KD  D KG CG+A +PS+P A
Sbjct  302   KNSWGTSWGENGFLRMEKDIADKKGMCGLAMEPSYPTA  339



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 220/333 (66%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+L  W+  +AT+R     D  M  RYEQW+  YGRVY +  EK  RF IFKENV FI
Sbjct  5     LILMLXAWSS-QATSRSL--QDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAFI  61

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTE-IPADMDW  479
             +S N+  N+ + + +N+F DLTN+EFK+SR G+K +    + T F YENVT  +PA MDW
Sbjct  62    ESSNKDANKPYKLSVNQFXDLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDW  121

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA EG+ Q+  G L SLSEQ+L+DCD      GC G
Sbjct  122   RKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGCEG  181

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N GI+TE NYPY    G C   K A I AKI GF+ VP   E  L+ A
Sbjct  182   GLMDDAFQFIQQNHGISTEXNYPYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTA  241

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+ NSWG
Sbjct  242   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVXNSWG  300

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D    +G CGIA   S+P A
Sbjct  301   AEWGEXGYIRMQRDVAAPEGLCGIAMSASYPTA  333



>ref|XP_004233054.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=351

 Score =   334 bits (856),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/343 (48%), Positives = 227/343 (66%), Gaps = 12/343 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             I  A   +V  +W+   A++R  ++++  M  R+EQWI  + ++Y +  EK  RF IFKE
Sbjct  11    ICLALFFIVFGLWSSQLASSR-PINNETTMRVRHEQWIAHHDKIYNDLKEKEIRFKIFKE  69

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYE-------NTPFMYEN  449
             NV  I++FN   ++ + +G+N+FADLTN+EF+    GYK+  + +        T F Y N
Sbjct  70    NVERIETFNAGEDKGYKLGVNKFADLTNEEFRVLHTGYKSSSHPKIMSSSKPKTHFRYAN  129

Query  450   VTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
             +T++P  MDW +KGAVTP+K+Q +CGCCWAFSAVAA+EG+ Q++ G L  LSEQ+L+DCD
Sbjct  130   ITDVPPIMDWRRKGAVTPIKDQMECGCCWAFSAVAAMEGLHQLKTGKLIPLSEQELVDCD  189

Query  630   II--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
             +    LGC GG +   F +++ N G+TTE+NYPY    G C + K+A   AKI G++ VP
Sbjct  190   VEGEDLGCTGGLLDTAFQFIIKNKGLTTEANYPYQAADGVCNKKKSALSVAKITGYEDVP  249

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGR  980
                E  L++AVANQPVS AID S   FQFY  G++    C+T +NHA+T VGYG  SDG 
Sbjct  250   ANNEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFS-GSCSTWLNHAVTAVGYGAASDGT  308

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             K+W+IKNSWG  WGENGY  + +D  D KG CG+A K S+P A
Sbjct  309   KYWIIKNSWGSKWGENGYAHMKRDIDDKKGLCGLAMKASYPTA  351



>ref|XP_007050065.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX94222.1| Senescence-associated gene 12 [Theobroma cacao]
Length=342

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 214/334 (64%), Gaps = 7/334 (2%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             II    I A C      R   +  + +R+EQW+ EYGRVY N+ E   RF IFK N+ FI
Sbjct  10    IIAFFLILAVCIPNVMSRQLHEASLSQRHEQWMEEYGRVYKNDAETELRFSIFKSNLAFI  69

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGY---KNPPYYENTPFMYENVTEIPADMD  476
             +SFN AGN  + + INEFAD TN+EF++ R GY   +     + T F YENVT +PA +D
Sbjct  70    ESFNAAGNRPYKLSINEFADQTNEEFRAYRNGYGRAQRLTSRKETSFRYENVTALPASVD  129

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCH  650
             W KKGAVTP+K+Q QCG CWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC 
Sbjct  130   WRKKGAVTPIKDQAQCGSCWAFSAVAATEGIHQLTTGKLISLSEQELVDCDTQGEDQGCA  189

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F +++ N GI +E  YPY    G C ++K A   A I G++ VP   E  LMK
Sbjct  190   GGEMEDAFEFIIRNHGIASEVTYPYKGDDGTCNKTKEASHAATITGYEVVPANSEKALMK  249

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSW  1007
             AVANQPVS +IDA G AFQFY  GI+  D C T ++H +T VGYG S DG  +WL+KNSW
Sbjct  250   AVANQPVSVSIDAGGYAFQFYSSGIFTGD-CGTELDHGVTAVGYGTSEDGTMYWLVKNSW  308

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G GWGE GY+++ +D    +G CGIA   S+P A
Sbjct  309   GTGWGEKGYIRMQRDIKAKEGLCGIAMDSSYPTA  342



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 222/333 (67%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             ++ +L  W+C EAT+R     D  M  RYEQW+  YGRVY +  EK  RF IFKENV FI
Sbjct  11    LLFMLGAWSC-EATSRSL--QDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFI  67

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENV-TEIPADMDW  479
             +S N   N+ + +G+N+FADLTN+EFK+SR G+K +    + T F YENV   +PA MDW
Sbjct  68    ESSNNDVNKPYKLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAPVPATMDW  127

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  128   RKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEG  187

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G++ E+NYPY    G C   KAA I AKI G++ VP   E  L+ A
Sbjct  188   GLMDDAFQFIQQNHGLSAEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTA  247

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDA G  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  248   VAHQPVSVAIDAGGSDFQFYSSGVF-TGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  306

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D    +G CGIA + S+P A
Sbjct  307   TEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  339



>ref|XP_008780645.1| PREDICTED: vignain-like, partial [Phoenix dactylifera]
Length=286

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/286 (56%), Positives = 206/286 (72%), Gaps = 3/286 (1%)
 Frame = +3

Query  258   EKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYEN-TP  434
             EK  RF IFK NV++I+S NQAG+  + + IN+FADLT +EF++S  G+K  P       
Sbjct  2     EKEHRFQIFKANVDYIESTNQAGHRKYKLNINQFADLTTEEFRASHTGFKPKPMRATGQN  61

Query  435   FMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQ  614
             F Y NVT++P  +DW  KGAVTPVK+Q QCGCCWAFSAVAA EGI QI  G L+SLSEQQ
Sbjct  62    FGYANVTDVPPSVDWRSKGAVTPVKDQGQCGCCWAFSAVAATEGIAQISTGKLTSLSEQQ  121

Query  615   LLDCDIISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQ  794
             L+DCD  + GC GG +   F +++ N GITTE+NYPY  K G C  +K++ + A I G++
Sbjct  122   LVDCDKKNGGCDGGIMDDAFKFIISNKGITTEANYPYMAKDGTCDTNKSSSVAATISGYE  181

Query  795   WVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-S  971
              VPR  ES L++AVA QPVS AI+ SG  FQFY GG++    C T ++HA+TVVGYG  +
Sbjct  182   DVPRNSESSLLQAVAKQPVSVAIEGSGKDFQFYSGGVF-MGNCGTDLDHAVTVVGYGTAT  240

Query  972   DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             DG K+WL+KNSWG  WGENGY++L++D  DA+G CGIA +PS+P A
Sbjct  241   DGTKYWLLKNSWGTTWGENGYMRLLRDIDDAEGLCGIAMQPSYPTA  286



>gb|EMT15489.1| Thiol protease SEN102 [Aegilops tauschii]
Length=340

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 226/338 (67%), Gaps = 15/338 (4%)
 Frame = +3

Query  129   ILVLEIWAC---CEATARWR-LDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             +L+L I  C   C +    R L DD  +V R+E W+ +YGRVY + TEK ++F +FK NV
Sbjct  7     VLLLAILGCLCLCSSVLAARELSDDLSIVARHESWMAQYGRVYKDATEKAQKFKVFKANV  66

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIP  464
              FI+SFN A N  F +G+N+FADLTN EFK ++   GYK       T F YENV+   +P
Sbjct  67    EFIESFN-AENHKFFLGVNQFADLTNGEFKMTKANKGYKASLGSAPTGFRYENVSLDALP  125

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--IS  638
             A +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +++ G L SLSEQ+L+DCD+  + 
Sbjct  126   ATVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKLKTGKLISLSEQELVDCDVHGVD  185

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+T ES+YPY  + G C+    ++  A IK ++ VP   E 
Sbjct  186   QGCEGGLMDDAFKFIISNGGLTGESSYPYTAEDGKCK--SGSKDAATIKSYEDVPANNEG  243

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              LM AVANQP+S A+D   M FQFYKGG+     C T ++H I  +GYG+ SDG K+WL+
Sbjct  244   ALMAAVANQPISVAVDGGDMMFQFYKGGVM-TGSCGTDLDHGIATIGYGKTSDGTKYWLL  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENGYL++ KD  D +G CG+A +PS+P A
Sbjct  303   KNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPTA  340



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 220/333 (66%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+L  W+  EAT+R     D  M  RY+QW+  YGR+Y +  EK  RF IFKENV FI
Sbjct  5     LILMLGAWSS-EATSRSL--QDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAFI  61

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP-FMYENVT-EIPADMDW  479
             +  N+  N+ + + +N+FADLTN+EFK++R G+K       T  F YENVT  +PA MDW
Sbjct  62    EFSNKDANKPYKLSVNQFADLTNEEFKATRNGFKGHECSTKTSSFKYENVTVPLPATMDW  121

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ L+DCD      GC G
Sbjct  122   RKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQXLVDCDTAGEDQGCEG  181

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N GI+TE+NYPY    G C   K A I AKI GF+ VP   E  L+ A
Sbjct  182   GLMDDAFQFIQQNHGISTEANYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTA  241

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  242   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  300

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  301   AEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  333



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score =   334 bits (856),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 213/313 (68%), Gaps = 7/313 (2%)
 Frame = +3

Query  189   DDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADL  368
             D  M +R+EQW+  +GRVY +  EK + F IFK  V +I+SFNQ GN+ + + IN FADL
Sbjct  53    DATMRERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKPYKLAINAFADL  112

Query  369   TNDEFKSSRMGYKNPPYYENT---PFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWA  539
             T++EFK+SR GYK           PF YE+VT IP+ MDW KKGAVTP+K+Q QCGC WA
Sbjct  113   TSEEFKASRTGYKRSSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQCGCRWA  172

Query  540   FSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTES  713
             FSAVAA+EGI Q+  G L+SLSEQ+L+DCD      GC GG +   F +++ N G+TTE+
Sbjct  173   FSAVAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTTEA  232

Query  714   NYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFY  893
             NYPY      C   KAA   AKI G++ VP   ES L+KAVA+QPVS AIDA    FQFY
Sbjct  233   NYPYQAVDNTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAIDAGETDFQFY  292

Query  894   KGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSWGEGWGENGYLKLIKDSGDAKG  1070
               GI+   +C T ++H +T VGYG S+ G K+WL+KNSWG GWGE GY+++ +D   A+G
Sbjct  293   STGIF-TGECGTDLDHGVTAVGYGTSENGTKYWLVKNSWGTGWGEEGYIRMQRDIDAAEG  351

Query  1071  ACGIATKPSFPVA  1109
              CGIA + S+P A
Sbjct  352   LCGIAMEASYPTA  364



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 228/342 (67%), Gaps = 10/342 (3%)
 Frame = +3

Query  96    KYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRF  275
             K   + +F   +L+L     C       LD+ + M+KR+E+W+ ++GRVY +  EK KR+
Sbjct  4     KKCSIHIFLPFLLILATKIVCRP-----LDEQEYMLKRHEEWMAQHGRVYEDMKEKEKRY  58

Query  276   DIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENV  452
              IFKEN+  I++FN   +  + +G+N+FADLTN+EF++   GYK       ++ F +EN+
Sbjct  59    LIFKENIERIEAFNSGSDRGYKLGVNKFADLTNEEFRAMHHGYKRQSSKLMSSSFRHENL  118

Query  453   TEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI  632
             + IP  MDW K GAVTPVK+Q  CGCCWAFSAVAAIEGI +++ G L SL+EQQL+DCD+
Sbjct  119   SAIPPSMDWRKAGAVTPVKDQGSCGCCWAFSAVAAIEGIIKLKTGKLISLTEQQLVDCDV  178

Query  633   ISL--GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPR  806
               L  GC GG +   F ++L NGG+T+E+ YPY    G C+  K A IEAKI G++ VP 
Sbjct  179   EGLDQGCGGGLMDNAFQFILRNGGLTSEATYPYQGVDGTCKSKKTASIEAKITGYEDVPV  238

Query  807   FRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRK  983
               E+ L++AVA QPVS A++  G  FQFYK G++ K  C T ++HA+T +GYG  SDG  
Sbjct  239   NNENALLQAVAKQPVSVAVEGGGYDFQFYKSGVF-KGDCGTYLDHAVTAIGYGTNSDGTN  297

Query  984   FWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +WL+KNSWG  WGE+GY+++ +  G  +G CG+A   S+P A
Sbjct  298   YWLVKNSWGTSWGESGYMRMQRGIGAREGLCGVAMDASYPTA  339



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/336 (49%), Positives = 223/336 (66%), Gaps = 7/336 (2%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             ++ A  +L++ IWA  +  A   L ++  M++R+EQW+ ++GRVY N  EK  RF+IF+ 
Sbjct  9     LLPALALLIVAIWAS-QGEAGRSLGENKSMLERHEQWMAQHGRVYKNAAEKAHRFEIFRA  67

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFMYENVTEIPAD  470
             NV  I+SFN A N  F +G+N+FADLTN+EFK+ R   K         F YENVT +PA 
Sbjct  68    NVERIESFN-AENHKFKLGVNQFADLTNEEFKT-RNTLKPSKMASTKSFKYENVTAVPAT  125

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS--LG  644
             MDW  KGAVTP+K+Q QCG CWAFSAVAA EGI ++  G L SLSEQ+++DCD+ S   G
Sbjct  126   MDWRTKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQEVVDCDVTSDDQG  185

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C+GG +   F Y++ N GITTE+NYPY    G C   KAA   A I G++ V    E+ L
Sbjct  186   CNGGEMDDAFEYIIKNKGITTEANYPYKAADGTCNTKKAASHAASITGYEDVTVNSEAAL  245

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKN  1001
             +KA ANQP++ AIDA   AFQ Y  G++  D C T ++H +T+VGYG  SDG K+WL+KN
Sbjct  246   LKAAANQPIAVAIDAGDFAFQMYSSGVFTGD-CGTDLDHGVTLVGYGATSDGTKYWLVKN  304

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE+GY+++ +D    +G CGIA   S+P A
Sbjct  305   SWGTSWGEDGYIRMERDVDAKEGLCGIAMDASYPTA  340



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score =   333 bits (855),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 219/335 (65%), Gaps = 8/335 (2%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F   ++VL +W    ATAR   D+   M  ++EQW+ + GRVY +  EK +RF IF++N 
Sbjct  32    FELALMVLGVWVS-GATARGIADE--PMRTKHEQWMAQNGRVYTDAAEKERRFQIFRDNY  88

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADM  473
              +I S N+AG+  + +G+N+FADLTN EFK+SR+ +K  P    T  F Y N+T++P  M
Sbjct  89    EYIKSVNRAGDRKYKLGLNQFADLTNGEFKASRLAFKPMPTASTTGSFQYANLTDVPNSM  148

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGC  647
             DW  +GAVTPVKNQ  CGC WAFS+VAAIE I QI+ G L SLSEQQL+DCD+   + GC
Sbjct  149   DWRTRGAVTPVKNQGSCGCFWAFSSVAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGC  208

Query  648   HGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELM  827
              GG +   F YV+ NGGITTE NYPY    G C  +K +   A I G++ VP   ES L+
Sbjct  209   DGGLMTRAFQYVIDNGGITTEDNYPYMAANGTCDTNKTSSSAATISGYESVPANDESSLL  268

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNS  1004
             +AVANQPVS  ID SG  F+ Y  GI+    C T + HA+T VGYG   DG ++WL+KNS
Sbjct  269   QAVANQPVSVGIDGSGQDFRHYSSGIF-TGPCETQMTHAVTAVGYGIAEDGTEYWLVKNS  327

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WG  WGE GY+++ +D G  +G CG+A   S+P A
Sbjct  328   WGTTWGETGYMRIQRDVGAPEGLCGMAKLASYPTA  362



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score =   332 bits (852),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 219/335 (65%), Gaps = 8/335 (2%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F   ++VL +W    ATAR   D+   M  ++EQW+ + GRVY +  EK +RF IF++N 
Sbjct  6     FELALMVLGVWVS-GATARGIADE--PMRTKHEQWMAQNGRVYTDAAEKERRFQIFRDNY  62

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADM  473
              +I S N+AG+  + +G+N+FADLTN EFK+SR+ +K  P    T  F Y N+T++P  M
Sbjct  63    EYIKSVNRAGDRKYKLGLNQFADLTNGEFKASRLAFKPMPTASTTGSFQYANLTDVPNSM  122

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGC  647
             DW  +GAVTPVKNQ  CGC WAFS+VAAIE I QI+ G L SLSEQQL+DCD+   + GC
Sbjct  123   DWRTRGAVTPVKNQGSCGCFWAFSSVAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGC  182

Query  648   HGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELM  827
              GG +   F YV+ NGGITTE NYPY    G C  +K +   A I G++ VP   ES L+
Sbjct  183   DGGLMTRAFQYVIDNGGITTEDNYPYMAANGTCDTNKTSSSAATISGYESVPANDESSLL  242

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNS  1004
             +AVANQPVS  ID SG  F+ Y  GI+    C T + HA+T VGYG   DG ++WL+KNS
Sbjct  243   QAVANQPVSVGIDGSGQDFRHYSSGIF-TGPCETQMTHAVTAVGYGIAEDGTEYWLVKNS  301

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WG  WGE GY+++ +D G  +G CG+A   S+P A
Sbjct  302   WGTTWGETGYMRIQRDVGAPEGLCGMAKLASYPTA  336



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   333 bits (853),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/341 (50%), Positives = 229/341 (67%), Gaps = 11/341 (3%)
 Frame = +3

Query  114   VFAAIILVLEIWA--CCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             V+ A+++ L  WA    EAT+R  L D   +  R+E+W+  +G VY +  EK KRF+IFK
Sbjct  10    VYLALVISLGTWAKYNVEATSR-SLQDASTLKIRHEEWMSRHGIVYKDADEKAKRFEIFK  68

Query  288   ENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK----NPPYYENTPFMYENVT  455
             ENV  I++FN+A  + + +GIN+FADLTN+EF + R  +K    +     +T F YENVT
Sbjct  69    ENVARIEAFNRAAIKPYKLGINKFADLTNEEFITKRNKFKAHVCDSGRAISTSFKYENVT  128

Query  456   EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII  635
              +P+ +DW KKGAVTPVK+Q QCGCCWAFS VAA+EGI ++  G L SLSEQ+L+DCD+ 
Sbjct  129   SVPSALDWRKKGAVTPVKDQGQCGCCWAFSTVAAMEGITKLSTGKLLSLSEQELVDCDVK  188

Query  636   --SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRF  809
                 GC+GG +   F ++  NGG+TTE+NYPY    G C   K A   AKI G++ VP  
Sbjct  189   GEDQGCNGGLMDEAFKFIQHNGGLTTEANYPYEGVDGTCNAKKEATHAAKITGYEDVPAN  248

Query  810   RESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKF  986
              E +L+KAV +QPVS AIDASG  FQFY GG++    C T ++H +T VGYG + DG K+
Sbjct  249   SEKDLLKAVTHQPVSVAIDASGFEFQFYSGGVF-TGACGTNLDHGVTAVGYGATKDGTKY  307

Query  987   WLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WL+KNSWG+ WGE GY+++ +D    +G CGIA   S+P A
Sbjct  308   WLVKNSWGKQWGEKGYIRMQRDVDAKEGLCGIAMMASYPTA  348



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   332 bits (851),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 220/333 (66%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+L  W+  EAT+R     D  M  RY+QW+  YGR+Y +  EK  RF IFKENV FI
Sbjct  5     LILMLGAWSS-EATSRSL--QDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAFI  61

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP-FMYENVT-EIPADMDW  479
             +  N+  N+ + + +N+FADLTN+EFK++R G+K       T  F YENVT  +PA MDW
Sbjct  62    EFSNKDANKPYKLSVNQFADLTNEEFKATRNGFKGHECSTKTSSFKYENVTVPLPATMDW  121

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ L+DCD      GC G
Sbjct  122   RKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQVLVDCDTAGEDQGCEG  181

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N GI+TE+NYPY    G C   K A I AKI GF+ VP   E  L+ A
Sbjct  182   GLMDBAFQFIQQNHGISTEANYPYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTA  241

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  242   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  300

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  301   AEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  333



>ref|XP_002446132.1| hypothetical protein SORBIDRAFT_06g002150 [Sorghum bicolor]
 gb|EES10460.1| hypothetical protein SORBIDRAFT_06g002150 [Sorghum bicolor]
Length=337

 Score =   332 bits (852),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 172/338 (51%), Positives = 226/338 (67%), Gaps = 16/338 (5%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
             A ++ +L   + C +    R   D  MV+R+E W+VEYGRVY +  EK +RF+ FK NV 
Sbjct  6     AFLLAILGCASLCSSVLAARELSDAAMVERHENWMVEYGRVYKDAAEKARRFEAFKHNVA  65

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP---FMYEN--VTEIP  464
             F++SFN      F +G+N+FADLT +EFK+++ G+K  P  E  P   F YEN  V+ +P
Sbjct  66    FVESFNTNKKNKFWLGVNQFADLTTEEFKANK-GFK--PTAEKVPTTGFKYENLSVSALP  122

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIISL-  641
               +DW  KGAVTP+KNQ QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD  S+ 
Sbjct  123   TAVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTGNLISLSEQELVDCDTHSMD  182

Query  642   -GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQ-RSKAAQIEAKIKGFQWVPRFRE  815
              GC GGW+ + F +V+ NGG+ TESNYPY    G C+  SK+A   A IKG + VP   E
Sbjct  183   EGCEGGWMDSAFEFVIKNGGLATESNYPYKAVDGKCKGGSKSA---ATIKGHEDVPVNNE  239

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWL  992
             + LMKAVANQPVS A+DAS   F  Y GG+     C T ++H I  +GYG ESDG K+W+
Sbjct  240   AALMKAVANQPVSVAVDASDRTFMLYSGGVM-TGSCGTELDHGIAAIGYGMESDGTKYWI  298

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             +KNSWG  WGE G+L++ KD  D +G CG+A KPS+P 
Sbjct  299   LKNSWGTTWGEKGFLRMEKDITDKRGMCGLAMKPSYPT  336



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score =   331 bits (848),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 215/306 (70%), Gaps = 3/306 (1%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             M+KR+ +W+ +YGRVY +  EK KR+ IFKEN+  I++FN   +  + +G+N+FADLTN+
Sbjct  1     MLKRHGEWMAQYGRVYGDMKEKDKRYLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNE  60

Query  378   EFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVA  554
             EF++   GYK       ++ F YEN+++IP  MDW    AVTPVK+Q +CGCCWAFS VA
Sbjct  61    EFRAMYHGYKRQSSKLMSSSFRYENLSDIPTSMDWRNAEAVTPVKDQGRCGCCWAFSTVA  120

Query  555   AIEGIKQIRAGILSSLSEQQLLDCDIISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMK  734
             AIEGI +++ G L SLSEQQL+DCD+ + GCHGG++   F Y++ NGG+ +E NYPY   
Sbjct  121   AIEGIIKLKTGKLISLSEQQLVDCDVGNNGCHGGFMDNAFQYIIRNGGLASEDNYPYQGV  180

