BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79505_g1_i1 len=849 path=[1:0-848]

Length=849
                                                                      Score     E

ref|XP_002315899.1|  hypothetical protein POPTR_0010s12630g             157   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_009596594.1|  PREDICTED: uncharacterized protein LOC104092649    151   4e-41   
ref|XP_011070665.1|  PREDICTED: uncharacterized protein LOC105156271    149   4e-40   
ref|XP_002311488.1|  hypothetical protein POPTR_0008s12610g             149   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011078202.1|  PREDICTED: uncharacterized protein LOC105161997    148   5e-40   
gb|EYU30039.1|  hypothetical protein MIMGU_mgv1a017671mg                145   4e-39   
ref|XP_007045058.1|  Uncharacterized protein TCM_010809                 145   1e-38   
gb|KDP34983.1|  hypothetical protein JCGZ_09271                         144   1e-38   
ref|XP_004237025.1|  PREDICTED: uncharacterized protein LOC101267223    144   2e-38   
ref|XP_002284010.1|  PREDICTED: uncharacterized protein LOC100262828    144   2e-38   Vitis vinifera
ref|XP_009758026.1|  PREDICTED: uncharacterized protein LOC104210762    144   2e-38   
emb|CDP00724.1|  unnamed protein product                                144   2e-38   
ref|XP_009780349.1|  PREDICTED: uncharacterized protein LOC104229402    142   8e-38   
ref|XP_011022986.1|  PREDICTED: uncharacterized protein LOC105124599    142   8e-38   
ref|XP_006360425.1|  PREDICTED: uncharacterized protein LOC102583797    142   8e-38   
ref|XP_011099502.1|  PREDICTED: uncharacterized protein LOC105177908    141   2e-37   
ref|XP_007143004.1|  hypothetical protein PHAVU_007G035500g             140   3e-37   
ref|XP_004496994.1|  PREDICTED: uncharacterized protein LOC101497518    140   4e-37   
gb|EYU44595.1|  hypothetical protein MIMGU_mgv1a026484mg                139   1e-36   
ref|XP_009589128.1|  PREDICTED: uncharacterized protein LOC104086543    139   1e-36   
ref|XP_002268613.1|  PREDICTED: uncharacterized protein LOC100258732    139   2e-36   Vitis vinifera
ref|XP_003592570.1|  hypothetical protein MTR_1g108640                  138   3e-36   
ref|XP_010253019.1|  PREDICTED: uncharacterized protein LOC104594432    138   3e-36   
ref|XP_010316076.1|  PREDICTED: uncharacterized protein LOC104645686    138   4e-36   
ref|XP_009610331.1|  PREDICTED: uncharacterized protein LOC104104049    137   9e-36   
ref|XP_006448311.1|  hypothetical protein CICLE_v10016694mg             137   1e-35   
ref|XP_003555937.1|  PREDICTED: uncharacterized protein LOC100792170    136   2e-35   
ref|XP_008467138.1|  PREDICTED: uncharacterized protein LOC103504565    134   8e-35   
ref|XP_004150859.1|  PREDICTED: uncharacterized protein LOC101213469    134   1e-34   
ref|XP_006357799.1|  PREDICTED: uncharacterized protein LOC102602533    134   1e-34   
ref|XP_010096754.1|  hypothetical protein L484_025872                   134   2e-34   
emb|CAN67693.1|  hypothetical protein VITISV_035607                     133   2e-34   Vitis vinifera
gb|KDO64746.1|  hypothetical protein CISIN_1g029256mg                   133   4e-34   
gb|KHN06733.1|  hypothetical protein glysoja_021279                     132   6e-34   
ref|XP_010243819.1|  PREDICTED: uncharacterized protein LOC104587793    132   7e-34   
ref|XP_010108920.1|  hypothetical protein L484_027115                   132   7e-34   
emb|CDP02732.1|  unnamed protein product                                132   8e-34   
ref|XP_006430689.1|  hypothetical protein CICLE_v10012926mg             130   2e-33   
ref|XP_009599422.1|  PREDICTED: uncharacterized protein LOC104095078    131   2e-33   
gb|ACU20604.1|  unknown                                                 130   2e-33   Glycine max [soybeans]
ref|XP_010274867.1|  PREDICTED: uncharacterized protein LOC104610092    131   2e-33   
ref|XP_009799837.1|  PREDICTED: uncharacterized protein LOC104245840    130   3e-33   
ref|XP_003536643.1|  PREDICTED: uncharacterized protein LOC100794402    130   3e-33   
ref|XP_006482180.1|  PREDICTED: uncharacterized protein LOC102618345    129   6e-33   
ref|XP_008229288.1|  PREDICTED: uncharacterized protein LOC103328658    131   1e-32   
ref|XP_007033135.1|  Uncharacterized protein TCM_019323                 129   1e-32   
ref|XP_007216061.1|  hypothetical protein PRUPE_ppa017741mg             129   2e-32   
ref|XP_004305524.1|  PREDICTED: uncharacterized protein LOC101304025    127   3e-32   
ref|XP_010046535.1|  PREDICTED: uncharacterized protein LOC104435497    127   6e-32   
ref|XP_003525687.1|  PREDICTED: uncharacterized protein LOC100783889    126   7e-32   
ref|XP_008243324.1|  PREDICTED: uncharacterized protein LOC103341559    126   1e-31   
ref|XP_011097152.1|  PREDICTED: uncharacterized protein LOC105176137    126   2e-31   
ref|XP_007225904.1|  hypothetical protein PRUPE_ppa011934mg             125   5e-31   
ref|XP_003555690.1|  PREDICTED: uncharacterized protein LOC100794800    124   5e-31   
ref|XP_008800930.1|  PREDICTED: uncharacterized protein LOC103715169    124   6e-31   
ref|XP_010062223.1|  PREDICTED: uncharacterized protein LOC104449684    124   6e-31   
ref|XP_003529256.1|  PREDICTED: uncharacterized protein LOC100790460    124   8e-31   
ref|XP_008360149.1|  PREDICTED: uncharacterized protein LOC103423846    123   2e-30   
ref|XP_010693577.1|  PREDICTED: uncharacterized protein LOC104906507    122   2e-30   
ref|XP_007150876.1|  hypothetical protein PHAVU_004G001600g             122   4e-30   
ref|XP_009418419.1|  PREDICTED: uncharacterized protein LOC103998624    122   4e-30   
gb|KDP33032.1|  hypothetical protein JCGZ_13063                         122   5e-30   
ref|XP_009341324.1|  PREDICTED: uncharacterized protein LOC103933362    122   6e-30   
ref|XP_011021323.1|  PREDICTED: uncharacterized protein LOC105123433    122   6e-30   
ref|XP_009587579.1|  PREDICTED: uncharacterized protein LOC104085282    122   7e-30   
ref|XP_009371843.1|  PREDICTED: uncharacterized protein LOC103961061    122   7e-30   
ref|XP_008787612.1|  PREDICTED: uncharacterized protein LOC103705608    121   9e-30   
ref|XP_008340272.1|  PREDICTED: uncharacterized protein LOC103403221    121   1e-29   
ref|XP_009358897.1|  PREDICTED: uncharacterized protein LOC103949506    119   5e-29   
ref|XP_008381292.1|  PREDICTED: uncharacterized protein LOC103444153    119   1e-28   
ref|XP_006383374.1|  hypothetical protein POPTR_0005s14980g             118   1e-28   
ref|XP_010317753.1|  PREDICTED: uncharacterized protein LOC104646198    117   2e-28   
emb|CDY50689.1|  BnaC05g47940D                                          117   2e-28   
ref|XP_009107504.1|  PREDICTED: uncharacterized protein LOC103833162    117   4e-28   
emb|CDY38422.1|  BnaA10g17360D                                          115   1e-27   
ref|XP_008343032.1|  PREDICTED: uncharacterized protein LOC103405798    116   1e-27   
ref|XP_002528053.1|  conserved hypothetical protein                     115   2e-27   Ricinus communis
emb|CDY43135.1|  BnaA05g32510D                                          114   5e-27   
ref|XP_009130353.1|  PREDICTED: uncharacterized protein LOC103855148    114   6e-27   
ref|XP_008460510.1|  PREDICTED: uncharacterized protein LOC103499309    112   4e-26   
emb|CDY16932.1|  BnaC09g40590D                                          111   5e-26   
ref|XP_006837231.1|  hypothetical protein AMTR_s00105p00148840          112   5e-26   
ref|XP_002528056.1|  conserved hypothetical protein                     111   6e-26   Ricinus communis
ref|XP_002882281.1|  hypothetical protein ARALYDRAFT_896322             110   7e-26   
ref|XP_009394648.1|  PREDICTED: uncharacterized protein LOC103980088    110   9e-26   
ref|XP_009126180.1|  PREDICTED: uncharacterized protein LOC103851103    110   2e-25   
emb|CDX85458.1|  BnaA02g03550D                                          109   3e-25   
ref|XP_004492243.1|  PREDICTED: uncharacterized protein LOC101495409    108   3e-25   
emb|CDY02708.1|  BnaC02g07270D                                          108   5e-25   
ref|XP_010924035.1|  PREDICTED: uncharacterized protein LOC105046976    108   5e-25   
gb|KGN51040.1|  hypothetical protein Csa_5G416270                       108   6e-25   
ref|XP_006408320.1|  hypothetical protein EUTSA_v10022137mg             108   8e-25   
gb|KFK25945.1|  hypothetical protein AALP_AA8G183300                    108   1e-24   
ref|XP_002305848.2|  hypothetical protein POPTR_0004s09290g             107   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006400272.1|  hypothetical protein EUTSA_v10014832mg             107   1e-24   
gb|KHN19699.1|  hypothetical protein glysoja_037201                     107   1e-24   
emb|CDX78745.1|  BnaA03g06570D                                          108   1e-24   
ref|XP_010485663.1|  PREDICTED: uncharacterized protein LOC104763952    106   3e-24   
emb|CDX70757.1|  BnaC03g08410D                                          107   3e-24   
ref|NP_186978.1|  uncharacterized protein                               105   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KHN42400.1|  hypothetical protein glysoja_020112                     105   4e-24   
emb|CDX70755.1|  BnaC03g08390D                                          107   4e-24   
ref|XP_009131593.1|  PREDICTED: uncharacterized protein LOC103856246    107   5e-24   
emb|CBI26932.3|  unnamed protein product                                110   5e-24   
ref|XP_003554835.2|  PREDICTED: uncharacterized protein LOC100786487    106   5e-24   
ref|XP_009131592.1|  PREDICTED: uncharacterized protein LOC103856244    106   8e-24   
ref|NP_197237.1|  uncharacterized protein                               103   6e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KEH39692.1|  DUF4228 domain protein                                  102   8e-23   
ref|XP_010508298.1|  PREDICTED: uncharacterized protein LOC104784866    102   1e-22   
ref|XP_006299661.1|  hypothetical protein CARUB_v10015849mg             101   2e-22   
gb|EYU34547.1|  hypothetical protein MIMGU_mgv1a020327mg                100   4e-22   
ref|XP_010463778.1|  PREDICTED: uncharacterized protein LOC104744418  99.4    1e-21   
gb|KHN44905.1|  hypothetical protein glysoja_042953                   96.3    4e-21   
gb|EPS62024.1|  hypothetical protein M569_12770                       94.0    1e-20   
ref|XP_002871762.1|  hypothetical protein ARALYDRAFT_488600           96.7    2e-20   
ref|XP_010453924.1|  PREDICTED: uncharacterized protein LOC104735773  96.3    2e-20   
ref|XP_010525033.1|  PREDICTED: uncharacterized protein LOC104802908  95.5    3e-20   
ref|XP_010492685.1|  PREDICTED: uncharacterized protein LOC104770035  95.9    3e-20   
ref|XP_006286576.1|  hypothetical protein CARUB_v10002057mg           95.5    5e-20   
ref|XP_010420449.1|  PREDICTED: uncharacterized protein LOC104706026  95.5    5e-20   
gb|EEC79660.1|  hypothetical protein OsI_20903                        92.8    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_003567003.1|  PREDICTED: uncharacterized protein LOC100835323  91.3    1e-18   
dbj|BAH01454.1|  unnamed protein product                              90.9    1e-18   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ91872.1|  predicted protein                                    91.3    2e-18   
dbj|BAJ88108.1|  predicted protein                                    89.7    7e-18   
dbj|BAJ90900.1|  predicted protein                                    89.7    8e-18   
ref|XP_010558673.1|  PREDICTED: uncharacterized protein LOC104827233  88.2    1e-17   
emb|CDM83898.1|  unnamed protein product                              86.7    5e-17   
gb|EPS59815.1|  hypothetical protein M569_14993                       82.8    1e-16   
ref|XP_010231055.1|  PREDICTED: uncharacterized protein LOC100845581  85.1    2e-16   
emb|CDM83897.1|  unnamed protein product                              84.3    2e-16   
gb|EMT33581.1|  hypothetical protein F775_21936                       83.6    4e-16   
dbj|BAD82524.1|  unknown protein                                      83.2    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043902.1|  Os01g0686000                                     84.0    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056259.1|  Os05g0552800                                     82.8    9e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010247001.1|  PREDICTED: uncharacterized protein LOC104590155  80.9    2e-15   
gb|EAZ13124.1|  hypothetical protein OsJ_03044                        81.6    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961301.1|  PREDICTED: uncharacterized protein LOC101771988  81.3    3e-15   
dbj|BAK05735.1|  predicted protein                                    81.3    3e-15   
ref|XP_010663707.1|  PREDICTED: uncharacterized protein LOC100257591  78.6    2e-14   
ref|XP_007036867.1|  Uncharacterized protein TCM_012897               77.4    5e-14   
gb|EYU41313.1|  hypothetical protein MIMGU_mgv1a019370mg              76.6    6e-14   
gb|ABK26794.1|  unknown                                               77.8    8e-14   Picea sitchensis
ref|XP_004301246.1|  PREDICTED: uncharacterized protein LOC101291835  77.0    9e-14   
ref|XP_004969575.1|  PREDICTED: angiomotin-like                       75.9    4e-13   
ref|XP_007160548.1|  hypothetical protein PHAVU_002G330900g           73.6    1e-12   
gb|EYU40372.1|  hypothetical protein MIMGU_mgv1a026017mg              73.2    2e-12   
ref|NP_001142659.1|  hypothetical protein                             73.9    2e-12   Zea mays [maize]
ref|XP_010045684.1|  PREDICTED: uncharacterized protein LOC104434463  72.8    2e-12   
ref|XP_011039166.1|  PREDICTED: uncharacterized protein LOC105135810  72.8    2e-12   
ref|XP_004969573.1|  PREDICTED: uncharacterized protein LOC101758952  73.2    3e-12   
ref|XP_002456164.1|  hypothetical protein SORBIDRAFT_03g031490        74.3    3e-12   Sorghum bicolor [broomcorn]
ref|XP_010034171.1|  PREDICTED: uncharacterized protein LOC104423366  72.4    3e-12   
emb|CBI15598.3|  unnamed protein product                              72.0    5e-12   
gb|ABK25935.1|  unknown                                               72.4    6e-12   Picea sitchensis
ref|XP_002317865.1|  hypothetical protein POPTR_0012s04290g           71.2    8e-12   Populus trichocarpa [western balsam poplar]
emb|CDO98332.1|  unnamed protein product                              70.9    1e-11   
gb|AFG55392.1|  hypothetical protein 0_9306_01                        70.1    1e-11   
gb|AFG55379.1|  hypothetical protein 0_9306_01                        70.1    1e-11   
gb|AEW07701.1|  hypothetical protein 0_9306_01                        70.1    1e-11   
gb|AFG55383.1|  hypothetical protein 0_9306_01                        70.1    1e-11   
ref|XP_011035591.1|  PREDICTED: uncharacterized protein LOC105133339  70.5    2e-11   
ref|XP_011084092.1|  PREDICTED: uncharacterized protein LOC105166437  69.7    4e-11   
ref|XP_010253032.1|  PREDICTED: uncharacterized protein LOC104594455  68.2    8e-11   
gb|ABK24016.1|  unknown                                               68.9    9e-11   Picea sitchensis
ref|NP_001145429.1|  uncharacterized protein LOC100278798             68.6    1e-10   Zea mays [maize]
gb|AFW81018.1|  hypothetical protein ZEAMMB73_853883                  68.2    1e-10   
ref|XP_002530795.1|  conserved hypothetical protein                   67.8    1e-10   Ricinus communis
gb|ABK23724.1|  unknown                                               68.6    2e-10   Picea sitchensis
ref|XP_002322115.2|  hypothetical protein POPTR_0015s04770g           67.8    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006855288.1|  hypothetical protein AMTR_s00057p00042010        67.4    2e-10   
ref|XP_002275699.1|  PREDICTED: uncharacterized protein LOC100253802  66.2    5e-10   Vitis vinifera
ref|XP_010688542.1|  PREDICTED: uncharacterized protein LOC104902448  65.9    7e-10   
ref|NP_001144445.1|  uncharacterized protein LOC100277407             64.7    2e-09   Zea mays [maize]
gb|ABK21767.1|  unknown                                               64.3    3e-09   Picea sitchensis
gb|KDP25973.1|  hypothetical protein JCGZ_22703                       63.9    3e-09   
ref|XP_004503263.1|  PREDICTED: uncharacterized protein LOC101493228  63.5    5e-09   
ref|XP_010243767.1|  PREDICTED: uncharacterized protein LOC104587745  63.5    5e-09   
ref|XP_010921515.1|  PREDICTED: uncharacterized protein LOC105045054  63.9    6e-09   
ref|NP_001241321.1|  uncharacterized protein LOC100792772             63.2    7e-09   
ref|XP_010259338.1|  PREDICTED: uncharacterized protein LOC104598806  63.5    8e-09   
ref|XP_003631129.1|  hypothetical protein MTR_8g107420                62.8    1e-08   
ref|XP_008786364.1|  PREDICTED: uncharacterized protein LOC103704729  63.2    1e-08   
ref|XP_007210759.1|  hypothetical protein PRUPE_ppa020619mg           62.8    1e-08   
ref|XP_010087252.1|  hypothetical protein L484_009761                 63.2    1e-08   
ref|XP_002275655.1|  PREDICTED: uncharacterized protein LOC100258949  62.4    2e-08   Vitis vinifera
ref|XP_008781326.1|  PREDICTED: uncharacterized protein LOC103701130  61.6    4e-08   
ref|XP_008235192.1|  PREDICTED: uncharacterized protein LOC103334045  60.8    6e-08   
ref|XP_008240290.1|  PREDICTED: uncharacterized protein LOC103338811  60.1    1e-07   
ref|XP_004137354.1|  PREDICTED: uncharacterized protein LOC101203132  59.7    1e-07   
ref|XP_009382505.1|  PREDICTED: uncharacterized protein LOC103970450  59.3    1e-07   
ref|XP_006837232.1|  hypothetical protein AMTR_s00105p00150760        59.7    2e-07   
ref|XP_002441485.1|  hypothetical protein SORBIDRAFT_09g027770        59.7    2e-07   Sorghum bicolor [broomcorn]
ref|XP_009401639.1|  PREDICTED: uncharacterized protein LOC103985613  58.9    3e-07   
ref|XP_006855290.1|  hypothetical protein AMTR_s00057p00042470        58.9    4e-07   
ref|XP_003558091.1|  PREDICTED: uncharacterized protein LOC100836996  58.9    4e-07   
ref|XP_007199315.1|  hypothetical protein PRUPE_ppa023376mg           58.5    4e-07   
ref|XP_009380315.1|  PREDICTED: uncharacterized protein LOC103968736  57.8    5e-07   
ref|XP_007051081.1|  Multidrug resistance protein ABC transporter...  58.2    6e-07   
ref|XP_008453692.1|  PREDICTED: uncharacterized protein LOC103494340  57.8    6e-07   
ref|XP_009384419.1|  PREDICTED: uncharacterized protein LOC103971974  57.8    6e-07   
ref|XP_010095648.1|  hypothetical protein L484_008805                 57.8    7e-07   
ref|XP_003519749.1|  PREDICTED: uncharacterized protein LOC100798099  57.8    8e-07   
ref|XP_006492320.1|  PREDICTED: uncharacterized protein LOC102625981  57.8    8e-07   
ref|XP_007051082.1|  Uncharacterized protein TCM_004789               57.4    9e-07   
gb|KCW58369.1|  hypothetical protein EUGRSUZ_H01054                   57.8    1e-06   
ref|XP_009356023.1|  PREDICTED: uncharacterized protein LOC103946923  57.4    1e-06   
ref|XP_010069866.1|  PREDICTED: uncharacterized protein LOC104456709  57.8    1e-06   
gb|KCW58368.1|  hypothetical protein EUGRSUZ_H01053                   57.0    1e-06   
ref|NP_192118.1|  uncharacterized protein                             57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008367622.1|  PREDICTED: uncharacterized protein LOC103431264  57.0    1e-06   
ref|XP_006444471.1|  hypothetical protein CICLE_v10021856mg           58.2    1e-06   
ref|XP_010938298.1|  PREDICTED: uncharacterized protein LOC105057397  56.6    1e-06   
ref|XP_008786238.1|  PREDICTED: uncharacterized protein LOC103704646  56.6    1e-06   
gb|AFG53536.1|  hypothetical protein UMN_2119_01                      55.1    2e-06   
ref|XP_004968104.1|  PREDICTED: uncharacterized protein LOC101774883  56.6    2e-06   
ref|XP_009378703.1|  PREDICTED: uncharacterized protein LOC103967164  56.6    3e-06   
tpg|DAA53777.1|  TPA: hypothetical protein ZEAMMB73_618286            56.2    3e-06   
ref|XP_010938299.1|  PREDICTED: uncharacterized protein LOC105057398  56.2    3e-06   
gb|AEW09278.1|  hypothetical protein UMN_2119_01                      54.7    3e-06   
ref|XP_009339786.1|  PREDICTED: uncharacterized protein LOC103931978  56.2    3e-06   
ref|XP_007163168.1|  hypothetical protein PHAVU_001G212200g           56.2    3e-06   
ref|XP_008386728.1|  PREDICTED: uncharacterized protein LOC103449220  56.2    3e-06   
ref|XP_002874940.1|  hypothetical protein ARALYDRAFT_490371           56.2    4e-06   
gb|KCW86192.1|  hypothetical protein EUGRSUZ_B02882                   55.8    4e-06   
emb|CDY22028.1|  BnaA09g00570D                                        55.5    6e-06   
ref|XP_004967549.1|  PREDICTED: uncharacterized protein LOC101757...  54.7    7e-06   
ref|XP_009404718.1|  PREDICTED: uncharacterized protein LOC103987965  55.5    7e-06   
ref|XP_004967550.1|  PREDICTED: uncharacterized protein LOC101757...  54.3    7e-06   
emb|CCG48018.1|  conserved hypothetical protein                       55.1    8e-06   
ref|XP_008673802.1|  PREDICTED: uncharacterized protein LOC103649897  56.2    8e-06   
ref|XP_010916301.1|  PREDICTED: uncharacterized protein LOC105041154  54.3    8e-06   
emb|CBH32659.1|  conserved hypothetical protein                       55.1    9e-06   
ref|XP_008374862.1|  PREDICTED: uncharacterized protein LOC103438096  54.7    9e-06   
ref|XP_003525184.1|  PREDICTED: uncharacterized protein LOC100820022  54.3    9e-06   
gb|KGN45009.1|  hypothetical protein Csa_7G407620                     54.3    1e-05   
gb|AFK42156.1|  unknown                                               53.9    1e-05   
ref|XP_006381252.1|  hypothetical protein POPTR_0006s10620g           53.9    1e-05   
ref|XP_009111318.1|  PREDICTED: uncharacterized protein LOC103836776  55.1    1e-05   
ref|XP_010921514.1|  PREDICTED: uncharacterized protein LOC105045053  53.9    2e-05   
ref|XP_010456083.1|  PREDICTED: uncharacterized protein LOC104737...  54.3    2e-05   
ref|XP_002308239.1|  hypothetical protein POPTR_0006s10630g           53.5    2e-05   Populus trichocarpa [western balsam poplar]
emb|CDY07095.1|  BnaCnng01100D                                        55.5    2e-05   
gb|ACU24427.1|  unknown                                               53.5    2e-05   Glycine max [soybeans]
gb|ABR17317.1|  unknown                                               53.9    2e-05   Picea sitchensis
ref|XP_004494418.1|  PREDICTED: uncharacterized protein LOC101499148  53.5    2e-05   
gb|EAZ10340.1|  hypothetical protein OsJ_00176                        53.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049881.1|  Os03g0305200                                     53.9    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008451488.1|  PREDICTED: uncharacterized protein LOC103492762  53.1    2e-05   
gb|EAY89690.1|  hypothetical protein OsI_11225                        54.3    2e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010422640.1|  PREDICTED: uncharacterized protein LOC104707...  53.1    2e-05   
gb|ABR16531.1|  unknown                                               53.5    2e-05   Picea sitchensis
ref|NP_001172148.1|  Os01g0120900                                     53.9    2e-05   
gb|AFW88617.1|  hypothetical protein ZEAMMB73_801146                  53.9    2e-05   
ref|XP_010456082.1|  PREDICTED: uncharacterized protein LOC104737...  53.9    2e-05   
ref|XP_010429170.1|  PREDICTED: uncharacterized protein LOC104713688  53.9    2e-05   
ref|XP_008811790.1|  PREDICTED: uncharacterized protein LOC103722870  53.1    2e-05   
ref|XP_006643711.1|  PREDICTED: uncharacterized protein LOC102702883  53.5    3e-05   
emb|CBI36936.3|  unnamed protein product                              52.4    3e-05   
ref|XP_011019050.1|  PREDICTED: uncharacterized protein LOC105121891  53.1    3e-05   
gb|KDP28243.1|  hypothetical protein JCGZ_14014                       53.5    3e-05   
gb|AFB33464.1|  hypothetical protein 2_6541_01                        52.4    3e-05   
ref|XP_007145155.1|  hypothetical protein PHAVU_007G214900g           53.1    3e-05   
ref|XP_006396408.1|  hypothetical protein EUTSA_v10029320mg           53.5    3e-05   
ref|XP_008369114.1|  PREDICTED: uncharacterized protein LOC103432694  53.1    4e-05   
gb|AFB33466.1|  hypothetical protein 2_6541_01                        52.4    4e-05   
ref|XP_004494415.1|  PREDICTED: uncharacterized protein LOC101498153  53.1    4e-05   
ref|XP_002515298.1|  conserved hypothetical protein                   52.4    4e-05   Ricinus communis
ref|XP_006588575.1|  PREDICTED: uncharacterized protein LOC100784884  53.1    4e-05   
ref|XP_011019052.1|  PREDICTED: uncharacterized protein LOC105121892  52.4    5e-05   
ref|XP_003625958.1|  hypothetical protein MTR_7g109410                52.8    5e-05   
gb|AFK49072.1|  unknown                                               52.8    5e-05   
gb|AEW08335.1|  hypothetical protein 2_6541_01                        51.6    5e-05   
ref|XP_010268021.1|  PREDICTED: uncharacterized protein LOC104605103  52.4    5e-05   
ref|XP_006423149.1|  hypothetical protein CICLE_v10029512mg           51.6    6e-05   
ref|XP_008781080.1|  PREDICTED: uncharacterized protein LOC103700955  52.0    6e-05   
ref|XP_010679496.1|  PREDICTED: uncharacterized protein LOC104894848  52.0    7e-05   
ref|XP_010522823.1|  PREDICTED: uncharacterized protein LOC104801302  52.4    8e-05   
ref|XP_002515299.1|  conserved hypothetical protein                   52.0    8e-05   Ricinus communis
ref|XP_010422639.1|  PREDICTED: uncharacterized protein LOC104707...  52.4    8e-05   
ref|XP_009141055.1|  PREDICTED: uncharacterized protein LOC103864993  51.6    9e-05   
ref|XP_006444472.1|  hypothetical protein CICLE_v10022487mg           51.6    9e-05   
ref|XP_004135994.1|  PREDICTED: uncharacterized protein LOC101221516  52.0    1e-04   
ref|XP_004984634.1|  PREDICTED: uncharacterized protein LOC101757963  52.0    1e-04   
emb|CDX69254.1|  BnaC01g01990D                                        51.6    1e-04   
ref|XP_010926075.1|  PREDICTED: uncharacterized protein LOC105048466  51.2    1e-04   
ref|XP_002465381.1|  hypothetical protein SORBIDRAFT_01g037590        52.0    1e-04   
ref|XP_003521590.1|  PREDICTED: uncharacterized protein LOC100801308  52.0    1e-04   
gb|EYU46802.1|  hypothetical protein MIMGU_mgv1a021523mg              52.0    1e-04   
ref|NP_001236416.1|  uncharacterized protein LOC100527719             51.6    1e-04   
ref|XP_009360170.1|  PREDICTED: uncharacterized protein LOC103950664  51.6    1e-04   
ref|XP_008654827.1|  PREDICTED: uncharacterized protein LOC103634550  52.0    1e-04   
ref|XP_008451489.1|  PREDICTED: uncharacterized protein LOC103492763  51.6    1e-04   
gb|ABK22262.1|  unknown                                               51.2    1e-04   
ref|XP_009799961.1|  PREDICTED: uncharacterized protein LOC104245943  50.8    1e-04   
ref|XP_006338261.1|  PREDICTED: uncharacterized protein LOC102606002  50.8    1e-04   
ref|XP_006425774.1|  hypothetical protein CICLE_v10026684mg           50.8    1e-04   
ref|XP_009629967.1|  PREDICTED: uncharacterized protein LOC104120024  50.8    2e-04   
ref|XP_009403815.1|  PREDICTED: uncharacterized protein LOC103987280  51.6    2e-04   
ref|XP_010910875.1|  PREDICTED: uncharacterized protein LOC105036847  50.8    2e-04   
ref|XP_009613606.1|  PREDICTED: uncharacterized protein LOC104106706  50.4    2e-04   
gb|EYU40113.1|  hypothetical protein MIMGU_mgv1a021511mg              50.4    2e-04   
ref|XP_009403954.1|  PREDICTED: uncharacterized protein LOC103987386  50.1    2e-04   
ref|XP_004145398.1|  PREDICTED: uncharacterized protein LOC101205353  49.7    2e-04   
ref|XP_007163169.1|  hypothetical protein PHAVU_001G212300g           50.1    3e-04   
gb|AFW79882.1|  hypothetical protein ZEAMMB73_278238                  50.8    3e-04   
ref|XP_009759929.1|  PREDICTED: uncharacterized protein LOC104212392  50.1    3e-04   
ref|XP_004232083.1|  PREDICTED: uncharacterized protein LOC101260191  50.1    3e-04   
gb|AFB33468.1|  hypothetical protein 2_6541_01                        49.7    3e-04   
gb|KDP28244.1|  hypothetical protein JCGZ_14015                       50.1    3e-04   
ref|XP_003625959.1|  hypothetical protein MTR_7g109420                50.1    3e-04   
gb|ABK21419.1|  unknown                                               50.4    3e-04   
gb|AES82177.2|  DUF4228 domain protein                                49.7    3e-04   
ref|XP_008790201.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.1    3e-04   
ref|XP_002457474.1|  hypothetical protein SORBIDRAFT_03g007830        50.8    3e-04   
gb|AEW08334.1|  hypothetical protein 2_6541_01                        49.3    3e-04   
gb|AFG56659.1|  hypothetical protein 2_6541_01                        49.3    4e-04   
ref|XP_011032585.1|  PREDICTED: uncharacterized protein LOC105131356  49.7    4e-04   
ref|XP_006290144.1|  hypothetical protein CARUB_v10003810mg           50.4    5e-04   
ref|XP_009413007.1|  PREDICTED: uncharacterized protein LOC103994413  50.4    6e-04   
gb|KGN61773.1|  hypothetical protein Csa_2G239380                     49.3    6e-04   
ref|NP_001142816.1|  hypothetical protein                             49.7    6e-04   
ref|XP_010941915.1|  PREDICTED: uncharacterized protein LOC105060034  48.5    9e-04   
gb|KHN19221.1|  hypothetical protein glysoja_041573                   48.5    0.001   
dbj|BAK02482.1|  predicted protein                                    48.5    0.001   



