BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79509_g1_i1 len=600 path=[578:0-599]

Length=600
                                                                      Score     E

ref|XP_010317560.1|  PREDICTED: proteinase inhibitor type-2 P303....  55.1    3e-06   
gb|ABA42905.1|  trypsin proteinase inhibitor precursor                52.8    8e-06   Nicotiana corymbosa
gb|AFN85539.1|  proteinase inhibitor type-2                           50.8    2e-05   
gb|ADP05506.1|  serine proteinase inhibitor 2c-R2                     51.6    3e-05   
ref|XP_009787056.1|  PREDICTED: proteinase inhibitor PSI-1.2-like     50.4    3e-05   
gb|ABA42904.1|  trypsin proteinase inhibitor precursor                51.6    1e-04   Nicotiana acuminata
ref|XP_006351573.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  50.1    2e-04   
ref|XP_006362682.1|  PREDICTED: proteinase inhibitor type-2 CEVI5...  50.4    3e-04   
gb|AIT75805.1|  Pin-II type proteinase inhibitor 69                   49.3    3e-04   
gb|AAF18451.1|AF205852_1  proteinase inhibitor type II precursor ...  50.1    3e-04   Nicotiana glutinosa
gb|AIT75808.1|  Pin-II type proteinase inhibitor 71                   48.9    3e-04   
gb|AIT75816.1|  Pin-II type proteinase inhibitor 70                   49.3    4e-04   
gb|AIT75806.1|  Pin-II type proteinase inhibitor 79                   49.3    4e-04   
gb|ABP96802.1|  proteinase inhibitor II                               50.1    4e-04   Nicotiana tabacum [American tobacco]
gb|AAF18450.1|AF205851_1  proteinase inhibitor type II precursor ...  50.1    4e-04   Nicotiana glutinosa
gb|ABA42891.1|  trypsin proteinase inhibitor precursor                48.1    5e-04   Nicotiana cavicola
gb|AAF14181.1|AF105340_1  proteinase inhibitor precursor              49.3    5e-04   Nicotiana alata [Indian tobacco]
ref|XP_009792960.1|  PREDICTED: uncharacterized protein LOC104239916  49.7    5e-04   
gb|AAA17739.1|  proteinase inhibitor precursor                        49.3    8e-04   Nicotiana alata [Indian tobacco]
gb|ABA42906.1|  trypsin proteinase inhibitor precursor                49.3    8e-04   Nicotiana rustica [wild tobacco]



>ref|XP_010317560.1| PREDICTED: proteinase inhibitor type-2 P303.51-like [Solanum 
lycopersicum]
Length=206

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = +1

Query  154  QVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICKDE-QSF  330
            + KACT+ECDPR  ++ICP    A ++ Q+C NCCTA   GC LY + G  IC  E QS+
Sbjct  145  EPKACTMECDPRVAYMICPSSGLA-KLSQVCVNCCTA-GDGCKLYGYDGSLICTGEPQSY  202

Query  331  FN  336
             +
Sbjct  203  IS  204



>gb|ABA42905.1| trypsin proteinase inhibitor precursor [Nicotiana corymbosa]
Length=147

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 5/91 (5%)
 Frame = +1

Query  64   MATSKFGFVTLLLLCSIVFVHGCEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQL  243
            MA  +  F+  LLL  +  +    V+HA+   KAC   CDPR  + +CPR S+  +  Q+
Sbjct  1    MAVHRVSFLAFLLLFGMSLLVN-NVEHAD--AKACPFNCDPRIAYGVCPR-SEEKKNNQI  56

Query  244  CENCCTAQSRGCMLYNFFGYPICKDEQSFFN  336
            C NCC A ++GC  ++  G  +CK E    N
Sbjct  57   CTNCC-AGTKGCNYFSADGTFVCKGESDPRN  86



>gb|AFN85539.1| proteinase inhibitor type-2, partial [Olea europaea]
Length=78

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = +1

Query  73   SKFGFVTLLLLCSIVFVHGCEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQLCEN  252
            SK G  TLLL+C + F+ G  V +A  + K CT EC     ++ICP  S   ++   C N
Sbjct  2    SKVGIFTLLLICGLFFL-GSNVNYAEAETKICTKEC-LNVGYMICP-SSGPQKLHPSCTN  58

Query  253  CCTAQSRGCMLYNFFGYPIC  312
            CC AQ +GC LY   G  IC
Sbjct  59   CCRAQ-KGCKLYRSDGTLIC  77



>gb|ADP05506.1| serine proteinase inhibitor 2c-R2 [Solanum nigrum]
Length=155

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +1

Query  109  SIVFVHGCEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLY  288
            +++ + G  V  +N   K CT ECD R  + ICP  S+  +I Q+C NCC A  +GCM +
Sbjct  7    ALLLLFGMIVLGSNADGKPCTRECDTRIAYGICPL-SETKRINQICTNCC-AGKKGCMYF  64

Query  289  NFFGYPICKDEQSFFNKI  342
            +  G  IC+ E  + +++
Sbjct  65   SNDGTFICEGESEYVSEV  82



>ref|XP_009787056.1| PREDICTED: proteinase inhibitor PSI-1.2-like [Nicotiana sylvestris]
Length=90