Query  735   KGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGK  914
              G C   KA+ IEA+I G++ VP+  E+ L++AVA QPVS  +D  G  FQFYK G++ K
Sbjct  181   DGTCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVVVDGGGQDFQFYKSGVF-K  239

Query  915   DKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATK  1091
               C T  NHA+T +GYG +SDG  +WL+KNSWG  WGE+GY+++ +  G ++G CG+A  
Sbjct  240   GDCGTEQNHAVTAIGYGTDSDGTDYWLVKNSWGTSWGESGYMRMQRGIGASEGLCGVAMD  299

Query  1092  PSFPVA  1109
              S+P A
Sbjct  300   ASYPTA  305



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   332 bits (852),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 227/338 (67%), Gaps = 10/338 (3%)
 Frame = +3

Query  114   VFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKEN  293
             +    +L++ +WA   + A  R   +  M +R+E W+  YGR Y +  EK +RF IFKEN
Sbjct  7     IICITLLIMGVWA---SQALSRTLHEVSMSERHEDWMGLYGRTYKDIAEKERRFKIFKEN  63

Query  294   VNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGY---KNPPYYENTPFMYENVTEIP  464
             V +I+S N AGN  + + INEFAD TN+EFK+SR GY     P   E T F YENV  +P
Sbjct  64    VEYIESVNSAGNRRYKLSINEFADQTNEEFKASRNGYNMSSRPRSSEITSFRYENVAAVP  123

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             + MDW KKGAVTP+K+Q QCGCCWAFSAVAA+EG+ Q++ G L SLSEQ+L+DCD     
Sbjct  124   SSMDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGVTQLKTGELISLSEQELVDCDTSGED  183

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG + + F +++ NGG+TTE+NYPY      C + KAA   AKIK ++ VP   E+
Sbjct  184   QGCGGGLMDSAFEFIIGNGGLTTEANYPYKGVDATCNKKKAASSAAKIKNYEDVPANSEA  243

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLI  995
              L+KAVA  PVS AIDA G  FQFY  G++   +C T ++H +T VGYG++ DG K+WL+
Sbjct  244   ALLKAVAQHPVSVAIDAGGSDFQFYSSGVF-TGQCGTELDHGVTAVGYGKTDDGTKYWLV  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG GWGE+GY+ + +D G  +G CGIA + S+P A
Sbjct  303   KNSWGTGWGEDGYIWMERDIGADEGLCGIAMEASYPTA  340



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   332 bits (852),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/333 (50%), Positives = 227/333 (68%), Gaps = 8/333 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++  L  WA  +ATAR  L+    M +R+E W+ +YGRVY +  EK KR+ IFK+NV  
Sbjct  13    ALLFFLAAWAS-QATARNLLEA--SMYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVAR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDW  479
             I+SFN+A ++++ + INEFADLTN+EF++SR  +K +    E T F YE+V  +P+ +DW
Sbjct  70    IESFNKAMDKSYKLSINEFADLTNEEFRASRNRFKAHICSTEATSFKYEHVAAVPSTVDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCG CWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD      GC+G
Sbjct  130   RKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTSGEDQGCNG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+ TE+NYPYA   G C R KAA   AKI G++ VP   E  L KA
Sbjct  190   GLMDDAFKFIEQNHGLATEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPANNEKALQKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QP++ AIDA G  FQFY  G++   +C T ++H +  VGYG S DG K+WL+KNSWG
Sbjct  250   VAHQPIAVAIDAGGFEFQFYSSGVF-TGQCGTELDHGVAAVGYGTSDDGMKYWLVKNSWG  308

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              GWGE GY+++ +D    +G CGIA + S+P A
Sbjct  309   TGWGEVGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>ref|XP_006652104.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=342

 Score =   332 bits (852),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/342 (49%), Positives = 223/342 (65%), Gaps = 11/342 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEAT--ARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             I  A ++ VL     C A   AR   DDD  M  R+E+W+ +YGRVY +  EK +RF++F
Sbjct  3     IPSAPLVAVLGCLYLCSAVLAARELGDDDAAMAARHERWMAQYGRVYKDAAEKARRFEVF  62

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT-  455
             K NV FI+SFN  G   F +G+N+FADLTN EF+++       P     P  F YENV+ 
Sbjct  63    KANVAFIESFNGGGGRKFWLGVNQFADLTNYEFRATNTNKGFIPSTVRVPTGFRYENVSI  122

Query  456   -EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI  632
               +PA +DW  KGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+
Sbjct  123   DALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDV  182

Query  633   I--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPR  806
                  GC GG +   F +++ NGG+TTESNYPY    G C +  +    A IKG++ VP 
Sbjct  183   HGEDQGCEGGLMDDAFKFIVNNGGLTTESNYPYTAADGKC-KGGSGSAAATIKGYEDVPA  241

Query  807   FRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRK  983
               E+ LMKAVA+QPVS A+D   M FQFY GG+     C T ++H I  +GYG + DG K
Sbjct  242   NDEAALMKAVASQPVSVAVDGGDMTFQFYSGGVM-SGSCGTDLDHGIVAIGYGTAGDGTK  300

Query  984   FWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +WL+KNSWG  WGENG+L++ KD  D +G CG+A +PS+P A
Sbjct  301   YWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  342



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   332 bits (850),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 172/330 (52%), Positives = 220/330 (67%), Gaps = 9/330 (3%)
 Frame = +3

Query  135   VLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSF  314
             +L  W+C EAT+R     D  M  RYEQW+  YGRVY +  EK  RF IFKENV FI+S 
Sbjct  1     MLGAWSC-EATSRSL--QDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESS  57

Query  315   NQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENV-TEIPADMDWVKK  488
             N   N+ + +G+N+FADLTN+EFK+SR G+K +    + T F YEN+   +PA MDW KK
Sbjct  58    NNDVNKPYKLGVNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENIKAPVPATMDWRKK  117

Query  489   GAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWI  662
             GAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC GG +
Sbjct  118   GAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLM  177

Query  663   GAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVAN  842
                F ++  N G++ E+NYPY    G C   KAA I AKI G++ VP   E  L+ AVA+
Sbjct  178   DDAFQFIQQNHGLSAEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAH  237

Query  843   QPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGW  1019
             QPVS AIDA G  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG  W
Sbjct  238   QPVSVAIDAGGSDFQFYSSGVF-TGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEW  296

Query  1020  GENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             GE GY+++ +D    +G CGIA + S+P A
Sbjct  297   GEEGYIRMQRDVEAKEGLCGIAMEASYPTA  326



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/340 (51%), Positives = 221/340 (65%), Gaps = 7/340 (2%)
 Frame = +3

Query  105   HLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             H  +  A+I +       +AT+R     D  M +R+EQW+ +YGRVY +  +K KRF IF
Sbjct  7     HGCLCLALIFIFGTNLVFQATSRTLPIQDSAMYERHEQWMAQYGRVYKDSNDKEKRFKIF  66

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT--PFMYENVTE  458
             KENV  ID+FN A  + + +GIN+FADLTN+EF +SR  +K      NT   F YENVT 
Sbjct  67    KENVARIDAFNTANGKPYKLGINQFADLTNEEFTASRNRFKGH-MCSNTAASFKYENVTA  125

Query  459   IPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-  635
             +P+ MDW +KGAVTPVK+Q QCGCCWAFSAVAA+EGI  I  G L SLSEQ+L+DCD   
Sbjct  126   VPSAMDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGINMITTGKLISLSEQELVDCDTKG  185

Query  636   -SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFR  812
                GC GG +   F ++    G+TTE++YPY    G C  +K A   AKI G++ VP   
Sbjct  186   EDQGCQGGLMDDAFKFIQKIQGLTTETDYPYRGVDGTCNTNKEANHAAKINGYEDVPANS  245

Query  813   ESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFW  989
             E+ L+KAVANQPVS AIDA G  FQFY GGI+    C T ++H +T VGYG   DG K+W
Sbjct  246   ETVLLKAVANQPVSVAIDAGGFEFQFYSGGIF-TGACETQLDHGVTAVGYGVGDDGTKYW  304

Query  990   LIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             L+KNSWG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  305   LVKNSWGTSWGEKGYIRMQRDVDAKEGLCGIAMAASYPTA  344



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/310 (53%), Positives = 211/310 (68%), Gaps = 7/310 (2%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             + +R+E W+ ++ RVY + TEK  RF IF+ENV FI+SFN+AGN+++ +GIN F DLTN 
Sbjct  18    LEERHEIWMAQHERVYKDATEKEMRFQIFRENVKFIESFNKAGNKSYKLGINAFTDLTNK  77

Query  378   EFKSSRMGYKNPPYYE---NTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSA  548
             EF++SR GYK   Y        F YENVT IP+ +DW  KG VTP+K+Q QCGCCWAFSA
Sbjct  78    EFRASRNGYKRSSYSSSSGTNSFKYENVTTIPSSLDWRSKGVVTPIKDQGQCGCCWAFSA  137

Query  549   VAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTESNYP  722
             VAA+EGI ++    L SLSEQ+L+DCD   I  GC GG +   F +++ N G+TTE+NYP
Sbjct  138   VAAMEGITKLSTEKLISLSEQELIDCDTSGIDQGCEGGLMDDAFEFIIQNNGLTTEANYP  197

Query  723   YAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGG  902
             Y  + G C   KAA   A I  ++ VP   E  L  AVANQPVS AIDA   AFQ Y  G
Sbjct  198   YQAEDGTCNTEKAANHAATITSYEDVPENNEEALRMAVANQPVSVAIDAGESAFQHYSSG  257

Query  903   IYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACG  1079
             I+  D C T ++H +TVVGYG SD G K+WL+KNSWG  WGE+GY+++ +D    +G CG
Sbjct  258   IFTGD-CGTELDHGVTVVGYGTSDDGTKYWLVKNSWGTSWGEDGYIRMQRDIDAKEGLCG  316

Query  1080  IATKPSFPVA  1109
             IA +PS+P A
Sbjct  317   IAMQPSYPTA  326



>ref|XP_011014388.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=340

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 227/338 (67%), Gaps = 7/338 (2%)
 Frame = +3

Query  102   THLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDI  281
             TH  +F   +L+L  WA     A   LD+ + M+KR+ +W+ +YGRVY +  EK KR+ I
Sbjct  8     TH--IFLPFLLILAAWAT--KIACRPLDEQEYMLKRHGEWMAQYGRVYGDMKEKDKRYLI  63

Query  282   FKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTE  458
             FKEN+  I++FN   +  + +G+N+FADLTN+EF++   GYK       ++ F YEN+++
Sbjct  64    FKENIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMYHGYKRQSSKLMSSSFRYENLSD  123

Query  459   IPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS  638
             IP  MDW    AVTPVK+Q +CG CWAFSAVAAIEGI +++ G L SLSEQQL+DC+  +
Sbjct  124   IPTSMDWRNAEAVTPVKDQGRCGSCWAFSAVAAIEGIIKLKTGKLISLSEQQLVDCNAGN  183

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG++   F Y++  GG+T+E NYPY    G C   KAA IEA+I G++ VP+  E+
Sbjct  184   KGCQGGFMDTAFQYIIRKGGLTSEENYPYQGVDGTCNSEKAASIEAEITGYEDVPQNNEN  243

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLI  995
              L++AVA QPVS  ID  G  FQFYK G++ K  C    NHA+T +G+G +SDG  +WL+
Sbjct  244   ALLQAVAKQPVSVGIDGGGQDFQFYKSGVF-KGDCGAEQNHAVTAIGFGTDSDGTDYWLV  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGE+GY+++ +  G ++G CG+A   S+P A
Sbjct  303   KNSWGTSWGESGYMRMQRGIGASEGLCGVAMDASYPTA  340



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/329 (50%), Positives = 220/329 (67%), Gaps = 10/329 (3%)
 Frame = +3

Query  144   IWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQA  323
             +   C + A  R   +  M +R+EQW+ + GR Y +  EK +R+ IFK NV  I+SFN A
Sbjct  17    LLCACASHATARTLSEMTMAERHEQWMAQQGRAYRDSAEKERRYQIFKANVELIESFN-A  75

Query  324   GNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP----FMYENVTEIPADMDWVKKG  491
             GN  + +G+N+FADLTN+EFK+   G+K P   +       F YENVT +P+ MDW  KG
Sbjct  76    GNSKYKLGVNQFADLTNEEFKAMMNGFK-PSTLKTLKATNVFSYENVTAVPSSMDWRAKG  134

Query  492   AVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS--LGCHGGWIG  665
             AVTP+K+Q QCGCCWAFSAVAA+EGI +++ G L SLSEQ+L+DCD+ S   GC GG + 
Sbjct  135   AVTPIKDQGQCGCCWAFSAVAAMEGITKLKTGKLMSLSEQELVDCDVASDDQGCDGGLMD  194

Query  666   AGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQ  845
               F +++ N G+TTE+NYPY    G C   K+A   A IKG++ VP   E+ L+KAVANQ
Sbjct  195   NAFKFIINNRGLTTETNYPYKGIDGTCNSKKSASHVASIKGYEDVPANSEAALLKAVANQ  254

Query  846   PVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWG  1022
             PVS AI+AS  +FQFY  GI+    C T ++H +T VGYG + DG K+WL+KNSWG  WG
Sbjct  255   PVSVAIEASSGSFQFYSSGIF-TGSCGTDLDHGVTTVGYGTTKDGTKYWLVKNSWGSSWG  313

Query  1023  ENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             E GY+++ +D    +G CGIA + S+P A
Sbjct  314   EKGYIRMERDVAAKEGLCGIAMEASYPTA  342



>gb|EMT08019.1| Vignain [Aegilops tauschii]
Length=309

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/310 (53%), Positives = 215/310 (69%), Gaps = 9/310 (3%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             MV+R+EQW+ ++ RVY + TEK +RF++FK NV FI+SFN AGN  F +G+N+F DLTND
Sbjct  1     MVERHEQWMAKFNRVYKDGTEKAQRFEVFKANVAFIESFN-AGNHKFWLGVNQFTDLTND  59

Query  378   EFKSSRM--GYKNPPYYENTPFMYENVTE--IPADMDWVKKGAVTPVKNQKQCGCCWAFS  545
             EFK+++   G K       T F Y NV+   +PA +DW  KGAVTP+K+Q QCGCCWAFS
Sbjct  60    EFKATKTNKGLKRSGSQAPTGFKYNNVSTDALPAAVDWRTKGAVTPIKDQGQCGCCWAFS  119

Query  546   AVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTESNY  719
             AVAA EGI ++  G L SLSEQ+L+DCDI  +  GC GG +   F +++ NGG+TTE+NY
Sbjct  120   AVAATEGIVKLSTGKLVSLSEQELVDCDIHGVDQGCEGGEMDDAFKFIIKNGGLTTEANY  179

Query  720   PYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKG  899
             PY  + G C+ S A+   A IKG++ VP   ES LMKAVANQPVS A+D   + FQ Y G
Sbjct  180   PYTAQDGQCKTSIASNSVATIKGYEDVPANDESSLMKAVANQPVSVAVDGGDVIFQHYSG  239

Query  900   GIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGAC  1076
             G+     C T ++H I  +GYG  SDG K+WL+KNSWG  WGE+GYL++ KD  D  G C
Sbjct  240   GVM-TGSCGTDLDHGIATIGYGMTSDGTKYWLLKNSWGTTWGESGYLRMEKDISDKSGMC  298

Query  1077  GIATKPSFPV  1106
             G+A +PS+P 
Sbjct  299   GLAMQPSYPT  308



>ref|XP_010279091.1| PREDICTED: ervatamin-B [Nelumbo nucifera]
Length=345

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/342 (49%), Positives = 234/342 (68%), Gaps = 17/342 (5%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
                 + +L +WA  +AT+R RL +   + K+YE+W+  +GRVY N  EK KRF IF++N+
Sbjct  10    LCVTLFILSVWAP-QATSR-RLQET-SIAKKYEEWVNNHGRVYNNVAEKEKRFKIFRDNL  66

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP-----FMYENVTEI  461
             NFI+SFN   N+++ + +N+FADLTN+EF S+  GYK  P  ++ P     F +EN+T++
Sbjct  67    NFIESFNSIRNQSYKLNLNKFADLTNEEFTSTSKGYK--PSSKSRPLAARSFTHENLTDL  124

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDC-----  626
             P+ +DW + GAVTPVK+Q+ CG CWAFSAVAA+EGI +I+ G L SLSEQQL+DC     
Sbjct  125   PSSVDWREMGAVTPVKDQQNCGSCWAFSAVAAVEGITKIKTGNLISLSEQQLVDCDSEYD  184

Query  627   DIISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPR  806
             D  + GC GG++   F Y++ N GITTE+NYPY     +C+ +K A   A+I G+  V  
Sbjct  185   DYDNHGCDGGFMEDAFEYIIANEGITTEANYPYLGHDEYCEMTKEANHVARINGYGLVEF  244

Query  807   FRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRK  983
               E+ LMKAVA QPVSA ++ASG AFQFY  GI+   +C +  +HAITVVGYG   DG K
Sbjct  245   NDENALMKAVAQQPVSAVVEASGKAFQFYSSGIF-TGQCGSNTDHAITVVGYGICKDGMK  303

Query  984   FWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +W++KNSWG GWGE+GY+++ +D     G CGIAT  S+P A
Sbjct  304   YWIVKNSWGSGWGEDGYMRMQRDVPYQGGLCGIATDASYPTA  345



>gb|AGT97048.1| senescence-specific cysteine protease [Capsicum annuum]
Length=347

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 223/343 (65%), Gaps = 11/343 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             +  A   + L +W+   A+ R    D   M  R+EQWI  + +VY N  EK  R  IFKE
Sbjct  6     LCLALFFISLGLWSSQVASPRPIHYDATSMRARHEQWIAHHEKVYNNLNEKEMRSKIFKE  65

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK---NPPYYE----NTPFMYEN  449
             NV  I++FN   ++ + +G+N+FADLTN+EF+   +GYK   +P        NT F Y N
Sbjct  66    NVERIETFNAGEDKGYKLGVNKFADLTNEEFRVLHLGYKWSSHPKVMSSSKPNTHFRYAN  125

Query  450   VTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
             VT+IP  MDW KKGAVTP+K+QK CGCCWAFSAVAA+E + Q++ G L+ LSEQ+L+DCD
Sbjct  126   VTDIPPTMDWRKKGAVTPIKDQKDCGCCWAFSAVAAMESLHQLKTGKLNPLSEQELVDCD  185

Query  630   II--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
             +    +GC GG +   F +++ N G+TTE+NYPY    G C + K+A   AKI G++ VP
Sbjct  186   VEGEDVGCSGGLLDTAFKFIMKNKGLTTEANYPYEGADGVCNKKKSAVSAAKITGYEDVP  245

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGR  980
                E  L++AVANQPVS AID S   FQ Y  G++    C+T +NHA+T VGYG  SDG 
Sbjct  246   ANNEKALLQAVANQPVSVAIDGSSFDFQSYSSGVFS-GSCSTWLNHAVTAVGYGATSDGT  304

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             K+W+IKNSWG  WGENGY+ + +D  D +G CG+A + S+P A
Sbjct  305   KYWIIKNSWGSKWGENGYIHMKRDIDDREGLCGLAMEASYPTA  347



>ref|XP_003578807.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=339

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/339 (50%), Positives = 226/339 (67%), Gaps = 14/339 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWR-LDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A+++ +L     C +    R L+DD  MV R+E W+++YGRVY +  EK  +F++FK N 
Sbjct  6     ASLLAILGCLCFCSSVLAARELNDDLSMVARHESWMLQYGRVYKDAAEKASKFEVFKANA  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIP  464
              FIDSFN AGN  F +GIN+FAD+TN EFK+++   G+ +      T F YENV+   +P
Sbjct  66    GFIDSFN-AGNHKFWLGINQFADITNKEFKATKTNKGFISNKVRAPTGFSYENVSFDALP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW  KGAVTPVK+Q QCGCCWAFSAVAA EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   ASIDWRTKGAVTPVKDQGQCGCCWAFSAVAATEGIVKLSTGKLVSLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQR-SKAAQIEAKIKGFQWVPRFRE  815
              GC GG +   F +++ NGG+T ES+YPY  + G C+  SK+A     IK ++ VP   E
Sbjct  185   QGCEGGLMDDAFKFIISNGGLTQESSYPYDAEDGKCKSGSKSA---GTIKSYEDVPANNE  241

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWL  992
               LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG  SDG K+WL
Sbjct  242   GALMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGVTSDGTKYWL  300

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGENG+L++ KD  D KG CG+A +PS+P A
Sbjct  301   MKNSWGTSWGENGFLRMEKDIADKKGMCGLAMEPSYPTA  339



>ref|XP_006362428.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 171/337 (51%), Positives = 232/337 (69%), Gaps = 10/337 (3%)
 Frame = +3

Query  114   VFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKEN  293
              F A++++  +WA  EAT+R    ++  MV++ E+W+  +GRVY ++TEK KRF+IFK+N
Sbjct  10    AFLALLVIGILWAN-EATSRDL--NEASMVQKNEKWMARFGRVYRDDTEKAKRFNIFKDN  66

Query  294   VNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYY---ENTPFMYENVTEIP  464
              ++I S N+AG   + + IN FADLTN+EF+++  GYK   ++   + T F YENVT  P
Sbjct  67    FDYIQSINKAGMRPYKLSINGFADLTNEEFRATHNGYKMSSHHTSSKTTFFRYENVT-AP  125

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-L  641
             A MDW KKGAVT VK+Q QCGCCWAFSAVAA +GI +I+ G L SLSEQ+L+DCD  S +
Sbjct  126   ATMDWRKKGAVTGVKDQWQCGCCWAFSAVAATKGINEIKTGKLISLSEQELVDCDTSSDM  185

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F +++ N G+TTESNYPY    G C+  K +   AKI G++ VP   ES 
Sbjct  186   GCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESNDAAKITGYEDVPANSESA  245

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIK  998
             L+ AVANQPVS AIDASG  FQFY  G++   +  T ++H +T VGYG  SDG K+WL+K
Sbjct  246   LLNAVANQPVSVAIDASGSDFQFYSSGVF-TGEYGTDLDHGVTAVGYGITSDGTKYWLVK  304

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG  WGENGY+++ +     +G CGIA + S+P A
Sbjct  305   NSWGTSWGENGYIRMQRGVVPEEGICGIAMQASYPTA  341



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   330 bits (846),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 222/333 (67%), Gaps = 9/333 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A+IL+L  W+  EAT+R     D  M  RYEQW++ YGR+Y++  EK KRF IFKENV F
Sbjct  13    ALILILGAWSS-EATSRSL--QDALMYGRYEQWMIRYGRIYSDTDEKEKRFKIFKENVAF  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDW  479
             I+S N   N+ + + +N FADLTN+EF +SR  +K +    + T F YEN T +P  MDW
Sbjct  70    IESSNDEANKPYKLSVNGFADLTNEEFTASRNRFKGHECSTKTTSFKYENAT-VPTKMDW  128

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              +KGAVTP+K+Q QCGCCWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD+     GC G
Sbjct  129   RQKGAVTPIKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEG  188

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G++TE+NYPY    G C   K A   A I G + VP   ES L+KA
Sbjct  189   GLMDDAFEFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKA  248

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWG  1010
             VANQP+S AIDASG  FQFY  G++    C T+++H +T VGYG   DG K+WL+KNSWG
Sbjct  249   VANQPISVAIDASGSDFQFYSSGVF-TGACGTSLDHGVTAVGYGVGDDGTKYWLVKNSWG  307

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D    +G CGIA + S+P A
Sbjct  308   AEWGEQGYIRMQRDVDAPEGLCGIAMEASYPTA  340