>ref|XP_002315899.1| hypothetical protein POPTR_0010s12630g [Populus trichocarpa]
 gb|ABK95625.1| unknown [Populus trichocarpa]
 gb|EEF02070.1| hypothetical protein POPTR_0010s12630g [Populus trichocarpa]
Length=178

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 123/179 (69%), Gaps = 12/179 (7%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + +  ARV+ P GE+R+ REPVKAAE+MLE P  FL N+ SL  GR
Sbjct  1    MGNYISCTLATPLMKHSKVARVVFPTGEVRQFREPVKAAELMLECPNFFLANSQSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS LSAD++LESGNVY  FPMKR+SS++TAAD+AV  +AA  S AKR+S GN+ +V P 
Sbjct  61   RFSALSADEELESGNVYLMFPMKRVSSIVTAADMAVFFIAA-NSAAKRISGGNSNRVLPE  119

Query  272  EGGDET-----PGNDVG--RLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
             GGD+       G D G  RL +     F   EY++RLS CRS+KP+LETI EEPVR R
Sbjct  120  SGGDQNVQESLEGRDNGAARLSLEGVEDFPAPEYKYRLSCCRSRKPMLETIKEEPVRLR  178



>ref|XP_009596594.1| PREDICTED: uncharacterized protein LOC104092649 [Nicotiana tomentosiformis]
Length=173

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 128/176 (73%), Gaps = 11/176 (6%)
 Frame = -2

Query  626  MGNLVSCSar-kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+     R + AARV+LPGGEIR+ REP+KAAE+MLE+P +FLVN+ SL  GRR
Sbjct  1    MGNFTSCTVLPTIRNSKAARVVLPGGEIRQFREPIKAAELMLENPNNFLVNSSSLNIGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP--  276
            FS LSAD+DLE GNVY  FPMKR++SV+TA+D+ VLL+AA  S AKR+S GN  K+SP  
Sbjct  61   FSALSADEDLEYGNVYIMFPMKRVNSVVTASDMTVLLLAA-NSAAKRISGGN-VKISPEV  118

Query  275  -AEGGDETPGNDV--GR-LGVTSGF-VGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
             A   + TP N+   GR L    GF V QE ++RLS CRS+KP L TI+EEPV +R
Sbjct  119  SAPAPESTPENNAAGGRSLDGVEGFPVEQELKYRLS-CRSRKPSLATILEEPVCSR  173



>ref|XP_011070665.1| PREDICTED: uncharacterized protein LOC105156271 [Sesamum indicum]
Length=175

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 121/170 (71%), Gaps = 7/170 (4%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaa--aaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+    +  +  +ARVILPGGEIR+ R+PVKAAE+MLE P  FLVN+ SL  GR
Sbjct  1    MGNFISCTFVAPKLRSPKSARVILPGGEIRQFRQPVKAAELMLESPNFFLVNSKSLNIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGN-AAKVSP  276
            RFSPLSAD+DLE GN+Y   PM+R++SV+TAA+VAV L+AA  +P KR+S GN + KVSP
Sbjct  61   RFSPLSADEDLEFGNLYVMIPMRRVNSVVTAAEVAVFLMAANSAP-KRISGGNYSMKVSP  119

Query  275  ---AEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
                  GD+    +  R  +    V  EY++RL++CRSK+P L+TI EEP
Sbjct  120  EAVTSPGDDDSSTESERPRLNLDGVAPEYKYRLAVCRSKRPGLDTITEEP  169



>ref|XP_002311488.1| hypothetical protein POPTR_0008s12610g [Populus trichocarpa]
 gb|EEE88855.1| hypothetical protein POPTR_0008s12610g [Populus trichocarpa]
Length=179

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 121/180 (67%), Gaps = 13/180 (7%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + AARV+ P GE+R+ REPVKAAE+MLE P  FL N+ SL  GR
Sbjct  1    MGNYISCTLATPLIKSSKAARVVFPAGEVRQFREPVKAAELMLECPNFFLANSQSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG-NAAKVSP  276
            RFS LSAD++LE GNVY  FPMKR+ S +TAAD+AV  + A  S A+R+S G N  +V P
Sbjct  61   RFSALSADEELEFGNVYLMFPMKRVFSTVTAADMAVFFMTA-NSAARRISGGNNITRVLP  119

Query  275  AEGGD----ETPG---NDVGRLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              GGD    E+P    N   RL +    GF   EY++RLS CRS+KP+LETI EEPVR+R
Sbjct  120  ESGGDQNARESPKGSENGAARLSLEEVEGFPLPEYKYRLSSCRSRKPMLETINEEPVRSR  179



>ref|XP_011078202.1| PREDICTED: uncharacterized protein LOC105161997 [Sesamum indicum]
Length=173

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 121/176 (69%), Gaps = 11/176 (6%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaa--aaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+    R  +   ARVILPGGEIR+ R+PVKAAE+MLE PT+F+VN+ SL  GR
Sbjct  1    MGNYVSCTFVAPRLRSPRTARVILPGGEIRQFRQPVKAAELMLESPTYFVVNSRSLNIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFSPLSAD+DLE GN+Y  FPM+R++S++TAADVAV L++A  +P KR+S  N  KVSP 
Sbjct  61   RFSPLSADEDLEFGNLYVMFPMRRVNSIVTAADVAVFLMSANSAP-KRISCVNTVKVSPE  119

Query  272  EGGDETPGNDVG------RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              G        G      RL V    V  EY++R+  CRS+KP+L+TI EEPV  R
Sbjct  120  ATGTRKEEEGEGSENGRPRLIVEG--VAPEYKYRVGGCRSRKPVLDTITEEPVFVR  173



>gb|EYU30039.1| hypothetical protein MIMGU_mgv1a017671mg [Erythranthe guttata]
Length=172

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 10/175 (6%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      R   +ARV+LPGGEIR+ R+PVKAAE+ML+ P++F+ N+ SL  GR
Sbjct  1    MGNYISCAFVAPKLRNHRSARVLLPGGEIRQFRQPVKAAELMLDSPSYFVANSKSLIIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLS---AGNAAKV  282
            RFSPLSAD+DLE GN+Y   PM+R++SV+TAADVAV L++A  +P KRLS    G+A +V
Sbjct  61   RFSPLSADEDLEFGNLYVMLPMRRVNSVVTAADVAVFLMSANSAP-KRLSGGGGGSAVRV  119

Query  281  SP--AEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            SP  A   D +  N   RL +    +  EY+ RL++CRSK+P L+TIIEEP+ +R
Sbjct  120  SPEAAAAADNSSENGRPRLSLED--MAPEYQFRLAVCRSKRPGLDTIIEEPIFSR  172



>ref|XP_007045058.1| Uncharacterized protein TCM_010809 [Theobroma cacao]
 gb|EOY00890.1| Uncharacterized protein TCM_010809 [Theobroma cacao]
Length=177

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 123/179 (69%), Gaps = 13/179 (7%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      +   AARVILPGGEIR+ RE +KAAE+MLE P  FL N+ SL  GR
Sbjct  1    MGNYISCTLATPLIKSGKAARVILPGGEIRQFRESIKAAELMLECPNFFLTNSQSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS LSAD++LE GNVY  FPMKR++S++TAAD+A+L +AA  S AKR+S G   ++ P 
Sbjct  61   RFSALSADEELEFGNVYIMFPMKRVNSMVTAADMAMLFMAA-NSAAKRISGGK-VRILPE  118

Query  272  E---GGDETP------GNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
                GG E+       G+ +   GV  GF   E+++RLS+CRS+KP LETI EEPVR+R
Sbjct  119  SGNVGGQESSTECEDGGSRLSLEGVDEGFPVAEFKYRLSVCRSRKPSLETIKEEPVRSR  177



>gb|KDP34983.1| hypothetical protein JCGZ_09271 [Jatropha curcas]
Length=181

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 127/182 (70%), Gaps = 15/182 (8%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      + A AARVILPGGE+R+ RE +KAAE+MLE P  FLVN+ SL  GR
Sbjct  1    MGNFVSCTLATPLIKSAKAARVILPGGEVRQFREQIKAAELMLECPNFFLVNSQSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLS-AGNAAK--V  282
            RFS L+AD+++E GNVY  FPMKRL+SV+TAAD+AVL +AA  S AKR+S AGN  K  +
Sbjct  61   RFSALAADEEVEFGNVYIMFPMKRLNSVVTAADMAVLFLAA-NSAAKRISGAGNNNKGRI  119

Query  281  SPAEGG------DETPGNDVGRLGVT---SGFVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
             P  GG      +   G++ G    T   + F   EY++RLS+CRS+KP+LETI EEPVR
Sbjct  120  LPESGGVINLQENLEMGSEDGESSSTEEIAVFPMAEYQYRLSVCRSRKPMLETIKEEPVR  179

Query  128  TR  123
            +R
Sbjct  180  SR  181



>ref|XP_004237025.1| PREDICTED: uncharacterized protein LOC101267223 [Solanum lycopersicum]
Length=164

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = -2

Query  626  MGNLVSCSar-kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC      + + A+RV+LPGGEIR+ REP+KAAEIM+E+P++FLV++ SL  GRR
Sbjct  1    MGNFTSCPILPSIKTSKASRVVLPGGEIRQFREPIKAAEIMMEYPSNFLVDSSSLNIGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE  270
            FS LSAD+DLE G+VY  FPMKR++SV+TA D+ V+L+AA  S AKR+S GN  ++SPA 
Sbjct  61   FSALSADEDLEFGSVYIMFPMKRVNSVVTATDMTVILLAA-NSAAKRISGGN-GRISPAT  118

Query  269  GGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              +     D G + V    V +E ++RL+ CRS+KP L TI+EEPV  R
Sbjct  119  ENNVAGDQDSGEVEVFP--VEREMKYRLA-CRSRKPSLATIMEEPVSFR  164



>ref|XP_002284010.1| PREDICTED: uncharacterized protein LOC100262828 [Vitis vinifera]
Length=181

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 123/183 (67%), Gaps = 17/183 (9%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + AARVI P GE+R+ REP+KAAE+MLE P  FLVN+ SL  GR
Sbjct  1    MGNYISCTLITPTIKSSKAARVIFPTGEVRQFREPLKAAELMLESPNFFLVNSKSLHMGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RF+PL+AD+DLE GN+Y  FPMKR++SV+TAAD+AV L+AA  S AKR+S G   ++ P 
Sbjct  61   RFNPLTADEDLEFGNLYILFPMKRVNSVVTAADMAVYLLAA-NSAAKRISGGK-VRILPE  118

Query  272  EGGDETP---------GNDVG----RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
             GGD +           N+ G     L    GF   EY++RL++ RSKKPLLETI EEPV
Sbjct  119  SGGDGSEEVAVATAAVENEAGCSRLNLDEVEGFPVSEYKYRLAMFRSKKPLLETIREEPV  178

Query  131  RTR  123
             +R
Sbjct  179  CSR  181



>ref|XP_009758026.1| PREDICTED: uncharacterized protein LOC104210762 [Nicotiana sylvestris]
Length=172

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 124/175 (71%), Gaps = 10/175 (6%)
 Frame = -2

Query  626  MGNLVSCSar-kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+     R + AARV+LPGGEIR+ REP+KAAE+MLE+P +FLVN+ SL  GRR
Sbjct  1    MGNFNSCTVLPTIRNSKAARVVLPGGEIRQFREPIKAAELMLENPNNFLVNSSSLNIGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP--  276
            FS LSAD+DLE GNVY  FPMKR++SV+TA+D+ VLL+AA  S AKR+S G   K+SP  
Sbjct  61   FSALSADEDLEFGNVYIMFPMKRVNSVVTASDMTVLLLAA-NSAAKRISGGK-VKISPEV  118

Query  275  -AEGGDETPGNDVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
             A   + TP  + G     GV    V  E ++RLS CRS+KP LETI+EEPV +R
Sbjct  119  SAPAPESTPEINAGGRNSDGVEGFPVEHELKYRLS-CRSRKPSLETILEEPVCSR  172



>emb|CDP00724.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 118/175 (67%), Gaps = 8/175 (5%)
 Frame = -2

Query  626  MGNLVSCSar---kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGNL+SCS       +   AARVILPGGE+R+ R+ VKAAE+MLE P +FLVN+ SL  G
Sbjct  1    MGNLMSCSTLPTPLMKTTRAARVILPGGEVRQFRQLVKAAELMLECPNYFLVNSKSLNIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            +RFS LSAD+DLE GNVY  F MKR++S++TAAD+AV+L+AA  + A+R++ G       
Sbjct  61   KRFSALSADEDLECGNVYIMFQMKRVNSIVTAADMAVVLMAA-NTAARRIAGGKVEPEVA  119

Query  275  AEGGDETPGNDVGR----LGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            A         +VGR    L    GF   EYR RL+ C+S+KPLL+TI EEPV +R
Sbjct  120  AAAVTRDDDQEVGRSRLNLEEIEGFKDMEYRFRLASCKSRKPLLDTITEEPVFSR  174



>ref|XP_009780349.1| PREDICTED: uncharacterized protein LOC104229402 [Nicotiana sylvestris]
Length=163

 Score =   142 bits (358),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 112/175 (64%), Gaps = 20/175 (11%)
 Frame = -2

Query  626  MGNLVSCSarkgr-kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN +SC+       + AA+VILP G+I++  E VKAAE+MLE+P  FLVN+ SL  GRR
Sbjct  1    MGNFISCTTSTRIRNSKAAKVILPNGQIQQFHEIVKAAELMLEYPNFFLVNSCSLIIGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE  270
            F  LSAD+DLE GN+Y  FPMKR++SVIT           +K     L   N+   +PA 
Sbjct  61   FFALSADEDLEFGNIYVMFPMKRVNSVIT-----------EKDMEVFLMMANSGS-TPAH  108