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 48/83 (58%), Gaps = 6/83 (7%)
 Frame = +1

Query  64   MATSKFGFVTLLLLCSIVFVHGCEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQL  243
            MA  +  F+ +LLL   + + G +VK A+G  KACT  CDP   +++CP  S   +I + 
Sbjct  11   MAIHRVAFLAILLLSGAILL-GNKVKCADG--KACTRNCDPDVAYMVCP--STRQKITKP  65

Query  244  CENCCTAQSRGCMLYNFFGYPIC  312
            C NCC+A+ +GC L+   G   C
Sbjct  66   CVNCCSAR-KGCKLFRSNGSVKC  87



>gb|ABA42904.1| trypsin proteinase inhibitor precursor [Nicotiana acuminata]
Length=432

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = +1

Query  64   MATSKFGFVTLLLLCSIVFVHGCEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQL  243
            MA  +  F+  LLL     +    V+HA+   KAC   CDPR  + +CPR S+  +  Q+
Sbjct  1    MAVHRVSFLAFLLLFGTSLLVS-NVEHAD--AKACPFNCDPRIAYGVCPR-SEEKKNNQI  56

Query  244  CENCCTAQSRGCMLYNFFGYPICKDEQSFFN  336
            C NCC A ++GC  ++  G  +CK E    N
Sbjct  57   CTNCC-AGTKGCNYFSADGTFVCKGESDPRN  86



>ref|XP_006351573.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Solanum tuberosum]
Length=205

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (60%), Gaps = 3/62 (5%)
 Frame = +1

Query  154  QVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICKDE-QSF  330
            + KACTLECD R  ++ CP    A +I Q+C NCCTA   GC LY   G  IC  E QS+
Sbjct  144  EPKACTLECDSRVAYMTCPSSGLA-KIYQVCVNCCTA-GEGCKLYGHDGSLICTGEPQSY  201

Query  331  FN  336
             +
Sbjct  202  IS  203



>ref|XP_006362682.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Solanum tuberosum]
Length=386

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 3/62 (5%)
 Frame = +1

Query  154  QVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICKDE-QSF  330
            + KACTLECD R  ++ CP    A ++ Q+C NCCTA   GC LY + G  IC  E QS+
Sbjct  144  EPKACTLECDSRVAYMTCPSSGLA-KLNQVCVNCCTA-GEGCKLYGYDGSLICTGEPQSY  201

Query  331  FN  336
              
Sbjct  202  IT  203



>gb|AIT75805.1| Pin-II type proteinase inhibitor 69 [Capsicum annuum]
Length=199

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 2/57 (4%)
 Frame = +1

Query  154  QVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICKDEQ  324
            + KACTLECDPR  ++ CP    A +I  +C NCCTA   GC LY   G  +C  E 
Sbjct  139  EPKACTLECDPRVAYMTCPSTGLA-KIKDVCVNCCTA-GEGCKLYGHNGSLLCTGES  193



>gb|AAF18451.1|AF205852_1 proteinase inhibitor type II precursor NGPI-2 [Nicotiana glutinosa]
Length=390

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +1

Query  130  CEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPI  309
            CE +      KAC L CD R  + ICPR ++  +  Q+C NCC A ++GC  +N  G  I
Sbjct  308  CEGESDPRNPKACPLNCDGRIAYEICPR-TEEKKTNQICTNCC-AGTKGCNYFNANGTFI  365

Query  310  CKDEQSFFNKI  342
            C+ E  + NK+
Sbjct  366  CEGESEYVNKV  376



>gb|AIT75808.1| Pin-II type proteinase inhibitor 71, partial [Capsicum annuum]
Length=181

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 2/57 (4%)
 Frame = +1

Query  154  QVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICKDEQ  324
            + KACTLECDPR  ++ CP    A +I  +C NCCTA   GC LY   G  +C  E 
Sbjct  121  EPKACTLECDPRVAYMTCPSTGLA-KIKDVCVNCCTA-GEGCKLYGHNGSLLCTGES  175



>gb|AIT75816.1| Pin-II type proteinase inhibitor 70 [Capsicum annuum]
Length=199

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 2/57 (4%)
 Frame = +1

Query  154  QVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICKDEQ  324
            + KACTLECDPR  ++ CP    A +I  +C NCCTA   GC LY   G  +C  E 
Sbjct  139  EPKACTLECDPRVAYMTCPSTGLA-KIKDVCVNCCTA-GEGCKLYGHNGSLLCTGES  193



>gb|AIT75806.1| Pin-II type proteinase inhibitor 79 [Capsicum annuum]
Length=199

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 2/57 (4%)
 Frame = +1

Query  154  QVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICKDEQ  324
            + KACTLECDPR  ++ CP    A +I  +C NCCTA   GC LY   G  +C  E 
Sbjct  139  EPKACTLECDPRVAYMTCPSTGLA-KIKDVCVNCCTA-GEGCKLYGHNGSLLCTGES  193