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/339 (49%), Positives = 224/339 (66%), Gaps = 8/339 (2%)
 Frame = +3

Query  105   HLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             H     A++  + + A   + A  R  ++  M + ++QW+  YGRVY    EK +R  IF
Sbjct  7     HQCTPLALLFTIGVLA---SLAAARSLNEASMTETHDQWMARYGRVYKTANEKNRRSTIF  63

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP-FMYENVTEI  461
             +EN+ +I +FN+A N+ + +G+NEFADLTN+EF +SR  +K+      T  F YENVT +
Sbjct  64    QENLKYIQTFNKANNKPYKLGVNEFADLTNEEFTTSRNKFKSHVCATVTNVFRYENVTAV  123

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             PA MDW KKGAVTP+KNQ QCGCCWAFSAVAA+EGI Q++ G L SLSEQ+L+DCD    
Sbjct  124   PATMDWRKKGAVTPIKNQGQCGCCWAFSAVAAMEGITQLKTGKLISLSEQELVDCDTNGE  183

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F ++  N G++TE+NYPY+   G C  +K A   A I G + VP   E
Sbjct  184   DQGCEGGLMDYAFDFIQQNHGLSTETNYPYSGTDGTCNANKEANHAATITGHEDVPANSE  243

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWL  992
             S L+KAVANQP+S AIDASG  FQFY  G++   +C T ++H +T VGYG  +DG K+WL
Sbjct  244   SALLKAVANQPISVAIDASGSDFQFYSSGVF-TGECGTELDHGVTAVGYGTAADGTKYWL  302

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE GY+++ +    A+G CGIA + S+P A
Sbjct  303   VKNSWGTSWGEEGYIQMQRGVAAAEGLCGIAMQASYPTA  341



>ref|XP_002446135.1| hypothetical protein SORBIDRAFT_06g002170 [Sorghum bicolor]
 gb|EES10463.1| hypothetical protein SORBIDRAFT_06g002170 [Sorghum bicolor]
Length=338

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 172/338 (51%), Positives = 228/338 (67%), Gaps = 15/338 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
             A ++ +L   + C +    R   D  MV+R+E W+VEYGRVY +  EK +RF++FK+NV 
Sbjct  6     AFLLAILGCASLCSSVLAARELSDAAMVERHENWMVEYGRVYKDAAEKARRFEVFKDNVA  65

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP---FMYEN--VTEIP  464
             F++SFN   N  F +GIN+FADLT +EFK+++ G+K P   E  P   F YEN  V+ +P
Sbjct  66    FVESFNTNKNNKFWLGINQFADLTIEEFKANK-GFK-PISAEKVPTTGFKYENLSVSALP  123

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIISL-  641
               +DW  KGAVTP+KNQ QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD  S+ 
Sbjct  124   TAVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTGNLISLSEQELVDCDTHSMD  183

Query  642   -GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQ-RSKAAQIEAKIKGFQWVPRFRE  815
              GC GGW+ + F +V+ NGG+ T S+YPY    G C+  SK+A   A IKG + VP   E
Sbjct  184   EGCEGGWMDSAFEFVIKNGGLATVSSYPYKAVDGKCKGGSKSA---ATIKGHEDVPVNDE  240

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWL  992
             + LMKAVANQPVS A+DAS   F  Y GG+     C T ++H I  +GYG ESDG K+W+
Sbjct  241   AALMKAVANQPVSVAVDASDRTFMLYSGGVM-TGSCGTELDHGIAAIGYGVESDGTKYWI  299

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             +KNSWG  WGE G+L++ KD  D +G CG+A KPS+P 
Sbjct  300   LKNSWGTTWGEKGFLRMEKDISDKQGMCGLAMKPSYPT  337



>gb|EMT29822.1| Vignain [Aegilops tauschii]
Length=339

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 223/343 (65%), Gaps = 13/343 (4%)
 Frame = +3

Query  108   LIVFAAIILVLE--IWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDI  281
             + +  A+IL +   ++ C    A   L+DD  MV R+E W+V+Y RVY + TEK +RF +
Sbjct  1     MAISKALILSILGCLYFCSSVLAARELNDDLSMVARHESWMVQYNRVYKDTTEKAQRFQV  60

Query  282   FKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT  455
             FK NV FI+SFN   N  F +GIN+F DLTN EFK+++      P  E  P  F YENV+
Sbjct  61    FKANVGFIESFNTE-NCKFYLGINQFTDLTNKEFKATKANKGYKPSLERVPTGFRYENVS  119

Query  456   --EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
                +P  +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +++ G L SLSEQ+L+DCD
Sbjct  120   LVALPETVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKLKTGKLISLSEQELVDCD  179

Query  630   II--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
             +     GC GG +   F +++ NGG+TTESNYPY      C+        A IK ++ VP
Sbjct  180   VHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYTAADDKCKSGTNGA--ATIKSYEDVP  237

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGR  980
                E  LM+AVA+QPVS A+D   M FQFYKGG+     C T ++H I  +GYG+ SDG 
Sbjct  238   ANNEGALMQAVASQPVSVAVDGGDMTFQFYKGGVM-TGSCGTDLDHGIAAIGYGKTSDGT  296

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             K+WL+KNSWG  WGENGYL++ KD  D +G CG+A +PS+P A
Sbjct  297   KYWLLKNSWGTTWGENGYLRMEKDITDKRGMCGLAMEPSYPTA  339



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 224/336 (67%), Gaps = 9/336 (3%)
 Frame = +3

Query  114   VFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKEN  293
             ++ A+I++L  W+  EAT+R     D  M  RYEQW+  Y RVY++  EK KRF IFKEN
Sbjct  10    IYLALIIMLGAWSS-EATSRSL--QDVIMYGRYEQWMARYERVYSDFDEKEKRFQIFKEN  66

Query  294   VNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPAD  470
             V F++S N   N+ + + +N FADLTN+EF +SR  +K +    E T + YENVT +PA 
Sbjct  67    VAFVESSNGEANKPYKLSVNRFADLTNEEFTASRNRFKGHECSTETTSYKYENVT-VPAT  125

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLG  644
             MDW +KGAVTP+K+Q QCGCCWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD+     G
Sbjct  126   MDWRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQG  185

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C GG +   F ++  N G++TE+NYPY    G C   K A   A I G + VP   ES L
Sbjct  186   CEGGLMDDAFQFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPANSESAL  245

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKN  1001
             +KAVANQP+S AIDASG  FQFY  G++    C T+++H +T VGYG SD G K+WL+KN
Sbjct  246   LKAVANQPISVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSDNGTKYWLVKN  304

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  305   SWGAEWGEGGYIRMQRDVDAQEGLCGIAMAASYPTA  340



>ref|XP_007132814.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
 gb|ESW04808.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
Length=333

 Score =   329 bits (844),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/330 (50%), Positives = 217/330 (66%), Gaps = 8/330 (2%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             I+ +  + A   +    R   +  + +R+E W+ EYG+VY +  EK KRF IFK+NV FI
Sbjct  10    ILALFLLLAVGISQVMSRKLHETSLRERHENWMQEYGKVYKDAAEKEKRFLIFKDNVEFI  69

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFMYENVTEIPADMDWVK  485
             +SFN  GN+ + +G+N FADLT  EFK+SR G+K P  +  TPF YENVT IPA +DW K
Sbjct  70    ESFNAVGNKPYKLGVNHFADLTVQEFKASRNGFKRPHEFSTTPFKYENVTAIPAAIDWRK  129

Query  486   KGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGW  659
             KGAVTP+KNQ   G CWAFS VAA EGI QI  G L SLSEQ+L+DCD   +  GC GG+
Sbjct  130   KGAVTPIKNQ---GSCWAFSTVAATEGIHQIATGKLVSLSEQELVDCDTKGVDQGCEGGY  186

Query  660   IGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVA  839
             +  GF +++ NGGI++E+NYPY    G C+  K     A+IKG++ VP   E  L KAVA
Sbjct  187   MEDGFEFIIKNGGISSEANYPYKAADGSCK--KGTSPVAQIKGYEKVPPNSEKALQKAVA  244

Query  840   NQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGW  1019
             NQPVS +I+A G  F FY  GIY  + C T ++H +T VGYG ++G ++WL+KNSWG  W
Sbjct  245   NQPVSVSINADGSGFMFYSSGIYSGE-CGTELDHGVTAVGYGIANGTEYWLVKNSWGTQW  303

Query  1020  GENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             GE GY+++ +      G CGIA   S+P A
Sbjct  304   GEEGYVRMKRGIAAKHGLCGIALDSSYPTA  333



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   330 bits (845),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 222/340 (65%), Gaps = 9/340 (3%)
 Frame = +3

Query  105   HLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
              L    A+I++L  W+   + A  R   D  M  R+EQW+V YGRVY +  EK KRF IF
Sbjct  10    RLCTCLALIIMLGAWS---SKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIF  66

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVT-E  458
             KENV +I+S N   ++ + + +N+F DLTN+EF +SR  +K +    + T F YENVT  
Sbjct  67    KENVAYIESSNADASKPYKLRVNQFTDLTNEEFIASRNRFKGHECSTKTTSFKYENVTAS  126

Query  459   IPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--  632
             +PA MDW KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD   
Sbjct  127   VPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKG  186

Query  633   ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFR  812
             +  GC GG +   F ++  N G++TE+NYPY    G C   K A I AKI G + VP   
Sbjct  187   VDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITGHEDVPAND  246

Query  813   ESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFW  989
             E  L+ AVA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+W
Sbjct  247   EKALLNAVAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSDDGTKYW  305

Query  990   LIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             L+KNSWG  WGE GY+++ +D    +G CGIA + S+P A
Sbjct  306   LVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA  345



>ref|XP_007021896.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY13421.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
Length=333

 Score =   329 bits (843),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 216/311 (69%), Gaps = 5/311 (2%)
 Frame = +3

Query  189   DDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADL  368
             ++  +  +E W+ +YGR Y N+TEK +RF IFKEN+ +I +FN AGN ++ +GINEFAD+
Sbjct  24    NEAAIAEHELWMAKYGRTYQNKTEKDRRFKIFKENLEYIQNFNNAGNRSYKLGINEFADM  83

Query  369   TNDEFKSSRMGYKNP-PYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFS  545
             ++DEF ++R GYKNP     ++PF Y   T++P  +DW +KGAVT VK+Q  CGCCWAF+
Sbjct  84    SHDEFVAARTGYKNPGNLATSSPFSYAEFTDVPTSLDWREKGAVTAVKDQGDCGCCWAFA  143

Query  546   AVAAIEGIKQIRAGILSSLSEQQLLDCDIISLGCHGGWIGA--GFLYVLFNGGITTESNY  719
             AVAA+EGI QI+ G L SLSEQQ+LDC         G       F Y++ NGG+TTE NY
Sbjct  144   AVAAVEGINQIKTGKLISLSEQQVLDCSTNGNNHGCGGGSKTDAFQYIMQNGGLTTEDNY  203

Query  720   PYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKG  899
             PY   +G C + K     A I  +  VP   E EL+KAV+NQPV+ +I+ASGM F+FY+ 
Sbjct  204   PYQATQGACDKEKETSHVADISDYARVPANSEEELLKAVSNQPVTISIEASGMDFKFYES  263

Query  900   GIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGAC  1076
             GI+  D C T +NHA+TVVG+G S DG  +WL+KNSW + WGENGY+K+ ++   ++G C
Sbjct  264   GIFSGD-CGTNLNHAVTVVGFGTSVDGIDYWLVKNSWNQSWGENGYIKMQRNVDASEGLC  322

Query  1077  GIATKPSFPVA  1109
             G+A +P++P+A
Sbjct  323   GLAIRPAYPIA  333



>ref|XP_006362420.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=347

 Score =   330 bits (845),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 162/339 (48%), Positives = 223/339 (66%), Gaps = 8/339 (2%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             I  A + LV  +W+    ++R  ++ +  M  R+EQWI  + ++Y +  EK  RF IFKE
Sbjct  11    ICLAFLFLVFGLWSSQLVSSR-PINYETTMRVRHEQWIAHHDKIYNDLKEKEMRFKIFKE  69

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP---FMYENVTEI  461
             NV  I++FN   ++ + +G+N+FADLTN+EF+    GYK+     + P   F Y N+T++
Sbjct  70    NVKRIETFNAGEDKGYKLGVNKFADLTNEEFRVVHTGYKSSFMSSSKPKTHFRYANITDV  129

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             P  MDW KKGAVTP+K+Q +CG CWAFSAVAA+EG+ Q+  G L  LSEQ+L+DCD+   
Sbjct  130   PPTMDWRKKGAVTPIKDQMECGSCWAFSAVAAMEGVHQVTTGKLIPLSEQELVDCDVEGE  189

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
              +GC GG +   F +++ N G+TTE+NYPY    G C + K+A   AKI G++ VP   E
Sbjct  190   DVGCTGGLLDTAFQFIIKNKGLTTEANYPYEAADGVCNKKKSAVSVAKITGYEDVPANNE  249

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWL  992
               L++AVANQPVS AID S   FQFY  G++    C+T +NHA+T VGYG  SDG K+W+
Sbjct  250   KALLQAVANQPVSVAIDGSSFDFQFYSSGVFS-GSCSTWLNHAVTAVGYGAASDGAKYWI  308

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             IKNSWG  WGENGY  + +D  D KG CG+A K S+P A
Sbjct  309   IKNSWGSKWGENGYAHMKRDIDDKKGLCGLAMKASYPTA  347



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/332 (50%), Positives = 218/332 (66%), Gaps = 7/332 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A+I +L   A   + A  R   D  + +R+E+W+ +YG+VY +  EKV R  IFK NV  
Sbjct  13    ALIFILGALA---SQAIARSLQDASINERHEKWMAQYGKVYKDANEKVIRRKIFKRNVER  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVTEIPADMDW  479
             I+SFN+AG + + +GIN+FADLTN+EFK+SR  +K         PF YENVT +P+ MDW
Sbjct  70    IESFNKAGGKPYKLGINQFADLTNEEFKTSRNRFKGHMCSPQAGPFRYENVTAVPSSMDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTP+K+Q QCG CWAFS VAA+EGI Q+    L SLSEQ+L+DCD      GC G
Sbjct  130   RKKGAVTPIKDQGQCGSCWAFSTVAAVEGITQLTTKKLISLSEQELVDCDTKGEDQGCQG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPY    G C   K A   AKI G++ VP   E+ L+KA
Sbjct  190   GLMDDAFKFIENNQGLTTEANYPYVGSDGTCNTKKEANHAAKITGYEDVPANNEAALLKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGE  1013
             V NQPVS AIDA G AFQFY  GI+  D C T ++H +  VGYG S+G K+WL+KNSWG 
Sbjct  250   VTNQPVSVAIDAGGFAFQFYSSGIFTGD-CGTELDHGVAAVGYGVSNGTKYWLVKNSWGT  308

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGE GY+++ +D    +G CGIA + S+P A
Sbjct  309   QWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  340



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 228/339 (67%), Gaps = 14/339 (4%)
 Frame = +3

Query  108   LIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             +++FA    +L IWA  + TAR  +D+   ++ +YEQW+++YGRVY N  EK   F IFK
Sbjct  5     ILLFA----ILGIWAS-KTTARTLVDE--PLMLKYEQWMIQYGRVYKNNAEKDSHFKIFK  57

Query  288   ENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYEN--TPFMYENVTEI  461
             +N   I++FN A N+ + +GIN FADLTN+EF+++R G K  P+ E   T F YENVT I
Sbjct  58    KNAERIEAFNDAANQPYKLGINAFADLTNEEFRAARNGLK-IPFCEPKITSFRYENVTAI  116

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-  638
             P  MDW  KGAVTP+K+Q QCG CWAFSA+AA EGI ++  G L SLSEQ+L+DCD  S 
Sbjct  117   PTTMDWRIKGAVTPIKDQGQCGSCWAFSAIAATEGITKLSTGKLISLSEQELMDCDRNSE  176

Query  639   -LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG++   F +++ N G+TTE+ YPY      C   K +   A IKG++ VP++ E
Sbjct  177   DQGCEGGYMEDAFEFIVKNKGLTTETTYPYKAADEKCNTKKESSHVADIKGYEKVPKYNE  236

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWL  992
               L+ AVANQP+S +IDAS  +FQFY  G++    C T ++H +T VGYG++ DG K+WL
Sbjct  237   KALLNAVANQPISVSIDASDFSFQFYTSGVF-TGTCGTELDHGVTAVGYGKAEDGTKYWL  295

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             IKNSWG  WGENGY+++ +D    +G CGIA   S+P A
Sbjct  296   IKNSWGSSWGENGYIRMERDIDAKEGLCGIAMDASYPTA  334



>dbj|BAF56429.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 223/333 (67%), Gaps = 8/333 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A+ L+L +       +R   + +  +++R+EQW+ +Y +VY +  EK KRF IFK+NV F
Sbjct  13    ALFLLLAV-GISRVISRELHETETSLIERHEQWMAKYDKVYKDAAEKEKRFLIFKDNVEF  71

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYE--NTPFMYENVTEIPADMD  476
             I+SFN AGN+ + +G+N  ADLT +EFK+SR G K    YE   T F YENVT IPA +D
Sbjct  72    IESFNAAGNKPYKLGVNHLADLTIEEFKASRNGLKRSYDYEVGTTSFKYENVTAIPASVD  131

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCH  650
             W KKGAVTP+K+Q QCG CWAFS VAA EGI +I  G L SLSEQ+L+DCD      GC 
Sbjct  132   WRKKGAVTPIKDQGQCGSCWAFSTVAATEGIHKISTGKLVSLSEQELVDCDRKGTDQGCE  191

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG++  GF +++ NGGITTE+NYPY    G C+ + A    A+IKG++ VP   E  L+K
Sbjct  192   GGYMEDGFEFIIKNGGITTEANYPYKAVDGSCKNATAPA--AQIKGYEKVPVNSEKALLK  249

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWG  1010
             AVANQPVS +IDA+  +F FY  GI+   +C T ++H +T VGYG ++G  +W++KNSWG
Sbjct  250   AVANQPVSVSIDAADGSFMFYSSGIF-TGECGTELDHGVTAVGYGRANGTDYWIVKNSWG  308

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +     +G CGIA   S+P A
Sbjct  309   TVWGEQGYIRMQRGIAAKEGLCGIAMDSSYPTA  341



>ref|XP_002446133.1| hypothetical protein SORBIDRAFT_06g002160 [Sorghum bicolor]
 gb|EES10461.1| hypothetical protein SORBIDRAFT_06g002160 [Sorghum bicolor]
Length=338

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/338 (51%), Positives = 226/338 (67%), Gaps = 15/338 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
             A ++ +L   + C +    R   D  MV+R+E W+VEYGRVY +  EK +RF+ FK NV 
Sbjct  6     AFLLAILGCASLCSSVLAARELSDAAMVERHENWMVEYGRVYKDAAEKARRFEAFKHNVA  65

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP---FMYEN--VTEIP  464
             F++SFN      F +G+N+FADLT +EFK+++ G+K P   E  P   F YEN  V+ +P
Sbjct  66    FVESFNTNKKNKFWLGVNQFADLTTEEFKANK-GFK-PISAEMVPTTGFKYENLSVSALP  123

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIISL-  641
               +DW  KGAVTP+KNQ QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD  S+ 
Sbjct  124   TAVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTGNLISLSEQELVDCDTHSMD  183

Query  642   -GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQ-RSKAAQIEAKIKGFQWVPRFRE  815
              GC GGW+ + F +V+ NGG+ TES+YPY    G C+  SK+A   A IKG + VP   E
Sbjct  184   EGCEGGWMDSAFEFVIKNGGLATESSYPYKAVDGKCKGGSKSA---ATIKGHEDVPVNDE  240

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWL  992
             + LMKAVANQPVS A+DAS   F  Y GG+     C T ++H I  +GYG ESDG K+W+
Sbjct  241   AALMKAVANQPVSVAVDASDRTFMLYSGGVM-TGSCGTELDHGIAAIGYGVESDGTKYWI  299

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             +KNSWG  WGE G+L++ KD  D +G CG+A KPS+P 
Sbjct  300   LKNSWGTTWGEKGFLRMEKDISDKQGMCGLAMKPSYPT  337



>gb|EAY93078.1| hypothetical protein OsI_14879 [Oryza sativa Indica Group]
Length=339

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 222/338 (66%), Gaps = 12/338 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWRLDDDDE-MVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A +  +L     C A    R   D   MV R+E+W+ +YGRVY + TEK +RF+IFK NV
Sbjct  6     ALLFAILSCLCLCSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--EIP  464
              FI+SFN AGN  F +G+N+FADLTN EF++++      P     P  F YENV+   +P
Sbjct  66    AFIESFN-AGNHKFWLGVNQFADLTNYEFRATKTNKGFIPSTVRVPTTFRYENVSIDTLP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW  KGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   ATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTES YPY    G C  +  +   A IKG++ VP   E+
Sbjct  185   QGCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGKC--NGGSNSAATIKGYEEVPANNEA  242

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG + DG ++WL+
Sbjct  243   ALMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIVAIGYGKDGDGTQYWLL  301

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENG+L++ KD  D +G CG+A +PS+P A
Sbjct  302   KNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  339



>ref|XP_004975184.1| PREDICTED: vignain-like [Setaria italica]
Length=340

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 211/311 (68%), Gaps = 7/311 (2%)
 Frame = +3

Query  189   DDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADL  368
             D  M  R+EQW+ +YGRVY +  EK +RF++F+ NV FI+S N   N  F V +N+FADL
Sbjct  31    DQAMAARHEQWMAKYGRVYVDAAEKARRFEVFRANVAFIESVNSQ-NHKFWVEVNQFADL  89

Query  369   TNDEFKSSRMGYKNPPYYENTPFMYENVT--EIPADMDWVKKGAVTPVKNQKQCGCCWAF  542
             T+DEF+++R GYK       T F Y NV+  ++P  +DW  KGAVTP+K+Q QCGCCWAF
Sbjct  90    TDDEFRATRTGYKPAGKARTTAFRYANVSLDDLPDSVDWRTKGAVTPIKDQGQCGCCWAF  149

Query  543   SAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTESN  716
             S VA++EGI ++  G L SLSEQ+L+DCD+  +  GC GG +   F +++ NGG+TTESN
Sbjct  150   STVASMEGIVKLSTGKLISLSEQELVDCDVNGMDQGCEGGEMDNAFEFIIDNGGLTTESN  209

Query  717   YPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYK  896
             YPY    G C  +KA+   A IKG++ VP   E+ L KAVANQPVS A+D     F+FYK
Sbjct  210   YPYTASDGTCNSNKASNDAASIKGYEDVPANDEASLRKAVANQPVSVAVDGGDSLFRFYK  269

Query  897   GGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGA  1073
             GG+     C T ++H I  VGYG  SDG K+WL+KNSWG  WGE GY+++ +D  D +G 
Sbjct  270   GGVL-SGSCGTELDHGIAAVGYGVASDGTKYWLMKNSWGTSWGEGGYIRMERDIADEEGL  328

Query  1074  CGIATKPSFPV  1106
             CG+A +PS+P 
Sbjct  329   CGLAMQPSYPT  339



>ref|XP_006582266.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=341

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/309 (51%), Positives = 206/309 (67%), Gaps = 6/309 (2%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             + +R+E W+ EYG++Y +  EK KRF IFK+NV FI+SFN AGN+ + +G+N  ADLT +
Sbjct  34    LRERHENWMAEYGKMYKDAAEKEKRFQIFKDNVEFIESFNAAGNKPYKLGVNHLADLTLE  93