Query  269  GGDETPGND-VGRLGVT----SGFVG-QEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              D + G D VG LG+      GFV  QE+R+R+S C+SKKPLLETI+EEP+ +R
Sbjct  109  IPDNSSGKDGVGWLGLNLNELEGFVEVQEFRYRVS-CKSKKPLLETIMEEPISSR  162



>ref|XP_011022986.1| PREDICTED: uncharacterized protein LOC105124599 [Populus euphratica]
Length=179

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 119/180 (66%), Gaps = 13/180 (7%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + AARV+ P GE+R+ REPVKAAE+MLE P  FL N+ SL  GR
Sbjct  1    MGNYISCTLATPLIKSSKAARVVFPAGEVRQFREPVKAAELMLECPNFFLANSQSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG-NAAKVSP  276
            RFS LSAD++LE GNVY  FPMKR+ S +TAAD+AV  +AA  S A+R+S G N  +V P
Sbjct  61   RFSALSADEELEFGNVYLMFPMKRVFSSVTAADMAVFFMAA-NSAARRISGGNNKTRVLP  119

Query  275  AEGGD----ETP---GNDVGRLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
                D    E+P    N   RL +    GF   EY++RLS CRS+KP+LETI EEPVR R
Sbjct  120  ESADDQNARESPEGSENGASRLSLEEVEGFPVPEYKYRLSSCRSRKPMLETINEEPVRLR  179



>ref|XP_006360425.1| PREDICTED: uncharacterized protein LOC102583797 [Solanum tuberosum]
Length=168

 Score =   142 bits (358),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 123/177 (69%), Gaps = 18/177 (10%)
 Frame = -2

Query  626  MGNLVSCSar-kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC      + + A+RV+LPGGEIR+ REP+KAAEIM+E+P++FLV++ SL  GRR
Sbjct  1    MGNFTSCPILPSIKNSKASRVVLPGGEIRQFREPIKAAEIMMEYPSNFLVDSSSLNIGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE  270
            FS L AD+DLE GNVY  FPMKR++SV+TA D+ V+L+AA  S AKR+S GN  ++SP +
Sbjct  61   FSALVADEDLEFGNVYIIFPMKRVNSVVTATDMTVILLAA-NSAAKRISGGN-GRISPED  118

Query  269  --------GGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
                     GD     D G + V    VG+E ++RL+ CRSKKP L TI+EEPV +R
Sbjct  119  MPAPESNVAGDW----DSGEVEVFP--VGREMKYRLA-CRSKKPSLATIMEEPVSSR  168



>ref|XP_011099502.1| PREDICTED: uncharacterized protein LOC105177908 [Sesamum indicum]
Length=175

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 108/177 (61%), Gaps = 11/177 (6%)
 Frame = -2

Query  626  MGNLVSCSarkg---rkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN VSC+         +   +VI P GEIRRL EP KAAE+MLE P  FLVN  SL  G
Sbjct  1    MGNYVSCTLSVTVGKTSSRVTKVIFPSGEIRRLCEPTKAAELMLETPNSFLVNTRSLQIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRF+ L+AD+DLE GNVY  FPMKRL+SV+ AAD+  L +AA  S AKR  A    ++ P
Sbjct  61   RRFAALNADEDLEMGNVYVFFPMKRLNSVVMAADIGPLFMAA-NSAAKR-GALAGVRILP  118

Query  275  AEGGDET------PGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              G D        P      L     F   E+RHRLS+CRSKKPLLETI+EEPV  R
Sbjct  119  EAGADVQSGEKGFPAAPKLNLDDIEEFSTPEFRHRLSMCRSKKPLLETIVEEPVWLR  175



>ref|XP_007143004.1| hypothetical protein PHAVU_007G035500g [Phaseolus vulgaris]
 gb|ESW14998.1| hypothetical protein PHAVU_007G035500g [Phaseolus vulgaris]
Length=169

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 119/177 (67%), Gaps = 17/177 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN VSC+       A   VI+P GE+++ +E +KAAE+MLEHPT+FLVN+ SL  GRRF
Sbjct  1    MGNYVSCTLAPPSTKATR-VIVPTGEVKQFKEIIKAAELMLEHPTYFLVNSRSLHIGRRF  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
            S L+AD++LE GNVY  FPM+RL S++TAAD+AVL +AA  S  KRLS G   +V P  G
Sbjct  60   SALAADEELEFGNVYIFFPMRRLKSLVTAADMAVLYLAA-SSAVKRLSGGK-TRVLPHSG  117

Query  266  GDE------TPGNDVGRL---GVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            G E      T   ++ RL   GV SGF     ++RL+ CRS+KP+LETI EEP R R
Sbjct  118  GGEGQQEEKTSDVEIPRLSLEGVDSGF-----QYRLNYCRSRKPVLETITEEPARLR  169



>ref|XP_004496994.1| PREDICTED: uncharacterized protein LOC101497518 [Cicer arietinum]
Length=169

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 121/176 (69%), Gaps = 15/176 (9%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      + A A RVILP GE+++ RE +KAAE+MLE+P+ FLVN+ SL   R
Sbjct  1    MGNYVSCTLAPPLMKNAKATRVILPTGEVKQFREIMKAAELMLENPSFFLVNSRSLHISR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFSPL AD++LE GNVY  FPM+RL+SV+TAAD+AVL +AA  S AKRLS G   +V P 
Sbjct  61   RFSPLVADEELEFGNVYIFFPMRRLNSVVTAADMAVLFLAA-NSAAKRLSNGK-TRVQPD  118

Query  272  EGGDETPGND---VGRL---GVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
             G      N+   V RL   GV SGF      +RLS CRSKKP+LETI EEP+R+R
Sbjct  119  NGEVVKVANENDCVPRLSLEGVESGF-----SYRLSYCRSKKPILETINEEPIRSR  169



>gb|EYU44595.1| hypothetical protein MIMGU_mgv1a026484mg [Erythranthe guttata]
Length=168

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 109/173 (63%), Gaps = 10/173 (6%)
 Frame = -2

Query  626  MGNLVSCSarkgr---kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN VSC+         +   +VI P GE+RR+ EP KAAE+MLE P  FLVN  SL  G
Sbjct  1    MGNYVSCTLSGPAGKGSSRGTKVIFPSGEVRRVHEPTKAAELMLETPGSFLVNTKSLQIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRF+ LSAD+DLE GNVY  FPM RL+S +TA D+ VL +A     AKR ++    +VSP
Sbjct  61   RRFAALSADEDLEIGNVYVFFPMNRLNSAVTATDMGVLFLA-----AKRAASVGRVRVSP  115

Query  275  AEGGDETPGNDVGRLGVTS--GFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              GG       + +L +     F   +++HRLS+CRSKKPLLETI+EEPV  R
Sbjct  116  ESGGGGEAEVVLPKLNLDDIEEFSTPDFKHRLSMCRSKKPLLETIVEEPVSLR  168



>ref|XP_009589128.1| PREDICTED: uncharacterized protein LOC104086543 [Nicotiana tomentosiformis]
Length=161

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 114/173 (66%), Gaps = 19/173 (11%)
 Frame = -2

Query  626  MGNLVSCSar-kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN +SC+   + R + AARVILP G+I++ RE VKAAE+MLE+P  FLVN+ SL  GRR
Sbjct  1    MGNFISCTTSPRTRNSRAARVILPNGQIQQFREIVKAAELMLEYPNSFLVNSCSLIIGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE  270
            FS LSAD+DLE GN+Y  FPMKR++SVIT           +K     + A N+A ++P +
Sbjct  61   FSALSADEDLEFGNIYLMFPMKRVNSVIT-----------EKDVEVFMMAANSA-LAPVQ  108

Query  269  GGDETPGNDVGRLGVT----SGFV-GQEYRHRLSLCRSKKPLLETIIEEPVRT  126
              D +    V   G+      GF+ GQE+R+ +S CRS+KPLLETIIEEP R+
Sbjct  109  IPDNSSRKGVEWSGLNLNELEGFMGGQEFRYWVS-CRSRKPLLETIIEEPFRS  160



>ref|XP_002268613.1| PREDICTED: uncharacterized protein LOC100258732 [Vitis vinifera]
Length=177

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 111/178 (62%), Gaps = 11/178 (6%)
 Frame = -2

Query  626  MGNLVSCSarkgrk--aaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+          AA+VI PGGE+R L  P K AE+MLE P+ F+VN+ SL  GR
Sbjct  1    MGNYVSCALATSSMGKYRAAKVIFPGGEVRVLDRPTKVAELMLEEPSFFVVNSQSLHMGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadv----avllvaAKKSPAKRL----SAG  297
            RFS L AD+DLE GNVYA FPMKRL+SV+TAAD+         + K++ A R+     +G
Sbjct  61   RFSALGADEDLEMGNVYAMFPMKRLNSVVTAADMGALFMRANSSVKQASAGRMRLLAESG  120

Query  296  NAAKVSPAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              +++ P+    E  G     L     +   E++HRLS+CRSKKPLLETI EEP+ +R
Sbjct  121  RGSQIMPSPAA-ENAGETRLNLEDIEEYSTPEFKHRLSMCRSKKPLLETIAEEPLCSR  177



>ref|XP_003592570.1| hypothetical protein MTR_1g108640 [Medicago truncatula]
 gb|AES62821.1| DUF4228 domain protein [Medicago truncatula]
 gb|AFK37909.1| unknown [Medicago truncatula]
Length=173

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 122/180 (68%), Gaps = 19/180 (11%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      R A A RVILP GE+++ RE +KAAE+MLE+P +FLVN+ SL    
Sbjct  1    MGNYVSCTLAPPLMRNAKATRVILPTGEVKQFREIMKAAELMLENPNYFLVNSRSLHIST  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFSPL+AD++LE GNVY  FPM+RL+SV+T AD+AVL +AA  S AKRL AG   +V P 
Sbjct  61   RFSPLAADEELEFGNVYIFFPMRRLNSVVTGADMAVLFLAA-NSAAKRLRAGK-TRVQPD  118

Query  272  EG------GDETPGND-VGRL---GVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            E       G E   N+ V RL   GV SGF      +RLS CRSKKP+LETI EEP+R+R
Sbjct  119  ESSEVKGDGVENDQNECVPRLSLEGVESGF-----SYRLSYCRSKKPILETINEEPIRSR  173



>ref|XP_010253019.1| PREDICTED: uncharacterized protein LOC104594432 [Nelumbo nucifera]
Length=183

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 117/184 (64%), Gaps = 17/184 (9%)
 Frame = -2

Query  626  MGNLVSCSarkg--rkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      R++   RVILP G+IR+L   VKAAE+MLE P +FLVN+ SL  GR
Sbjct  1    MGNYISCTLASPPGRQSRGTRVILPSGKIRQLDGQVKAAELMLETPNYFLVNSRSLQIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L+AD+DLE GNVY  FPMKR+ SVITAAD+ VL ++A  S AKR S G    +  A
Sbjct  61   RFSALNADEDLEMGNVYIMFPMKRVKSVITAADMGVLFMSA-NSAAKRASDGKIRILPEA  119

Query  272  EGGDE--TPGNDVG------------RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
              GD   TP + V             +L     F   E+RHRLS+CRS+KPLLETI EEP
Sbjct  120  SSGDSRVTPVSAVNNSSGSETPLPRLKLDDIEEFSTPEFRHRLSMCRSRKPLLETITEEP  179

Query  134  VRTR  123
            + +R
Sbjct  180  ICSR  183



>ref|XP_010316076.1| PREDICTED: uncharacterized protein LOC104645686 [Solanum lycopersicum]
Length=166

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 112/171 (65%), Gaps = 8/171 (5%)
 Frame = -2

Query  626  MGNLVSCSark---grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+       +++   +VI P GEIR   EP+KAAEIM+E P  FLVN  SL  G
Sbjct  1    MGNYISCTLSGPGGNKESRGIKVIFPCGEIRHFYEPIKAAEIMMETPNFFLVNTRSLHIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRFS L+AD+DLE GNVY  FPMKR++S ++A D+  LL+ A  S +KR+S G + ++ P
Sbjct  61   RRFSALNADEDLEMGNVYVMFPMKRVNSFVSAGDMGALLLTA-NSVSKRVSIG-SLRILP  118

Query  275  AEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
             E     P  ++  +     F  +E++HRLS+CRSKKPLLETI EEPV  R
Sbjct  119  EENYCTLPKLNLDDI---EDFSSEEFKHRLSMCRSKKPLLETIAEEPVCLR  166



>ref|XP_009610331.1| PREDICTED: uncharacterized protein LOC104104049 [Nicotiana tomentosiformis]
Length=160

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 114/168 (68%), Gaps = 10/168 (6%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaa-aaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN +SC+     + + AA+VILP G I++  E VKAAE+MLE+P  FLVN+ SL  GRR
Sbjct  1    MGNFISCTTSTRIRNSRAAKVILPNGPIQQFHEIVKAAELMLEYPNSFLVNSCSLIIGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE  270
            FS LSAD+DLE GN+Y  FPMKR++SVIT  D+ V +++   + A      N+++    +
Sbjct  61   FSALSADEDLEFGNIYLMFPMKRVNSVITEKDMEVFMMSENSALAPVQIPDNSSR----K  116

Query  269  GGDETPGNDVGRLGVTSGFV-GQEYRHRLSLCRSKKPLLETIIEEPVR  129
             G E  G ++  L    GF+ GQE+R+R+S CRS+KPLLETIIEEP R
Sbjct  117  DGVEWSGLNLNEL---EGFMGGQEFRYRVS-CRSRKPLLETIIEEPFR  160



>ref|XP_006448311.1| hypothetical protein CICLE_v10016694mg [Citrus clementina]
 gb|ESR61551.1| hypothetical protein CICLE_v10016694mg [Citrus clementina]
Length=210

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 117/191 (61%), Gaps = 27/191 (14%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      +   AARVILPGGEIR+ RE VKAAE+MLE P  FL NA SL  G+
Sbjct  1    MGNYVSCTLPTPLMKSPKAARVILPGGEIRQFRELVKAAEVMLECPNFFLTNAKSLHIGK  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L+AD++LE GNVY  FPMKR++S++TAAD+A L +AA  S AKR+S G   +VSP 
Sbjct  61   RFSALAADEELEFGNVYIMFPMKRVNSMVTAADMASLFMAA-HSAAKRISGGQIVRVSPE  119

Query  272  EGG--------------------DETPGNDVGRLGVTSGFVGQ----EYRHRLSLCRSKK  165
             G                     D+    +V RL +     G     E+++RL  CRS+K
Sbjct  120  SGAAAASCAEKEERLNDGGKVDDDDNNNEEVSRLSLEGDHEGYFPVPEFKYRLVSCRSRK  179

Query  164  PLLETIIEEPV  132
            PLLETI EEPV
Sbjct  180  PLLETIKEEPV  190



>ref|XP_003555937.1| PREDICTED: uncharacterized protein LOC100792170 [Glycine max]
Length=177

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 120/183 (66%), Gaps = 21/183 (11%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      + + A RVI+P GE+++ RE VKAAE+MLEHP++FLVN+ SL  GR
Sbjct  1    MGNYVSCTLAPPLMKNSKATRVIIPTGEVKQFREIVKAAELMLEHPSYFLVNSRSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNA------  291
            RFS L AD++LESGNVY  FPM+R++SV+T  D+AVL +AA  S AKRLS G A      
Sbjct  61   RFSALGADEELESGNVYIFFPMRRVNSVVTPTDMAVLFLAA-NSAAKRLSGGKARVLPDN  119

Query  290  ----AKVSPAEGGDETPGNDVGRL---GVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
                A     E   +   +++ RL   GV SGF     + RL+ CRS+KP+LETI EEPV
Sbjct  120  CDGGAWQHKEESSKDGSLSEIPRLSLEGVESGF-----QCRLNYCRSRKPVLETINEEPV  174

Query  131  RTR  123
            R R
Sbjct  175  RLR  177



>ref|XP_008467138.1| PREDICTED: uncharacterized protein LOC103504565 [Cucumis melo]
Length=174

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 117/179 (65%), Gaps = 16/179 (9%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + A RV+LPGGE+R+ R+ VKAAE+MLE P+HFL NA SL  GR
Sbjct  1    MGNYISCALATPLIKNSKAVRVVLPGGEVRQFRDSVKAAELMLESPSHFLANAQSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L+AD++LE GNVY  FPMKR++SV+TAAD+A   +AA  S A+R+S+     +   
Sbjct  61   RFSALAADEELEFGNVYLMFPMKRVNSVVTAADLATFFMAA-NSAARRISSAKIRVLHEN  119

Query  272  EGGDE-------TPGNDVGRLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
                E       + GN+  RL +    GF      HRLS+CRS+KPLLETI EE +R+R
Sbjct  120  RNLQESEAMPRISDGNEGPRLSLEGVEGFP----MHRLSVCRSRKPLLETIKEEQIRSR  174



>ref|XP_004150859.1| PREDICTED: uncharacterized protein LOC101213469 [Cucumis sativus]
 ref|XP_004168654.1| PREDICTED: uncharacterized LOC101213469 [Cucumis sativus]
 gb|KGN51501.1| hypothetical protein Csa_5G571440 [Cucumis sativus]
Length=174

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 119/179 (66%), Gaps = 16/179 (9%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + A RV+LPGGE+R+ R+ VKAAE+MLE P+HFL NA SL  GR
Sbjct  1    MGNYISCALATPLIKNSKAVRVVLPGGEVRQFRDSVKAAELMLESPSHFLANAQSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP-  276
            RFS L+AD++LE GNVY  FPMKR++SV+TAAD+A   +AA  S A+R+S+     ++  
Sbjct  61   RFSALAADEELEFGNVYLMFPMKRVNSVVTAADLATFFMAA-NSAARRISSAKIRVLNEN  119

Query  275  --AEGGDETP----GNDVGRLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
               +  +  P    GN+  RL +    GF      HRLS+CRS+KPLLETI EE +R+R
Sbjct  120  RNLQASEAMPRISDGNEGPRLSLEGVEGFP----MHRLSVCRSRKPLLETIKEEQIRSR  174



>ref|XP_006357799.1| PREDICTED: uncharacterized protein LOC102602533 [Solanum tuberosum]
Length=181

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 115/183 (63%), Gaps = 17/183 (9%)
 Frame = -2

Query  626  MGNLVSCSark---grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+       +++   +VI P GEIR   +P+KAAEIM+E P  FLVN  SL  G
Sbjct  1    MGNYISCTLSGPGGNKQSRGVKVIFPSGEIRHFYQPIKAAEIMMETPNFFLVNTRSLHIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRFS L+AD+DLE GNVY  FPMKR++S ++AAD+  LL+ A  S +KR+S G + ++ P
Sbjct  61   RRFSALNADEDLEMGNVYVMFPMKRVNSFVSAADMGALLLTA-NSVSKRMSIG-SLRILP  118

Query  275  AEGGDET-----PGNDVGR-------LGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
                 ET      GN   +       L     F  ++++HRLS+CRSKKPLLETI EEPV
Sbjct  119  ESLVAETEQIQIQGNYYEKSTLPKLNLDDIEDFSSEQFKHRLSMCRSKKPLLETIAEEPV  178

Query  131  RTR  123
             +R
Sbjct  179  CSR  181



>ref|XP_010096754.1| hypothetical protein L484_025872 [Morus notabilis]
 gb|EXB65606.1| hypothetical protein L484_025872 [Morus notabilis]
Length=197

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 120/198 (61%), Gaps = 31/198 (16%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      + + A RVI PGGE+R+ RE VKAAE+MLE P  FL N+G+L  GR
Sbjct  1    MGNYVSCTLAAPLMKNSKAVRVIFPGGEVRQFRETVKAAELMLELPNFFLANSGALHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG--------  297
            RFS LSAD++LE GNVY  FPM+R++SVITAAD+A+  +AA  S AKR+S G        
Sbjct  61   RFSALSADEELEFGNVYVMFPMRRVNSVITAADLAMFFMAA-NSAAKRISGGKVRILPDS  119

Query  296  ----NAAKVSPA--------------EGGDETPGNDVGRLGVTSGF--VGQEYRHRLSLC  177
                N  ++S A               G  +  G+     GV  GF  V  E+++RL+ C
Sbjct  120  GVSNNTRELSTAVDFDQANSRGDHDQSGQRDVKGSTSSLDGVHEGFELVLPEFKYRLAAC  179

Query  176  RSKKPLLETIIEEPVRTR  123
            RS+KP+LETI EEP+  R
Sbjct  180  RSRKPMLETIKEEPIYLR  197



>emb|CAN67693.1| hypothetical protein VITISV_035607 [Vitis vinifera]
Length=164

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI PGGE+R L  P K AE+MLE P+ F+VN+ SL  GRRFS L AD+DLE G+VYA FP
Sbjct  9    VIFPGGEVRVLDRPTKVAELMLEEPSFFVVNSQSLHMGRRFSALGADEDLEMGBVYAMFP  68

Query  389  MKRLSSVITaadv----avllvaAKKSPAKRL----SAGNAAKVSPAEGGDETPGNDVGR  234
            MKRL+SV+TAAD+         + K++ A R+     +G  +++ P+    E  G     
Sbjct  69   MKRLNSVVTAADMGALFMRANSSVKQASAGRMRLLAESGRGSQIMPSPAA-ENAGETRLN  127

Query  233  LGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            L     +   E++HRLS+CRSKKPLLETI EEP+ +R
Sbjct  128  LEDIEEYSTXEFKHRLSMCRSKKPLLETIAEEPLCSR  164



>gb|KDO64746.1| hypothetical protein CISIN_1g029256mg [Citrus sinensis]
Length=196

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 118/197 (60%), Gaps = 30/197 (15%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      +   AARVILPGGEIR+ RE VKAAE+MLE P  FL NA SL  G+
Sbjct  1    MGNYVSCTLPTPLMKSPKAARVILPGGEIRQFRELVKAAEMMLECPNFFLTNAKSLHIGK  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L+AD++LE G+VY  FPMKR++S++TAAD+A L +AA  S AKR+S G   +VSP 
Sbjct  61   RFSALAADEELEFGDVYIMFPMKRVNSMVTAADMASLFMAA-HSAAKRISGGQIVRVSPE  119

Query  272  EG-----------------------GDETPGNDVGRLGVTSGFVGQ----EYRHRLSLCR  174
             G                        D+    +  RL +     G     E+++RL  CR
Sbjct  120  SGAAAAAAASCAEKEERLNDGGKVDDDDNNNEEASRLSLEGDHEGYFPVPEFKYRLVSCR  179