>gb|ABP96802.1| proteinase inhibitor II [Nicotiana tabacum]
Length=396

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = +1

Query  64   MATSKFGFVTLLLLCSIVFVHGCEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQL  243
            MA  K  F+ L+LL  +  +    V+HA+   KAC   CDPR  + +CPR  +     Q+
Sbjct  1    MAVHKVSFLALVLLFGMSLLVS-NVEHAD--AKACPFNCDPRIAYGVCPRLEEDKN-NQI  56

Query  244  CENCCTAQSRGCMLYNFFGYPICKDEQSFFN  336
            C NCC A ++GC  ++  G  ICK +    N
Sbjct  57   CTNCC-AGTKGCNYFSADGTFICKGQSDPRN  86



>gb|AAF18450.1|AF205851_1 proteinase inhibitor type II precursor NGPI-1 [Nicotiana glutinosa]
Length=506

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +1

Query  130  CEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPI  309
            CE +      KAC L CD R  + ICPR ++  +  Q+C NCC A ++GC  +N  G  I
Sbjct  426  CEGESDPRNPKACPLNCDGRIAYEICPR-TEEKKTNQICTNCC-AGTKGCNYFNANGTFI  483

Query  310  CKDEQSFFNKI  342
            C+ E  + NK+
Sbjct  484  CEGESEYVNKV  494



>gb|ABA42891.1| trypsin proteinase inhibitor precursor [Nicotiana cavicola]
Length=163

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +1

Query  130  CEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPI  309
            CE +      K CT ECDPR  + ICPR S+  +  +LC NCC A  +GC  ++  G  I
Sbjct  76   CEGESDPRNPKGCTFECDPRIAYGICPR-SEEKKNNRLCTNCC-AGKKGCNYFSSNGTFI  133

Query  310  CKDEQSFFNK  339
            C+ E  + +K
Sbjct  134  CEGESEYASK  143



>gb|AAF14181.1|AF105340_1 proteinase inhibitor precursor [Nicotiana alata]
Length=281

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 8/95 (8%)
 Frame = +1

Query  136  VKHANGQVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICK  315
            V+HA+   KACTL CDPR  + +CPR S+  +  ++C NCC A ++GC  ++  G  +C+
Sbjct  24   VEHAD--AKACTLNCDPRIAYGVCPR-SEEKKNDRICTNCC-AGTKGCKYFSDDGTFVCE  79

Query  316  DEQSFFNKIRLWFN*LDP---VGPCMHAANEKMTR  411
             E    N      N  DP    G C  +  +K  R
Sbjct  80   GESDPRNPKACTLN-CDPRIAYGVCPRSEEKKNDR  113



>ref|XP_009792960.1| PREDICTED: uncharacterized protein LOC104239916 [Nicotiana sylvestris]
Length=434

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = +1

Query  64   MATSKFGFVTLLLLCSIVFVHGCEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQL  243
            MA  +  F+  LLL  +  +    V+HA+   KAC+  CDPR  + +CPR S+  +  Q+
Sbjct  1    MAVHRVNFLAFLLLFGMSLLVN-NVEHAD--AKACSFNCDPRIAYGVCPR-SEEKKNNQI  56

Query  244  CENCCTAQSRGCMLYNFFGYPICK  315
            C NCC A ++GC  ++  G  +C+
Sbjct  57   CTNCC-AGTKGCNYFSADGTFVCE  79



>gb|AAA17739.1| proteinase inhibitor precursor [Nicotiana alata]
Length=397

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 8/95 (8%)
 Frame = +1

Query  136  VKHANGQVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICK  315
            V+HA+   KACTL CDPR  + +CPR S+  +  ++C NCC A ++GC  ++  G  +C+
Sbjct  24   VEHAD--AKACTLNCDPRIAYGVCPR-SEEKKNDRICTNCC-AGTKGCKYFSDDGTFVCE  79

Query  316  DEQSFFNKIRLWFN*LDP---VGPCMHAANEKMTR  411
             E    N      N  DP    G C  +  +K  R
Sbjct  80   GESDPRNPKACTLN-CDPRIAYGVCPRSEEKKNDR  113



>gb|ABA42906.1| trypsin proteinase inhibitor precursor [Nicotiana rustica]
Length=448

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  130  CEVKHANGQVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPI  309
            CE +      KACTL CDPR  + +CPR S+  +  Q+C NCC A ++GC  ++  G  +
Sbjct  136  CEGESDPRNPKACTLNCDPRIAYGVCPR-SEEKKNNQICTNCC-AGTKGCNYFSADGTFV  193

Query  310  CKDEQSFFN  336
            CK E    N
Sbjct  194  CKGESDPRN  202


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 4/67 (6%)
 Frame = +1

Query  136  VKHANGQVKACTLECDPRAKFIICPRESKAMQIGQLCENCCTAQSRGCMLYNFFGYPICK  315
            V+HA+   KACTL CDPR  + +CPR S+  +  Q+C NCC A ++GC  ++  G  +C+
Sbjct  24   VEHAD--AKACTLNCDPRIAYGVCPR-SEEKKNNQICTNCC-AGTKGCNYFSADGTFVCE  79

Query  316  DEQSFFN  336
             E    N
Sbjct  80   GESDPRN  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 742397556606