Query  378   EFKSSRMGYKNPPYYENTPFM-----YENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAF  542
             EFK SR G K    +  T F      YENVT+IP  +DW  KGAVTP+K Q QCG CWAF
Sbjct  94    EFKDSRNGLKRTYEFRTTTFKLNGFKYENVTDIPEAIDWRAKGAVTPIKYQGQCGSCWAF  153

Query  543   SAVAAIEGIKQIRAGILSSLSEQQLLDCDIISLGCHGGWIGAGFLYVLFNGGITTESNYP  722
             S +AA EGI QIR G L SLSEQ+L+DCD +  GC GG++  GF +++ NGGIT+E+NYP
Sbjct  154   STIAATEGIHQIRTGNLVSLSEQELVDCDSVDHGCKGGFMEHGFEFIVKNGGITSETNYP  213

Query  723   YAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGG  902
             Y    G C  + AA   A+IKG++ VP + E  L KAVANQPVS +I A+   F FY  G
Sbjct  214   YKGVDGTCNTTIAASPVAQIKGYEIVPSYSEEALQKAVANQPVSVSIHATNATFMFYSSG  273

Query  903   IYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGI  1082
             IY  + C T ++H +T VGYG  +G  +W++KNSWG  WGE GY+++ +      G CGI
Sbjct  274   IYNGE-CGTDLDHGVTAVGYGTENGTDYWIVKNSWGTQWGEKGYIRMHRGIAAKHGICGI  332

Query  1083  ATKPSFPVA  1109
             A   S+P A
Sbjct  333   ALDSSYPTA  341



>ref|XP_009354321.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=393

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 212/319 (66%), Gaps = 6/319 (2%)
 Frame = +3

Query  168   ARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVG  347
             A  R   D  M  RYEQW+  YGRVY +  EK  RF IFKENV FI+S N+  N+   + 
Sbjct  76    ATSRSLQDASMYGRYEQWLARYGRVYNDVDEKEIRFKIFKENVAFIESSNKDANKPHKLS  135

Query  348   INEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTE-IPADMDWVKKGAVTPVKNQKQ  521
             +N+FADLTN+EFK+SR G+K +    + T F YENVT  +PA MDW KKGAVTPVK+Q Q
Sbjct  136   VNQFADLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQ  195

Query  522   CGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNG  695
             CGCCWAFSAVAA EG+ Q+  G L SLSEQ+L+DCD      GC GG +   F ++  N 
Sbjct  196   CGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNH  255

Query  696   GITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASG  875
             GI+TE+NYPY    G C   K A I AKI GF+ VP   E  L+ AVA+QPVS AIDASG
Sbjct  256   GISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASG  315

Query  876   MAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKD  1052
               FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG  WGE GY+++ +D
Sbjct  316   SDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRD  374

Query  1053  SGDAKGACGIATKPSFPVA  1109
                 +G CGIA   S+P A
Sbjct  375   VAAPEGLCGIAMSASYPTA  393



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 227/339 (67%), Gaps = 13/339 (4%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             ++  A++L+L  W+  EAT+R     D     RYEQW+  YGRVY + TEK +RF IFK 
Sbjct  9     VLCLALVLMLGAWSS-EATSRSL--QDALAYGRYEQWMARYGRVYNDATEKEERFKIFKA  65

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSR---MGYKNPPYYENTPFMYENVTEI  461
             N  FI+S N  GN+ + +G+N+FADLTN+EF +SR   +G++     ++T F YEN T +
Sbjct  66    NEAFIESSNNEGNKPYKLGLNQFADLTNEEFIASRNRFLGHECST--KSTTFKYENST-V  122

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             PA +DW +KGAVTPVK+Q QCGCCWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD+   
Sbjct  123   PATIDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGE  182

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F ++  N G++TE+NYPY    G C   K A   A I G + VP   E
Sbjct  183   DQGCEGGLMDNAFEFINQNHGLSTEANYPYTGVDGTCNAKKEANHAASITGHEDVPPNDE  242

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWL  992
             S L KAVANQP+S AIDASG  FQFY  G++    C T+++H +T VGYG S DG KFWL
Sbjct  243   SALQKAVANQPISVAIDASGSGFQFYSSGVF-TGPCGTSLDHGVTAVGYGVSDDGTKFWL  301

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE GY+++ +D    +G CGIA +PS+P A
Sbjct  302   VKNSWGAQWGEEGYIRMQRDIPAPEGLCGIAMEPSYPTA  340



>emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa Japonica Group]
 gb|EAZ29777.1| hypothetical protein OsJ_13835 [Oryza sativa Japonica Group]
Length=339

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 222/338 (66%), Gaps = 12/338 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWRLDDDDE-MVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A +  +L     C A    R   D   MV R+E+W+ +YGRVY + TEK +RF+IFK NV
Sbjct  6     ALLFAILSCLCLCSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--EIP  464
              FI+SFN AGN  F +G+N+FADLTN EF++++      P     P  F YENV+   +P
Sbjct  66    AFIESFN-AGNHKFWLGVNQFADLTNYEFRATKTNKGFIPSTVRVPTTFRYENVSIDTLP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW  KGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   ATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTES YPY    G C  +  +   A IKG++ VP   E+
Sbjct  185   QGCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGKC--NGGSNSAATIKGYEDVPANNEA  242

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG + DG ++WL+
Sbjct  243   ALMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIVAIGYGKDGDGTQYWLL  301

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENG+L++ KD  D +G CG+A +PS+P A
Sbjct  302   KNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  339



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/340 (48%), Positives = 222/340 (65%), Gaps = 7/340 (2%)
 Frame = +3

Query  102   THLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDI  281
             T L + +  +L++  +   EA AR    +D  M +R+EQW+ +YG+VY +  EK  R  I
Sbjct  5     TVLNITSLTLLLVFGFLSFEANARTL--EDASMHERHEQWMAQYGKVYKDSYEKELRSKI  62

Query  282   FKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT  455
             FKENV  I++FN AGN+++ +GIN+FADLTN+EFK+     G+          F YE+VT
Sbjct  63    FKENVQRIEAFNNAGNKSYKLGINQFADLTNEEFKARNRFKGHMCSNSTRTPTFKYEHVT  122

Query  456   EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI-  632
              +PA +DW +KGAVTP+K+Q QCGCCWAFSAVAA EGI ++  G L SLSEQ+L+DCD  
Sbjct  123   SVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTK  182

Query  633   -ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRF  809
              +  GC GG +   F +++ N G+ TE+ YPY      C  +  A+  A IKGF+ VP  
Sbjct  183   GVDQGCEGGLMDDAFKFIMQNKGLNTEAKYPYQGVDATCNANAEAKDAASIKGFEDVPAN  242

Query  810   RESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFW  989
              ES L+KAVANQP+S AIDASG  FQFY  G++    C T ++H +T VGYG   G K+W
Sbjct  243   SESALLKAVANQPISVAIDASGSEFQFYSSGVF-TGSCGTELDHGVTAVGYGSDGGTKYW  301

Query  990   LIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             L+KNSWGE WGE GY+++ +D    +G CG A + S+P A
Sbjct  302   LVKNSWGEQWGEQGYIRMQRDVAAEEGLCGFAMQASYPTA  341



>gb|AHA62781.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 214/314 (68%), Gaps = 12/314 (4%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             M++++EQW+  +GR+Y N  EK+KRF IF EN+  I++ N+ G  +FT+G+N FADLTND
Sbjct  33    MIEKHEQWMTLHGRIYENNNEKMKRFKIFSENIKRIEAMNKMG-RSFTLGVNAFADLTND  91

Query  378   EFKSSRMGYKNPPYYENTP------FMYENVT--EIPADMDWVKKGAVTPVKNQKQCGCC  533
             EF++SR GYK      N        F YENVT   +    DW  KGAVTP+K+Q  CGCC
Sbjct  92    EFRNSRTGYKKQLTTTNNNNLASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCC  151

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI-ISLGCHGGWIGAGFLYVLFNGGITTE  710
             WAF+ VAA EG+ Q++ G L SLSEQ+L+DCD     GC GG +   + ++L NGG+TTE
Sbjct  152   WAFATVAATEGLNQLKTGKLISLSEQELVDCDTNFDQGCEGGLLDTAYTFILKNGGLTTE  211

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             SNYPY    G C    +A+ +A I G+Q VP   E+ L+KAVA+QPVS A++  G  FQF
Sbjct  212   SNYPYMATDGICTTKHSAKSDASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQF  271

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAK  1067
             Y  G++ + +C   ++HA+ ++GYGES DG K+WLIKNSWG  WGENGY+++ +D  D  
Sbjct  272   YSSGVF-QGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDVDDKY  330

Query  1068  GACGIATKPSFPVA  1109
             G CG+A +PS+P+A
Sbjct  331   GLCGLAMQPSYPIA  344



>gb|AHA62779.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   328 bits (840),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 213/314 (68%), Gaps = 12/314 (4%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             M++++EQW+  YGR+Y N  EK+KRF IF EN+  I++ N+ G   FT+G+N FADLTND
Sbjct  33    MIEKHEQWMTLYGRIYENNNEKMKRFKIFSENIKRIEAMNKMG-RGFTLGVNAFADLTND  91

Query  378   EFKSSRMGYKNPPYYENTP------FMYENVT--EIPADMDWVKKGAVTPVKNQKQCGCC  533
             EF++SR GYK      N        F YENVT   +    DW  KGAVTP+K+Q  CGCC
Sbjct  92    EFRNSRTGYKKQLTTTNNNNLASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCC  151

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI-ISLGCHGGWIGAGFLYVLFNGGITTE  710
             WAF+ VAA EG+ Q++ G L SLSEQ+L+DCD     GC GG +   + ++L NGG+TTE
Sbjct  152   WAFATVAATEGLNQLKTGKLISLSEQELVDCDTNFDQGCEGGLLDTAYTFILKNGGLTTE  211

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             SNYPY    G C    +A+ +A I G+Q VP   E+ L+KAVA+QPVS A++  G  FQF
Sbjct  212   SNYPYMATDGICTTKHSAKSDASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQF  271

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAK  1067
             Y  G++ + +C   ++HA+ ++GYGES DG K+WLIKNSWG  WGENGY+++ +D  D  
Sbjct  272   YSSGVF-QGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDVDDKY  330

Query  1068  GACGIATKPSFPVA  1109
             G CG+A +PS+P+A
Sbjct  331   GLCGLAMQPSYPIA  344



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   328 bits (840),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 222/334 (66%), Gaps = 9/334 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A+I++L  W+  EAT+R     D  M  R+EQW+  YGRVY +  EK KRF IFKENV +
Sbjct  16    ALIIMLGAWSS-EATSRSL--QDASMYGRHEQWMTRYGRVYTDNEEKEKRFKIFKENVAY  72

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVT-EIPADMD  476
             I+S N   ++ + + +N+F DLTN+EF +SR  +K +    + T F YENVT  +PA MD
Sbjct  73    IESSNADTSKPYKLRVNQFTDLTNEEFIASRNRFKGHECSTKTTSFKYENVTTSVPATMD  132

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCH  650
             W KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD   +  GC 
Sbjct  133   WRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGVDQGCE  192

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F ++  N G++TE+NYPY    G C   K A I AKI G + VP   E  L+ 
Sbjct  193   GGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITGHEDVPANDEKALLN  252

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSW  1007
             AVA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSW
Sbjct  253   AVAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSW  311

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G  WGE GY+++ +D    +G CGIA + S+P A
Sbjct  312   GTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA  345



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   328 bits (840),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 221/337 (66%), Gaps = 6/337 (2%)
 Frame = +3

Query  114   VFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKEN  293
             +F + + ++ ++A C   A  R   D  M +R+EQW+V +G++Y + +EK +++ IFKEN
Sbjct  6     LFHSTLALVIVFAFCALEANARTLQDASMRERHEQWMVTHGKLYLDSSEKEQKYQIFKEN  65

Query  294   VNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVTEIPA  467
             V  I++FN AGN+ + +GIN+FADLTN+EFK+     G+          F YE+VT +P 
Sbjct  66    VQRIEAFNNAGNKPYKLGINQFADLTNEEFKARNRFKGHICSTITRTPTFKYEHVTALPT  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW +KGAVTP+K+Q QCG CWAFSAVAA EGI ++  G L SLSEQ+L+DCD      
Sbjct  126   SLDWRQKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQELIDCDTKGEDQ  185

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F ++L N G+TTE+ YPY    G C     +   A IKG++ VP   ES 
Sbjct  186   GCEGGLMDDAFKFILNNKGLTTEATYPYEGIDGTCNAKAESSHAASIKGYEDVPANSESA  245

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIK  998
             L+KAVANQPVS AIDASG  FQFY GG++    C T ++H +T VGYG S DG K+WL+K
Sbjct  246   LLKAVANQPVSVAIDASGYEFQFYAGGVF-NGSCDTNLDHGVTAVGYGVSDDGSKYWLVK  304

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  305   NSWGVKWGEKGYIRMQRDVSAKEGLCGIAMLASYPTA  341



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   327 bits (839),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 169/341 (50%), Positives = 221/341 (65%), Gaps = 10/341 (3%)
 Frame = +3

Query  99    YTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFD  278
             Y   I  A I ++ ++     + A  R   D  M  +YEQW+  YGRVY    EK KRF+
Sbjct  8     YCKCICLALIFMLGDL----SSQATSRALQDASMYGKYEQWMARYGRVYTGINEKEKRFN  63

Query  279   IFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVT  455
             IFKENV FI+S N+  N+ + + +N+FADLTN++FK+SR G+  +      T F YENVT
Sbjct  64    IFKENVAFIESSNKDANKLYKLSVNQFADLTNEQFKASRNGFMGHECSAAKTSFKYENVT  123

Query  456   EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI-  632
               P  +DW KKGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD  
Sbjct  124   -APPTVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTS  182

Query  633   -ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRF  809
              +  GC GG +   F ++  N G++TE+NYPY    G C   K A   AKI G + VP  
Sbjct  183   GVDQGCQGGLMDDAFQFINQNHGLSTEANYPYTGVDGTCNTKKEANHAAKITGHEDVPAN  242

Query  810   RESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKF  986
             RE  LMKAVANQP+S AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+
Sbjct  243   REDALMKAVANQPISVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSDDGTKY  301

Query  987   WLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WL+KNSWG  WGE GY+++ +     +G CGIA + S+P A
Sbjct  302   WLVKNSWGTEWGEEGYIRMQRGIEAKEGLCGIAMEASYPTA  342



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   327 bits (838),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 222/333 (67%), Gaps = 9/333 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A+IL+L  W+  EAT+R     D  M  RYEQW+  +GRV+++  EK  RF IFKEN+ +
Sbjct  13    ALILMLGAWSS-EATSRTL--QDVTMYGRYEQWMARHGRVFSSIDEKESRFKIFKENLAY  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDW  479
             I+S N   ++TF +G+N+FA LTN+EF S   G+K +    + + F YENVT +PA MDW
Sbjct  70    IESSNNDASKTFRLGVNQFAHLTNEEFTSLSNGFKGHESSTKTSSFRYENVT-VPATMDW  128

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
               KGAVTP+KNQ QCGCCWAFSAVAA+EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  129   RSKGAVTPIKNQGQCGCCWAFSAVAAMEGITQLTMGKLISLSEQELVDCDKSGEDQGCEG  188

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G++TE+NYPY    G C   K A   A I G + VP   ES L+KA
Sbjct  189   GLMDDAFEFINQNHGLSTEANYPYTGVDGKCNARKEASHAASITGHEDVPANSESALLKA  248

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QP+S AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  249   VASQPISVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  307

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  308   AQWGEEGYIRMQRDVDAAEGLCGIAMAASYPTA  340



>gb|AHA62780.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=344

 Score =   327 bits (838),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 212/314 (68%), Gaps = 12/314 (4%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             M++++EQW+  YGR+Y N  EK+KRF IF EN+  I++ N+ G   FT+G+N FADLTND
Sbjct  33    MIEKHEQWMTLYGRIYENNNEKMKRFKIFSENIKRIEAMNKMG-RGFTLGVNAFADLTND  91

Query  378   EFKSSRMGYKNPPYYENTP------FMYENVT--EIPADMDWVKKGAVTPVKNQKQCGCC  533
             EF++SR GYK      N        F YENVT   +    DW  KGAVTP+K+Q  CGCC
Sbjct  92    EFRNSRTGYKKQLTTTNNNNLASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCC  151

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI-ISLGCHGGWIGAGFLYVLFNGGITTE  710
             WAF+ VAA EG+ Q++ G L SLSEQ+L+DCD     GC GG +   + ++L NGG+TTE
Sbjct  152   WAFATVAATEGLNQLKTGKLISLSEQELVDCDTSFDQGCEGGLLDTAYTFILKNGGLTTE  211

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             SNYPY    G C    +A+  A I G+Q VP   E+ L+KAVA+QPVS A++  G  FQF
Sbjct  212   SNYPYMATDGICTTKHSAKSAASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQF  271

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAK  1067
             Y  G++ + +C   ++HA+ ++GYGES DG K+WLIKNSWG  WGENGY+++ +D  D  
Sbjct  272   YSSGVF-QGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDVDDKY  330

Query  1068  GACGIATKPSFPVA  1109
             G CG+A +PS+P+A
Sbjct  331   GLCGLAMQPSYPIA  344



>ref|XP_003578815.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=339

 Score =   327 bits (838),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 224/339 (66%), Gaps = 14/339 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWR-LDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A+I+ +L     C +    R L+DD  M  R+E W+ +YGRVY +  EK ++F++FK N 
Sbjct  6     ASILAILGCLCFCSSVLAARELNDDLSMAARHETWMAQYGRVYKDAAEKAQKFEVFKANA  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYEN--VTEIP  464
              FIDSFN A N  F +GIN+FADLTN+EFK+++   G+ +     +T F YEN  +  +P
Sbjct  66    RFIDSFN-AENHKFWLGINQFADLTNEEFKATKTNKGFISNKARVSTGFKYENLKIEALP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
               +DW  KGAVTPVK+Q QCGCCWAFSAVAA EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   TSIDWRTKGAVTPVKDQGQCGCCWAFSAVAATEGIVKLSTGKLVSLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQR-SKAAQIEAKIKGFQWVPRFRE  815
              GC GG +   F +++ NGG+T ES+YPY  + G C+  SK+A     IK ++ VP   E
Sbjct  185   QGCEGGLMDDAFKFIITNGGLTQESSYPYDAEDGKCKSGSKSA---GTIKSYEDVPANNE  241

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWL  992
               LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG  SDG KFWL
Sbjct  242   GALMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGVTSDGTKFWL  300

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGENG+L++ KD  D KG CG+A +PS+P A
Sbjct  301   MKNSWGTTWGENGFLRMEKDIADKKGMCGLAMEPSYPTA  339



>ref|XP_006857797.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
 gb|ERN19264.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
Length=347

 Score =   327 bits (838),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 211/307 (69%), Gaps = 9/307 (3%)
 Frame = +3

Query  207   RYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFK  386
             R+EQW+  +GR Y +  EK +R  IF+EN+ FIDS N AG   + +  N+FADLTNDEF+
Sbjct  44    RFEQWMALHGRQYMDAQEKEQRSQIFEENLKFIDSVN-AGGRPYKLSANKFADLTNDEFR  102

Query  387   SSRMGYKN---PPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAA  557
             +  MG+K    P    + PFMY NV+  PA MDW KKGAVT VK+Q QCGCCWAFSAVAA
Sbjct  103   AMHMGFKGHECPTRASDAPFMYANVS-APASMDWRKKGAVTQVKDQGQCGCCWAFSAVAA  161

Query  558   IEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAM  731
             +EGI QI+ G L SLSEQ+++DCD      GC+GG++   F +++ N G+TTE+ YPY  
Sbjct  162   VEGITQIKTGKLVSLSEQEVVDCDTKGEDQGCNGGFMDDAFEFIINNHGLTTEAKYPYKA  221

Query  732   KKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYG  911
               G C   KA+   AKI G++ VP   E  L+KAVANQPVS AIDASG  FQFY GG++ 
Sbjct  222   VDGTCNTKKASSGAAKITGYEDVPTNNEKALVKAVANQPVSVAIDASGYEFQFYSGGVFN  281

Query  912   KDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIAT  1088
              D C T ++H +T VGYG  SDG K+WL+KNSWGE WGE GY+++ +D    +G CGIA 
Sbjct  282   GD-CGTELDHGVTAVGYGVSSDGTKYWLVKNSWGEEWGEKGYIRMQRDVASKEGLCGIAM  340

Query  1089  KPSFPVA  1109
             + S+P A
Sbjct  341   EASYPTA  347



>ref|XP_002280263.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=339

 Score =   327 bits (838),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 222/335 (66%), Gaps = 8/335 (2%)
 Frame = +3

Query  114   VFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKEN  293
             V  A++ +L  WA  +AT+R     +  M +R+E W+  YGR+Y +  EK KRF IFK+N
Sbjct  10    VSMALLFILAAWAS-QATSRSL--HEASMYERHEDWMARYGRMYKDANEKEKRFKIFKDN  66

Query  294   VNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFMYENVTEIPADM  473
             V  I+SFN+A ++T+ + INEFADLTN+EF+S R  +K     E T F YENVT +P+ +
Sbjct  67    VARIESFNKAMDKTYKLSINEFADLTNEEFRSLRNRFKAHICSEATTFKYENVTAVPSTI  126

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGC  647
             DW KKGAVTP+K+Q+QCGCCWAFSAVAA EGI QI  G L SLSEQ+L+DCD    + GC
Sbjct  127   DWRKKGAVTPIKDQQQCGCCWAFSAVAATEGITQITTGKLISLSEQELVDCDTGGENQGC  186

Query  648   HGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELM  827
              GG +   F ++  + G+ +E+ YPY    G C   K A   AKIKG++ VP   E  L 
Sbjct  187   SGGLMDDAFRFIKIH-GLASEATYPYEGDDGTCNSKKEAHPAAKIKGYEDVPANNEKALQ  245

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNS  1004
             KAVA+QPV+ AIDA G  FQFY  G++   +C T ++H +  VGYG   DG  +WL+KNS
Sbjct  246   KAVAHQPVAVAIDAGGFEFQFYTSGVF-TGQCGTELDHGVAAVGYGIGDDGMMYWLVKNS  304

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WG GWGE GY+++ +D    +G CGIA + S+P A
Sbjct  305   WGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  339



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   327 bits (838),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 225/344 (65%), Gaps = 18/344 (5%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARW-RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             +V AAI LVL +WA       W R  +D  M +R+E W+ +YGRVY +  EK  RF IFK
Sbjct  10    LVLAAI-LVLGVWA----PQSWSRTLNDATMNERHEMWMAQYGRVYRDNAEKEMRFKIFK  64

Query  288   ENVNFIDSFN-QAGNETFTVGINEFADLTNDEFKSSRMGYKN------PPYYENTPFMYE  446
             ENV +I SFN +A N+ + +GINEFAD TN+EF++ R GYK            +  F YE
Sbjct  65    ENVEYIASFNNKARNKPYKLGINEFADQTNEEFRAPRNGYKRRLPSVRSSETTDVSFRYE  124

Query  447   NVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDC  626
             N + +PA +DW KKGAVT VK+Q QCGCCWAFSAVAA+EGI  I    L+SLSEQ+L+DC
Sbjct  125   NAS-VPASIDWRKKGAVTGVKDQGQCGCCWAFSAVAAMEGINHITTRKLTSLSEQELVDC  183