Query  173  SKKPLLETIIEEPVRTR  123
            S+KPLLETI EEPV +R
Sbjct  180  SRKPLLETIKEEPVCSR  196



>gb|KHN06733.1| hypothetical protein glysoja_021279 [Glycine soja]
Length=180

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 122/187 (65%), Gaps = 26/187 (14%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      + + A RVI+P GE+++ +E VKAAE+MLEHP +FLVN+ SL  GR
Sbjct  1    MGNYVSCTLAPPLMKNSKATRVIIPTGEVKQFKEIVKAAELMLEHPNYFLVNSRSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L AD++LE GNVY  FPM+R++S++TA D+AVL +AA  S AKRLS G+ A+V P 
Sbjct  61   RFSALGADEELEFGNVYIFFPMRRVNSLVTAPDMAVLFLAA-NSAAKRLS-GSKARVLPD  118

Query  272  EGGDETPGND--------------VGRL---GVTSGFVGQEYRHRLSLCRSKKPLLETII  144
              G +T                  + RL   GV SGF     ++RL+ CRS+KP+LETI 
Sbjct  119  NCGGKTWQQREEEEESSKDESLSVIPRLSLEGVESGF-----QYRLNYCRSRKPVLETIN  173

Query  143  EEPVRTR  123
            EEPVR R
Sbjct  174  EEPVRLR  180



>ref|XP_010243819.1| PREDICTED: uncharacterized protein LOC104587793 [Nelumbo nucifera]
Length=184

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 113/184 (61%), Gaps = 16/184 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaa--aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+        +  A+VILP GEIR+L   VKAAE+M E P +FLVN+ SL  GR
Sbjct  1    MGNYISCTLANSAGRQSRGAKVILPSGEIRQLDGHVKAAELMFEIPNYFLVNSRSLQIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS LSA +DLE GNVY  FPMKR++SVI AAD+  L ++A ++  +  SAG    VS A
Sbjct  61   RFSALSAVEDLEMGNVYIMFPMKRVNSVIKAADMGALFMSANRAANRASSAGAVCIVSEA  120

Query  272  EGGDE----TPGNDVGRLGVT----------SGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
              G+      P  D  R G T            F   E++HR S+C+S+KPLLETI+EEP
Sbjct  121  GNGNAQVTPVPAVDGLREGETPLPRLKLDDVEEFSTPEFKHRRSMCKSRKPLLETIMEEP  180

Query  134  VRTR  123
            + +R
Sbjct  181  ISSR  184



>ref|XP_010108920.1| hypothetical protein L484_027115 [Morus notabilis]
 gb|EXC20560.1| hypothetical protein L484_027115 [Morus notabilis]
Length=179

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 108/184 (59%), Gaps = 27/184 (15%)
 Frame = -2

Query  626  MGNLVSCSark----grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            MGN VSC+            AA+VI PGGE+R+  EP+KAAE+MLE P  FLVN+ SL  
Sbjct  1    MGNYVSCTLSTLGGKQPACKAAKVIFPGGELRKFDEPIKAAELMLEMPNFFLVNSCSLQI  60

Query  458  GRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVS  279
            GRRFS L+AD+DLE GNVY  FPM+R++SV+TAAD+  + + AKK+      +G   +V 
Sbjct  61   GRRFSALNADEDLEMGNVYVMFPMQRVNSVVTAADMGAIFLVAKKA-----VSGGKKRVL  115

Query  278  PAEGG-----------DETPGNDVG-------RLGVTSGFVGQEYRHRLSLCRSKKPLLE  153
            PAE G           D    + V         L     F   E+ HRLS+ RSKKPLLE
Sbjct  116  PAEAGEAAVAIGNLRKDNIDHDHVAAAPAPKLNLDDIEDFSAPEFMHRLSMSRSKKPLLE  175

Query  152  TIIE  141
            TI+E
Sbjct  176  TIVE  179



>emb|CDP02732.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 110/181 (61%), Gaps = 14/181 (8%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC  S    +++   +++ PGGEIR   EP+KAAE M E P  FLVN  SL  GR
Sbjct  1    MGNYVSCTLSGPASKQSRGIKIVFPGGEIRHFYEPMKAAEPMFETPGFFLVNTKSLQIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLS---------A  300
            RFS L+AD+DLE  NVY  FPMKR++SV+TAAD+  L + A  S AKR+S          
Sbjct  61   RFSALNADEDLEIANVYVMFPMKRVNSVVTAADLGALFIQANSS-AKRVSLKRVRILPEC  119

Query  299  GNAAKVSPAEGGDETPGNDVGRLGVTS--GFVGQEYRHRLSLCRSKKPLLETIIEEPVRT  126
               A +   +   +T    V +L +     F   E+RHRLS+CRSKKPLLETI EEPV +
Sbjct  120  NAPAALEIVQPQPKTTEAAVPKLNLDDIEEFSTPEFRHRLSMCRSKKPLLETIAEEPVCS  179

Query  125  R  123
            R
Sbjct  180  R  180



>ref|XP_006430689.1| hypothetical protein CICLE_v10012926mg [Citrus clementina]
 gb|ESR43929.1| hypothetical protein CICLE_v10012926mg [Citrus clementina]
Length=172

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 110/173 (64%), Gaps = 6/173 (3%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC  S   G+   +A+VI PGGEIR+++ P+KAAE+MLE P  FL+N+ SL  G+
Sbjct  1    MGNHISCTLSKPLGKHTRSAKVIFPGGEIRQIQTPIKAAELMLEKPNFFLINSRSLKIGQ  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFSPL+AD+DLE  NVY  FPMKR +S ITA D+A L V A K+  KR S+G       +
Sbjct  61   RFSPLNADEDLEPKNVYVMFPMKRATSKITATDMATLFVLANKA-VKRCSSGKVRNFPES  119

Query  272  E-GGDETPG--NDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            E  G+E       V +L     F   EY +RLS+ RSKKPLLETI EE    R
Sbjct  120  ESAGEEVAACTAPVPKLDDMEEFSQPEYVYRLSVSRSKKPLLETIEEETTYAR  172



>ref|XP_009599422.1| PREDICTED: uncharacterized protein LOC104095078 [Nicotiana tomentosiformis]
Length=182

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 112/183 (61%), Gaps = 16/183 (9%)
 Frame = -2

Query  626  MGNLVSCSark---grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+       +++   +VI P GEIR   +P+KAAE+MLE P  FLVN  SL  G
Sbjct  1    MGNYISCTLLGPGGNKQSRGVKVIFPSGEIRHFYQPIKAAEVMLETPNFFLVNTRSLKIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG-------  297
            RRFS L+AD+DL+ GNVYA FPMKR++S ++AAD+  LL+ A  S +KR+S G       
Sbjct  61   RRFSALNADEDLDMGNVYAMFPMKRVNSFVSAADMGALLLTA-NSVSKRVSIGSFRILPE  119

Query  296  -----NAAKVSPAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
                 +A ++   +   E        L     F   E++HRLS+CRSKKPLLETI EEPV
Sbjct  120  SCVEYSALEIVQPQANYEQQVLPKLNLDDIEEFSTPEFKHRLSMCRSKKPLLETIAEEPV  179

Query  131  RTR  123
             +R
Sbjct  180  CSR  182



>gb|ACU20604.1| unknown [Glycine max]
Length=177

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 118/183 (64%), Gaps = 21/183 (11%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      + + A RVI+P GE+++ RE VKAAE+MLEHP++FLVN+ SL  GR
Sbjct  1    MGNYVSCTLAPPLMKNSKATRVIIPTGEVKQFREIVKAAELMLEHPSYFLVNSRSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNA------  291
            RFS L AD++LESGNVY  F M+R++ V+T  D+AVL +AA  S AKRLS G A      
Sbjct  61   RFSALGADEELESGNVYIFFSMRRVNPVVTPTDMAVLFLAA-NSAAKRLSGGKARVLPDN  119

Query  290  ----AKVSPAEGGDETPGNDVGRL---GVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
                A     E   +   +++ RL   GV SGF     + RL+ CRS+KP+LETI EEPV
Sbjct  120  CDGGAWQHKEESSKDGSLSEIPRLSLEGVESGF-----QCRLNYCRSRKPVLETINEEPV  174

Query  131  RTR  123
            R R
Sbjct  175  RLR  177



>ref|XP_010274867.1| PREDICTED: uncharacterized protein LOC104610092 [Nelumbo nucifera]
Length=183

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 116/184 (63%), Gaps = 17/184 (9%)
 Frame = -2

Query  626  MGNLVSCSarkg--rkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN  SC+      R++  A+VILP GEIR+L   VKAAE+M E P +FLVN+ SL  GR
Sbjct  1    MGNYNSCTLASPPGRQSRGAKVILPSGEIRQLDGQVKAAELMFETPNYFLVNSRSLQIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L+AD+DLE GNVY  FPMKR++SVITAAD+ VL ++A  S AKR S G    +  A
Sbjct  61   RFSALNADKDLEMGNVYIMFPMKRVNSVITAADMGVLFMSA-NSAAKRASDGKVRILPEA  119

Query  272  EGGDE--TPGNDVGR------------LGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
              G+   TP + V              LG    F   E+R RLS+CRSKKPLLETI EEP
Sbjct  120  ISGNSWVTPVSAVNNSSSSEAPLPRLDLGDIEKFSTPEFRRRLSVCRSKKPLLETITEEP  179

Query  134  VRTR  123
            + +R
Sbjct  180  ICSR  183



>ref|XP_009799837.1| PREDICTED: uncharacterized protein LOC104245840 [Nicotiana sylvestris]
Length=182

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 111/183 (61%), Gaps = 16/183 (9%)
 Frame = -2

Query  626  MGNLVSCSark---grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+       ++    +VI P GEIR   +P+KAAE+MLE P  FLVN  SL  G
Sbjct  1    MGNYISCTLLGPGGNKQTRGVKVIFPSGEIRHFYQPIKAAEVMLETPNFFLVNTRSLKIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG-------  297
            RRFS L+AD+DL+ GNVYA FPMKR++S ++AAD+  LL+ A  S +KR+S G       
Sbjct  61   RRFSALNADEDLDMGNVYAMFPMKRVNSFVSAADMGALLLTA-NSVSKRVSIGSFRILPE  119

Query  296  -----NAAKVSPAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
                 +A ++   +   E        L     F   E++HRLS+CRSKKPLLETI EEPV
Sbjct  120  SCVEYSALEIVQPQANCEQQVLPKLNLDDIEEFSTPEFKHRLSMCRSKKPLLETIAEEPV  179

Query  131  RTR  123
             +R
Sbjct  180  CSR  182



>ref|XP_003536643.1| PREDICTED: uncharacterized protein LOC100794402 [Glycine max]
Length=180

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 121/187 (65%), Gaps = 26/187 (14%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      + + A RVI+P GE+++ +E VKAAE+MLEHP +FLVN+ SL  GR
Sbjct  1    MGNYVSCTLAPPLMKNSKATRVIIPTGEVKQFKEIVKAAELMLEHPNYFLVNSRSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L AD++LE GNVY  FPM+R++S++TA D+AVL +AA  S AKRLS G+ A+V P 
Sbjct  61   RFSALGADEELEFGNVYIFFPMRRVNSLVTAPDMAVLFLAA-NSAAKRLS-GSKARVLPD  118

Query  272  EGGDETPGND--------------VGRL---GVTSGFVGQEYRHRLSLCRSKKPLLETII  144
              G +                   + RL   GV SGF     ++RL+ CRS+KP+LETI 
Sbjct  119  NCGGKAWQQREEEEESSKDESLSVIPRLSLEGVESGF-----QYRLNYCRSRKPVLETIN  173

Query  143  EEPVRTR  123
            EEPVR R
Sbjct  174  EEPVRLR  180



>ref|XP_006482180.1| PREDICTED: uncharacterized protein LOC102618345 [Citrus sinensis]
 gb|KDO63178.1| hypothetical protein CISIN_1g040603mg [Citrus sinensis]
Length=172

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 110/173 (64%), Gaps = 6/173 (3%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC  S   G+   +A+VI PGGEIR+++ P+KAAE+MLE P  FL+N+ SL  G+
Sbjct  1    MGNHISCTLSKPLGKHTRSAKVIFPGGEIRQIQTPIKAAELMLEKPNFFLINSRSLKIGQ  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFSPL+AD+DLE  NVY  FPMKR +S ITA D+A L V A K+  KR S+G       +
Sbjct  61   RFSPLNADEDLEPKNVYVMFPMKRATSKITATDMATLFVLANKA-VKRCSSGKVRNFPES  119

Query  272  E-GGDETPG--NDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            E  G+E       + +L     F   EY +RLS+ RSKKPLLETI EE    R
Sbjct  120  ESAGEEVAACTAPMPKLDDMEEFSQPEYVYRLSVSRSKKPLLETIEEETTYAR  172



>ref|XP_008229288.1| PREDICTED: uncharacterized protein LOC103328658 [Prunus mume]
Length=248

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 106/195 (54%), Gaps = 31/195 (16%)
 Frame = -2

Query  629  NMGNLVSCSarkg---rkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            +MGN VSC+          AA +VI+P GEI++   P+KAAE+MLE P  FLVN  SL  
Sbjct  51   DMGNYVSCTLSTQIAKNSKAATKVIVPSGEIKQFYVPMKAAELMLETPNFFLVNTKSLHI  110

Query  458  GRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVS  279
            GRRFS L+AD+DLE G+VY  FPMKRL+S +T AD+  L + A  S  KRLS G   +V 
Sbjct  111  GRRFSALNADEDLEIGDVYVMFPMKRLNSTVTPADMGALFLTA-SSATKRLS-GRNVRVQ  168

Query  278  PAEGG--------------------------DETPGNDVGRLGVTSGFVGQEYRHRLSLC  177
            PAE                            D         L     F   E+ HRLS+C
Sbjct  169  PAEDKSGELDDDDDDEEEEDNKRMENWRENLDHEAAKPKLNLDDIEDFSAPEFMHRLSMC  228

Query  176  RSKKPLLETIIEEPV  132
            RSKKPLLETI EEPV
Sbjct  229  RSKKPLLETIAEEPV  243



>ref|XP_007033135.1| Uncharacterized protein TCM_019323 [Theobroma cacao]
 gb|EOY04061.1| Uncharacterized protein TCM_019323 [Theobroma cacao]
Length=179

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 106/181 (59%), Gaps = 15/181 (8%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC  S   G+ + A +VILP GEIR+  EP+KAAE+MLE P  FLVN+ SL  G 
Sbjct  1    MGNYVSCTLSTPLGKSSKATKVILPSGEIRQFNEPIKAAELMLETPNFFLVNSQSLKLGC  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFSPL AD+DLE  NVY  FPMKR++S +TA D+  L +AA  +  K    G   ++ P 
Sbjct  61   RFSPLHADEDLEFANVYVMFPMKRVNSTVTAGDMGALFLAANSAAKKGF--GGEVRILPE  118

Query  272  -----------EGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRT  126
                       E  +ET       L     F    + HRLS+ RSKKPLLETI EEPVR 
Sbjct  119  AEEPNLRDVSLENIEETEKMPKLNLDDIEEFSTPGFMHRLSMSRSKKPLLETIAEEPVRA  178

Query  125  R  123
            R
Sbjct  179  R  179



>ref|XP_007216061.1| hypothetical protein PRUPE_ppa017741mg [Prunus persica]
 gb|EMJ17260.1| hypothetical protein PRUPE_ppa017741mg [Prunus persica]
Length=197

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 109/194 (56%), Gaps = 31/194 (16%)
 Frame = -2

Query  626  MGNLVSCSarkg---rkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN VSC+          AA +VI+P GEI++   P+KAAE+MLE P  FLVN  SL  G
Sbjct  1    MGNYVSCTLSTQIAKNSKAATKVIVPTGEIKQFYVPMKAAELMLETPNFFLVNTKSLHIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRFS L+AD+DLE G VY  FPMKRL+S++T AD+  L + A  S AKRLS G   +V P
Sbjct  61   RRFSALNADEDLEIGEVYVMFPMKRLNSIVTPADMGALFLTAS-SAAKRLS-GRNMRVQP  118

Query  275  AE----------------------GGDETPGNDVGR----LGVTSGFVGQEYRHRLSLCR  174
            AE                         E   ++  +    L     F   E+ HR+S+CR
Sbjct  119  AEDQSGELADDDDEEEEEDNKRMENWRENLEHEAAKPKLNLDDIEDFSAPEFMHRVSMCR  178

Query  173  SKKPLLETIIEEPV  132
            SKKPLLETI EEPV
Sbjct  179  SKKPLLETIAEEPV  192



>ref|XP_004305524.1| PREDICTED: uncharacterized protein LOC101304025 [Fragaria vesca 
subsp. vesca]
Length=170

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 98/171 (57%), Gaps = 12/171 (7%)
 Frame = -2

Query  626  MGNLVSCSarkgrk------aaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSL  465
            MGN +SC                 +V++P GEIR L EPVKAAE+MLE P  FLVN   L
Sbjct  1    MGNYISCRLSVSNTGGGKHCKKVTKVVVPSGEIRELNEPVKAAEVMLETPNFFLVNTKCL  60

Query  464  TAGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAK  285
              G RFS L+AD DLE G+VY  FPMKRL+S +T++D++ L + A  +P  +        
Sbjct  61   HMGSRFSALNADHDLEMGSVYVMFPMKRLNSTVTSSDMSALFLTAVATPKPKRQLSAHRN  120

Query  284  VSPAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
            ++  E  D+   +D+        F   E+ HRLS+ RSKKPLLETI EE V
Sbjct  121  MNWQEATDKLNLDDIQE------FSAPEFMHRLSMTRSKKPLLETITEETV  165



>ref|XP_010046535.1| PREDICTED: uncharacterized protein LOC104435497 [Eucalyptus grandis]
Length=186

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 115/189 (61%), Gaps = 24/189 (13%)
 Frame = -2

Query  626  MGNLVSCS-----arkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLT  462
            MGN +SC+         + +  ARVI PGGE+++ REPV AAE+MLE P +FL ++ SL 
Sbjct  1    MGNYISCTFVAPPLMMKKGSRVARVIFPGGEMKKFREPVNAAELMLECPGYFLASSRSLH  60

Query  461  AGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKV  282
             GRRF+ L AD++LE G+VY  FPM+R++SV+TA DVA + VAA   P KR+S G   +V
Sbjct  61   VGRRFAALGADEELELGDVYLMFPMRRVNSVVTAGDVAAMFVAASTGP-KRIS-GAKVRV  118

Query  281  SPAEGGDETPGNDVG----------------RLGVTSGFVGQEYRHRLSLCRSKKPLLET  150
            SP   G E+P                     RL    GF   EY+HRLS+CRS++P+LET
Sbjct  119  SPESAG-ESPEGAAATAATGESLQKEDETRPRLEEVEGFPLVEYKHRLSVCRSRRPMLET  177

Query  149  IIEEPVRTR  123
            I EE V  R
Sbjct  178  ITEEAVFAR  186



>ref|XP_003525687.1| PREDICTED: uncharacterized protein LOC100783889 [Glycine max]
 gb|KHN27484.1| hypothetical protein glysoja_022193 [Glycine soja]
Length=161

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaa---RVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+      +      +VI P GEI +L E VKAAE+MLE P+ F+V+  SL  G
Sbjct  1    MGNYISCTLSTAGSSKHWRGIKVIFPSGEIEQLEEGVKAAELMLEMPSFFVVDTRSLQIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRFS L+AD++LE GNVY   PMKRL+S++ A+D+  LL+ AK+  AK        KV P
Sbjct  61   RRFSALNADEELECGNVYVMLPMKRLNSLVKASDMGALLLTAKRVSAK--------KVIP  112

Query  275  AEGGDE--TPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            AE   E     +D+        F   E+ HRLS+ RSKKPLLETI EEPV +R
Sbjct  113  AEKEPELKLDCDDIQE------FSSPEFMHRLSMSRSKKPLLETIAEEPVSSR  159



>ref|XP_008243324.1| PREDICTED: uncharacterized protein LOC103341559 [Prunus mume]
Length=190

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 116/192 (60%), Gaps = 26/192 (14%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + +ARVI P   +R+ REP+KAAE+MLE P  FL N+ SL  GR
Sbjct  1    MGNYISCTLATPLIKSSKSARVIFPNSAVRQFREPIKAAELMLECPGTFLANSQSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L AD++LE GNVY  FPM+RLSS++TAAD+AV  +AA  S AKR+S G   ++ P 
Sbjct  61   RFSALGADEELEFGNVYIMFPMRRLSSIVTAADMAVFFMAA-NSAAKRISGGK-VRILPE  118

Query  272  EG--GDETPGNDVGR--------------------LGVTSGFVGQEYRHRLSLCRSKKPL  159
             G  G E  G + G+                    L    G    E+++RL+ CRS+KP+
Sbjct  119  NGREGGEMVGAESGKESHDDQDQDGKGDRGPLRLSLDGVEGLQVAEFQYRLAACRSRKPV  178

Query  158  LETIIEEPVRTR  123
            LETI EEP+ +R
Sbjct  179  LETIKEEPISSR  190



>ref|XP_011097152.1| PREDICTED: uncharacterized protein LOC105176137 [Sesamum indicum]
Length=173

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 104/179 (58%), Gaps = 17/179 (9%)
 Frame = -2

Query  626  MGNLVSCSar---kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN  SC+           A +VI P GE+RR+  P KAAE+MLE P  FL  A  L  G
Sbjct  1    MGNYASCTLSGPVSKSFIRATKVIFPSGEVRRMYHPTKAAELMLEVPGFFLSEAKCLRIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            +R + L+AD+DLE G VY  FPMKRL+S +TA D+  L +AA  S A+R+S     +V P
Sbjct  61   KRLAALAADEDLEIGGVYVFFPMKRLNSAVTAGDMGALFMAA-NSAARRVS-----RVLP  114

Query  275  AEGGDETPGNDVGRLGVTSG--------FVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              GGD       G+   T          F   E++HRLS+CRSKKPLLETI+EEPV  R
Sbjct  115  ESGGDVEVVRSGGKCAATGKLNLDEIEEFSTPEFKHRLSMCRSKKPLLETIVEEPVCLR  173



>ref|XP_007225904.1| hypothetical protein PRUPE_ppa011934mg [Prunus persica]
 gb|EMJ27103.1| hypothetical protein PRUPE_ppa011934mg [Prunus persica]
Length=190

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 115/192 (60%), Gaps = 26/192 (14%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + +ARVI P   +R+ REP+KAAE+MLE P  FL N+ SL  GR
Sbjct  1    MGNYISCTLATPLIKSSKSARVIFPNSAVRQFREPIKAAELMLECPGTFLANSQSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L AD++LE GNVY  FPM+RLSS++TAAD+AV  +AA  S AKR+S G   ++ P 
Sbjct  61   RFSALGADEELEFGNVYLMFPMRRLSSIVTAADMAVFFMAA-NSAAKRISGGK-VRILPE  118

Query  272  EG--GDETPGNDVGR--------------------LGVTSGFVGQEYRHRLSLCRSKKPL  159
             G  G E  G + G                     L    G    E+++RL+ CRS+KP+
Sbjct  119  NGREGGEMVGVESGEESHDDQDQDGKGDRGPLRLSLDGVEGLQVAEFQYRLAACRSRKPV  178

Query  158  LETIIEEPVRTR  123
            LETI EEP+ +R
Sbjct  179  LETIKEEPISSR  190



>ref|XP_003555690.1| PREDICTED: uncharacterized protein LOC100794800 [Glycine max]
 gb|KHM99007.1| hypothetical protein glysoja_024307 [Glycine soja]
Length=170

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 113/173 (65%), Gaps = 8/173 (5%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPV-KAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+      +   AARVI P GE+++ +E V   AE+M+E PTHFL N+ SL  G
Sbjct  1    MGNYISCTLAPPLMKNTRAARVIFPTGEVKQYKEQVINVAELMMECPTHFLANSNSLHIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRFSPL AD++LE GNVY  FPM+RL+SV+TAADVAVL +AA  + AKR++  N   +  
Sbjct  61   RRFSPLGADEELECGNVYIFFPMRRLNSVVTAADVAVLFMAANMT-AKRIT--NDKDLMS  117

Query  275  AEGGDETPG--NDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
             +   E  G  +DV RL +    V   +R+R S CRS+KP LETI EEP+  R
Sbjct  118  CDHLAEGVGTNDDVPRLSLEGVEVESGFRNRFSYCRSRKPALETINEEPIWLR  170



>ref|XP_008800930.1| PREDICTED: uncharacterized protein LOC103715169 [Phoenix dactylifera]
Length=178

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 114/182 (63%), Gaps = 15/182 (8%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC  S   G    A  VILPGGE+RR+   V AAE+ML+ P HFLVN  S+  GR
Sbjct  1    MGNYVSCTLSVGAGGSTGAITVILPGGEVRRMEGLVNAAELMLDAPGHFLVNTRSMQVGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RF+ LSAD+DLE G+VY   PMKRL+SVITAAD+AVLL+AA K   +R S GN ++V PA
Sbjct  61   RFAALSADEDLEMGDVYVMMPMKRLNSVITAADMAVLLLAANKK-VRRASGGN-SRVLPA  118

Query  272  ---------EGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTRV  120
                       G E    D     +T+    +++++R  LCRS+KP LETI EE + +R 
Sbjct  119  CTSSSPKNPLAGHELDEVDDDVPTMTTAMAMEDFKYR--LCRSRKPTLETIEEEGISSRR  176

Query  119  RL  114
             L
Sbjct  177  EL  178



>ref|XP_010062223.1| PREDICTED: uncharacterized protein LOC104449684 [Eucalyptus grandis]
 gb|KCW69319.1| hypothetical protein EUGRSUZ_F02810 [Eucalyptus grandis]
Length=176

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 113/176 (64%), Gaps = 13/176 (7%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN  SC  S   GR++ AA+VI PGGE+++   P KAAE+MLE P++FLVN  SL AGR
Sbjct  1    MGNYASCALSGPAGRQSRAAKVIFPGGEVQQFHAPTKAAELMLETPSYFLVNTRSLRAGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RFS L+AD+DLE  NVY  FPM+RL+S +TAAD+  L +AA  +  K  ++G +   +  
Sbjct  61   RFSALNADEDLEMANVYVMFPMRRLNSFVTAADMGALFLAASSAAKKGGASGGSRVGALP  120

Query  272  EGGDETPG---------NDVGRLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
            E G++  G           V +L +    GF  QE+ HRLS+ +SKKPLLETI E+
Sbjct  121  EAGEKREGEAEAEAAAAAAVPKLNLEEIEGFSTQEFMHRLSMSKSKKPLLETITED  176



>ref|XP_003529256.1| PREDICTED: uncharacterized protein LOC100790460 [Glycine max]
Length=170

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 111/173 (64%), Gaps = 14/173 (8%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPV-KAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+      +   A RVI P GE+++ +E V  AAE+MLE PTHFL N+ SL  G
Sbjct  1    MGNYISCTLAPPLMKNTRAKRVIFPTGEVKQYKEQVINAAELMLECPTHFLTNSKSLHIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSA-----GNA  291
            RRFSPL AD++LE GNVY  FPM+RL+S++TAADVAVL +AA  +  KR+S+        
Sbjct  61   RRFSPLGADEELECGNVYIFFPMRRLNSMVTAADVAVLFMAANMA-TKRISSREDLISRD  119

Query  290  AKVSPAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
              +      DE P   +  L V SGF     R+RLS CRS+KP+LETI EEP+
Sbjct  120  HSIDVIGINDEVPRLSLEGLEVESGF-----RNRLSYCRSRKPVLETINEEPI  167



>ref|XP_008360149.1| PREDICTED: uncharacterized protein LOC103423846 [Malus domestica]
Length=189

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 115/191 (60%), Gaps = 25/191 (13%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + +ARVI P G++R+ RE VKAAE+MLE P  FL N+ SL  GR
Sbjct  1    MGNYISCTLATPMIKSSKSARVIFPNGDVRQFREMVKAAELMLECPNTFLANSRSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP-  276
            RFS LSAD++LE GNVY  FPM+RLSS++TAAD+AV  +AA  S AKR+S G   ++ P 
Sbjct  61   RFSALSADEELEFGNVYIMFPMRRLSSIVTAADMAVFFMAA-NSAAKRISGGQ-VRILPE  118

Query  275  ----------AEGGDETPGNDVGR----------LGVTSGFVGQEYRHRLSLCRSKKPLL  156
                       E G E  G+              L    G    E+++RL+ CRS+KP+L
Sbjct  119  SGSGGGEVGAVESGKENLGDQDHEGDHQGPLRLSLDGVEGLQVAEFQYRLAACRSRKPVL  178

Query  155  ETIIEEPVRTR  123
            ETI EE + +R
Sbjct  179  ETIKEEQICSR  189



>ref|XP_010693577.1| PREDICTED: uncharacterized protein LOC104906507 [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 106/172 (62%), Gaps = 11/172 (6%)
 Frame = -2

Query  626  MGNLVSCSarkgr-kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+      K  +A+VILP GEI++ ++ +KAAE+MLE P +FLVN+ SL  G+R
Sbjct  1    MGNYASCALSTQFGKNKSAKVILPSGEIKQFQQSIKAAELMLEIPNYFLVNSKSLQIGKR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA-  273
            FS L+AD+DLE GNVY  F MKR++S + AAD+  + + AK+   K        +V P+ 
Sbjct  61   FSALNADEDLEMGNVYVMFGMKRVNSFVNAADMGAVYLVAKRGARK-------VRVVPSY  113

Query  272  --EGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              E        D   +      +  E+ HR S+CRSKKP+LETI+EEPV +R
Sbjct  114  SIESDSPAREEDAPEIKAEIEELLSEFTHRRSVCRSKKPVLETIVEEPVFSR  165



>ref|XP_007150876.1| hypothetical protein PHAVU_004G001600g [Phaseolus vulgaris]
 gb|ESW22870.1| hypothetical protein PHAVU_004G001600g [Phaseolus vulgaris]
Length=160

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 104/170 (61%), Gaps = 13/170 (8%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC  SA   R     +V+ P GE+++  E VKAAE+MLE P+ F+VN  SL  GR
Sbjct  1    MGNYISCTLSAAGNRHWRGIKVVFPSGEVQKFEEGVKAAELMLEMPSFFVVNTRSLQIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RF  L+AD++LE GNVY   PMKRL+SV+T +D+  LL+ AK+  AK        +V+P 
Sbjct  61   RFCALNADEELECGNVYVMHPMKRLNSVVTPSDMGALLLTAKRVTAK-------VRVAPE  113

Query  272  EGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            +  +E       +L     F   E+ HRLS+ RSKKPLLETI EE V  R
Sbjct  114  KEAEEAK----LKLDGIEEFSSPEFMHRLSISRSKKPLLETIAEEAVCAR  159



>ref|XP_009418419.1| PREDICTED: uncharacterized protein LOC103998624 [Musa acuminata 
subsp. malaccensis]
Length=171

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 115/173 (66%), Gaps = 7/173 (4%)
 Frame = -2

Query  626  MGNLVSCSarkg--rkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+       +A + +VILP G +RR+  P+ AAEIML+ P HFLV++ S+  GR
Sbjct  1    MGNYVSCTLAGAPGIRARSTKVILPDGRVRRIEAPINAAEIMLDEPGHFLVDSRSMHVGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RF+PL+AD+DLE G+VYA FPMKR ++V+ AAD+AVLL+AA+K   + L  G+ A+V P 
Sbjct  61   RFAPLAADEDLEMGHVYAMFPMKRANAVVAAADMAVLLMAAQKEVRREL--GHGARVLPE  118

Query  272  EGGDETPGNDVGRLGVTSGFVGQ---EYRHRLSLCRSKKPLLETIIEEPVRTR  123
                  P  D+  +   S        E+++RLS+CRS++P LETI EE + +R
Sbjct  119  MAERSVPKPDLESMTEASEPAAVEIGEFKYRLSMCRSRRPTLETITEEGICSR  171



>gb|KDP33032.1| hypothetical protein JCGZ_13063 [Jatropha curcas]
Length=195

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 109/187 (58%), Gaps = 20/187 (11%)
 Frame = -2

Query  626  MGNLVSCSarkg---rkaaaaRVILPGGEIRRLR----EPVKAAEIMLEHPTHFLVNAGS  468
            MGN VSC        + +   ++ILP GEIR+++    +P KAAE+MLE P  F+VN  S
Sbjct  1    MGNYVSCKLANPLVPKNSKLTKIILPTGEIRQIQYHHQQPTKAAELMLETPNFFIVNTKS  60

Query  467  LTAGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAA  288
            L   RRF PL+AD DLE  NVY  FPM+R  + +TA+D+  L + A  S  KR+S G   
Sbjct  61   LKIDRRFCPLNADDDLEKANVYVMFPMQRKDTKVTASDLGALFMTA-NSALKRVSGGK-V  118

Query  287  KVSPAEGGDETPGND---------VGRLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIE  141
            +V P    D T  ++         V RL +         E+RHR+S+ RSKKPLLETI E
Sbjct  119  RVRPDITADNTVDDERRKSDDEVVVPRLSLEGIEEVSTPEFRHRMSMSRSKKPLLETIEE  178

Query  140  EPVRTRV  120
            EP+R+R+
Sbjct  179  EPIRSRL  185



>ref|XP_009341324.1| PREDICTED: uncharacterized protein LOC103933362 [Pyrus x bretschneideri]
Length=201

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 107/194 (55%), Gaps = 30/194 (15%)
 Frame = -2

Query  626  MGNLVSCSarkgrka-----aaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLT  462
            MGN +SCS      +     AA +VI+P GEI++   P+KAAE ML+ P  FLVN  SL 
Sbjct  1    MGNYISCSLVTPILSKLGKPAATKVIIPSGEIKQFHVPIKAAEPMLDTPNFFLVNTKSLR  60

Query  461  AGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadv-avllvaAKKSPAKRLSAGNAAK  285
             GRRFSPL+AD+DL+ G+VY  FPM RL+S +T AD+  + L A   S A + ++G   K
Sbjct  61   VGRRFSPLNADEDLDIGDVYVMFPMIRLNSTVTTADMGPLFLKATVASSASKRASGRNVK  120

Query  284  VSPA-----------EGGDETPGNDVGR-------------LGVTSGFVGQEYRHRLSLC  177
            V PA           + GDE    +  R             L     F   E+ HRLS+ 
Sbjct  121  VRPADDHHQATKFARDDGDEGKMIESWRESSDNEAVMPKLNLDDIEDFSAPEFMHRLSMS  180

Query  176  RSKKPLLETIIEEP  135
            RSKKPLLETI EEP
Sbjct  181  RSKKPLLETIAEEP  194



>ref|XP_011021323.1| PREDICTED: uncharacterized protein LOC105123433 [Populus euphratica]
Length=178

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 108/179 (60%), Gaps = 12/179 (7%)
 Frame = -2

Query  626  MGNLVSCSark----grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            MGN VSC+          + + +VILP GEI+++++P KAAE+MLE P  F+VN+ SL  
Sbjct  1    MGNYVSCTLSNPQGRKNSSKSTKVILPTGEIKKIQQPTKAAELMLEAPNFFIVNSKSLKI  60

Query  458  GRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGN-----  294
            GRRF PLSAD +L   +VY  FPM++ +SV+TA D+  L V A  S  KR S GN     
Sbjct  61   GRRFCPLSADYELGKADVYVMFPMRKKNSVVTAGDMGALFVTA-NSVMKRASKGNIRVLP  119

Query  293  AAKVSPAEGGDETPGNDVGRLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
             +KV   +  +    ++  RL +         E  HR+S+ RSKKPLLETI EEP+R++
Sbjct  120  ESKVEIPQDMERDDIDEAPRLSLEGIEDVSAHELIHRMSISRSKKPLLETIEEEPIRSK  178



>ref|XP_009587579.1| PREDICTED: uncharacterized protein LOC104085282 [Nicotiana tomentosiformis]
Length=180

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 108/182 (59%), Gaps = 16/182 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgr---kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+        ++   +VI P GEIR + + +KAAE+MLE P  FLVN+ SL  G
Sbjct  1    MGNYISCTLLAQVGNKQSRIVKVIFPNGEIRNIHQQIKAAELMLETPNFFLVNSKSLHIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRF  L+AD+DLE  NVY  FPMKRL+S+++AAD+  L + A  S AKR+S     K+ P
Sbjct  61   RRFFALNADEDLEMANVYVMFPMKRLNSLVSAADLGALFLTA-NSIAKRVSFKR-VKILP  118

Query  275  ------AEGGDETPGNDVG-----RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
                   +  +  P  D       +L     F   E++H L +CRSKKPLLETIIEE + 
Sbjct  119  ECTEFAVDIEEPKPKYDKIALPKLKLEDIEEFSTPEFKHMLLMCRSKKPLLETIIEESIC  178

Query  128  TR  123
            +R
Sbjct  179  SR  180



>ref|XP_009371843.1| PREDICTED: uncharacterized protein LOC103961061 [Pyrus x bretschneideri]
Length=198

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 108/191 (57%), Gaps = 27/191 (14%)
 Frame = -2

Query  626  MGNLVSCSarkgr-----kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLT  462
            MGN +SCS          KAAA +VI+P GEI++   P+KAAE+M++ P  FLVN  SL 
Sbjct  1    MGNYISCSLATQILSKHGKAAATKVIVPSGEIKQFNVPIKAAELMVDTPNFFLVNVQSLH  60

Query  461  AGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKV  282
             GRRFS LSAD++L+ GNVY  FPMKRL+S +T AD+  L + A    A + ++G   +V
Sbjct  61   VGRRFSHLSADEELDIGNVYVMFPMKRLNSTVTTADIGPLFLTAAAGSASKRASGRNVRV  120

Query  281  SPA---------EGGDE-----TPGNDVGRLGVT--------SGFVGQEYRHRLSLCRSK  168
             PA           GDE     + G  +     T          F   E+ HRLS+ RSK
Sbjct  121  RPAYHHQSMKFGNEGDECKRIKSWGKSLEHEAATPKLNLDDIEDFSAPEFMHRLSMSRSK  180

Query  167  KPLLETIIEEP  135
            KPLL+TI EEP
Sbjct  181  KPLLDTIAEEP  191



>ref|XP_008787612.1| PREDICTED: uncharacterized protein LOC103705608 [Phoenix dactylifera]
Length=175

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 115/176 (65%), Gaps = 9/176 (5%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLRE-PVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN VSC  S     +A A +VILP G++RR+ + PV AAEIML+ P HFLVN+ S+  G
Sbjct  1    MGNYVSCALSTVPSSRARAVKVILPSGDVRRIIDGPVNAAEIMLDTPGHFLVNSRSMQLG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRF+ LSAD+DLE G+V+   PMKRL+S+ITAAD+A LL+AA K   K     +++  S 
Sbjct  61   RRFAALSADEDLEMGDVFVMMPMKRLNSIITAADMARLLLAANKEVRKSRVQPDSSSSSS  120

Query  275  AEGGDETPG-----NDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            ++G    P      +DV    V +     E+++RLS+CRS+KP LETI EE + +R
Sbjct  121  SQGSPANPVAAPALDDVDD-DVPTAMGTGEFKYRLSMCRSRKPTLETIAEEGIISR  175



>ref|XP_008340272.1| PREDICTED: uncharacterized protein LOC103403221 [Malus domestica]
Length=189

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 112/190 (59%), Gaps = 23/190 (12%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + +ARVI P G++R+ RE  KAAE+MLE P  FL N+ SL  GR
Sbjct  1    MGNYISCTLATPMIKSSKSARVIFPNGDVRQFRETTKAAELMLECPNTFLANSTSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGN-------  294
            RFS LSAD++LE GN Y  FPM+RLSS++TAAD+AV  +AA  S AKR+S          
Sbjct  61   RFSALSADEELEFGNAYIMFPMRRLSSIVTAADMAVFFMAA-NSAAKRISGWKVRILPES  119

Query  293  ---AAKVSPAEGGDETPGNDVGR----------LGVTSGFVGQEYRHRLSLCRSKKPLLE  153
                 +V+  E G E  G+              L    G    E+R+RL+  RS+KP+LE
Sbjct  120  GCGGGEVAAVESGKENHGDKDHEGDHQGPLRLSLDGVEGLQVAEFRYRLAASRSRKPVLE  179

Query  152  TIIEEPVRTR  123
            TI EEP+ +R
Sbjct  180  TIKEEPIGSR  189



>ref|XP_009358897.1| PREDICTED: uncharacterized protein LOC103949506 [Pyrus x bretschneideri]
Length=189

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 111/190 (58%), Gaps = 23/190 (12%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + +ARVI P G++R+ RE  KAAE+MLE P  FL N+ SL  GR
Sbjct  1    MGNYISCTLATPMIKSSKSARVIFPNGDVRQFRETTKAAELMLECPNAFLANSTSLQMGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNA------  291
            RFS L+AD++LE GNVY  FPM+RLSS++TAAD+AV  +AA  S  KR+S          
Sbjct  61   RFSALTADEELEFGNVYIMFPMRRLSSIVTAADMAVFFMAA-NSATKRISGWKVRILPES  119

Query  290  ----AKVSPAEGGDETPGNDVGR----------LGVTSGFVGQEYRHRLSLCRSKKPLLE  153
                 +V   E G E  G+              L    G    E+++RL+  RS+KP+LE
Sbjct  120  GGGGGEVVAVESGKENHGDQDHEGDHQGPLRLSLDGVEGLQVAEFQYRLAASRSRKPVLE  179

Query  152  TIIEEPVRTR  123
            TI EEP+ +R
Sbjct  180  TIKEEPIGSR  189



>ref|XP_008381292.1| PREDICTED: uncharacterized protein LOC103444153 [Malus domestica]
Length=198

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 109/193 (56%), Gaps = 31/193 (16%)
 Frame = -2

Query  626  MGNLVSCSarkgr-----kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLT  462
            MGN +SCS          KAAA +VI+P GEI++   P+KAAE+M++ P  FLVN  SL 
Sbjct  1    MGNYISCSLATQILSKHGKAAATKVIVPSGEIKQFNVPIKAAELMVDTPNFFLVNIKSLH  60

Query  461  AGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKV  282
             GRRFS LSAD++L+ GNVY  FPMKRL+S +T AD+  L + A    A + ++G   +V
Sbjct  61   VGRRFSHLSADEELDIGNVYVMFPMKRLNSTVTTADMGPLFLTAAAGSASKRASGRNVRV  120

Query  281  SPAEG------GDETPGNDVGR------------------LGVTSGFVGQEYRHRLSLCR  174
              A+       G+E  G++  R                  L     F   E+ HRLS+ R
Sbjct  121  RRADHRQSMKFGNE--GDECKRIKSWGKSLEHEAAAPKLNLDDIEDFSAPEFMHRLSMSR  178

Query  173  SKKPLLETIIEEP  135
            SKKPLL+TI EEP
Sbjct  179  SKKPLLDTIAEEP  191



>ref|XP_006383374.1| hypothetical protein POPTR_0005s14980g [Populus trichocarpa]
 gb|ERP61171.1| hypothetical protein POPTR_0005s14980g [Populus trichocarpa]
Length=178

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 106/179 (59%), Gaps = 12/179 (7%)
 Frame = -2

Query  626  MGNLVSCSark----grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            MGN VSC+          + + +VILP GEI+++++P KAAE+MLE P  F+VN+ SL  
Sbjct  1    MGNYVSCTLSNPQGLRNSSKSTKVILPTGEIKKIQQPTKAAELMLEAPNFFIVNSKSLKI  60

Query  458  GRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNA----  291
            G RF PL AD +L   +VY  FPM++ +SV+TA D+  L V A  S  KR S GN     
Sbjct  61   GSRFCPLGADYELGKADVYVMFPMRKKNSVVTAGDMGALFVTA-NSVMKRASKGNMRVLP  119

Query  290  -AKVSPAEGGDETPGNDVGRLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
             +KV   +  +    ++  RL +         E  HR+S+ RSKKPLLETI EEP+R+R
Sbjct  120  KSKVEIPQDMERDDIDEAPRLSLEGIEDVSAHELIHRMSMSRSKKPLLETIEEEPIRSR  178



>ref|XP_010317753.1| PREDICTED: uncharacterized protein LOC104646198 [Solanum lycopersicum]
Length=171

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 110/174 (63%), Gaps = 11/174 (6%)
 Frame = -2

Query  626  MGNLVSCSarkg---rkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN VSC+       +++ + +VI P GEIR +   +KAAE+MLE P  F+VN+ SL  G
Sbjct  1    MGNYVSCTLLVQGGNKQSRSTKVIFPNGEIRNVHPQIKAAEVMLETPNFFIVNSRSLHIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            +RF  L+AD+DLE  NVY  FPM++L+S ++AAD+  L + A  + +K++S G  AK+ P
Sbjct  61   KRFFALNADEDLEIANVYVMFPMQKLNSFVSAADLGALFLTA-NTVSKKVSFGR-AKILP  118

Query  275  AEGGDETPGNDVG-----RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
             E  +E   +D       +L     F   +++  LS+CRSKKPLLETI+EEP R
Sbjct  119  -EYTEEPKFDDKIDLPKLKLDDIEEFSTPQFKKMLSMCRSKKPLLETIVEEPSR  171



>emb|CDY50689.1| BnaC05g47940D [Brassica napus]
Length=174

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 106/176 (60%), Gaps = 15/176 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaa------aaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSL  465
            MGN VSC+  K   +       AA+VILP GE+R +  P KAAE+M+E  +HFLVN  SL
Sbjct  1    MGNYVSCALSKTTSSNSSSSSPAAKVILPDGEVRDINVPTKAAELMMEMSSHFLVNVKSL  60

Query  464  TAGRRFSPLSADQDLESG--NVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNA  291
              GR+F PL+AD DL+ G  +VY AFPM R++S   A+D+A + +A K    KRL + + 
Sbjct  61   KTGRKFIPLAADDDLDVGGCHVYVAFPMTRVASAANASDMARIFMAGK----KRLRSCDN  116

Query  290  AKVSPAEGGDETPGNDVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
             KVSP E  DE      G    L     F   E+ HR+S+ +SKKP LETI+EE V
Sbjct  117  RKVSPEEEEDENARLVKGTKLNLEDIEDFSAVEFMHRISVSKSKKPELETIVEENV  172



>ref|XP_009107504.1| PREDICTED: uncharacterized protein LOC103833162 [Brassica rapa]
Length=184

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 111/181 (61%), Gaps = 18/181 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN VS +  K   + AARVILP GE+RR+ EP KAAE+M+E P+ FLV+A SL  GR+F
Sbjct  1    MGNYVSSALSKTSSSPAARVILPDGEVRRIHEPTKAAELMMEIPSFFLVDAKSLKIGRKF  60

Query  446  SPLSADQDLE--SGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRL---SAGNAAKV  282
            +PL+AD DL+  S +VY AFPM R +S   A+D+A L  AAKK    R+   S+G    V
Sbjct  61   NPLAADDDLQIKSCHVYIAFPMTRATSAANASDMARLFAAAKKQQRSRVGPKSSGVGTAV  120

Query  281  SPAEGGDETPG---NDVGRLGVTSG----------FVGQEYRHRLSLCRSKKPLLETIIE  141
                 G  +P    +DV  + +++G          F   E+ HR+S+ +SKKP LETI+E
Sbjct  121  KSCHNGRVSPDGGEDDVKMISLSAGSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIVE  180

Query  140  E  138
            E
Sbjct  181  E  181



>emb|CDY38422.1| BnaA10g17360D [Brassica napus]
Length=166

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 107/175 (61%), Gaps = 24/175 (14%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN VS +  K   + AARVILP GE+RR+ EP KAAE+M+E P+ FLV+A SL  GR+F
Sbjct  1    MGNYVSSALSKTSSSPAARVILPDGEVRRIHEPTKAAELMMEIPSFFLVDAKSLKIGRKF  60

Query  446  SPLSADQDLE--SGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            +PL+AD DL+  S +VY AFPM R +S   A+D+A L  AAKK    R        V P 
Sbjct  61   NPLAADDDLQIKSCHVYIAFPMTRATSAANASDMARLFAAAKKQQRSR--------VGPK  112

Query  272  EGGDETPGNDVGRLGVTSG----------FVGQEYRHRLSLCRSKKPLLETIIEE  138
              G+    +DV  + +++G          F   E+ HR+S+ +SKKP LETI+EE
Sbjct  113  SSGE----DDVKMISLSAGSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIVEE  163



>ref|XP_008343032.1| PREDICTED: uncharacterized protein LOC103405798 [Malus domestica]
Length=194

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 98/170 (58%), Gaps = 25/170 (15%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI+P GEI++   P+KAAE+ML+ P  FLVN  SL  GRRFSPL+AD+DL+ G+VY  FP
Sbjct  18   VIIPNGEIKQFHVPIKAAELMLDTPNFFLVNTKSLRVGRRFSPLNADEDLDIGDVYVXFP  77

Query  389  MKRLSSVITaadv-avllvaAKKSPAKRLSAGNAAKVSPA-----------EGGD-----  261
            M RL+S +T AD+  + L A   S A + ++G   KV PA           + GD     
Sbjct  78   MIRLNSTVTTADMGJLFLKATAASSASKRASGRNVKVRPADDPHQATKFAHDDGDEGKMI  137

Query  260  ----ETPGNDVG----RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
                E+  N+       L     F   E+ HRLS+ RSKKPLLETI EEP
Sbjct  138  ESWRESSDNEAAMPKLNLDDIEDFSAPEFMHRLSMSRSKKPLLETIAEEP  187



>ref|XP_002528053.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34303.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 106/179 (59%), Gaps = 17/179 (9%)
 Frame = -2

Query  626  MGNLVSCSark----grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            MGN  SC            +  +VI P GEI+++ +P KAAE+M+E P  F+ N+ ++  
Sbjct  1    MGNYASCKLANPLHIKNSKSTTKVIFPTGEIKQINQPTKAAELMMETPNFFITNSKTMKI  60

Query  458  GRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVS  279
            G+RF PL+AD DL+ G VY  FPM + +S +TA+D+  L + A  S  KR+S+G   +V 
Sbjct  61   GKRFCPLNADDDLQKGAVYIMFPMHKKNSFVTASDLGSLFMTA-NSAVKRVSSGR-VRVL  118

Query  278  PAEGGDETPGND-----VGRLGV--TSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            P    D+T   D     V RL +         E+RHR+S+ RS+KPLLETI EEPVR+R
Sbjct  119  P----DDTKLVDDDEVVVPRLSLEGMEEVSMPEFRHRISMSRSRKPLLETIDEEPVRSR  173



>emb|CDY43135.1| BnaA05g32510D [Brassica napus]
Length=175

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 106/177 (60%), Gaps = 16/177 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaa-------aaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGS  468
            MGN VSC+  K   +        AA+VILP G +R +  P KAAE+M+E P+HFLV+A S
Sbjct  1    MGNYVSCALSKTTSSNLSSSSSPAAKVILPDGGVRNINVPTKAAELMMEMPSHFLVDAKS  60

Query  467  LTAGRRFSPLSADQDLESG--NVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGN  294
            L  GR+  PL+AD DL+ G  +VY AFPM R++S   A+D+A + +A K    KRL + +
Sbjct  61   LKIGRKLIPLAADDDLDVGGCHVYVAFPMTRVASAANASDMARIFMAGK----KRLRSCD  116

Query  293  AAKVSPAEGGDETPGNDVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
              KVSP E  DE      G    L     F   E+ HR+S+ +SKKP LETI+EE V
Sbjct  117  NRKVSPEEEEDEDARLVKGTKLNLEDIEDFSAVEFMHRISVSKSKKPELETIVEENV  173



>ref|XP_009130353.1| PREDICTED: uncharacterized protein LOC103855148 [Brassica rapa]
Length=175

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 106/177 (60%), Gaps = 16/177 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaa-------aaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGS  468
            MGN VSC+  K   +        AA+VILP G +R +  P KAAE+M+E P+HFLV+A S
Sbjct  1    MGNYVSCALSKTTSSNLSSSSSPAAKVILPDGGVRDINVPTKAAELMMEMPSHFLVDAKS  60

Query  467  LTAGRRFSPLSADQDLESG--NVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGN  294
            L  GR+  PL+AD DL+ G  +VY AFPM R++S   A+D+A + +A K    KRL + +
Sbjct  61   LKIGRKLIPLAADDDLDVGGCHVYVAFPMTRVASAANASDMARIFMAGK----KRLRSCD  116

Query  293  AAKVSPAEGGDETPGNDVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
              KVSP E  DE      G    L     F   E+ HR+S+ +SKKP LETI+EE V
Sbjct  117  NRKVSPEEEEDEDARLVKGTKLNLEDIEDFSAVEFMHRISVSKSKKPELETIVEENV  173



>ref|XP_008460510.1| PREDICTED: uncharacterized protein LOC103499309 [Cucumis melo]
Length=187

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 106/194 (55%), Gaps = 33/194 (17%)
 Frame = -2

Query  626  MGNLVSCSarkg-----rkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLT  462
            MGN +SC+           ++   VI P G+IR   E VKAAE+M E P  FLVN+ SL 
Sbjct  1    MGNYISCTLSTPIGVKPSSSSTTTVIFPSGQIRHFHESVKAAELMFEIPNFFLVNSQSLH  60

Query  461  AGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKV  282
             GRRFS L AD+DLE GN+Y  FPMK+++SV++ AD+  L +A     A+R+S  N  ++
Sbjct  61   LGRRFSALMADEDLEMGNLYLMFPMKKVNSVVSVADMGALFLA-----AERVSGRNKRRI  115

Query  281  SPAEGGDET-------------PGNDVGRLGVTSGFVGQ--------EYRHRLSLCRSKK  165
                GGD T             P  ++   G +              E+ HR S+CRS+K
Sbjct  116  --IGGGDSTVCVWPEVETEESKPKLNLDGSGGSDEDDDDVEGFSPVPEFGHRRSMCRSRK  173

Query  164  PLLETIIEEPVRTR  123
            PLLETI EEPV +R
Sbjct  174  PLLETIAEEPVCSR  187



>emb|CDY16932.1| BnaC09g40590D [Brassica napus]
Length=184

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 96/160 (60%), Gaps = 16/160 (10%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP GE+RR+ EP KAAE+M+E P+ FLV+A SL  GR+F+PL+AD DL+  S +VY A
Sbjct  22   VILPNGEVRRIHEPTKAAELMMEIPSFFLVDAKSLKIGRKFNPLAADDDLQIKSCHVYIA  81

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRL-----SAGNAAK------VSPAEGGDETPG  249
            FPM R +S   A+D+A L  AAKK    R+       G A K      VSP  G D+   
Sbjct  82   FPMTRATSAANASDMARLFAAAKKRQRSRVGPKSSGVGTAVKSCHNGRVSPDGGEDDVKM  141

Query  248  NDVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
               G    L     F   E+ HR+S+ +SKKP LETI+EE
Sbjct  142  ISAGSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIVEE  181



>ref|XP_006837231.1| hypothetical protein AMTR_s00105p00148840 [Amborella trichopoda]
 gb|ERN00085.1| hypothetical protein AMTR_s00105p00148840 [Amborella trichopoda]
Length=188

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 106/185 (57%), Gaps = 25/185 (14%)
 Frame = -2

Query  626  MGNLVSC-SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN +SC S     K +  +V+L  G IRR   PVKAAE+MLE P HFL N+ S+  GRR
Sbjct  1    MGNYISCASTGVPSKNSGVKVVLSDGSIRRFDRPVKAAELMLEAPNHFLSNSKSVHLGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP--  276
            FSP+ AD+DL+ G VY  FPM+R +S+++ AD+A +L+ A K+  K  ++G   +V P  
Sbjct  61   FSPIPADEDLDMGEVYFMFPMRRANSMVSPADMAGMLMRADKAIKK--TSGGLKRVLPEI  118

Query  275  ------AEGGDETPGNDVGRLGVTSGFVG-------------QEYRHRLSLCRSKKPLLE  153
                  A   D  P  ++G +G   G V                + HRLS+CRS+KP LE
Sbjct  119  IQEEDYARKIDSRP-TEIGEVGNCGGEVNFRRPGFEEVEDFPMGFNHRLSMCRSRKPRLE  177

Query  152  TIIEE  138
            TI EE
Sbjct  178  TINEE  182



>ref|XP_002528056.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34306.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 97/159 (61%), Gaps = 11/159 (7%)
 Frame = -2

Query  569  VILPGGEIRRLREPV--KAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAA  396
            V+LP GEIR++R+P   KAAE+M++ P  F+VN  SL  G+RF PLSAD DLE GNVY  
Sbjct  23   VVLPTGEIRKIRQPTATKAAELMMDVPGFFVVNTKSLKIGKRFYPLSADDDLEKGNVYVM  82

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKV--------SPAEGGDETPGNDV  240
            +PM R +SV+TA D+ VL V A K   +    GN   +        S AEG ++     +
Sbjct  83   YPMYRKNSVVTAGDMVVLFVTANKVMKRGACKGNDINIKVLPESQSSAAEGVEDEASPRL  142

Query  239  GRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
               G+      Q +R+R+S+ RSKKPLLETI EE + +R
Sbjct  143  SLEGIEHVSTPQ-FRYRMSISRSKKPLLETIQEESICSR  180



>ref|XP_002882281.1| hypothetical protein ARALYDRAFT_896322 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58540.1| hypothetical protein ARALYDRAFT_896322 [Arabidopsis lyrata subsp. 
lyrata]
Length=166

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 105/173 (61%), Gaps = 16/173 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN VSC+  K   +  A+VILP G +R +  P+KAAE+M+E P +FLV+  SL  GR+F
Sbjct  1    MGNYVSCALNKTSSSPLAKVILPDGGVRDIHVPMKAAELMMEMPRYFLVDGKSLKIGRKF  60

Query  446  SPLSADQDLESG--NVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
             PL+AD DL+ G  +VY AFPM R +S   A+D+A L +A K    KR  + +  +VSP 
Sbjct  61   IPLAADDDLDLGGFHVYVAFPMTRATSAANASDLARLYLAGK----KRTKSCDNRRVSP-  115

Query  272  EGGDETPGNDVGRLG------VTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
               ++   +DV  +G          F   E+ HR+S+ +SKKP LETI+EE V
Sbjct  116  ---EDEDNDDVRLIGPKLNLEDIEEFSAAEFIHRISVSKSKKPQLETIVEEHV  165



>ref|XP_009394648.1| PREDICTED: uncharacterized protein LOC103980088 [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 111/176 (63%), Gaps = 11/176 (6%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+     G  A + +VILP G ++R+  P  AAE+ML+ P HFLV++ S+  GR
Sbjct  1    MGNYVSCTLAGPAGGHARSVKVILPCGRVQRIDGPANAAELMLDAPGHFLVDSRSMHVGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG-----NAA  288
            RF+PL AD+DLE G+VYA FPMKR+++V+ AAD+A LL+AA+K   + L  G     +A 
Sbjct  61   RFAPLVADEDLEMGHVYAMFPMKRVNAVVAAADMAALLMAARKEVRRELGGGARVLPDAT  120

Query  287  KVSPAEGGDETPGNDVG----RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
             VS     D  P ++       L   +    +E+R+RLS+CRS++P LETI  E +
Sbjct  121  HVSTEVAEDYPPESEQNAARTSLEEAAAAEMREFRYRLSMCRSRRPTLETINTENI  176



>ref|XP_009126180.1| PREDICTED: uncharacterized protein LOC103851103 [Brassica rapa]
Length=183

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 95/160 (59%), Gaps = 16/160 (10%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP GE+R + EP KAAE+M+E P+ FLV+A SL  GR+ +PL+AD DLE    +VY  
Sbjct  21   VILPDGEVRHIHEPTKAAELMMEIPSFFLVDAKSLKIGRKLNPLAADDDLELKGCHVYVT  80

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRL---SAGNAAKVSPAEGGDETPGNDVGRLGV  225
            FPM R +S   A+D+  L +AAKK   +R+   S+ +   V     G  +P  +VG +GV
Sbjct  81   FPMTRATSAANASDMTRLFLAAKKQQRRRVGNKSSRDGTAVKHCHNGRVSPDGEVGDVGV  140

Query  224  TSG-----------FVGQEYRHRLSLCRSKKPLLETIIEE  138
             +            F   E+ HR+S+ +SKKP LETI EE
Sbjct  141  ITAVSKLSLEDIEEFSAAEFMHRISISKSKKPKLETIDEE  180



>emb|CDX85458.1| BnaA02g03550D [Brassica napus]
Length=183

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 94/160 (59%), Gaps = 16/160 (10%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP GE+R + EP KAAE+M+E P+ FLV+A SL  GR+  PL+AD DLE    +VY  
Sbjct  21   VILPDGEVRHIHEPTKAAELMMEIPSFFLVDAKSLKIGRKLHPLAADDDLELKGCHVYVT  80

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRL---SAGNAAKVSPAEGGDETPGNDVGRLGV  225
            FPM R +S   A+D+  L +AAKK   +R+   S+ +   V     G  +P  +VG +GV
Sbjct  81   FPMTRATSAANASDMTRLFLAAKKQQRRRVGNKSSRDGTAVKHCHNGRVSPDGEVGDVGV  140

Query  224  TSG-----------FVGQEYRHRLSLCRSKKPLLETIIEE  138
             +            F   E+ HR+S+ +SKKP LETI EE
Sbjct  141  ITAVSKLSLEDIEEFSAAEFMHRISISKSKKPKLETIDEE  180



>ref|XP_004492243.1| PREDICTED: uncharacterized protein LOC101495409 [Cicer arietinum]
Length=160

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 104/169 (62%), Gaps = 14/169 (8%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SCS      ++    +VI P GE+R+  E VKAAE+M+E P+ F+VN+ SL  GR
Sbjct  1    MGNYISCSLSSGGNKQWRGIKVIFPSGEVRKFEEAVKAAELMVEMPSFFVVNSLSLQNGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            RF  L+AD++LE GNVY   PMK+L+S +TAAD+  LL+AAK+  AK        K+ P 
Sbjct  61   RFCALNADEELEYGNVYTMIPMKKLNSSVTAADMGTLLLAAKRVSAK-------LKILPT  113

Query  272  EGGDETPGNDVGRLGVTSGFVGQEYR-HRLSLC-RSKKPLLETIIEEPV  132
               +    +   +L +    + Q+   HR S+C RSKKPLLETI EE V
Sbjct  114  TDSNFEMESQ-PKLNLDD--IDQDLSMHRFSVCSRSKKPLLETIAEETV  159



>emb|CDY02708.1| BnaC02g07270D [Brassica napus]
Length=183

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 95/162 (59%), Gaps = 16/162 (10%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP GE+R + EP KAAE+M+E P+ FLV A SL  GR+ +PL+AD DLE    +VY  
Sbjct  21   VILPDGEVRHIHEPTKAAELMMEIPSFFLVEAKSLKIGRKLNPLAADDDLELKGCHVYVT  80

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRL---SAGNAAKVSPAEGGDETPGNDVGRLGV  225
            FPM R +S   A+D+  L +AAKK   +R+   S+ +   V     G  +P  +VG +GV
Sbjct  81   FPMTRATSAANASDMTRLFLAAKKQQRRRVGNKSSRDGTAVKHCHNGRVSPDGEVGDVGV  140

Query  224  TSG-----------FVGQEYRHRLSLCRSKKPLLETIIEEPV  132
             +            F   E+ HR+S+ +SKKP LETI EE +
Sbjct  141  ITAGSKLSLEDIEEFSAAEFMHRISISKSKKPKLETIDEESL  182



>ref|XP_010924035.1| PREDICTED: uncharacterized protein LOC105046976 [Elaeis guineensis]
Length=176

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 112/180 (62%), Gaps = 16/180 (9%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLRE-PVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC  SA  G ++ A +VILP G++RR+ +     AE+ML+ P HFLVN+ S+  G
Sbjct  1    MGNYISCAISAVPGGRSRAIKVILPSGDVRRIVDGTANVAELMLDTPGHFLVNSRSMQLG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRF+ LSAD+DLE G V+   PMKRL+S++ AAD+A L +AA K   K      ++  S 
Sbjct  61   RRFAALSADEDLEMGEVFVMMPMKRLNSIVMAADMARLFLAANKEVRKSRVLPESSSSSS  120

Query  275  AEGGDETP---------GNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
            ++G    P         GNDV  + + +G    E+++RLS+ RS+KP LETI EE + +R
Sbjct  121  SQGSPANPVVGPELDDAGNDVNPMAMGTG----EFKYRLSMRRSRKPTLETIAEEAIGSR  176



>gb|KGN51040.1| hypothetical protein Csa_5G416270 [Cucumis sativus]
Length=185

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 103/192 (54%), Gaps = 31/192 (16%)
 Frame = -2

Query  626  MGNLVSCSarkgr-----kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLT  462
            MGN +SC+           ++   VI P G+IR   E +KAAE+M E P  FLVN+ SL 
Sbjct  1    MGNYISCTLSTSIGGKSSTSSTTTVIFPSGQIRHFHESLKAAELMFEIPNFFLVNSQSLH  60

Query  461  AGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKV  282
             GRRFS L AD+DLE GN+Y  FPM +++SV++ AD+  L +A     A+R+S G   ++
Sbjct  61   LGRRFSALMADEDLEMGNLYLMFPMNKVNSVVSVADMGALFLA-----AERVSGGKKRRI  115

Query  281  SPAEGGDET-------------PGNDVGRLGVTSGFVGQ------EYRHRLSLCRSKKPL  159
                GGD T             P   +           +      E+ HR S+CRS+KPL
Sbjct  116  --VGGGDSTVCVWPEVETEESKPKLKLDGGDDEDDDDLEGFSPVPEFAHRRSMCRSRKPL  173

Query  158  LETIIEEPVRTR  123
            LETI EEP+ +R
Sbjct  174  LETIAEEPICSR  185



>ref|XP_006408320.1| hypothetical protein EUTSA_v10022137mg [Eutrema salsugineum]
 gb|ESQ49773.1| hypothetical protein EUTSA_v10022137mg [Eutrema salsugineum]
Length=176

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 108/179 (60%), Gaps = 18/179 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaa------RVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSL  465
            MGN VSC+  K   + ++      +VILP   +R +  P KAAE+M+E P+HFLV+A SL
Sbjct  1    MGNYVSCALSKTTSSVSSPSPAAAKVILPDCRVRDIHAPTKAAELMMEMPSHFLVDAKSL  60

Query  464  TAGRRFSPLSADQDLESG--NVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNA  291
              GR+F+PL+AD D++ G  +VY AFPM R++S   A+D+A L +A K    KR  + + 
Sbjct  61   KIGRKFTPLAADDDIDLGGCHVYVAFPMTRVASAANASDMARLFLAGK----KRAKSCDN  116

Query  290  AKVSPAEGGDE------TPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
             +VSP E  D+      + G  +  L     F   E+ HR+S+ +SKKP LETI+EE V
Sbjct  117  RRVSPEEEEDDDDVRLMSSGAKLLNLEDIEDFSAAEFIHRISVSKSKKPQLETIVEENV  175



>gb|KFK25945.1| hypothetical protein AALP_AA8G183300 [Arabis alpina]
Length=184

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 96/160 (60%), Gaps = 14/160 (9%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP GE+R +  P+KAAE+M+E P  FLV+A SL  GR+F+PL+AD DL+    +VY A
Sbjct  24   VILPDGEVRHIHAPMKAAEVMMEIPRFFLVDAKSLKIGRKFNPLAADDDLQIRGCHVYVA  83

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAA---------KVSPAEGGDETPGND  243
            FPM R +S   A+D+A L VAAKK   +R   G+ +         +VSP   GD+     
Sbjct  84   FPMTRATSAANASDMARLFVAAKKQQQQRRRVGSKSSGAGNGRNGRVSPDGEGDDVKMIS  143

Query  242  VG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
             G    L     F   E+ HR+S+ +SKKP LETIIEE +
Sbjct  144  AGSKLSLEDIEEFSAAEFMHRISVSKSKKPKLETIIEESL  183



>ref|XP_002305848.2| hypothetical protein POPTR_0004s09290g [Populus trichocarpa]
 ref|XP_011035145.1| PREDICTED: uncharacterized protein LOC105133044 [Populus euphratica]
 gb|EEE86359.2| hypothetical protein POPTR_0004s09290g [Populus trichocarpa]
Length=178

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 101/177 (57%), Gaps = 14/177 (8%)
 Frame = -2

Query  626  MGNLVSCSark----grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            MGN VSC+          + + RVILP GEI+++++  KAAE+MLE P  F+ N  SL  
Sbjct  1    MGNYVSCTLSNPQVLKNSSKSTRVILPTGEIKKIQQRTKAAELMLEAPNFFIANTKSLKI  60