Query  627   DII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWV  800
             D      GC GG +   F +++ N G+ TE+ YPY    G C + +A    AKI G++ V
Sbjct  184   DTSGEDQGCEGGLMDDAFEFIISNKGLATEAKYPYKASDGSCNKKEANPSAAKISGYEDV  243

Query  801   PRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DG  977
             P   E+ LMKAVANQPVS AIDASG  FQFY  G++   +C T ++H +T VGYG + DG
Sbjct  244   PSNNEAALMKAVANQPVSVAIDASGSDFQFYSSGVF-TGQCGTELDHGVTAVGYGTADDG  302

Query  978   RKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              K+WL+KNSWG  WGENGY+++ +D    +G CGIA + S+P A
Sbjct  303   TKYWLVKNSWGTTWGENGYIRMQRDIDAKEGLCGIAMQASYPTA  346



>ref|XP_010038688.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW47321.1| hypothetical protein EUGRSUZ_K01109 [Eucalyptus grandis]
Length=340

 Score =   327 bits (838),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 222/345 (64%), Gaps = 8/345 (2%)
 Frame = +3

Query  84    MGSRKYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEK  263
             MGS +  + I+   ++ +L  WA  +A  R     DD M + + QW+  YGRVY +  E+
Sbjct  1     MGSFRNQYFIL-VPLVFLLGAWAH-QAAGR-TFQRDDPMYEMHGQWMARYGRVYKDVEER  57

Query  264   VKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTPFMY  443
               RF+IFK N   I+SFN A ++ + +G+N+FADLTN+EFK+      +    E   F Y
Sbjct  58    QSRFEIFKANAQGIESFNHANDKPYRLGVNQFADLTNEEFKARNRFKSHMCSTEAASFRY  117

Query  444   ENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLD  623
             EN+T +P+ MDW KKGAVTPVKNQ QCGCCWAFSAVAA+EG+ +I  G L SLSEQ+L+D
Sbjct  118   ENITAVPSSMDWRKKGAVTPVKNQGQCGCCWAFSAVAAVEGVNEITTGKLISLSEQELVD  177

Query  624   CDI--ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQW  797
             CD+     GC GGW+ + F +V  + G+TTE+NYPY    G C     +     IKG++ 
Sbjct  178   CDVGGQDQGCEGGWMDSAFQFVEKH-GLTTETNYPYNGTDGKCNVKSESNRAVIIKGYED  236

Query  798   VPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-D  974
             VP   E  L+KAVA QPVS AIDA G  FQFY  G++    C T ++H +T VGYG S D
Sbjct  237   VPANSEGALLKAVAKQPVSVAIDAGGFDFQFYSSGVF-TGACGTELDHGVTAVGYGTSDD  295

Query  975   GRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             G KFWL+KNSWGE WGE GY+++ +D    +G CGIA K S+P A
Sbjct  296   GTKFWLVKNSWGEEWGEKGYIRMQRDVSAKEGLCGIAMKASYPTA  340



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score =   327 bits (838),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 167/335 (50%), Positives = 220/335 (66%), Gaps = 9/335 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++  +  W   + T R  L DD  M +R+E+W+  YG VY +  E+ KRF IFK+NVN+
Sbjct  13    ALLFCMGFWGF-QVTCR-TLQDDVSMYERHEEWMTRYGSVYKDPEEREKRFRIFKKNVNY  70

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSR---MGYKNPPYYENTPFMYENVTEIPADM  473
             I++FN A N+ + +G N+FADLTN+EF + R    G+        T F YENVT IP+ +
Sbjct  71    IETFNNAANKPYQLGTNQFADLTNEEFIAGRNRFKGHMCSSILRTTTFKYENVTTIPSTV  130

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGC  647
             DW +KGAVTPVK+Q QCGCCWAFSAVAA EGI  + +G L SLSEQ+L+DCD   +  GC
Sbjct  131   DWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGC  190

Query  648   HGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELM  827
              GG++   F +++ N GI TE NYPY    G C     A   A I G++ VP   ES L 
Sbjct  191   EGGFMDGAFKFIIKNHGINTEVNYPYKGVDGKCNAKAEAVNGATITGYEDVPVNNESALE  250

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNS  1004
             KAV++QPVS AIDASG  FQFYK G++    C T ++H +T VGYG S DG+K+WL+KNS
Sbjct  251   KAVSSQPVSVAIDASGSDFQFYKSGVF-SGSCGTELDHGVTAVGYGVSDDGKKYWLVKNS  309

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WG  WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  310   WGTEWGEEGYIRMQRDVAAAEGLCGIAMMASYPTA  344



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   327 bits (838),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 169/339 (50%), Positives = 221/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  108   LIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             L    A+I++L  W+   + A  R   D  M  R+EQW+V YGRVY +  EK KRF IFK
Sbjct  11    LCTCLALIIMLGAWS---SKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFK  67

Query  288   ENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVT-EI  461
             ENV +I+S N   ++ + + +N+F DLTN+EF +SR  +K +    + T F YENVT  +
Sbjct  68    ENVAYIESSNADSSKPYKLRVNQFTDLTNEEFIASRNRFKGHECSTKTTSFKYENVTASV  127

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--I  635
             PA MDW KKGAVTP+K+Q QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD   +
Sbjct  128   PATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGV  187

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F ++  N G++TE+NYPY    G C   K A I AKI   + VP   E
Sbjct  188   DQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITDHEDVPANDE  247

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWL  992
               L+ AVA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL
Sbjct  248   KALLNAVAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSDDGTKYWL  306

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             +KNSWG  WGE GY+++ +D    +G CGIA + S+P A
Sbjct  307   VKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA  345



>ref|XP_003607647.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89844.1| papain family cysteine protease [Medicago truncatula]
Length=340

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 212/314 (68%), Gaps = 5/314 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             +L +   + +R+EQW+ EYG++Y +  EK KRF IFK+NV FI+SFN A N+ + + +N 
Sbjct  29    KLYESPSLQERHEQWMSEYGKLYKDAIEKEKRFMIFKDNVEFIESFNAADNKPYKLSVNH  88

Query  357   FADLTNDEFKSSRMGYKN-PPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCC  533
              ADLT DEFK+SR GYK     +  T F YENVT IP  +DW  KGAVTP+K+Q QCG C
Sbjct  89    LADLTLDEFKASRNGYKKIDREFATTSFKYENVTAIPEAVDWRVKGAVTPIKDQGQCGSC  148

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITT  707
             WAFS VAAIEGI QI  G L SLSEQ+L+DCD      GC GG +  GF +++ NGGIT+
Sbjct  149   WAFSTVAAIEGINQITTGKLISLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNGGITS  208

Query  708   ESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQ  887
             E+NYPY    G C  +  A + AKI G++ VP   E  L+KAVANQP+S +IDAS  +F 
Sbjct  209   ETNYPYKAADGSCNTATTAPV-AKITGYEKVPVNSEISLLKAVANQPISVSIDASDSSFM  267

Query  888   FYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAK  1067
             FY  GIY   +C T ++H +T VGYG ++G  +W++KNSWG  WGE GY+++ +   D +
Sbjct  268   FYSSGIY-TGECGTELDHGVTAVGYGSANGTDYWIVKNSWGTVWGEKGYIRMQRGIADKE  326

Query  1068  GACGIATKPSFPVA  1109
             G CGIA   S+P A
Sbjct  327   GLCGIAMDSSYPTA  340



>gb|EMT08022.1| Vignain [Aegilops tauschii]
Length=341

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 221/342 (65%), Gaps = 11/342 (3%)
 Frame = +3

Query  108   LIVFAAIILVL--EIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDI  281
             + +  A++L +   I+ C       R   D  MV+++EQW+ ++ RVY + TEK +RF  
Sbjct  1     MAIPKALLLAIIGSIYLCSSTVLSARELGDAAMVEKHEQWMAKFNRVYKDSTEKAQRFKA  60

Query  282   FKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT  455
             FK NV FI+SFN  GN  F +G+N+F DLTNDEF++++   G K       T F Y NV+
Sbjct  61    FKANVAFIESFN-TGNHKFWLGVNQFTDLTNDEFRATKTNKGLKRNGARAPTRFKYNNVS  119

Query  456   E--IPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
                +PA +DW  KG VTP+K+Q QCGCCWAFSAVAA EGI ++  G L SLSEQ+L+DCD
Sbjct  120   TDALPAAVDWRTKGVVTPIKDQGQCGCCWAFSAVAATEGIVKLSTGKLVSLSEQELVDCD  179

Query  630   I--ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
             +  +  GC GG +   F +++ NGG+TTE+NYPY  + G C+ S  +   A IKG++ VP
Sbjct  180   VHGVDQGCEGGEMDDAFKFIIKNGGLTTEANYPYTAQDGQCKTSTTSNSVATIKGYEDVP  239

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGR  980
                ES LMKAVANQPVS A+D   + FQ Y GG+     C T ++H I  +GYG  SDG 
Sbjct  240   ANDESSLMKAVANQPVSVAVDGGDVIFQHYSGGVM-TGSCGTDLDHGIVAIGYGMTSDGT  298

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             KFWL+KNSW   WGE+GYL++ KD  D  G CG+A +PS+P 
Sbjct  299   KFWLLKNSWSTTWGESGYLRMEKDISDKSGMCGLAMQPSYPT  340



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/338 (51%), Positives = 229/338 (68%), Gaps = 11/338 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             + FAA+ LVL + A   + A  R   +  MV+++EQW+  + RVY ++ EK KR  IFKE
Sbjct  9     LAFAAL-LVLGMQA---SRASSRGFYEGSMVQKHEQWMDRFRRVYKDDAEKEKRLKIFKE  64

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYY---ENTPFMYENVTEI  461
             N  +IDS N+AG   + +GINEFADLTN+EF+++  GYK   +    E T F YENVT  
Sbjct  65    NAEYIDSVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMRSHQKSSETTSFKYENVT-A  123

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII-S  638
             P  +DW KKGAVT VK+Q QCGCCWAFSAVAA EGI +I+ G L SLSEQ+L+DCD   +
Sbjct  124   PTSIDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKKGKLISLSEQELVDCDTSWN  183

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
             +GC GG +   F +++ N G+TTESNYPY    G C+  K +   AKI G++ VP   ES
Sbjct  184   MGCQGGLMDYAFKFIIKNHGLTTESNYPYEGIDGTCKTGKKSNHAAKIAGYEDVPVNSES  243

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              L+KAVA+QPVS AIDASG  FQFY  G++   +C T ++H +T +GYG+ SDG  +WL+
Sbjct  244   ALLKAVAHQPVSVAIDASGPDFQFYSSGVF-TGECGTELDHGVTAIGYGKTSDGTDYWLV  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGE GY+++ ++    +G CGIA + S+P A
Sbjct  303   KNSWGTSWGEKGYIRMRRNIDAEEGLCGIAMEASYPTA  340



>gb|AFK44139.1| unknown [Medicago truncatula]
Length=340

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 212/314 (68%), Gaps = 5/314 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             +L +   + +R+EQW+ EYG++Y +  EK KRF IFK+NV FI+SFN A N+ + + +N 
Sbjct  29    KLYESPSLQERHEQWMSEYGKLYKDAIEKEKRFMIFKDNVEFIESFNAADNKPYKLSVNH  88

Query  357   FADLTNDEFKSSRMGYKN-PPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCC  533
              ADLT DEFK+SR GYK     +  T F YENVT IP  +DW  KGAVTP+K+Q QCG C
Sbjct  89    LADLTLDEFKASRNGYKKIDREFATTSFKYENVTAIPEAVDWRVKGAVTPIKDQGQCGSC  148

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITT  707
             WAFS VAAIEGI QI  G L SLSEQ+L+DCD      GC GG +  GF +++ NGGIT+
Sbjct  149   WAFSTVAAIEGINQITTGKLISLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNGGITS  208

Query  708   ESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQ  887
             E+NYPY    G C  +  A + AKI G++ VP   E  L+KAVANQP+S +IDAS  +F 
Sbjct  209   ETNYPYKAADGSCSAATTAPV-AKITGYEKVPVNSEISLLKAVANQPISVSIDASDSSFM  267

Query  888   FYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAK  1067
             FY  GIY   +C T ++H +T VGYG ++G  +W++KNSWG  WGE GY+++ +   D +
Sbjct  268   FYSSGIY-TGECGTELDHGVTAVGYGSANGTDYWIVKNSWGTVWGEKGYIRMQRGIADKE  326

Query  1068  GACGIATKPSFPVA  1109
             G CGIA   S+P A
Sbjct  327   GLCGIAMDSSYPTA  340



>gb|EMT20795.1| Vignain [Aegilops tauschii]
Length=339

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/337 (49%), Positives = 220/337 (65%), Gaps = 15/337 (4%)
 Frame = +3

Query  132   LVLEIWAC----CEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
             L++ +  C        A   ++DD  MV R+E W+ +Y RVY + TEK  RF++FK NV 
Sbjct  7     LIIGLLGCLCFYSSVLAAREINDDFSMVARHESWMAQYNRVYKDATEKAYRFEVFKANVG  66

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--EIPA  467
             FI+SFN A N  F +GIN+F DLTN+EFK ++      P  +  P  F YEN++   +PA
Sbjct  67    FIESFN-AENHKFYLGINQFTDLTNEEFKGTKANKGYKPSLQRVPTGFRYENLSLDSLPA  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +++ G L SLSEQ+L+DCD+     
Sbjct  126   AVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKLKTGKLISLSEQELVDCDVHGEDQ  185

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F +++ NGG+TTESNYPYA     C+        A IK ++ VP   E  
Sbjct  186   GCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKCK--SGTNDAATIKSYEDVPANNEGA  243

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIK  998
             LM+AVA+QPVS A+D   M FQFYKGG+     C T ++H I  +GYG+ SDG K+WL+K
Sbjct  244   LMQAVASQPVSVAVDGGDMTFQFYKGGVM-TGSCGTDLDHGIAAIGYGKTSDGTKYWLLK  302

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG  WGENGYL++ KD  D +G CG+A +PS+P A
Sbjct  303   NSWGTTWGENGYLRMEKDITDKRGMCGLAMEPSYPTA  339



>gb|EAY97106.1| hypothetical protein OsI_19029 [Oryza sativa Indica Group]
Length=350

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/344 (48%), Positives = 224/344 (65%), Gaps = 13/344 (4%)
 Frame = +3

Query  108   LIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             L +   I+ +          A   L  D  M  R+E+W+ ++GRVY +  EK +R ++FK
Sbjct  10    LAILCCIVCLYSSSGGAIVAAARELGGDAAMAARHERWMAQHGRVYKDAAEKARRLEVFK  69

Query  288   ENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-----NPPYYENTPFMYENV  452
              NV FI+SFN  G   + +G+N+FADLT++EFK++    K     N     +T F YENV
Sbjct  70    ANVAFIESFNAGGKNRYWLGVNQFADLTSEEFKATMTNSKGFSTPNNGVRVSTGFKYENV  129

Query  453   TE--IPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDC  626
             +   +PA +DW  KGAVT +K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DC
Sbjct  130   SADALPASVDWRTKGAVTRIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDC  189

Query  627   DIIS--LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWV  800
             D+     GC GG I   F ++L NGG+T E+NYPY  + G C+ + AA + A I+G++ V
Sbjct  190   DVDGNDQGCEGGEIDGAFQFILSNGGLTAEANYPYTAEDGRCKTTAAADVAASIRGYEDV  249

Query  801   PRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDG  977
             P   E  LMKAVA QPVS A+DAS   FQFY GG+   + C T+++H +TV+GYG  SDG
Sbjct  250   PANDEPSLMKAVAGQPVSVAVDAS--KFQFYGGGVMAGE-CGTSLDHGVTVIGYGAASDG  306

Query  978   RKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              K+WL+KNSWG  WGE GYL++ KD  D +G CG+A +PS+P A
Sbjct  307   TKYWLVKNSWGTTWGEAGYLRMEKDIDDKRGMCGLAMQPSYPTA  350



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 222/334 (66%), Gaps = 9/334 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++LV    A  EA AR    +D  + +R+EQW+ +YG+VY +  EK  R +IFKENV  
Sbjct  13    ALLLVFGFLAF-EANARTL--EDVSLKERHEQWMTQYGKVYTDSYEKELRSNIFKENVQR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVTEIPADMD  476
             I++FN AGN+ + +GIN+FADLTN+EFK+     G+          F YE+V+ +PA +D
Sbjct  70    IEAFNNAGNKPYKLGINQFADLTNEEFKARNRFKGHMCSNSTRTPTFKYEDVSSVPASLD  129

Query  477   WVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCH  650
             W +KGAVTP+K+Q QCGCCWAFSAVAA EGI ++  G L SLSEQ+L+DCD   +  GC 
Sbjct  130   WRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCE  189

Query  651   GGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMK  830
             GG +   F +++ N G+ TE+ YPY      C  +  A+  A IKGF+ VP   ES L+K
Sbjct  190   GGLMDDAFKFIMQNKGLNTEAKYPYQGVDATCNANAEAKDAASIKGFEDVPANSESALLK  249

Query  831   AVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSW  1007
             AVANQP+S AIDASG  FQFY  G++    C T ++H +T VGYG S DG K+WL+KNSW
Sbjct  250   AVANQPISVAIDASGSEFQFYSSGLF-TGSCGTELDHGVTAVGYGVSDDGTKYWLVKNSW  308

Query  1008  GEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             GE WGE GY+++ +D    +G CGIA + S+P A
Sbjct  309   GEQWGEEGYIRMQRDVAAEEGLCGIAMQASYPTA  342



>ref|XP_008362421.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Malus domestica]
Length=344

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/333 (52%), Positives = 221/333 (66%), Gaps = 9/333 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +IL+L  W+  EAT+R     D  M  RYEQW+  YGRV+ +  EK  RF IFKENV FI
Sbjct  16    LILMLGAWSS-EATSRSL--KDASMYGRYEQWLALYGRVHNDINEKETRFKIFKENVAFI  72

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVT-EIPADMDW  479
             +  N+  ++ + + +N+FADLTN+EFK++R G+K +    + + F YENVT  +PA MDW
Sbjct  73    EFSNKDAHKPYKLSVNQFADLTNEEFKATRNGFKGHECSTKASSFKYENVTVPLPATMDW  132

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVTPVK+  QCGCCWAFSAVAA EGI Q+  G L SLSEQ+L+DCD      GC G
Sbjct  133   RKKGAVTPVKDXGQCGCCWAFSAVAATEGITQLTTGNLISLSEQELVDCDTAGEDQGCEG  192

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N GI+TE NYPY    G C   K A I AKI GF+ VP   E  L+ A
Sbjct  193   GLMDDAFQFIQQNHGISTEXNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTA  252

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWG  1010
             VA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+KNSWG
Sbjct  253   VAHQPVSVAIDASGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  311

Query  1011  EGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
               WGE GY+++ +D   A+G CGIA   S+P A
Sbjct  312   AEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  344



>ref|XP_003605890.1| Cysteine proteinase [Medicago truncatula]
 gb|AES88087.1| papain family cysteine protease [Medicago truncatula]
Length=343

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/313 (51%), Positives = 211/313 (67%), Gaps = 8/313 (3%)
 Frame = +3

Query  192   DEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQA-GNETFTVGINEFADL  368
             D+M +R+ QW+ +YG+VY +  E+ KRF IF ENVN+I++FN+   N+ +T+G+N+FADL
Sbjct  32    DDMYERHRQWMSQYGKVYKDSQEREKRFKIFTENVNYIEAFNKGDNNKLYTLGVNQFADL  91

Query  369   TNDEFKSSRMGYKN---PPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWA  539
             TNDEF SSR  +K          + F YEN + IP+ +DW KKGAVTPVKNQ QCGCCWA
Sbjct  92    TNDEFTSSRNKFKGHMCSSITRTSTFKYENASAIPSSVDWRKKGAVTPVKNQGQCGCCWA  151

Query  540   FSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTES  713
             FSAVAA EGI ++  G L SLSEQ+L+DCD   +  GC GG +   F +++ N G+ TE+
Sbjct  152   FSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLNTEA  211

Query  714   NYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFY  893
             NYPY    G C  +K +     I G++ VP   E  L KAVANQP+S AIDASG  FQFY
Sbjct  212   NYPYQGVDGTCNANKGSINAVTITGYEDVPTNNEQALQKAVANQPISVAIDASGSDFQFY  271

Query  894   KGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKG  1070
             K G++    C T ++H +T VGYG S DG K+WL+KNSWG  WGE GY+ + +    A+G
Sbjct  272   KSGVF-TGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTEWGEEGYIMMQRGVDAAEG  330

Query  1071  ACGIATKPSFPVA  1109
              CGIA + S+P A
Sbjct  331   LCGIAMQASYPTA  343



>ref|XP_007132817.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
 gb|ESW04811.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
Length=340

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/324 (50%), Positives = 211/324 (65%), Gaps = 5/324 (2%)
 Frame = +3

Query  150   ACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGN  329
             + C +    R   +  + +R+EQW+ +YGR Y +  EK KRF IFK+NV FI+ FN AGN
Sbjct  18    SICSSQVMSRNIHEASISQRHEQWMKQYGRTYKDAAEKQKRFLIFKDNVQFIEFFNTAGN  77

Query  330   ETFTVGINEFADLTNDEFKSSRMGYKNPPYYE---NTPFMYENVTEIPADMDWVKKGAVT  500
             + + +GIN  AD TN+EF +S  GYK          TPF YENVT IP  +DW + GAVT
Sbjct  78    KPYKLGINHLADQTNEEFIASHTGYKGSHELRITAQTPFKYENVTRIPTAVDWRENGAVT  137

Query  501   PVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIISLGCHGGWIGAGFLY  680
             P+K+Q +CG CWAFS VAA EGI QI  G L SLSEQ+L+DCD +  GC GG +  GF +
Sbjct  138   PIKDQGRCGSCWAFSTVAATEGIYQITTGKLVSLSEQELVDCDSVDQGCDGGLMEDGFEF  197

Query  681   VLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAA  860
             ++ NGGIT+E NYPY      C   K A  EA+IKG++ VP   E  L KAVANQPVS +
Sbjct  198   IIKNGGITSEVNYPYTGVNETCDTKKEASPEAQIKGYETVPPNSEEALQKAVANQPVSVS  257

Query  861   IDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESD-GRKFWLIKNSWGEGWGENGYL  1037
             IDA G AFQFY  G++   +C T ++H +T VGYG +D G ++W++KNSW   WGE GY+
Sbjct  258   IDAGGSAFQFYSSGVF-TGQCGTQLDHGVTAVGYGITDNGTEYWIVKNSWSTQWGEEGYI  316

Query  1038  KLIKDSGDAKGACGIATKPSFPVA  1109
             ++ +     +G CGIA   S+PVA
Sbjct  317   RMERGIDAKEGLCGIAMDASYPVA  340



>ref|XP_004306813.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 220/337 (65%), Gaps = 9/337 (3%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             I  A ++++L  W+  EAT+R     D     RYEQWI  YGRVY +  EK  RF IFKE
Sbjct  10    ICLALVLIMLGAWSS-EATSRSL--QDALAYGRYEQWIAHYGRVYNDINEKEDRFKIFKE  66

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGY-KNPPYYENTPFMYENVTEIPA  467
             N  +++S N+ GN+ + + +N+FADLTN+EF +SR  +  N    + T F YEN T +PA
Sbjct  67    NEAYVESSNKDGNKLYKLSLNQFADLTNEEFTASRNRFLGNECSTKTTTFKYENAT-VPA  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISL  641
              MDW KKGAVTPVK+Q QCG CWAFSAV A+EGI Q+  G L SLSEQ+L+DCD+  +  
Sbjct  126   TMDWRKKGAVTPVKDQGQCGSCWAFSAVGAMEGITQLTIGKLISLSEQELVDCDVNGVDQ  185