Query  458  GRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKV-  282
            GRRF PL+AD +L   NVY  FPM + +SV+TA D+  L + A  S  KR   GN   + 
Sbjct  61   GRRFCPLNADDELGKANVYVMFPMHKKNSVVTAGDMGALFITA-NSVMKRAFKGNIRVLP  119

Query  281  -SPAEGGDETPGNDVG---RLGVTSGF--VGQEYR-HRLSLCRSKKPLLETIIEEPV  132
             S  E       NDV    RL +  G   V   Y  HR+S+ RSKKPLLETI EEP+
Sbjct  120  ESTVEISQNMERNDVDAAPRLSL-EGIEEVSSPYSTHRMSMSRSKKPLLETIEEEPI  175



>ref|XP_006400272.1| hypothetical protein EUTSA_v10014832mg [Eutrema salsugineum]
 gb|ESQ41725.1| hypothetical protein EUTSA_v10014832mg [Eutrema salsugineum]
Length=172

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 91/149 (61%), Gaps = 8/149 (5%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP GE+R +  P KAAE+M+E P+ FLV+A SL  GR+FSPL+AD DL+    +VY A
Sbjct  24   VILPDGEVRHIHAPTKAAELMMEIPSFFLVDAKSLKLGRKFSPLAADDDLQIRGCHVYVA  83

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRL---SAGNAAKVSPAEGGDETPGNDVGRLGV  225
            FPM R +S   A+D+A L VAAKK   +R+   S+G    V     G  +P    G    
Sbjct  84   FPMTRATSAANASDMARLFVAAKKQQRRRVGNHSSGAGTAVKHCHNGKVSPD---GEEDD  140

Query  224  TSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
               F   E+ HR+S+ +SKKP LETI EE
Sbjct  141  IEEFSAAEFMHRISISKSKKPKLETIAEE  169



>gb|KHN19699.1| hypothetical protein glysoja_037201 [Glycine soja]
Length=162

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 95/168 (57%), Gaps = 16/168 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaR----VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            MGN +SC+               VI P GEI +L E VKAAE+MLE P+ F+VN  SL  
Sbjct  1    MGNYISCTLSTAGSRKLHWRGIKVIFPSGEIEKLEEGVKAAELMLEMPSFFVVNTRSLKI  60

Query  458  GRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVS  279
            G RFS L+AD++LE G VY   PMKRL+S++ A+D+  LL+ AKK    R+         
Sbjct  61   GGRFSALNADEELECGYVYVMVPMKRLNSLVKASDMGALLLTAKK--VTRVVPEKEESEE  118

Query  278  PAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
            P    D+         G+   F   E+ HRLS+ RSKKPLLETI EEP
Sbjct  119  PKFKLDD---------GILE-FSSPEFMHRLSMSRSKKPLLETIAEEP  156



>emb|CDX78745.1| BnaA03g06570D [Brassica napus]
Length=207

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 109/178 (61%), Gaps = 16/178 (9%)
 Frame = -2

Query  626  MGNLVSC-----SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLT  462
            MGN  SC     ++     +++++VILP GE+R +  P KAAE+M+E P+ FLV+A +L 
Sbjct  1    MGNYASCALGNTTSSFSSSSSSSKVILPDGEVRHIHAPTKAAELMMEIPSFFLVDAETLK  60

Query  461  AGRRFSPLSADQDLES--GNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG---  297
             GR+ +PL+AD DLE+   +VY AFPM R +S   A+D+A L +AAKK   +R+      
Sbjct  61   IGRKLNPLAADDDLETRGCHVYVAFPMTRATSAANASDMARLFLAAKKQQRRRVRTAVKH  120

Query  296  -NAAKVSPAEGGDE----TPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
             +  ++SP EG D+    + G+ +  L     F   E+ HR+S+ +SKKP LETI EE
Sbjct  121  CHNGRISP-EGEDDVKMMSAGSKLMSLVDIDEFSAAEFMHRISISKSKKPKLETIAEE  177



>ref|XP_010485663.1| PREDICTED: uncharacterized protein LOC104763952 [Camelina sativa]
Length=178

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 104/183 (57%), Gaps = 24/183 (13%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaa---------aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNA  474
            MGN  SC       ++          A+VILP G +R +  P K AEIM+E P++FLV+A
Sbjct  1    MGNYASCGLYYTTPSSQSSSSLSPSSAKVILPDGGVRDIHAPTKVAEIMMEMPSYFLVDA  60

Query  473  GSLTAGRRFSPLSADQDLESG--NVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSA  300
             SL  GR+F PL+AD DL+ G  +VYAAFPM R++S   A+D+  L +A K    KR  +
Sbjct  61   KSLRIGRKFIPLAADDDLDLGGCHVYAAFPMTRVTSAANASDMTRLYLAGK----KRAKS  116

Query  299  GNAAKVSPAEGGDETPGNDVGRLG-------VTSGFVGQEYRHRLSLCRSKKPLLETIIE  141
             +  +VSP E G     +DV  +G           F   E+ HR+S+ +SKKP LETIIE
Sbjct  117  VDNRRVSPEEEG--VHHHDVRLIGRPKLNLEDIEEFSAAEFIHRISVSKSKKPQLETIIE  174

Query  140  EPV  132
            + V
Sbjct  175  DHV  177



>emb|CDX70757.1| BnaC03g08410D [Brassica napus]
Length=206

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 108/177 (61%), Gaps = 15/177 (8%)
 Frame = -2

Query  626  MGNLVSC----SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            MGN  SC    +      +++++VILP GE+R +  P KAAE+M+E P+ FLV+A +L  
Sbjct  1    MGNYASCALGNTTSSFSSSSSSKVILPDGEVRHIHAPTKAAELMMEIPSFFLVDAETLKI  60

Query  458  GRRFSPLSADQDLES--GNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG----  297
            GR+ +PL+AD DLE+   +VY AFPM R +S   A+D+A L +AAKK   +R+       
Sbjct  61   GRKLNPLAADDDLETRGCHVYVAFPMTRATSAANASDMARLFLAAKKQQRRRVRTAVKHC  120

Query  296  NAAKVSPAEGGDE----TPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
            +  ++SP EG ++    + G+ +  L     F   E+ HR+S+ +SKKP LETI EE
Sbjct  121  HNGRISP-EGEEDVKMVSAGSKLMSLEDIDEFSAAEFMHRISISKSKKPKLETIAEE  176



>ref|NP_186978.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF26100.1|AC012328_3 unknown protein [Arabidopsis thaliana]
 gb|AAV31165.1| At3g03280 [Arabidopsis thaliana]
 gb|AAW38997.1| At3g03280 [Arabidopsis thaliana]
 gb|AEE73922.1| uncharacterized protein AT3G03280 [Arabidopsis thaliana]
Length=166

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 99/170 (58%), Gaps = 10/170 (6%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN VSC+  K   +  A+VILP G +R +  P KAAE+M+E P++FLV+  S+  GR+F
Sbjct  1    MGNYVSCALNKTSSSPLAKVILPDGGVRDIHVPTKAAELMMEMPSYFLVDTKSVKVGRKF  60

Query  446  SPLSADQDLESG--NVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
             PL+AD DL+ G  +VY AFPM R +S   A+D+A L +  K    KR       +VSP 
Sbjct  61   IPLAADDDLDLGGCHVYVAFPMTRATSAANASDMARLYLTGK----KRTKNCGHRRVSP-  115

Query  272  EGGDETPGNDVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
            E  D      +G    L     F   E+ HR+S+ +SKKP LETI E+ V
Sbjct  116  ENEDNDDVRLIGPKLNLEDIEEFSAAEFIHRISVSKSKKPQLETIAEDHV  165



>gb|KHN42400.1| hypothetical protein glysoja_020112 [Glycine soja]
Length=135

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN VSC+      + + A RVI+P GE+++ RE VKAAE+MLEHP++FLVN+ SL  GR
Sbjct  1    MGNYVSCTLAPPLMKNSKATRVIIPTGEVKQFREIVKAAELMLEHPSYFLVNSRSLHIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVIT  363
            RFS L AD++LESGNVY  FPM+R++SV+T
Sbjct  61   RFSALGADEELESGNVYIFFPMRRVNSVVT  90



>emb|CDX70755.1| BnaC03g08390D [Brassica napus]
Length=203

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 107/174 (61%), Gaps = 12/174 (7%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+      +++++VILP GE+R +  P KAAE+M+E P+ FLV+A +L  GR+ 
Sbjct  1    MGNYASCALSNITPSSSSKVILPDGEVRHIHAPTKAAELMMEIPSFFLVDAKTLKLGRKL  60

Query  446  SPLSADQDLESGN--VYAAFPMKR-LSSVITaadvavllvaAKKSPAKRLSAG----NAA  288
             PL+AD DL++    VY AFPM R  +S   A+D+A L +AAKK   +R+       +  
Sbjct  61   KPLAADDDLQTRGCPVYVAFPMTRATTSAANASDMARLFLAAKKQQRRRVRTAVKHCHNG  120

Query  287  KVSPAEGGDE----TPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
            ++SP EG ++    + G+++  L  T  F   E+ HR+S  +SKKP LETI EE
Sbjct  121  RISP-EGEEDVKMVSVGSNLMSLEDTDEFSAAEFMHRISNSKSKKPKLETIAEE  173



>ref|XP_009131593.1| PREDICTED: uncharacterized protein LOC103856246 [Brassica rapa]
 emb|CDY71753.1| BnaAnng38710D [Brassica napus]
Length=203

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 106/174 (61%), Gaps = 12/174 (7%)
 Frame = -2

Query  626  MGNLVSCSarkgr-kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+       +++++VILP GE+R +  P KAAE+M+E P+ FLV+A +L  GR+
Sbjct  1    MGNYASCALSNITPSSSSSKVILPDGEVRHIHAPTKAAELMMEIPSFFLVDAKTLKIGRK  60

Query  449  FSPLSADQDLES--GNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG----NAA  288
              PL+AD DL++   +VY AFPM R +S   A+D+A L +AAKK   +R+       +  
Sbjct  61   LKPLAADDDLQTRGCHVYVAFPMTRATSAANASDMARLFLAAKKQQRRRVRTAVKHCHNG  120

Query  287  KVSPAEGGDE----TPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
            ++SP EG D+    + G+ +  L     F   E+ HR+S  +SKKP LETI EE
Sbjct  121  RISP-EGEDDVKMMSAGSKLMSLVDIDEFSAAEFMHRISNSKSKKPKLETIAEE  173



>emb|CBI26932.3| unnamed protein product [Vitis vinifera]
Length=455

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 3/112 (3%)
 Frame = -2

Query  626  MGNLVSCSark--grkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC+      + + AARVI P GE+R+ REP+KAAE+MLE P  FLVN+ SL  GR
Sbjct  1    MGNYISCTLITPTIKSSKAARVIFPTGEVRQFREPLKAAELMLESPNFFLVNSKSLHMGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG  297
            RF+PL+AD+DLE GN+Y  FPMKR++SV+TAAD+AV L+AA  S AKR+S G
Sbjct  61   RFNPLTADEDLEFGNLYILFPMKRVNSVVTAADMAVYLLAA-NSAAKRISGG  111



>ref|XP_003554835.2| PREDICTED: uncharacterized protein LOC100786487 [Glycine max]
Length=200

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 95/168 (57%), Gaps = 16/168 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaR----VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            MGN +SC+               VI P GEI +L E VKAAE+MLE P+ F+VN  SL  
Sbjct  39   MGNYISCTLSTAGSRKLHWRGIKVIFPSGEIEKLEEGVKAAELMLEMPSFFVVNTRSLKI  98

Query  458  GRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVS  279
            G RFS L+AD++LE G VY   PMKRL+S++ A+D+  LL+ AKK    R+         
Sbjct  99   GGRFSALNADEELECGYVYVMVPMKRLNSLVKASDMGALLLTAKK--VTRVVPEKEESEE  156

Query  278  PAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
            P    D+         G+   F   E+ HRLS+ RSKKPLLETI EEP
Sbjct  157  PKFKLDD---------GILE-FSSPEFMHRLSMSRSKKPLLETIAEEP  194



>ref|XP_009131592.1| PREDICTED: uncharacterized protein LOC103856244 [Brassica rapa]
 emb|CDY71183.1| BnaA03g55990D [Brassica napus]
Length=207

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 107/178 (60%), Gaps = 16/178 (9%)
 Frame = -2

Query  626  MGNLVSC-----SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLT  462
            MGN  SC     ++     +++++VILP GE+R +  P KAAE+M+E P+ FLV+A +L 
Sbjct  1    MGNYASCALGNTTSSFSSSSSSSKVILPDGEVRHIHAPTKAAELMMEIPSFFLVDAKTLK  60

Query  461  AGRRFSPLSADQDLES--GNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG---  297
             GR+  PL+AD DLE+   +VY AFPM R +S   A+D+A L +AAKK   +R+      
Sbjct  61   IGRKLKPLAADDDLETRGCHVYVAFPMTRATSAANASDMARLFLAAKKQQRRRVRTAVKH  120

Query  296  -NAAKVSPAEGGDE----TPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
             +  ++SP EG D+    + G+ +  L     F   E+ HR+S  +SKKP LETI EE
Sbjct  121  CHNGRISP-EGEDDVKMMSAGSKLMSLVDIDEFSAAEFMHRISNSKSKKPKLETIAEE  177



>ref|NP_197237.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAC01730.1| putative protein [Arabidopsis thaliana]
 gb|AAM61425.1| unknown [Arabidopsis thaliana]
 dbj|BAF00704.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92416.1| uncharacterized protein AT5G17350 [Arabidopsis thaliana]
Length=183

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 93/159 (58%), Gaps = 15/159 (9%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP G +R +  P+KAAE+M+E P+ FLV+A SL  GR+F PL+AD DL+    +VY A
Sbjct  22   VILPDGGVRNIHAPMKAAELMMEIPSFFLVDAKSLKIGRKFCPLAADDDLQIKGCHVYVA  81

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRLSAG----------NAAKVSPAEGGDETPGN  246
            FPM R +S   A+D+A L VAAKK    R+ +           N  +VSP   GD+    
Sbjct  82   FPMTRATSAANASDLARLFVAAKKQRRHRVGSDHSSAAVKHCHNNGRVSPDGEGDDVKVI  141

Query  245  DVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
              G    L     F   E+ HR+S+ +SKKP LETI+EE
Sbjct  142  SAGSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIVEE  180



>gb|KEH39692.1| DUF4228 domain protein [Medicago truncatula]
Length=156

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 85/147 (58%), Gaps = 9/147 (6%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI P GEI +  E VKAAE+M+E P+ F+VN  SL  G RF  L+AD++LE GNVY   P
Sbjct  17   VIFPSGEIHKFEEAVKAAELMVEMPSFFVVNTRSLQIGTRFCALNADEELEYGNVYVMIP  76

Query  389  MKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEGGDETPGNDVGRLGVTSGFV  210
            MK+L S +TAAD+  LL+      AKR+SA     +  AE   E        L      +
Sbjct  77   MKKLHSAVTAADMGSLLLT-----AKRVSAKMNKILPSAESNLEMESQPKLDLDDIDQDL  131

Query  209  GQEYRHRLSLC-RSKKPLLETIIEEPV  132
                 HRLSLC RSKKPLLE I EE V
Sbjct  132  SM---HRLSLCSRSKKPLLEIIAEETV  155



>ref|XP_010508298.1| PREDICTED: uncharacterized protein LOC104784866 [Camelina sativa]
Length=178

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 92/155 (59%), Gaps = 15/155 (10%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESG--NVYAA  396
            VILP G +R +  P K AEIM+E P++FLV+A SL  GR+F PL AD DL+ G  +VY A
Sbjct  29   VILPDGGVRDIHAPTKVAEIMMEMPSYFLVDAKSLRIGRKFIPLGADDDLDLGGCHVYVA  88

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEGGDETPGNDVGRLG----  228
            FPM R+ S   A+D+  L +A K    KR  + +  +VSP E G     +DV  +G    
Sbjct  89   FPMTRVISAANASDMTRLYLAGK----KRAKSVDNRRVSPEEEG--VHHHDVRLIGRPKL  142

Query  227  ---VTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
                   F   E+ HR+S+ +SKKP LETIIE+ V
Sbjct  143  NLEDIEEFSAAEFIHRISVSKSKKPQLETIIEDHV  177



>ref|XP_006299661.1| hypothetical protein CARUB_v10015849mg [Capsella rubella]
 gb|EOA32559.1| hypothetical protein CARUB_v10015849mg [Capsella rubella]
Length=169

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 101/173 (58%), Gaps = 16/173 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaa-----aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLT  462
            MGN  SC+  K   ++      A+VILP G +R +  P KAAE+M+E P++FLV+A  L 
Sbjct  1    MGNYASCALNKTTPSSHSSSPSAKVILPDGGVRDIHAPTKAAELMMEMPSYFLVDAKFLK  60

Query  461  AGRRFSPLSADQDLESG--NVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAA  288
             GR+F PL+AD DL+ G  +VY  F M R++S   A+D+A L  A K    KR  + +  
Sbjct  61   IGRKFIPLAADDDLDLGGCHVYVVFQMMRVTSAANASDMARLYQAGK----KRAKSVDNR  116

Query  287  KVSPAEGGDETPGNDVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
            +VSP E GD+     +G    L     F   E+ HR+S+ +SKKP LETI EE
Sbjct  117  RVSPEEEGDDV--RLIGPKLNLEDIEEFSAAEFIHRISVSKSKKPQLETIAEE  167



>gb|EYU34547.1| hypothetical protein MIMGU_mgv1a020327mg [Erythranthe guttata]
Length=144

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 88/179 (49%), Gaps = 46/179 (26%)
 Frame = -2

Query  626  MGNLVSCS---arkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+   A         +VI P GE RRL EP KAAE+MLE+P  F+V+A SL  G
Sbjct  1    MGNYISCTLPGAVSRSTIKGTKVIFPSGETRRLHEPTKAAELMLENPNSFIVSAKSLQIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            RRFS L+AD DL+ G VY                                    A+++SP
Sbjct  61   RRFSALNADDDLQMGGVYV-----------------------------------ASRISP  85

Query  275  AEGGD----ETPG--NDVGRLGVTS--GFVGQEYRHRLSLCRSKKPLLETIIEEPVRTR  123
              GG     ET       G+L +     F   E++HRLS+ RSKKP LETI EEP+  R
Sbjct  86   ECGGGVCVVETTSVKCSAGKLNLDDFEEFSTPEFKHRLSMSRSKKPSLETIDEEPLCVR  144



>ref|XP_010463778.1| PREDICTED: uncharacterized protein LOC104744418 [Camelina sativa]
Length=179

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 12/154 (8%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE-SG-NVYAA  396
            VILP G +R +  P K AEIM+E P++FLV+A SL  G +F PL+AD DL+ SG +VY A
Sbjct  29   VILPDGGVRDIHAPTKVAEIMMEMPSYFLVDAKSLRIGGKFIPLAADDDLDLSGCHVYVA  88

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP--AEGGDETPGNDVGR----  234
            FPM R++S   ++D+  L +A K    KR  + +  +VSP   EG        +GR    
Sbjct  89   FPMTRVTSAANSSDMTRLYLAGK----KRAKSVDNRRVSPDQEEGDHHHDVRLIGRPKLN  144

Query  233  LGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
            L     F   E+ HR+S+ +SKKP LETIIE+ V
Sbjct  145  LEDIEEFSAAEFIHRMSVSKSKKPQLETIIEDHV  178



>gb|KHN44905.1| hypothetical protein glysoja_042953 [Glycine soja]
Length=105

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 65/91 (71%), Gaps = 3/91 (3%)
 Frame = -2

Query  626  MGNLVSCSar--kgrkaaaaRVILPGGEIRRLREPV-KAAEIMLEHPTHFLVNAGSLTAG  456
            MGN +SC+      +   A RVI P GE+++ +E V  AAE+MLE PTHFL N+ SL  G
Sbjct  1    MGNYISCTLAPPLMKNTRAKRVIFPTGEVKQYKEQVINAAELMLECPTHFLTNSKSLHIG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVIT  363
            RRFSPL AD++LE GNVY  FPM+RL+S++T
Sbjct  61   RRFSPLGADEELECGNVYIFFPMRRLNSMVT  91



>gb|EPS62024.1| hypothetical protein M569_12770, partial [Genlisea aurea]
Length=83

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            V+LPGGE+R+ RE VKAAE+MLE P  FLV++ SL  GRRFSPL+AD+DLE G VY   P
Sbjct  5    VVLPGGELRQFREAVKAAELMLESPNCFLVDSRSLNVGRRFSPLAADEDLEFGRVYVMLP  64

Query  389  MKRLSSV  369
            MKR+ SV
Sbjct  65   MKRVHSV  71



>ref|XP_002871762.1| hypothetical protein ARALYDRAFT_488600 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48021.1| hypothetical protein ARALYDRAFT_488600 [Arabidopsis lyrata subsp. 
lyrata]
Length=184

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 94/159 (59%), Gaps = 16/159 (10%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP G +R +  P+KAAE+M+E P+ FLV+A SL  GR+F PL+AD DL+    +VY A
Sbjct  24   VILPDGGVRHIHAPMKAAELMMEIPSFFLVDAKSLKIGRKFCPLAADDDLQIKGCHVYVA  83

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRL----SAG------NAAKVSPAEGGDETPGN  246
            FPM R +S   A+D+A L VAAKK   +RL    S+G      N  +VSP    D+    
Sbjct  84   FPMTRATSAANASDLARLFVAAKKQ-RRRLGSDHSSGAVKHCHNNGRVSPDGEEDDVRVI  142

Query  245  DVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
              G    L     F   E+ HR+S+ +SKKP LETI EE
Sbjct  143  SAGSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIAEE  181



>ref|XP_010453924.1| PREDICTED: uncharacterized protein LOC104735773 [Camelina sativa]
Length=188

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 99/168 (59%), Gaps = 27/168 (16%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP G +R +  P+KAAE+M+E P+ FLV+A SL  GR+ SPL+AD DL+    +VY A
Sbjct  25   VILPDGGVRNIHAPMKAAELMMEIPSFFLVDAKSLKIGRKLSPLAADDDLQIRGCHVYVA  84

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRLSAG----------NAAKVSPAEGGDETPGN  246
            FPM R +S   A+D+A L VAAKK   + + +           N  +VSP   G+E   +
Sbjct  85   FPMTRSTSAANASDLARLFVAAKKQRRRGVRSDCSGGGMKHCHNNGRVSP--DGEE---D  139

Query  245  DVGRLGVTSG----------FVGQEYRHRLSLCRSKKPLLETIIEEPV  132
            DV  +  ++G          F   E+ HR+S+ +SKKP LETI+EE +
Sbjct  140  DVRVMSSSAGSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIVEESL  187



>ref|XP_010525033.1| PREDICTED: uncharacterized protein LOC104802908 [Tarenaya hassleriana]
Length=171