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F +V+ N GI TE+NYPY    G C   K A   A I G + VP   ES 
Sbjct  186   GCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPANSESA  245

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIK  998
             L+KAVANQP+S AIDASG  FQ Y  G++    C T ++H +T VGYG ++DG K+WL+K
Sbjct  246   LLKAVANQPISVAIDASGYDFQLYSSGVF-TGTCGTELDHGVTAVGYGVDADGTKYWLVK  304

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG  WGE GY+++ +D    +G CGIA + S+P A
Sbjct  305   NSWGAQWGEQGYIRMQRDVAAPEGLCGIAMEASYPTA  341



>emb|CAH66233.1| H0825G02.10 [Oryza sativa Indica Group]
Length=339

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/338 (49%), Positives = 221/338 (65%), Gaps = 12/338 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWRLDDDDE-MVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A +  +L     C A    R   D   MV R+E+W+ +YGRVY + TEK +RF+IFK NV
Sbjct  6     ALLFAILSCLCLCSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--EIP  464
              FI+SFN AGN  F + +N+FADLTN EF++++      P     P  F YENV+   +P
Sbjct  66    AFIESFN-AGNHKFWLSVNQFADLTNYEFRATKTNKGFIPSTVRVPTTFRYENVSIDTLP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW  KGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   ATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTES YPY    G C  +  +   A IKG++ VP   E+
Sbjct  185   QGCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGKC--NGGSNSAATIKGYEDVPANNEA  242

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG + DG ++WL+
Sbjct  243   ALMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIVAIGYGKDGDGTQYWLL  301

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGENG+L++ KD  D +G CG+A +PS+P A
Sbjct  302   KNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  339



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 223/343 (65%), Gaps = 14/343 (4%)
 Frame = +3

Query  99    YTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFD  278
             Y   + FA I ++  +     + A  R   D  M  +YEQW+  YGRVY N  EK KRF+
Sbjct  4     YCKCMCFALIFMLGAL----SSHATSRTLQDPSMYGKYEQWMAHYGRVYTNINEKEKRFN  59

Query  279   IFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSR---MGYKNPPYYENTPFMYEN  449
             IFK NV+FI+S N   N+ + + +N+FADLTN+EFK+SR   MG++     + T F YEN
Sbjct  60    IFKANVDFIESSNNDANKPYKLKVNQFADLTNEEFKASRNRFMGHECST--KTTSFKYEN  117

Query  450   VTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
             VT  PA +DW KKGAVTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD
Sbjct  118   VT-APATVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCD  176

Query  630   I--ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
                +  GC GG +   F ++  N G++TE+NYPY    G C   K A   A I G + VP
Sbjct  177   TSGVDQGCEGGLMDDAFQFITQNHGLSTETNYPYTGVDGTCNTKKEASHAATITGHEDVP  236

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGR  980
                E+ L+KAVANQP+S AIDA G  FQFY  G++    C T+++H +T VG+G S DG 
Sbjct  237   ANSEAALLKAVANQPISVAIDAGGSDFQFYSSGVF-TGTCGTSLDHGVTAVGFGVSADGT  295

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             K+WL+KNSWG  WGE GY+++ +D    +G CGIA + S+P A
Sbjct  296   KYWLVKNSWGAEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  338



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 212/317 (67%), Gaps = 7/317 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   D  M +R+EQW+  YG+VY +  E+ KRF IFKENVN+I++FN A N+ + + IN+
Sbjct  28    RSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQ  87

Query  357   FADLTNDEFKSSR---MGYKNPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCG  527
             FADLTN+EF + R    G+        T F YENVT +P+ +DW +KGAVTP+K+Q QCG
Sbjct  88    FADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCG  147

Query  528   CCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGI  701
             CCWAFSAVAA EGI  + +G L SLSEQ+L+DCD   +  GC GG +   F +V+ N G+
Sbjct  148   CCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGL  207

Query  702   TTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMA  881
              TE+NYPY    G C  ++AA   A I G++ VP   E  L KAVANQPVS AIDASG  
Sbjct  208   NTEANYPYKGVDGKCNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSD  267

Query  882   FQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSG  1058
             FQFYK G++    C T ++H +T VGYG S DG ++WL+KNSWG  WGE GY+++ +   
Sbjct  268   FQFYKSGVF-TGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVN  326

Query  1059  DAKGACGIATKPSFPVA  1109
               +G CGIA + S+P A
Sbjct  327   SEEGLCGIAMQASYPTA  343



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 221/335 (66%), Gaps = 11/335 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A+ L L +WA  + T+R     DD M + +EQW+  YG+VY +  EK KR  IF +N+N+
Sbjct  13    ALFLCLGLWAI-QGTSRTL--QDDSMYESHEQWMRHYGKVYKDSQEKEKRSKIFTQNINY  69

Query  303   IDSFNQAGNE-TFTVGINEFADLTNDEFKSSRMGYKN---PPYYENTPFMYENVTEIPAD  470
             I +FN AGN+  + +GIN++ADLTN+EF SSR  +K          T F YENV+ +P+ 
Sbjct  70    IQAFNNAGNDKAYKLGINQYADLTNEEFISSRNKFKGHMCSSIIRTTTFKYENVSAVPST  129

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLG  644
             +DW KKGAVTPVKNQ QCGCCWAFSAVAA EGI ++  G L SLSEQ+L+DCD   +  G
Sbjct  130   VDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQG  189

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C GG +   F +++ N G+ TE+ YPY    G C  ++A+   A I G++ VP   E  L
Sbjct  190   CEGGLMDDAFKFIIQNHGLDTEAQYPYQGVDGTCNANEASIHAATITGYEDVPVNNEQAL  249

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKN  1001
              KAVANQP+S AIDASG  FQFYK G++    C T ++H +T VGYG S DG K+WL+KN
Sbjct  250   QKAVANQPISVAIDASGSDFQFYKSGVF-TGSCGTELDHGVTAVGYGVSNDGTKYWLVKN  308

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             SWG  WGE GY+++ +    A+G CGIA + S+P 
Sbjct  309   SWGTDWGEQGYIRMQRGVDAAEGLCGIAMQASYPT  343



>emb|CDP18638.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 224/322 (70%), Gaps = 12/322 (4%)
 Frame = +3

Query  159   EATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETF  338
             +ATAR   +    + +++EQW+VE+GRVY +E EK KRF IFKE V +I++FN+AGN+++
Sbjct  23    QATARSLYEA--SLTEKHEQWMVEHGRVYKDEAEKAKRFKIFKETVEYIEAFNKAGNKSY  80

Query  339   TVGINEFADLTNDEFKSSRMGYKNPP---YYENTPFMYENVTEIPADMDWVKKGAVTPVK  509
              +GIN FADLTN+EF S+  GY   P     + T F Y +V++ P  MDW +KGAVT VK
Sbjct  81    VLGINRFADLTNEEFLSASTGYNYKPRKDVSQGTSFRYADVSDAPPSMDWRQKGAVTEVK  140

Query  510   NQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-LGCHGGWIGAGFLYVL  686
             +Q  CG CWAFSAVAA+EGI +++AG L+SLSEQQL+DCD  S  GC GG + + F ++ 
Sbjct  141   DQAACGVCWAFSAVAAVEGIHKLKAGELTSLSEQQLVDCDTSSNHGCSGGRMDSAFNFIA  200

Query  687   FNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAID  866
              N G+ TES YPY    G C   + A    +I G++ VP+  E  L++AV+ QPVS  I+
Sbjct  201   SN-GLATESEYPYQGADGTCNNDQGA---VRITGYEDVPQNNEDALLQAVSKQPVSVGIE  256

Query  867   ASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKL  1043
              SGM F+ Y+ G++  D C   ++HA+T+VGYG S DG K+WL+KNSWG  WGE+GY++L
Sbjct  257   GSGMDFKNYQSGVFSGD-CGNNLDHAVTLVGYGTSEDGTKYWLVKNSWGTSWGEDGYMRL  315

Query  1044  IKDSGDAKGACGIATKPSFPVA  1109
              +D+G  +G CGIA++ S+P A
Sbjct  316   QRDTGAPEGLCGIASQASYPTA  337



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 212/317 (67%), Gaps = 7/317 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   D  M +R+EQW+  YG+VY +  E+ KRF IFKENVN+I++FN A N+ + + IN+
Sbjct  11    RSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQ  70

Query  357   FADLTNDEFKSSR---MGYKNPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCG  527
             FADLTN+EF + R    G+        T F YENVT +P+ +DW +KGAVTP+K+Q QCG
Sbjct  71    FADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCG  130

Query  528   CCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGI  701
             CCWAFSAVAA EGI  + +G L SLSEQ+L+DCD   +  GC GG +   F +V+ N G+
Sbjct  131   CCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGL  190

Query  702   TTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMA  881
              TE+NYPY    G C  ++AA   A I G++ VP   E  L KAVANQPVS AIDASG  
Sbjct  191   NTEANYPYKGVDGKCNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSD  250

Query  882   FQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSG  1058
             FQFYK G++    C T ++H +T VGYG S DG ++WL+KNSWG  WGE GY+++ +   
Sbjct  251   FQFYKSGVF-TGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVD  309

Query  1059  DAKGACGIATKPSFPVA  1109
               +G CGIA + S+P A
Sbjct  310   SEEGLCGIAMQASYPTA  326



>ref|XP_009354265.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 219/337 (65%), Gaps = 9/337 (3%)
 Frame = +3

Query  114   VFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKEN  293
             ++  +IL+L  W+  +AT+R     D  M  R+EQW+  YGRVY N  EK  RF I KEN
Sbjct  12    MYLGLILMLGAWSS-QATSRSL--QDAAMYGRHEQWLARYGRVYNNVNEKETRFKILKEN  68

Query  294   VNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-PFMYENVT-EIPA  467
             V F++S N+  N+ + + +N+FADLTN+EFK+SR G+K   Y   T  F YE VT  +PA
Sbjct  69    VAFVESSNKDANKPYKLSVNQFADLTNEEFKASRNGFKGQEYSTKTNSFKYEKVTAALPA  128

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISL  641
              MDW KKGAVTPVK+Q QCG CWAFSAVAA EGI  +  G L SLSEQ+L+DCD      
Sbjct  129   TMDWRKKGAVTPVKDQGQCGSCWAFSAVAATEGITHLTTGKLISLSEQELVDCDTGGEDQ  188

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG I   F ++  N GI+TE+NYPY      C   K A I AKI G++ VP   E  
Sbjct  189   GCWGGLIDDAFQFIQQNHGISTEANYPYIGVGDTCNTKKEAIIAAKITGYEVVPANSEKA  248

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIK  998
             L+ AVA+QPVS AIDASG  FQFY  G++    C T+++H +T VGYG S DG K+WL+K
Sbjct  249   LLTAVAHQPVSVAIDASGSNFQFYSSGVF-NGTCGTSLDHGVTAVGYGVSDDGTKYWLVK  307

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG  WGE GY+++ +D    +G CGIA   S+P A
Sbjct  308   NSWGAKWGEAGYIRMQRDVSAPEGLCGIAMSASYPTA  344



>gb|EMT29821.1| Thiol protease SEN102 [Aegilops tauschii]
Length=339

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 166/337 (49%), Positives = 219/337 (65%), Gaps = 15/337 (4%)
 Frame = +3

Query  132   LVLEIWAC----CEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVN  299
             L++ +  C        A   ++DD  MV R+E W+ +Y RVY + TEK  RF+ FK+NV 
Sbjct  7     LIIGLLGCLCFYSSVLAAREINDDLSMVARHESWMAQYNRVYKDATEKAYRFEAFKDNVG  66

Query  300   FIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--EIPA  467
             FI+SFN A N  F +GIN+F DLTN+EFK ++      P  +  P  F YENV+   +PA
Sbjct  67    FIESFN-AENHKFYLGINQFTDLTNEEFKGTKANKGYKPSLQRVPTRFRYENVSLDALPA  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW  KGAVTP+K+Q QCGCCWAFSAVAA EGI +++ G L SLSEQ+L+DCD+     
Sbjct  126   IIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKLKTGKLISLSEQELVDCDVHGEDQ  185

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GG +   F +++ NGG+TTESNYPY      C+        A IK ++ VP   E  
Sbjct  186   GCEGGLMDDAFKFIIKNGGLTTESNYPYTAADDKCK--SGTNDAATIKSYEDVPANNEGA  243

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLIK  998
             LM+AVA+QPVS A+D   M FQFYKGG+     C T ++H I  +GYG+ SDG K+WL+K
Sbjct  244   LMQAVASQPVSVAVDGGDMTFQFYKGGVM-TGSCGTDLDHGIAAIGYGKTSDGTKYWLLK  302

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG  WGENGYL++ KD  D +G CG+A +PS+P A
Sbjct  303   NSWGTTWGENGYLRMEKDITDKRGMCGLAMEPSYPTA  339



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   325 bits (833),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/344 (49%), Positives = 228/344 (66%), Gaps = 15/344 (4%)
 Frame = +3

Query  102   THLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDI  281
             T  +  A  +L+L  +A   ATAR  +  +  M +R+EQW+ ++GRVY +  EK +RF I
Sbjct  6     TKSLCMALFVLLLCTFAS-HATAR--MLSEMTMHERHEQWMSQHGRVYGDSAEKERRFQI  62

Query  282   FKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT-----PFMYE  446
             FK NV  I+SFN AGN  + +G+N+FADLT +EFK+   G+K  P   NT      F YE
Sbjct  63    FKANVELIESFN-AGNSKYKLGVNQFADLTIEEFKAMMNGFK--PSSVNTFKATNVFRYE  119

Query  447   NVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDC  626
             NVT +P  MDW  +GAVTP+K+Q   GCCWAFSAVAA+EGI +++ G L SLSEQ+L+DC
Sbjct  120   NVTAVPTSMDWRAEGAVTPIKDQGDYGCCWAFSAVAAMEGITKLKTGKLISLSEQELVDC  179

Query  627   DII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWV  800
             D+     GC GG +   F +++ NGG+TTE+NYPY    G C   K+    A IKG++ V
Sbjct  180   DVAGEDQGCEGGLMDDAFEFIIRNGGLTTETNYPYKGIDGTCNTKKSFSHAASIKGYEDV  239

Query  801   PRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DG  977
             P   E+ L+ AV+NQPVS AI+ASG +FQFY  G++    C T ++H +T VGYG + DG
Sbjct  240   PANSEAALLNAVSNQPVSVAIEASGYSFQFYSSGVF-TGSCGTDLDHGVTAVGYGTARDG  298

Query  978   RKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              K+WL+KNSWG  WGE+GY+++ +D    +G CGIA K S+P A
Sbjct  299   TKYWLVKNSWGSSWGESGYVRMERDVAAKEGLCGIAMKASYPTA  342



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   325 bits (833),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 228/348 (66%), Gaps = 12/348 (3%)
 Frame = +3

Query  84    MGSRKYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEK  263
             M ++   + + FA ++L L +WA   ++   R   D  M +R+EQW+  YGRVY +  EK
Sbjct  1     MATKNQFYQVSFA-LVLCLGLWAFQVSS---RTLQDASMQERHEQWMARYGRVYKDLQEK  56

Query  264   VKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSR---MGYKNPPYYENTP  434
              KRF IFKENVN+I++ N AG++ + +G+N+FADLTN+EF ++R    G+ +      T 
Sbjct  57    EKRFSIFKENVNYIEASNNAGDKPYKLGVNQFADLTNEEFIATRNKFKGHMSSSITRTTT  116

Query  435   FMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQ  614
             F YENVT  P+ +DW ++GAVTPVKNQ  CGCCWAFSAVAA EGI ++  G L SLSEQ+
Sbjct  117   FKYENVT-APSTVDWRQEGAVTPVKNQGTCGCCWAFSAVAATEGIHKLSTGNLVSLSEQE  175

Query  615   LLDCDI--ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKG  788
             L+DCD      GC GG +   F +++ NGG+ TE+ YPY    G C  ++ A   A I G
Sbjct  176   LVDCDTSGADQGCQGGLMDDAFKFIIQNGGLNTEAQYPYQGVDGTCNTNEEATHVATITG  235

Query  789   FQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE  968
             ++ VP   E  L +AVANQP+S AIDASG  FQ Y+ G++    C T ++H + VVGYG 
Sbjct  236   YEDVPSNNEQALQQAVANQPISIAIDASGSDFQNYQSGVF-TGSCGTQLDHGVAVVGYGV  294

Query  969   S-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             S DG K+WL+KNSWG  WGE GY+++ +D    +G CG+A +PS+P A
Sbjct  295   SDDGTKYWLVKNSWGADWGEEGYIRMQRDVDAPEGLCGLAMQPSYPTA  342



>ref|XP_010239696.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=341

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 219/335 (65%), Gaps = 9/335 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             +I +L       A A   L DD  MV R+EQW+ +YGRVY +  EK +R ++FK NV FI
Sbjct  9     LIAILACTCAVSALAARDLTDDLSMVARHEQWMAKYGRVYNDVAEKAQRLEVFKANVAFI  68

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYE--NTPFMYENVT--EIPADM  473
             +  N AGN+ F++  N+FAD+T DEF+++  GYK  P  +   T F Y NV+   +PA M
Sbjct  69    ELVN-AGNDKFSLEANQFADMTVDEFRAAHTGYKPVPANKGRTTQFKYANVSLDALPASM  127

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGC  647
             DW  KGAVTP+K+Q QCGCCWAFS VA++EGI ++  G L SLSEQ+L+DCD+  +  GC
Sbjct  128   DWRAKGAVTPIKDQGQCGCCWAFSTVASVEGIVKLSTGKLISLSEQELVDCDVDGMDQGC  187

Query  648   HGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELM  827
              GG +   F +++ NGG+TTE NYPY      C  +K +   A IKG++ VP   E+ L+
Sbjct  188   EGGLMDNAFEFIIDNGGLTTEGNYPYTGTDDSCNSNKESNDVASIKGYEDVPSNDETSLL  247

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNS  1004
             KAVA QPVS A+D     F+FYKGG+     C T ++H I  VGYG  SDG KFWL+KNS
Sbjct  248   KAVAAQPVSIAVDGGDNLFRFYKGGVL-SGACGTELDHGIAAVGYGITSDGTKFWLMKNS  306

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WG  WGE G++++ +D  D +G CG+A +PS+P A
Sbjct  307   WGTSWGEKGFIRMERDIADEEGLCGLAMQPSYPTA  341



>ref|XP_004308524.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 223/338 (66%), Gaps = 13/338 (4%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             +  A ++++L  W+  EAT+R     D     RYEQWI  YGRVY +  EK  RF IFKE
Sbjct  10    MCLAFVLIMLGAWSS-EATSRSL--QDALAYGRYEQWIARYGRVYNDINEKEDRFKIFKE  66

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSR---MGYKNPPYYENTPFMYENVTEI  461
             N  +++S N+ GN+ + + +N+FADLTN+EF +SR   +G++     + T F YENVT +
Sbjct  67    NEAYVESSNKDGNKLYKLSLNQFADLTNEEFTASRNRFLGHECST--KTTTFKYENVT-V  123

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--I  635
             PA MDW KKGAVTPVK+Q QCG CWAFSAV A+EGI Q+  G L SLSEQ+L+DCD+  +
Sbjct  124   PATMDWRKKGAVTPVKDQGQCGSCWAFSAVGAMEGITQLTTGKLISLSEQELVDCDVNGV  183

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F +V+ N GI TE+NYPY    G C   KAA   A I G + VP   E
Sbjct  184   DQGCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKAAGHAATITGHEDVPANSE  243

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWL  992
             S L+KAVANQP+S AIDASG  FQ Y  G++    C T ++H +T VGYG ++DG K+WL
Sbjct  244   SALLKAVANQPISVAIDASGYDFQLYSSGVF-TGTCGTELDHGVTAVGYGVDADGTKYWL  302

Query  993   IKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             +KNSWG  WGE GY+++ +D    +G CGIA + S+P 
Sbjct  303   VKNSWGAQWGEEGYIRMQRDVAAPEGLCGIAMEASYPT  340



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 220/343 (64%), Gaps = 14/343 (4%)
 Frame = +3

Query  99    YTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFD  278
             Y   I+ A I ++        + A  R   D  M  RYEQW+  YGRVY++  EK KRF+
Sbjct  8     YCKCIILALIFML----GALSSQATSRTLQDASMYGRYEQWMARYGRVYSDINEKEKRFN  63

Query  279   IFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSR---MGYKNPPYYENTPFMYEN  449
             IFKENV FI+S N   N+   + +N+FADLTN+EFK+SR   MG++     + T F YEN
Sbjct  64    IFKENVAFIESSNNDANKLHKLSVNQFADLTNEEFKASRNRFMGHECSA--KTTSFKYEN  121

Query  450   VTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
             VT  P  +DW KKGAVTPVK+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD
Sbjct  122   VT-APPTLDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCD  180

Query  630   I--ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
                +  GC GG +   F ++  N G++TE+NYPY    G C   K A   AKI G + VP
Sbjct  181   TSGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVP  240

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGR  980
                E  L+KAVANQP+S AIDA G  FQFY  G++    C T+++H +T VGYG S DG 
Sbjct  241   ANSEEALLKAVANQPISVAIDAGGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSADGT  299

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             K+WL+KNSWG  WGE GY+++ +     +G CGIA + S+P A
Sbjct  300   KYWLVKNSWGTEWGEEGYIRMQRGIKAKEGLCGIAMEASYPTA  342



>gb|KHN12137.1| Thiol protease [Glycine soja]
Length=341

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 205/309 (66%), Gaps = 6/309 (2%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             + +R+E W+ EYG++Y +  EK KRF IFK+NV FI+SFN AGN+ + +G+N  ADLT +
Sbjct  34    LRERHENWMAEYGKMYKDAAEKEKRFQIFKDNVEFIESFNAAGNKPYKLGVNHLADLTLE  93

Query  378   EFKSSRMGYKNPPYYENTPFM-----YENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAF  542
             EFK SR G K    +  T F      YENVT+IP  +DW  KGAVTP+K Q QCG CWAF
Sbjct  94    EFKDSRNGLKRTYEFSTTTFKLNGFKYENVTDIPEAIDWRVKGAVTPIKYQGQCGSCWAF  153

Query  543   SAVAAIEGIKQIRAGILSSLSEQQLLDCDIISLGCHGGWIGAGFLYVLFNGGITTESNYP  722
             S +AA EGI QI  G L SLSEQ+L+DCD +  GC GG++  GF +++ NGGIT+E+NYP
Sbjct  154   STIAATEGIHQISTGNLVSLSEQELVDCDSVDDGCEGGFMEDGFEFIIKNGGITSETNYP  213

Query  723   YAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGG  902
             Y    G C  + AA   A+IKG++ VP + E  L KAVANQPVS +I A+   F FY  G
Sbjct  214   YKGVDGTCNTTIAASPVAQIKGYEIVPSYSEEALQKAVANQPVSVSIHATNATFMFYSSG  273

Query  903   IYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGI  1082
             IY   +C T ++H +T VGYG  +G  +W++KNSWG  WGE GY+++ +      G CGI
Sbjct  274   IY-NGECGTDLDHGVTAVGYGTENGTDYWIVKNSWGTQWGEKGYIRMHRGIAAKHGICGI  332

Query  1083  ATKPSFPVA  1109
             A   S+P A
Sbjct  333   ALDSSYPTA  341



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   324 bits (831),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 216/332 (65%), Gaps = 7/332 (2%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A+I +L       + A  R   D  M +++E+W+  +GRVY +  EK  R+ IFKENV  
Sbjct  13    ALIFLL---GALVSQAMARTLQDASMHEKHEEWMSRFGRVYNDGNEKEIRYKIFKENVQR  69

Query  303   IDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEIPADMDW  479
             I+SFN+A  +++ +GIN+FADLTN+EFK+SR  +K +    +  PF YEN+T  P+ MDW
Sbjct  70    IESFNKASGKSYKLGINQFADLTNEEFKTSRNRFKGHMCSSQAGPFRYENLTAAPSSMDW  129

Query  480   VKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHG  653
              KKGAVT +K+Q QCG CWAFSAVAA+EGI Q+    L SLSEQ+L+DCD      GC G
Sbjct  130   RKKGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISLSEQELVDCDTKGEDQGCQG  189

Query  654   GWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKA  833
             G +   F ++  N G+TTE+NYPY    G C   + A   AKI GF+ VP   E  LMKA
Sbjct  190   GLMDDAFKFIEQNQGLTTEANYPYEGSDGTCNTKQEANHAAKINGFEDVPANNEGALMKA  249

Query  834   VANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGE  1013
             VA QPVS AIDA G  FQFY  GI+  D C T ++H +  VGYGES+G  +WL+KNSWG 
Sbjct  250   VAKQPVSVAIDAGGFGFQFYSSGIFTGD-CGTELDHGVAAVGYGESNGMNYWLVKNSWGT  308

Query  1014  GWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
              WGE GY+++ KD    +G CGIA + S+P A
Sbjct  309   QWGEEGYIRMQKDIDAKEGLCGIAMQASYPTA  340



>emb|CDP18639.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   324 bits (831),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 223/322 (69%), Gaps = 12/322 (4%)
 Frame = +3

Query  159   EATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETF  338
             +ATAR   +    + +++EQW+VE+GRVY +E EK KRF IFKE V +I++FN+AGN+++
Sbjct  23    QATARSLYEA--SLTEKHEQWMVEHGRVYKDEAEKAKRFKIFKETVEYIEAFNKAGNKSY  80

Query  339   TVGINEFADLTNDEFKSSRMGYKNPP---YYENTPFMYENVTEIPADMDWVKKGAVTPVK  509
              +GIN FADLTN+EF S+  GY   P     + T F Y +V++ P   DW +KGAVT VK
Sbjct  81    VLGINRFADLTNEEFLSASTGYNYKPRKDVSQGTSFRYADVSDAPPSTDWRQKGAVTGVK  140

Query  510   NQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDIIS-LGCHGGWIGAGFLYVL  686
             +Q  CGCCWAFSAVAA+EGI +++AG L+SLSEQQL+DCD  S  GC GG +   F ++ 
Sbjct  141   DQAACGCCWAFSAVAAVEGIHKLKAGELTSLSEQQLVDCDTSSNHGCSGGRMDEAFNFIA  200

Query  687   FNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAID  866
              N G+ TES YPY    G C   + A    +I G++ VP+  E  L++AV+ QPVS  I+
Sbjct  201   SN-GLATESEYPYQGADGTCNNDQGA---VQITGYEDVPQNNEDALLQAVSKQPVSVGIE  256

Query  867   ASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKL  1043
              SGM F+ Y+ G++  D C   ++HA+T+VGYG S DG K+WL+KNSWG  WGE+GY++L
Sbjct  257   GSGMDFKNYQSGVFSGD-CGNNLDHAVTLVGYGTSEDGTKYWLVKNSWGTSWGEDGYMRL  315

Query  1044  IKDSGDAKGACGIATKPSFPVA  1109
              +D+G  +G CGIA++ S+P A
Sbjct  316   QRDTGAPEGLCGIASQASYPTA  337



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score =   325 bits (832),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 220/338 (65%), Gaps = 12/338 (4%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
              A  +LVL     C + A  R   +  M +R+EQW+V +GRVY    EK +RF IFK NV
Sbjct  11    MALFVLVL---CACASHATARTLTEMTMAERHEQWMVRHGRVYKESAEKERRFQIFKANV  67

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP----FMYENVTEIP  464
              FI+SFN AGN  + +G+N+FADLTN+EFK+ R G K P   + +     F Y NVT +P
Sbjct  68    EFIESFN-AGNSKYKLGVNQFADLTNEEFKAMRNGLK-PSGVKTSKATSVFRYANVTAVP  125

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--IS  638
               MDW  KGAVTP+K+Q  CG CWAF+ VAA+EGI +++   L SLSEQ+L++CD+    
Sbjct  126   TRMDWRTKGAVTPIKDQGDCGSCWAFAVVAAMEGITKLKTHKLISLSEQELVECDVGGED  185

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC+GG   A   +++ NGG+ TE+NYPY    G C   K+A   A IKG++ VP   E+
Sbjct  186   EGCNGGLPDAALEFIIKNGGLATETNYPYKGMDGTCNTKKSASHAASIKGYEQVPANSEA  245

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLI  995
              L+KAVANQPVS  ID+ G +FQFY  G++    C T ++H++T VGYG++ DG K+WL+
Sbjct  246   ALLKAVANQPVSVNIDSGGSSFQFYASGVFTGGSCETDLDHSVTAVGYGKAKDGTKYWLV  305

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGE GY+++ +D    +G CGIA +  +P A
Sbjct  306   KNSWGSSWGEKGYIRMERDVSAKEGLCGIAMQAYYPTA  343



>gb|AHA62783.1| RCR3-like cysteine protease [Mirabilis viscosa]
Length=343

 Score =   324 bits (831),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 213/314 (68%), Gaps = 13/314 (4%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             M++++EQW+  YGR+Y N  EK+KRF IF EN+  I++ N+ G  +FT+G+N FADLTND
Sbjct  33    MIEKHEQWMTLYGRIYENNNEKMKRFKIFSENIKRIEAMNKMG-RSFTLGVNAFADLTND  91

Query  378   EFKSSRMGYKNPPYYENTP------FMYENVT--EIPADMDWVKKGAVTPVKNQKQCGCC  533
             EF++SR GYK      N        F YENVT   +    DW  KGAVTP+K+Q  CGCC
Sbjct  92    EFRNSRTGYKKQLTTTNNNNLASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCC  151

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI-ISLGCHGGWIGAGFLYVLFNGGITTE  710
             WAF+ VAA EG+ Q++ G L SLSEQ+L+DCD     GC GG +   + ++L NGG+TTE
Sbjct  152   WAFATVAATEGLNQLKTGKLISLSEQELVDCDTSFDQGCEGGLLDTAYTFILKNGGLTTE  211

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             SNYPY    G C    +A+  A I G+Q VP   E+ L+KAVA+QPVS A++  G  FQF
Sbjct  212   SNYPYMATDGICTTKHSAKSAASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQF  271

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAK  1067
             Y  G++ + +C   ++HA+ ++GYGES DG K+WLIKNSWG  WGENGY+++ +D  D  
Sbjct  272   YSSGVF-QGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDV-DKY  329

Query  1068  GACGIATKPSFPVA  1109
             G CG+A +PS+P+A
Sbjct  330   GLCGLAMQPSYPIA  343



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   324 bits (831),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 221/343 (64%), Gaps = 14/343 (4%)
 Frame = +3

Query  99    YTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFD  278
             Y   I+ A I ++  +     + A  R   D  M  RYEQW+  YGRVY++  EK KRF+
Sbjct  8     YCKCIILALIFMLGAL----SSQATSRTLQDASMYGRYEQWMAHYGRVYSDINEKEKRFN  63

Query  279   IFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSR---MGYKNPPYYENTPFMYEN  449
             IFKENV FI+S N   N+   + +N+FADLTN+EFK+SR   MG++     + T F YEN
Sbjct  64    IFKENVAFIESSNNDANKLHKLSVNQFADLTNEEFKASRNRFMGHECSA--KTTSFKYEN  121

Query  450   VTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCD  629
             VT  P  +DW KKGAVTPVK+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD
Sbjct  122   VT-APPTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCD  180

Query  630   I--ISLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVP  803
                +  GC GG +   F ++  N G++TE+NYPY    G C   K A   AKI G + VP
Sbjct  181   TSGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVP  240

Query  804   RFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGR  980
                E  L+KAVANQP+S AIDA G  FQFY  G++    C T+++H +T VGYG S DG 
Sbjct  241   ANSEEALLKAVANQPISVAIDAGGSDFQFYSSGVF-TGTCGTSLDHGVTAVGYGVSADGT  299

Query  981   KFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             K+WL+KNSWG  WGE GY+++ +     +G CGIA + S+P A
Sbjct  300   KYWLVKNSWGTEWGEEGYIRMQRGIKAKEGLCGIAMEASYPTA  342



>ref|XP_009759551.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=349

 Score =   324 bits (831),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 161/351 (46%), Positives = 228/351 (65%), Gaps = 11/351 (3%)
 Frame = +3

Query  84    MGSRKYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEK  263
             M     +  +  A   + L +W    A++R  ++ +  M  R++QWI  + +VY +  EK
Sbjct  1     MAFANLSQYLCLALFFIFLGVWRSQVASSR-PINYEASMRARHDQWIAHHDKVYKDLNEK  59

Query  264   VKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK--NPPYYEN---  428
               RF IFKENV  I++FN   ++ + +G+N+F+DLTN++F+    GYK  +P    +   
Sbjct  60    EMRFKIFKENVERIEAFNAGEDKGYKLGVNKFSDLTNEKFRVLHTGYKRSHPKVMSSSKP  119

Query  429   -TPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLS  605
              T F Y NVT+IP  MDW KKGAVTP+K+QK+CGCCWAFSAVAA EG+ Q++ G L  LS
Sbjct  120   KTHFRYANVTDIPPTMDWRKKGAVTPIKDQKECGCCWAFSAVAATEGLHQLKTGKLIPLS  179

Query  606   EQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAK  779
             EQ+L+DCD+     GC GG +   F ++L N G+TTE+NYPY  + G C + K+A   AK
Sbjct  180   EQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEANYPYKGEDGVCNKKKSALSAAK  239

Query  780   IKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVG  959
             I G++ VP   E  L++AVANQPVS AID S   FQFY  G++    C+T +NHA+T VG
Sbjct  240   IAGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFS-GSCSTWLNHAVTAVG  298

Query  960   YG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             YG  SDG K+W+IKNSWG  WG++GY+++ +D  + +G CG+A   S+P A
Sbjct  299   YGATSDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCGLAMDASYPTA  349



>ref|XP_006857795.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
 gb|ERN19262.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
Length=342

 Score =   324 bits (831),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 159/309 (51%), Positives = 213/309 (69%), Gaps = 10/309 (3%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             ++ R+EQW+  +GR Y +  EK +RF IF+EN+ FIDS N  G   + +  N+FADLTND
Sbjct  39    LLVRFEQWMALHGRQYMDAQEKEQRFQIFQENLKFIDSVNAEG-RPYKLTANKFADLTND  97

Query  378   EFKSSRMGYKN---PPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSA  548
             EF+ +RMG+K         + PFMY NV+  P  MDW KKGAVTPVK+Q QCGCCWAFSA
Sbjct  98    EFRVTRMGFKGHECAARASDAPFMYANVS-APTSMDWRKKGAVTPVKDQGQCGCCWAFSA  156

Query  549   VAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESNYP  722
             VAA+EGI QI+ G L SLSEQ+++DCD      GC+GG++   F +++ N G+TTE+ YP
Sbjct  157   VAAMEGIHQIKTGKLVSLSEQEVVDCDTKGEDQGCNGGFMDDAFKFIINNHGLTTEAKYP  216

Query  723   YAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGG  902
             Y    G C+  KA+ + A I G++ VP   E  L+KAV +QPVS AIDASG  FQFY GG
Sbjct  217   YKAVDGSCK--KASSLAATITGYEDVPTNNEKALLKAVTSQPVSVAIDASGYEFQFYSGG  274

Query  903   IYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGI  1082
             ++  + C T ++H +T VGYG S G K+WL+KNSWG+ WGE GY+++ +D    +G CGI
Sbjct  275   VFTGN-CGTELDHGVTAVGYGTSGGTKYWLVKNSWGKQWGEAGYIRMQRDVASKEGLCGI  333

Query  1083  ATKPSFPVA  1109
             A +PS+P A
Sbjct  334   AMQPSYPTA  342



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/338 (49%), Positives = 219/338 (65%), Gaps = 12/338 (4%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             I FA I++++ +    EA    R   D  M +R+E+W+ +YG VY +  EK  R  IF E
Sbjct  10    ICFAFILILVALAYQAEA----RSLPDASMYERHEEWMAKYGIVYKDANEKEMRHKIFNE  65

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSR---MGYKNPPYYENTPFMYENVTEI  461
             NV  I+ FN+A N+ + +GIN+FADLTN+EFK+SR    G+   P  +  PF YENVT +
Sbjct  66    NVERIEYFNRAANKPYKLGINQFADLTNEEFKTSRNRFKGHMCSP--QAGPFRYENVTAV  123

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             P+ MDW KKGAVTP+K+Q QCG CWAFSAVAA+EGI Q+    L SLSEQ+L+DCD    
Sbjct  124   PSSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTTQKLISLSEQELVDCDTKGE  183

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F ++  N G+TTE+NYPY    G C  +K A   AKI G++ VP   E
Sbjct  184   DQGCQGGLMDDAFKFIETNQGLTTEANYPYEGSDGTCNSNKEANHAAKITGYEDVPANNE  243

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLI  995
             + L+KAVA QPVS AIDA G  FQFY  GI+  D C T ++H +  VGYG S G  +WL+
Sbjct  244   AALLKAVAKQPVSVAIDAGGYEFQFYSSGIFTGD-CGTELDHGVAAVGYGVSQGTNYWLV  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGE GY+++ +D    +G CGIA + S+P A
Sbjct  303   KNSWGTQWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  340



>ref|XP_007025415.1| Senescence-associated gene 12, putative [Theobroma cacao]
 gb|EOY28037.1| Senescence-associated gene 12, putative [Theobroma cacao]
Length=341

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 222/337 (66%), Gaps = 10/337 (3%)
 Frame = +3

Query  117   FAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             F   IL++   +   A+A  R   +  + ++Y+QW+ +YGR Y  + E+  RF++FK N+
Sbjct  9     FLVFILIV---SGALASAMSRTLSETVVAEKYKQWMAQYGRTYEMKEEENMRFEVFKNNL  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP---FMYENVTEIPA  467
              +I++FN  GN+ + + INEFADLTN+EF +   GYK  P   ++    F Y+N+T +PA
Sbjct  66    EYIENFNNMGNQPYKLSINEFADLTNEEFLAYYAGYKIIPSTVSSKTKRFKYQNLTNVPA  125

Query  468   DMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SL  641
              +DW  KGAVT +K+Q  CG CWAFS VAA+EGI +I+ G L SLSEQQL+DC     S 
Sbjct  126   SIDWRNKGAVTQIKDQGHCGSCWAFSTVAAVEGIAKIKTGRLFSLSEQQLVDCVRTKGSQ  185

Query  642   GCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESE  821
             GC GGW+   F Y++ N G+  E+ YPY  K G C   KAA    +I G++ VP   E  
Sbjct  186   GCKGGWMHDAFEYIVKNHGLAEETRYPYKKKDGTCSPRKAAIKAVQILGYEDVPHKNEEA  245

Query  822   LMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIK  998
             L+KA + QPVS A+D +G AFQFY GG++    C T++NHA+TVVGYG S DG K+WLIK
Sbjct  246   LLKAASQQPVSVALDGNGTAFQFYSGGVF-TGPCRTSLNHAVTVVGYGTSEDGSKYWLIK  304

Query  999   NSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             NSWG+ WGENGY+++ +D    KG CGIA + S+PVA
Sbjct  305   NSWGKSWGENGYMRIKRDFNSKKGLCGIAKRASYPVA  341



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 219/338 (65%), Gaps = 7/338 (2%)
 Frame = +3

Query  105   HLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIF  284
             H  +  A+I  L   A   + A  R   D  + +++E+W+  + RVY++  EK  R+ IF
Sbjct  7     HGCISLALIFFLGALA---SQAIARTLQDASIHEKHEEWMTRFKRVYSDAKEKEIRYKIF  63

Query  285   KENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK-NPPYYENTPFMYENVTEI  461
             KENV  I+SFN+A  +++ +GIN+FADLTN+EFK+SR  +K +    +  PF YEN+T +
Sbjct  64    KENVQRIESFNKASEKSYKLGINQFADLTNEEFKTSRNRFKGHMCSSQAGPFRYENITAV  123

Query  462   PADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--  635
             P+ MDW K+GAVT +K+Q QCG CWAFSAVAA+EGI Q+    L SLSEQ+L+DCD    
Sbjct  124   PSSMDWRKEGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISLSEQELVDCDTKGE  183

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRE  815
               GC GG +   F ++  N G+TTE+NYPY    G C   + A   AKI GF+ VP   E
Sbjct  184   DQGCQGGLMDDAFKFIEQNQGLTTEANYPYEGSDGTCNTKQEANHAAKINGFEDVPANNE  243

Query  816   SELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLI  995
               LMKAVA QPVS AIDA G  FQFY  GI+  D C T ++H +  VGYGES+G  +WL+
Sbjct  244   GALMKAVAKQPVSVAIDAGGFEFQFYSSGIFTGD-CGTELDHGVAAVGYGESNGMNYWLV  302

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             KNSWG  WGE GY+++ KD    +G CGIA + S+P A
Sbjct  303   KNSWGTQWGEEGYIRMQKDIDAKEGLCGIAMQASYPTA  340



>gb|AHA62782.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=343

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 213/314 (68%), Gaps = 13/314 (4%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             M++++EQW+  YGR+Y N  EK+KRF IF EN+  I++ N+ G   FT+G+N FADLTND
Sbjct  33    MIEKHEQWMTLYGRIYENNNEKMKRFKIFSENIKRIEAMNKMG-RGFTLGVNAFADLTND  91

Query  378   EFKSSRMGYKNPPYYENTP------FMYENVT--EIPADMDWVKKGAVTPVKNQKQCGCC  533
             EF++SR GYK      N        F YENVT   +    DW  KGAVTP+K+Q  CGCC
Sbjct  92    EFRNSRTGYKKQLTTTNNNNLASKYFKYENVTNNSVSTSTDWRTKGAVTPIKDQGNCGCC  151

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI-ISLGCHGGWIGAGFLYVLFNGGITTE  710
             WAF+ VAA EG+ Q++ G L SLSEQ+L+DCD     GC GG +   + ++L NGG+TTE
Sbjct  152   WAFATVAATEGLNQLKTGKLISLSEQELVDCDTSFDQGCEGGLLDTAYTFILKNGGLTTE  211

Query  711   SNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQF  890
             SNYPY    G C    +A+ +A I G+Q VP   E+ L+KAVA+QPVS A++  G  FQF
Sbjct  212   SNYPYMATDGICTTKHSAKSDASIGGYQDVPANDEAALLKAVAHQPVSVALEGGGFDFQF  271

Query  891   YKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSGDAK  1067
             Y  G++ + +C   ++HA+ ++GYGES DG K+WLIKNSWG  WGENGY+++ +D  D  
Sbjct  272   YSSGVF-QGECGYELDHAVAIIGYGESDDGIKYWLIKNSWGTKWGENGYMRIKRDV-DKY  329

Query  1068  GACGIATKPSFPVA  1109
             G CG+A +PS+P+A
Sbjct  330   GLCGLAMQPSYPIA  343



>ref|XP_002436841.1| hypothetical protein SORBIDRAFT_10g009840 [Sorghum bicolor]
 gb|EER88208.1| hypothetical protein SORBIDRAFT_10g009840 [Sorghum bicolor]
Length=328

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/337 (49%), Positives = 222/337 (66%), Gaps = 23/337 (7%)
 Frame = +3

Query  120   AAIILVLEI-WACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A+I+ +L + + C  A A   L+DD  MV R+EQW+V+Y RVY + TEK +RF++FK NV
Sbjct  6     ASILAILGLAFFCGAALAARDLNDDSAMVARHEQWMVQYSRVYKDTTEKARRFEVFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIP  464
              FI+SFN  GN  F +G+N+FADLTNDEF++++   G+K  P   +T F YENV+   +P
Sbjct  66    KFIESFNAGGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPVKVSTGFRYENVSVDALP  125

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW  KGAVTP+K+Q QC            EGI +I  G L SLSEQ+L+DCD+    
Sbjct  126   ATIDWRTKGAVTPIKDQGQC------------EGIVKISTGKLISLSEQELVDCDVHGED  173

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTES+YPY    G C+    +   A +KGF+ VP   E+
Sbjct  174   QGCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKCK--SGSNSAATVKGFEDVPANDEA  231

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG K+WL+
Sbjct  232   ALMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGQTSDGTKYWLL  290

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             KNSWG  WGENGYL++ KD  D +G CG+A +PS+P 
Sbjct  291   KNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  327



>ref|XP_003599736.1| Cysteine proteinase [Medicago truncatula]
 ref|XP_003607644.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89841.1| papain family cysteine protease [Medicago truncatula]
Length=340

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 210/314 (67%), Gaps = 5/314 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             +L +   + +R+EQW+ E+G+VY +  EK KRF IFK+NV FI+SFN A N+ + + +N 
Sbjct  29    KLYESLSLQERHEQWMTEHGKVYEDAIEKEKRFMIFKDNVEFIESFNAADNQPYKLSVNH  88

Query  357   FADLTNDEFKSSRMGYKN-PPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCC  533
              ADLT DEFK+SR GYK     +  T F YENVT IPA +DW  KGAVTP+K+Q QCG C
Sbjct  89    LADLTLDEFKASRNGYKKIDREFTTTSFKYENVTAIPAAVDWRVKGAVTPIKDQGQCGSC  148

Query  534   WAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITT  707
             WAFS VAA EGI QI  G L SLSEQ+L+DCD      GC GG +  GF +++ NGGIT+
Sbjct  149   WAFSTVAATEGINQITTGKLVSLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNGGITS  208

Query  708   ESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQ  887
             E+NYPY    G C  +    + AKI G++ VP   E  L+KAVANQP+S +IDAS  +F 
Sbjct  209   ETNYPYKAADGSCNTATTTPV-AKITGYEKVPVNSEKSLLKAVANQPISVSIDASDSSFM  267

Query  888   FYKGGIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAK  1067
             FY  GIY   +C T ++H +T VGYG ++G  +W++KNSWG  WGE GY+++ +     +
Sbjct  268   FYSSGIY-TGECGTELDHGVTAVGYGSANGTDYWIVKNSWGTVWGEKGYIRMQRGIAAKE  326

Query  1068  GACGIATKPSFPVA  1109
             G CGIA   S+P A
Sbjct  327   GLCGIAMDSSYPTA  340



>ref|XP_008368206.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=344

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/341 (46%), Positives = 229/341 (67%), Gaps = 13/341 (4%)
 Frame = +3

Query  111   IVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKE  290
             I+  AI++ L   A  +AT+R   +    +  ++EQW+ ++GRVY +  EK +RF IFK 
Sbjct  7     ILIVAILITLGTLAS-QATSRTLYEAS--IAAKHEQWMEKFGRVYQDSAEKERRFHIFKN  63

Query  291   NVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENT---PFMYENV--T  455
             NV F++ FN  G +T+ +G+N F+D+T +EF S   GYK P    ++    F Y+N+  T
Sbjct  64    NVEFVEKFNSEGKKTYELGVNRFSDMTYEEFLSHHTGYKKPTESTSSADASFTYKNLSLT  123

Query  456   EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII  635
             ++P  MDW ++GAVTPVK+Q +CGCCWAFSAVAA+EGI +I+ G L SLSEQQL+ CD  
Sbjct  124   DVPPSMDWREQGAVTPVKDQGRCGCCWAFSAVAAVEGITEIKTGKLISLSEQQLVSCDTS  183

Query  636   SLGCHGGWIGAGFLYVLFNGGITTESNYPYAM---KKGFCQRSKAAQIEAKIKGFQWVPR  806
             + GC+GG +   F Y+  NGGI +E+NYPY     + G C +++A +  AKI  +  VPR
Sbjct  184   NSGCNGGNMVKAFAYIQRNGGIASEANYPYQSSDGRSGTCDKNRANEAAAKITNYARVPR  243

Query  807   FRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRK  983
               E+++ KAV+ QP+S AI AS  AFQ YKGG++  D C T +NHA+T++GYG + D   
Sbjct  244   NSEADINKAVSMQPISVAIVAS-QAFQAYKGGLFTDDNCGTNLNHAVTIIGYGTTEDDTP  302

Query  984   FWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             +WLIKNSWG  WGENGY+K+++ +   +G CG+A   S+P+
Sbjct  303   YWLIKNSWGTSWGENGYMKILRYADAPEGVCGLAMDASYPI  343



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 220/336 (65%), Gaps = 11/336 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++  L +WA  + T+R     D  M +R+E+W+  YG+VY +  E+ KRF IF EN+ +
Sbjct  13    ALVFCLGLWAI-QVTSRTL--QDGSMHERHERWMNHYGKVYKDHQEREKRFKIFTENMKY  69

Query  303   IDSFNQA-GNETFTVGINEFADLTNDEFKSSRMGYKN---PPYYENTPFMYENVTEIPAD  470
             I++FN    NE++ +GIN+FADLTN+EF +SR  +K          T F YENV+ IP+ 
Sbjct  70    IEAFNNGDNNESYKLGINQFADLTNEEFVASRNKFKGHMCSSIIRTTTFKYENVSAIPST  129

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLG  644
             +DW KKGAVTPVKNQ QCGCCWAFSAVAA EGI ++  G L SLSEQ+L+DCD   +  G
Sbjct  130   VDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQG  189

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C GG +   F +++ N G+ TE+ YPY    G C  +KA+     I G++ VP   E  L
Sbjct  190   CEGGLMDDAFKFIIQNHGLNTEAQYPYQGVDGTCNANKASIQATTITGYEDVPANNEQAL  249

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKN  1001
              KAVANQP+S AIDASG  FQFYK G++    C T ++H +T VGYG S DG K+WL+KN
Sbjct  250   QKAVANQPISVAIDASGSDFQFYKSGVF-TGSCGTELDHGVTAVGYGVSNDGTKYWLVKN  308

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE GY+ + +    A+G CGIA + S+P A
Sbjct  309   SWGTDWGEEGYIMMQRGVEAAEGLCGIAMQASYPTA  344



>ref|XP_010052197.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76117.1| hypothetical protein EUGRSUZ_D00494 [Eucalyptus grandis]
Length=369

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 217/319 (68%), Gaps = 9/319 (3%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   ++ ++K++EQW+  +GRVY +  EK KR++IFK+NVN I++FN   +  + + +N+
Sbjct  52    RTLGEEHLLKQHEQWMAVHGRVYKDADEKAKRYEIFKQNVNRINAFNNDKDAAYKLAVNK  111

Query  357   FADLTNDEFKSSRMGYKNPPY-----YENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQ  521
             FADLTN+EF++S  GYK          +  PF Y N T  P  +DW  K AVT VK+Q  
Sbjct  112   FADLTNEEFRASFTGYKRRSTRVLSSVDEKPFKYANFTAAPPVLDWRTKKAVTSVKDQSS  171

Query  522   CGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNG  695
             CG CWAFSAVAA+EGI  ++ G L SLSEQ+L+DCD+  ++ GC GG + + F ++   G
Sbjct  172   CGACWAFSAVAAMEGITMLKKGKLVSLSEQELVDCDVNGVNEGCEGGLMDSAFQFIKSKG  231

Query  696   GITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASG  875
             G+T+E+NYPY    G C+ +KAA I A I G+Q VP   E  L++AVANQPVS AI+ SG
Sbjct  232   GLTSEANYPYQGNDGTCRTAKAANIVASITGYQDVPANNEKALLQAVANQPVSVAIEGSG  291

Query  876   MAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNSWGEGWGENGYLKLIKD  1052
              +FQFY GG++    C T+++HA+T VGYG  S G K+WL+KNSWG GWGE+GY+++ +D
Sbjct  292   FSFQFYSGGVF-TGSCGTSLDHAVTAVGYGTTSGGAKYWLLKNSWGTGWGESGYMRIRRD  350

Query  1053  SGDAKGACGIATKPSFPVA  1109
                  G CG+A +PS+P A
Sbjct  351   VTSKAGLCGLAMEPSYPTA  369



>gb|EMS56453.1| KDEL-tailed cysteine endopeptidase CEP1 [Triticum urartu]
Length=339

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/341 (49%), Positives = 222/341 (65%), Gaps = 12/341 (4%)
 Frame = +3

Query  111   IVFAAIILVLE-IWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFK  287
             I  A+++ +L  +  C  A     L+ D  MV R+E W+ EYGRVY +  EK +RF+IF+
Sbjct  3     ITRASLLAILGCLCFCSSALGARELNGDLSMVARHEGWMTEYGRVYKDAAEKAQRFEIFQ  62

Query  288   ENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--  455
              N  FI+SFN AGN  F + IN+FADL+NDEF++++      P     P  F YEN++  
Sbjct  63    ANARFIESFN-AGNSKFWLSINQFADLSNDEFRATKTNKGFIPNKVKVPTEFRYENMSFD  121

Query  456   EIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII  635
              +PA +DW  KGA+TP+KNQ QCGCCWAFSAVAA EGI ++  G L SLSEQ+L+DCD+ 
Sbjct  122   ALPAMVDWRTKGAITPIKNQGQCGCCWAFSAVAATEGIVKLSTGNLVSLSEQELVDCDVH  181

Query  636   --SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRF  809
                 GC GG +   F +++ NGG+T ES+YPYA     C+    +   A IKG++ VP  
Sbjct  182   GEDQGCEGGLMDDAFKFIIKNGGLTKESSYPYAGADDKCK--SGSNSVATIKGYEDVPTN  239

Query  810   RESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKF  986
              E  LMKAVA+QPVS A+D   M FQFY GG+     C T ++H I  +GYG  SDG K+
Sbjct  240   DEGALMKAVASQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGTTSDGTKY  298

Query  987   WLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             WL+KNSWG  WGENGYL++ KD  D KG CG+A +PS+P A
Sbjct  299   WLLKNSWGTTWGENGYLRMEKDIADKKGMCGLAMEPSYPTA  339



>ref|XP_009608954.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=349

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/351 (46%), Positives = 228/351 (65%), Gaps = 11/351 (3%)
 Frame = +3

Query  84    MGSRKYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEK  263
             M     +  +  A   + L +W+   A +R  ++ +  M  R++QWIV + +VY +  EK
Sbjct  1     MAFANLSQYLCLALFFIFLGLWSSQVALSR-PINYEATMRARHDQWIVHHEKVYKDLNEK  59

Query  264   VKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK--NPPYYEN---  428
               RF IFKENV  I++FN   ++ + +G N+F+DLTN+EF+    GYK  +P    +   
Sbjct  60    EVRFQIFKENVERIEAFNAGEDKGYKLGFNKFSDLTNEEFRVLHTGYKRSHPKVMTSSKG  119

Query  429   -TPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLS  605
              T F Y NVT+IP  MDW KKGAVTP+K+QK+CGCCWAFSAVAA+EG+ Q++ G L  LS
Sbjct  120   KTHFRYTNVTDIPPTMDWRKKGAVTPIKDQKECGCCWAFSAVAAMEGLHQLKTGELIPLS  179

Query  606   EQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAK  779
             EQ+L+DCD+     GC GG +   F ++L N G+TTE NYPY  + G C + K+A   AK
Sbjct  180   EQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEVNYPYKGEDGVCNKKKSALSAAK  239

Query  780   IKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVG  959
             I G++ VP   E  L++AVANQPVS AID S   FQFY  G++    C+T +NHA+T VG
Sbjct  240   ITGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFS-GSCSTWLNHAVTAVG  298

Query  960   YG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             YG  +DG K+W+IKNSWG  WG++GY+++ +D  + +G CG+A   S+P A
Sbjct  299   YGATTDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCGLAMDASYPTA  349



>gb|ADP02218.1| Peptidase_C1 domain-containing protein [Triticum aestivum]
 gb|EMT08021.1| Vignain [Aegilops tauschii]
Length=341

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 219/334 (66%), Gaps = 9/334 (3%)
 Frame = +3

Query  126   IILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFI  305
             + +V  I  C  A    R   D  MV+R+EQW+ ++ RVY + TEK +RF++FK NV FI
Sbjct  9     LAIVGCICLCSSAVLSARELGDTAMVERHEQWMAKFNRVYKDGTEKAQRFEVFKANVAFI  68

Query  306   DSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIPADM  473
             +SFN A N  F +G+N+F DLTNDEF++++   G K       T F Y NV+   +P  +
Sbjct  69    ESFN-AENRKFWLGVNQFTDLTNDEFRATKTNKGLKMSGGRAPTGFKYSNVSIDALPTAV  127

Query  474   DWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGC  647
             DW  KG VTP+K+Q QCGCCWAFSAV A EGI ++  G L SLSEQ+L+DCD+  +  GC
Sbjct  128   DWRTKGVVTPIKDQGQCGCCWAFSAVVATEGIVKLSTGKLISLSEQELVDCDVHGVDQGC  187

Query  648   HGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELM  827
              GG +   F +++ NGG+TTE+NYPY  + G C+ S A+   A IKG++ VP   ES LM
Sbjct  188   EGGEMDDAFKFIIKNGGLTTEANYPYTAQDGQCKTSIASNSVATIKGYEDVPANDESSLM  247

Query  828   KAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYG-ESDGRKFWLIKNS  1004
             KAVANQPVS A+D   + FQ Y GG+     C T ++H I  +GYG  SDG K+WL+KNS
Sbjct  248   KAVANQPVSVAVDGGDVIFQHYSGGVM-TGSCGTDLDHGIAAIGYGMTSDGTKYWLLKNS  306

Query  1005  WGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             WG  WGE+GYL++ KD  D  G CG+A +PS+P 
Sbjct  307   WGTTWGESGYLRMEKDISDKSGMCGLAMQPSYPT  340



>ref|XP_002436840.1| hypothetical protein SORBIDRAFT_10g009830 [Sorghum bicolor]
 gb|EER88207.1| hypothetical protein SORBIDRAFT_10g009830 [Sorghum bicolor]
Length=328

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/337 (49%), Positives = 222/337 (66%), Gaps = 23/337 (7%)
 Frame = +3

Query  120   AAIILVLEI-WACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A+I+ +L + + C  A A   L+DD  MV R+EQW+V+Y RVY + TEK +RF++FK NV
Sbjct  6     ASILAILGLAFFCGAALAARDLNDDSAMVARHEQWMVQYSRVYKDTTEKARRFEVFKANV  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRM--GYKNPPYYENTPFMYENVT--EIP  464
              FI+SFN  GN  F +G+N+FADLTNDEF++++   G+K  P    T F YENV+   +P
Sbjct  66    KFIESFNAGGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPVKVPTGFRYENVSVDALP  125

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A +DW  KGAVTP+K+Q QC            EGI +I  G L SLSEQ+L+DCD+    
Sbjct  126   ATIDWRTKGAVTPIKDQGQC------------EGIVKISTGKLISLSEQELVDCDVHGED  173

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTES+YPY    G C+    +   A +KGF+ VP   E+
Sbjct  174   QGCEGGLMDDAFQFIIKNGGLTTESSYPYTAADGKCK--SGSNSAATVKGFEDVPANDEA  231

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFY GG+     C T ++H I  +GYG+ SDG K+WL+
Sbjct  232   ALMKAVANQPVSVAVDGGDMTFQFYSGGVM-TGSCGTDLDHGIAAIGYGQTSDGTKYWLL  290

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPV  1106
             KNSWG  WGENGYL++ KD  D +G CG+A +PS+P+
Sbjct  291   KNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPI  327



>ref|XP_006582265.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=342

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 206/310 (66%), Gaps = 7/310 (2%)
 Frame = +3

Query  198   MVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTND  377
             + +R+E W+ EYG++Y +  EK KRF IFK+NV FI+SFN AGN+ + +G+N  ADLT +
Sbjct  34    LRERHENWMAEYGKIYKDAAEKEKRFQIFKDNVEFIESFNAAGNKPYKLGVNHLADLTLE  93

Query  378   EFKSSRMGYKNPPYYENTPFM-----YENVTEIPADMDWVKKGAVTPVKNQ-KQCGCCWA  539
             EFK SR G K    +  T F      YENVT+IP  +DW  KGAVTP+K+Q  QCG CWA
Sbjct  94    EFKDSRNGLKRTYEFSTTTFKLNGFKYENVTDIPEAIDWRVKGAVTPIKDQGDQCGSCWA  153

Query  540   FSAVAAIEGIKQIRAGILSSLSEQQLLDCDIISLGCHGGWIGAGFLYVLFNGGITTESNY  719
             FS +AA EGI QI  G L SLSEQ+L+DCD +  GC GG++  GF +++ NGGIT+E+NY
Sbjct  154   FSTIAATEGIHQISTGNLVSLSEQELVDCDSVDDGCEGGFMEDGFEFIIKNGGITSETNY  213

Query  720   PYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKG  899
             PY    G C  + AA   A+IKG++ VP + E  L KAVANQPVS +I A+   F FY  
Sbjct  214   PYKGVDGTCNTTIAASPVAQIKGYEIVPSYSEEALQKAVANQPVSVSIHATNATFMFYSS  273

Query  900   GIYGKDKCTTTVNHAITVVGYGESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACG  1079
             GIY   +C T ++H +T VGYG  +G  +W++KNSWG  WGE GY+++ +      G CG
Sbjct  274   GIY-NGECGTDLDHGVTAVGYGTENGTDYWIVKNSWGTQWGEKGYIRMHRGIAAKHGICG  332

Query  1080  IATKPSFPVA  1109
             IA   S+P A
Sbjct  333   IALDSSYPTA  342



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 211/317 (67%), Gaps = 7/317 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   D  M +R+EQW+  YG+VY +  E+ KRF IFKENVN+I++FN A N+ + + IN+
Sbjct  28    RSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQ  87

Query  357   FADLTNDEFKSSR---MGYKNPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCG  527
             FADLTN+EF + R    G+        T F YENVT +P+ +DW +KGAVTP+K+Q QCG
Sbjct  88    FADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCG  147

Query  528   CCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGI  701
             CCWAFSAVAA EGI  + +G L SLSEQ+L+DCD   +  GC GG +   F +V+ N G+
Sbjct  148   CCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGL  207

Query  702   TTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMA  881
              TE+NYPY    G C  ++AA     I G++ VP   E  L KAVANQPVS AIDASG  
Sbjct  208   NTEANYPYKGVDGKCNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAIDASGSD  267

Query  882   FQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSG  1058
             FQFYK G++    C T ++H +T VGYG S DG ++WL+KNSWG  WGE GY+++ +   
Sbjct  268   FQFYKSGVF-TGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVD  326

Query  1059  DAKGACGIATKPSFPVA  1109
               +G CGIA + S+P A
Sbjct  327   SEEGLCGIAMQASYPTA  343



>gb|ADV41672.1| cysteine protease [Nicotiana tabacum]
Length=349

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/351 (46%), Positives = 228/351 (65%), Gaps = 11/351 (3%)
 Frame = +3

Query  84    MGSRKYTHLIVFAAIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEK  263
             M     +  +  A   + L +W    A++R  ++ +  M  R++QWI  + +VY +  EK
Sbjct  1     MAFANLSQYLCLALFFIFLGVWRSQVASSR-PINYEASMRARHDQWIAHHDKVYKDLNEK  59

Query  264   VKRFDIFKENVNFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYK--NPPYYEN---  428
               RF IFKENV  I++FN   ++ + +G+N+F+DLTN++F+    GYK  +P    +   
Sbjct  60    EMRFKIFKENVERIEAFNAGEDKGYKLGVNKFSDLTNEKFRVLHTGYKRSHPKVMSSSKP  119

Query  429   -TPFMYENVTEIPADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLS  605
              T F Y NVT+IP  MDW KKGAVTP+K+QK+CGCCWAFSAVAA EG+ Q++ G L  LS
Sbjct  120   KTHFRYANVTDIPPTMDWRKKGAVTPIKDQKECGCCWAFSAVAATEGLHQLKTGKLIPLS  179

Query  606   EQQLLDCDII--SLGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAK  779
             EQ+L+DCD+     GC GG +   F ++L N G+TTE+NYPY  + G C + K+A   AK
Sbjct  180   EQELVDCDVEGEDEGCSGGLLDTAFDFILKNKGLTTEANYPYKGEDGVCNKKKSALSAAK  239

Query  780   IKGFQWVPRFRESELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVG  959
             I G++ VP   E  L++AVANQPVS AID S   FQFY  G++    C+T +NHA+T VG
Sbjct  240   IAGYEDVPANSEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFS-GSCSTWLNHAVTAVG  298

Query  960   YG-ESDGRKFWLIKNSWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             YG  +DG K+W+IKNSWG  WG++GY+++ +D  + +G CG+A   S+P A
Sbjct  299   YGATTDGTKYWIIKNSWGSKWGDSGYMRIKRDVHEKEGLCGLAMDASYPTA  349



>emb|CAL64936.1| putative cysteine protease 8 [Trifolium pratense]
Length=344

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 224/336 (67%), Gaps = 11/336 (3%)
 Frame = +3

Query  123   AIILVLEIWACCEATARWRLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNF  302
             A++  L ++A  + T+R     DD M +R+ QW+ +YG++Y +  E+  RF IFKENVN+
Sbjct  13    ALLFCLGLFAI-QVTSRTL--QDDSMYERHGQWMSQYGKIYKDHQERETRFKIFKENVNY  69

Query  303   IDSFNQAGN-ETFTVGINEFADLTNDEFKSSRMGYKN---PPYYENTPFMYENVTEIPAD  470
             I++FN A + +++ +GIN+FADLTN+EF +SR  +K          T F YENV+ IP+ 
Sbjct  70    IETFNNADDTKSYKLGINQFADLTNEEFIASRNKFKGHMCSSIMRTTSFKYENVSGIPST  129

Query  471   MDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLG  644
             +DW KKGAVTPVKNQ QCGCCWAFSAVAA EGI ++  G L SLSEQ+L+DCD   +  G
Sbjct  130   VDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQG  189

Query  645   CHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESEL  824
             C GG +   F +++ N G++TE+ YPY    G C  +KA+     I G++ VP   E  L
Sbjct  190   CEGGLMDDAFKFIIQNHGLSTEAQYPYEGVDGTCNANKASVQAVTITGYEDVPANSEQAL  249

Query  825   MKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKN  1001
              KAVANQP+S AIDASG  FQFYK G++    C T ++H +T VGYG S DG K+WL+KN
Sbjct  250   QKAVANQPISVAIDASGSDFQFYKSGVF-TGACGTELDHGVTAVGYGVSNDGTKYWLVKN  308

Query  1002  SWGEGWGENGYLKLIKDSGDAKGACGIATKPSFPVA  1109
             SWG  WGE GY+ + +    A+G CGIA + S+P A
Sbjct  309   SWGTDWGEEGYIMMQRGIEAAEGICGIAMQASYPTA  344



>gb|EEC84514.1| hypothetical protein OsI_31214 [Oryza sativa Indica Group]
Length=348

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 218/332 (66%), Gaps = 12/332 (4%)
 Frame = +3

Query  120   AAIILVLEIWACCEATARWR-LDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENV  296
             A +  +L     C A    R L DD  M  R+E+W+ +YGR+Y ++ EK +RF++FK N 
Sbjct  6     ALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANA  65

Query  297   NFIDSFNQAGNETFTVGINEFADLTNDEFKSSRMGYKNPPYYENTP--FMYENVT--EIP  464
              FI+SFN AGN  F +G+N+FADLTNDEF+ ++      P     P  F YENV    +P
Sbjct  66    AFIESFN-AGNHKFWLGVNQFADLTNDEFRLTKTNKGFIPSTTRVPTGFRYENVNIDALP  124

Query  465   ADMDWVKKGAVTPVKNQKQCGCCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDII--S  638
             A MDW  KG VTP+K+Q QCGCCWAFSAVAA+EGI ++  G L SLSEQ+L+DCD+    
Sbjct  125   ATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGED  184

Query  639   LGCHGGWIGAGFLYVLFNGGITTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRES  818
              GC GG +   F +++ NGG+TTESNYPYA     C+    +   A IKG++ VP   E+
Sbjct  185   QGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKCK--SVSNSVASIKGYEDVPANNEA  242

Query  819   ELMKAVANQPVSAAIDASGMAFQFYKGGIYGKDKCTTTVNHAITVVGYGE-SDGRKFWLI  995
              LMKAVANQPVS A+D   M FQFYKGG+     C T ++H I  +GYG+ SDG K+WL+
Sbjct  243   ALMKAVANQPVSVAVDGDDMTFQFYKGGVM-IGSCGTDLDHGIVAIGYGKASDGTKYWLL  301

Query  996   KNSWGEGWGENGYLKLIKDSGDAKGACGIATK  1091
             KNSWG  WGENG+L++ KD  D +G CG+A +
Sbjct  302   KNSWGMTWGENGFLRMEKDISDKRGMCGLAME  333



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 211/317 (67%), Gaps = 7/317 (2%)
 Frame = +3

Query  177   RLDDDDEMVKRYEQWIVEYGRVYANETEKVKRFDIFKENVNFIDSFNQAGNETFTVGINE  356
             R   D  M +R+EQW+  YG+VY +  E+ KRF IFKENVN+I++FN A N+ + + IN+
Sbjct  11    RSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQ  70

Query  357   FADLTNDEFKSSR---MGYKNPPYYENTPFMYENVTEIPADMDWVKKGAVTPVKNQKQCG  527
             FADLTN+EF + R    G+        T F YENVT +P+ +DW +KGAVTP+K+Q QCG
Sbjct  71    FADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCG  130

Query  528   CCWAFSAVAAIEGIKQIRAGILSSLSEQQLLDCDI--ISLGCHGGWIGAGFLYVLFNGGI  701
             CCWAFSAVAA EGI  + +G L SLSEQ+L+DCD   +  GC GG +   F +V+ N G+
Sbjct  131   CCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGL  190

Query  702   TTESNYPYAMKKGFCQRSKAAQIEAKIKGFQWVPRFRESELMKAVANQPVSAAIDASGMA  881
              TE+NYPY    G C  ++AA     I G++ VP   E  L KAVANQPVS AIDASG  
Sbjct  191   NTEANYPYKGVDGKCNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAIDASGSD  250

Query  882   FQFYKGGIYGKDKCTTTVNHAITVVGYGES-DGRKFWLIKNSWGEGWGENGYLKLIKDSG  1058
             FQFYK G++    C T ++H +T VGYG S DG ++WL+KNSWG  WGE GY+++ +   
Sbjct  251   FQFYKSGVF-TGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIRMQRGVD  309

Query  1059  DAKGACGIATKPSFPVA  1109
               +G CGIA + S+P A
Sbjct  310   SEEGLCGIAMQASYPTA  326



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3524261125780