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 96/157 (61%), Gaps = 16/157 (10%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE---SGNVYA  399
            VILP GE+R +  P+KAAEIM+E P HFLV+A SL  GR+ SPL AD+DL+     +VY 
Sbjct  21   VILPDGEVRDVYAPMKAAEIMMETPNHFLVDAKSLKIGRKLSPLPADEDLDLRGGCHVYI  80

Query  398  AFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEGGDETPGNDVG------  237
            AFPM R SS   A+D A + +AA K   +R    N  +VSP  GG+   G+DV       
Sbjct  81   AFPMSRASSAANASDKARMFLAAGKK--RRRGGPNGGRVSP--GGE---GDDVRLISPKL  133

Query  236  RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRT  126
            +L     F   E+ HR+S+ +SKKP LETI EE V +
Sbjct  134  KLEDIEEFSAAEFMHRISVSKSKKPQLETIAEESVSS  170



>ref|XP_010492685.1| PREDICTED: uncharacterized protein LOC104770035 [Camelina sativa]
Length=185

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 93/161 (58%), Gaps = 17/161 (11%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP G +R +  P+KAAE+M+E P+ FLV+A SL  GR+ SPL+AD DL+    +VY A
Sbjct  22   VILPDGGVRHIHAPMKAAELMMEIPSFFLVDAKSLKIGRKLSPLAADDDLQIRGCHVYVA  81

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRLSAG----------NAAKVSPAEGGDE----  258
            FPM R +S   A+D+A L VAAKK   + + +           N  +VSP    D+    
Sbjct  82   FPMTRSTSAANASDLARLFVAAKKQRRRGVGSDCSGGSVKHCHNNGRVSPDGEEDDVKVV  141

Query  257  -TPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
             + G     L     F   E+ HR+S+ +SKKP LETI+EE
Sbjct  142  SSSGGSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIVEE  182



>ref|XP_006286576.1| hypothetical protein CARUB_v10002057mg [Capsella rubella]
 gb|EOA19474.1| hypothetical protein CARUB_v10002057mg [Capsella rubella]
Length=185

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 93/160 (58%), Gaps = 16/160 (10%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP G +R +  P+KAAE+M+E P+ FLV+A SL  GR+ SPL+AD DL+    +VY A
Sbjct  23   VILPDGGVRHIHAPMKAAELMMEIPSFFLVDAKSLKIGRKLSPLAADDDLQIRGCHVYVA  82

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRLSAG-----------NAAKVSPAEGGDETPG  249
            FPM R +S   A+D+A L VAAKK   + + +G           N  KVSP    ++   
Sbjct  83   FPMTRSTSAANASDLARLFVAAKKQRRRLVGSGCSGAAVKSHCHNNGKVSPDGEDNDDDD  142

Query  248  NDVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
              V     L     F   E+ HR+S+ +SKKP LETI+EE
Sbjct  143  VRVVSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIVEE  182



>ref|XP_010420449.1| PREDICTED: uncharacterized protein LOC104706026 [Camelina sativa]
Length=187

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 99/168 (59%), Gaps = 27/168 (16%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE--SGNVYAA  396
            VILP G +R +  P+KAAE+M++ P+ FLV+A SL  GR+ SPL+AD DL+    +VY A
Sbjct  24   VILPDGGVRNIHAPMKAAELMMDIPSFFLVDAKSLKIGRKLSPLAADDDLQIRGCHVYVA  83

Query  395  FPMKRLSSVITaadvavllvaAKKSPAKRLSAG----------NAAKVSPAEGGDETPGN  246
            FPM R +S   A+D+A L VAAKK   + + +           N  +VSP   G+E   +
Sbjct  84   FPMTRSTSAANASDLARLFVAAKKQRRRGVGSDCSGGGVKHCHNNGRVSP--DGEE---D  138

Query  245  DVGRLGVTSG----------FVGQEYRHRLSLCRSKKPLLETIIEEPV  132
            DV  +  ++G          F   E+ HR+S+ +SKKP LETI+EE +
Sbjct  139  DVRVMSSSAGSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIVEESL  186



>gb|EEC79660.1| hypothetical protein OsI_20903 [Oryza sativa Indica Group]
Length=175

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 96/170 (56%), Gaps = 8/170 (5%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPG-GEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN +SC+  K      ARVILP  G +R++  P  AAE+M++ P HFL +A +   G R
Sbjct  1    MGNYLSCTMAKVPGGKGARVILPDDGGVRQVALPATAAELMMDAPGHFLADARAARVGAR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSP---AKRLSAGNAAKVS  279
             + LSAD++LE G VYA FPMKRL + +  AD+A L   A +     AK  +A  A   +
Sbjct  61   LAALSADEELELGAVYATFPMKRLGTPLAPADMARLAAVATREARRSAKVAAAVVAPPPT  120

Query  278  PAEGGDETPGNDVGRLGVTSGFVGQE---YRHRLSLCRSKKPLLETIIEE  138
            P +  D  P   +  + V    V  +   Y+HRLS  RS++P LETI EE
Sbjct  121  PLQAEDAAPRLRLDEM-VDDEAVAADMNVYKHRLSSARSRRPTLETIQEE  169



>ref|XP_003567003.1| PREDICTED: uncharacterized protein LOC100835323 [Brachypodium 
distachyon]
Length=187

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaa-aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+  +   AA  ARV+LP G +R +R P  AAE+MLE P HFL +A +L AGRR
Sbjct  1    MGNFASCTLARIPGAAKGARVVLPDGGVRLVRPPATAAELMLEAPGHFLADARALQAGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSS  372
             + L+AD+DLE G VYAAFPMKRL S
Sbjct  61   IAALAADEDLELGAVYAAFPMKRLGS  86



>dbj|BAH01454.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 96/170 (56%), Gaps = 8/170 (5%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPG-GEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN +SC+  K      ARVILP  G +R++  P  AAE+M++ P HFL +A +   G R
Sbjct  1    MGNYLSCTMAKVPGGKGARVILPDDGGLRQVALPATAAELMMDAPGHFLADARAARVGAR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSP---AKRLSAGNAAKVS  279
             + LSAD++LE G VYA FPMKRL + +  AD+A L   A +     AK  +A  A   +
Sbjct  61   LAALSADEELELGAVYATFPMKRLGTPLAPADMARLAAVATREARRSAKVAAAVVAPPPT  120

Query  278  PAEGGDETPGNDVGRLGVTSGFVGQE---YRHRLSLCRSKKPLLETIIEE  138
            P +  D  P   +  + V    V  +   Y+HRLS  RS++P LETI EE
Sbjct  121  PLQAEDAAPRLRLDEM-VDDEAVAADMNVYKHRLSSERSRRPTLETIQEE  169



>dbj|BAJ91872.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -2

Query  632  FNMGNLVSCSarkgrkaaa-aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            F MGN  SC+  +   AA  ARV+LP G IR +R P  AAE+MLE P HFL +A +L AG
Sbjct  28   FGMGNFASCTLARIPGAAKGARVVLPDGGIRLVRPPTTAAELMLEAPGHFLTDARALQAG  87

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSS  372
            RR   L+AD++LE G VYAAFPMKRL S
Sbjct  88   RRIEALAADEELELGGVYAAFPMKRLGS  115



>dbj|BAJ88108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = -2

Query  632  FNMGNLVSCSarkgr-kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            F MGN  SC+       A AARV+LP G +R +R P  AAE+MLE P HFL +A +L AG
Sbjct  28   FGMGNFTSCTLAMIPGAAKAARVVLPDGGLRLVRPPATAAELMLEAPGHFLTDAHALQAG  87

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVI  366
             R   L+AD DLE G VYAAFPM+RL S +
Sbjct  88   HRIEALAADDDLELGGVYAAFPMQRLGSKV  117



>dbj|BAJ90900.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=218

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = -2

Query  632  FNMGNLVSCSarkgr-kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            F MGN  SC+       A AARV+LP G +R +R P  AAE+MLE P HFL +A +L AG
Sbjct  30   FGMGNFTSCTLAMIPGAAKAARVVLPDGGLRLVRPPATAAELMLEAPGHFLTDAHALQAG  89

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVI  366
             R   L+AD DLE G VYAAFPM+RL S +
Sbjct  90   HRIEALAADDDLELGGVYAAFPMQRLGSKV  119



>ref|XP_010558673.1| PREDICTED: uncharacterized protein LOC104827233 [Tarenaya hassleriana]
Length=174

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 88/162 (54%), Gaps = 24/162 (15%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLE---SGNVYA  399
            VILP GE+  +  P KAAEIM+E P HFLV+A +L  GR+ SPL AD+DL+      VY 
Sbjct  22   VILPDGEVHEVYAPTKAAEIMMEIPNHFLVDAKALKIGRKLSPLPADEDLDLRRGCRVYV  81

Query  398  AFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEGGDETPG--NDVGRLGV  225
             FPM+R SS   ++D+A L           L+AG   +   + G   +PG  +D  RL  
Sbjct  82   VFPMRRASSAANSSDMARLF----------LAAGKKRRRGGSGGVRVSPGGEDDDVRLVF  131

Query  224  TS---------GFVGQEYRHRLSLCRSKKPLLETIIEEPVRT  126
             +              E+ HR+S+ +SKKP LETI EE V +
Sbjct  132  PARKLSLEDIEEVSAAEFMHRMSVSKSKKPQLETIAEESVSS  173



>emb|CDM83898.1| unnamed protein product [Triticum aestivum]
Length=186

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaa-aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+  +   AA  ARV+LP G +R +R P  AAE+MLE P HFL +A +L AGRR
Sbjct  1    MGNFASCTLARIPGAAKGARVVLPDGGLRLVRPPATAAELMLEAPGHFLADARALQAGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSS  372
               L+AD+DLE   VYAAFPMKRL S
Sbjct  61   IEALAADEDLELRGVYAAFPMKRLGS  86



>gb|EPS59815.1| hypothetical protein M569_14993, partial [Genlisea aurea]
Length=77

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI P GE+RRLR+  KAAE+M+E P  FLVN  SL  GRR SPL+AD+DLE   VY  FP
Sbjct  17   VIFPTGEVRRLRQKAKAAELMMEMPNFFLVNVKSLRIGRRLSPLNADEDLEMNGVYLYFP  76

Query  389  M  387
            M
Sbjct  77   M  77



>ref|XP_010231055.1| PREDICTED: uncharacterized protein LOC100845581 [Brachypodium 
distachyon]
Length=186

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 94/189 (50%), Gaps = 36/189 (19%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaa-aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN +SC+  K       ARVILP G +R++  P  AAE+ML+ P HFL +A +   G R
Sbjct  1    MGNYLSCTLAKAPGGKQGARVILPDGRVRQVPLPATAAELMLDAPGHFLADARAARVGAR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRL-----------------------SSVITaadvavll  339
             + LSAD+DLE G VYA FPMKRL                       SS ++A  +    
Sbjct  61   LAALSADEDLEMGAVYATFPMKRLGTPLAAHDMARMAAAATREARRRSSKVSAVILVAAA  120

Query  338  vaAKKSPAKRLSAGNAAKVSP-AEGGDETPGNDV-GRLGVTSGFVGQEYRHRLSLCRSKK  165
             AA   P K+  A  A   SP A   DE   + V   +GV         +HRLS  RS++
Sbjct  121  AAAPPEPVKKAEA--APSPSPRAPRLDEMVDDAVAAEIGV--------LKHRLSSTRSRR  170

Query  164  PLLETIIEE  138
            P LETI EE
Sbjct  171  PALETIHEE  179



>emb|CDM83897.1| unnamed protein product [Triticum aestivum]
Length=173

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            ++LP G +R +R P  AAE+MLE P HFL +A +L AGRR   L+AD+DLE G VYAAFP
Sbjct  13   IVLPDGGLRLVRPPATAAELMLEAPGHFLADARALQAGRRIVALAADEDLELGGVYAAFP  72

Query  389  MKRLSS  372
            MKRL S
Sbjct  73   MKRLGS  78



>gb|EMT33581.1| hypothetical protein F775_21936 [Aegilops tauschii]
Length=169

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgr-kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+  +    A   R++LP G +R +R P  AAE+MLE P HFL +A +L  GRR
Sbjct  1    MGNFASCTLARIPGAAKDVRIVLPDGGLRLVRPPATAAELMLEAPGHFLADASALQVGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSS  372
               L+AD++LE G  YAAFPMKRL S
Sbjct  61   IEALAADEELELGGGYAAFPMKRLGS  86



>dbj|BAD82524.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG99037.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71293.1| hypothetical protein OsI_03307 [Oryza sativa Indica Group]
Length=188

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = -2

Query  626  MGN-LVSCSarkgrkaaa-aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN L SC+  +   AA  A+V+LP G +R ++ P KAAE+MLE P HFL +A +L AG 
Sbjct  1    MGNHLASCTMARVPGAARGAKVVLPDGAVRAVKVPAKAAELMLEAPGHFLADARALRAGG  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSS  372
            R + L AD+DLE G +YAAFPMKRL +
Sbjct  61   RIAALGADEDLELGGLYAAFPMKRLGA  87



>ref|NP_001043902.1| Os01g0686000 [Oryza sativa Japonica Group]
 dbj|BAF05816.1| Os01g0686000, partial [Oryza sativa Japonica Group]
Length=225

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = -2

Query  638  FKFNMGN-LVSCSarkgrkaaa-aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSL  465
            +   MGN L SC+  +   AA  A+V+LP G +R ++ P KAAE+MLE P HFL +A +L
Sbjct  34   YLVGMGNHLASCTMARVPGAARGAKVVLPDGAVRAVKVPAKAAELMLEAPGHFLADARAL  93

Query  464  TAGRRFSPLSADQDLESGNVYAAFPMKRLSS  372
             AG R + L AD+DLE G +YAAFPMKRL +
Sbjct  94   RAGGRIAALGADEDLELGGLYAAFPMKRLGA  124



>ref|NP_001056259.1| Os05g0552800 [Oryza sativa Japonica Group]
 gb|AAT85197.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF18173.1| Os05g0552800 [Oryza sativa Japonica Group]
Length=167

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 86/151 (57%), Gaps = 8/151 (5%)
 Frame = -2

Query  569  VILPG-GEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAF  393
            VILP  G +R++  P  AAE+M++ P HFL +A +   G R + LSAD++LE G VYA F
Sbjct  12   VILPDDGGLRQVALPATAAELMMDAPGHFLADARAARVGARLAALSADEELELGAVYATF  71

Query  392  PMKRLSSVITaadvavllvaAKKSP---AKRLSAGNAAKVSPAEGGDETPGNDVGRLGVT  222
            PMKRL + +  AD+A L   A +     AK  +A  A   +P +  D  P   +  + V 
Sbjct  72   PMKRLGTPLAPADMARLAAVATREARRSAKVAAAVVAPPPTPLQAEDAAPRLRLDEM-VD  130

Query  221  SGFVGQE---YRHRLSLCRSKKPLLETIIEE  138
               V  +   Y+HRLS  RS++P LETI EE
Sbjct  131  DEAVAADMNVYKHRLSSERSRRPTLETIQEE  161



>ref|XP_010247001.1| PREDICTED: uncharacterized protein LOC104590155 [Nelumbo nucifera]
Length=131

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = -2

Query  626  MGNLVSC--SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN +SC  +    R++  A+VIL  GEI++L   VKAAE++ E   +FL N  SL  GR
Sbjct  1    MGNYISCMLANPAERQSRGAKVILLSGEIQQLDGHVKAAELIFEISNYFLGNFRSLQIGR  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVI  366
            RFS LS D+DLE GNVY  FPMKR++ VI
Sbjct  61   RFSTLSPDEDLEMGNVYIMFPMKRVNFVI  89



>gb|EAZ13124.1| hypothetical protein OsJ_03044 [Oryza sativa Japonica Group]
Length=179

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            V+LP G +R ++ P KAAE+MLE P HFL +A +L AG R + L AD+DLE G +YAAFP
Sbjct  13   VVLPDGAVRAVKVPAKAAELMLEAPGHFLADARALRAGGRIAALGADEDLELGGLYAAFP  72

Query  389  MKRLSS  372
            MKRL +
Sbjct  73   MKRLGA  78



>ref|XP_004961301.1| PREDICTED: uncharacterized protein LOC101771988 [Setaria italica]
Length=183

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN +SC+  K      ARVILP G +R++  P  AAE+ML+ P HFLV+A +   G R 
Sbjct  1    MGNYLSCTLAKAPGGRCARVILPDGGVRQVSLPATAAELMLDAPGHFLVDARAARVGARL  60

Query  446  SPLSADQDLESGNVYAAFPMKRLSS  372
            + L AD++LE G  YAAFPMKRL +
Sbjct  61   AALPADEELELGGAYAAFPMKRLGT  85



>dbj|BAK05735.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02176.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 86/175 (49%), Gaps = 12/175 (7%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN +SC+  K      ARVILP G +R++  P  AAE+M++ P HFL        G R 
Sbjct  1    MGNYLSCTLAKTPGGKGARVILPDGAVRQVTLPATAAELMMDAPGHFLAETRHARVGTRL  60

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE-  270
              L AD+DLE G VYA FPMKR+ + + A D+A L  AA +   +          + A  
Sbjct  61   EALHADEDLEMGAVYATFPMKRIGTKLAATDMARLAAAATREARRSAKVSAVGAAAAAAP  120

Query  269  --------GGDETPGNDVGRLGVTSGFVGQE---YRHRLSLCRSKKPLLETIIEE  138
                      +ETP        +    V  E    +HRLS  RS++P LETI EE
Sbjct  121  EPAVTFVPAAEETPSPRARLDEMVDDAVAAEIGVLKHRLSSARSRRPNLETIHEE  175



>ref|XP_010663707.1| PREDICTED: uncharacterized protein LOC100257591 [Vitis vinifera]
Length=167

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 79/166 (48%), Gaps = 0/166 (0%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+          +V+   G +     PVKAAE+ML+ P HF+ N+  L  G+R 
Sbjct  1    MGNATSCAPSILSNTGVVKVLSSDGRLEVYTRPVKAAELMLDKPGHFVCNSTDLKVGQRI  60

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              LSAD++LE   +Y   PM+ L SV+T  +++ L   A K    R ++ N  ++ P   
Sbjct  61   PGLSADEELELRQLYFLLPMEMLYSVLTHEEISSLSYKASKVVKHRSTSNNFGRIFPLGL  120

Query  266  GDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
             D        +   +      E   R S  RS  P LETI+E P R
Sbjct  121  SDFCMFPSETKTLASPTTDHPEPVQRYSRQRSWSPALETIVETPSR  166



>ref|XP_007036867.1| Uncharacterized protein TCM_012897 [Theobroma cacao]
 gb|EOY21368.1| Uncharacterized protein TCM_012897 [Theobroma cacao]
Length=164

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 84/173 (49%), Gaps = 17/173 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+           V+ P G ++   +PVKAA++MLE+P  F+ ++ SL  G R 
Sbjct  1    MGNAASCAPSIISSGVVK-VLFPDGNMQMYTKPVKAADLMLENPGQFVCDSSSLKVGYRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA--  273
              L+AD+ LE   VY   PM+ L SV+T  +++ L   A K+  K  +  N  K+ P   
Sbjct  60   HGLTADEVLERRQVYFLLPMELLYSVLTHEEMSCLTCKATKA-LKHATFNNFGKIFPVFT  118

Query  272  -----EGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
                     +TP N V +          +   R S  RS +P LETI+E P R
Sbjct  119  EFCIFPSEAKTPENPVSKTA--------DPVERYSKQRSWRPALETIVETPCR  163



>gb|EYU41313.1| hypothetical protein MIMGU_mgv1a019370mg [Erythranthe guttata]
Length=133

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 72/122 (59%), Gaps = 9/122 (7%)
 Frame = -2

Query  479  NAGSLTAGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSA  300
            ++ S  + ++FS L+AD+DLE G VY  FPM RL S +TAAD A +  AA  +      A
Sbjct  18   SSNSSLSPQKFSALNADEDLEIGGVYVFFPMSRLKSAVTAADEAAISAAANSA------A  71

Query  299  GNAAKVSPAEGGDETPGNDVG---RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
              A++VSP   GD    +       L      +  E++HRLS+CRS+KPLLETI+EEPV 
Sbjct  72   KKASRVSPDRDGDTASASAPAPKLNLDDIEDLLTPEFKHRLSMCRSRKPLLETIVEEPVS  131

Query  128  TR  123
             R
Sbjct  132  LR  133



>gb|ABK26794.1| unknown [Picea sitchensis]
Length=201

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN VSC++          V+   G ++ L+  +KAAE+MLE+P HF+ +A  L  GRR 
Sbjct  1    MGNYVSCASNSVPSNTVK-VVSWNGSVQELQRRIKAAELMLENPQHFVCHANGLQIGRRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVIT  363
            +PL+AD++LE G++Y   PM +L+SV++
Sbjct  60   NPLTADEELEVGHLYFLLPMAKLNSVLS  87



>ref|XP_004301246.1| PREDICTED: uncharacterized protein LOC101291835 [Fragaria vesca 
subsp. vesca]
Length=177

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 84/172 (49%), Gaps = 12/172 (7%)
 Frame = -2

Query  626  MGNLV-SCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN   SC+      +A  +V+   G +     P+KAAE+MLE+  HF+V + SL  G R
Sbjct  1    MGNAAASCAPSILSNSATVKVLFFDGRLEVYTRPIKAAELMLENSGHFVVESTSLKVGNR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE  270
               L+AD+DLE  N Y   PM  L SV+T  +++ L   A ++   R S  N +K+ P  
Sbjct  61   IHGLTADEDLERRNFYFLLPMDLLYSVLTHEELSSLTYKASRALKHRGSFNNFSKIFPVL  120

Query  269  G---------GDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIE  141
            G              G+D   L   S     E R+  S  RS KP LETI+E
Sbjct  121  GEFCMFPNSESKTLDGSDHHSLASHSLVPLLERRY--SKQRSWKPALETIVE  170



>ref|XP_004969575.1| PREDICTED: angiomotin-like [Setaria italica]
Length=205

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaa-aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+          ARV+LP G +R++  P  AAE+MLE P HFL +A +L  GRR
Sbjct  1    MGNFASCTLATAAGTGRGARVVLPDGRVRQVPLPATAAELMLEAPGHFLADARALRPGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVI  366
               L AD+ L  G +YAA PMKRL + +
Sbjct  61   IEALPADEALVRGALYAALPMKRLGAPV  88



>ref|XP_007160548.1| hypothetical protein PHAVU_002G330900g [Phaseolus vulgaris]
 gb|ESW32542.1| hypothetical protein PHAVU_002G330900g [Phaseolus vulgaris]
Length=163

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 82/165 (50%), Gaps = 3/165 (2%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+           + L  G +    +P++AAE+MLE+P HF+ ++ +L  G R 
Sbjct  1    MGNAASCTPSLTANGVFKVLFL-DGRLESYTKPMRAAELMLEYPGHFVCDSTNLKVGHRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              L AD++L+    Y   PM+ L SV+T  +++ L   A + P K  S  N  K+ P   
Sbjct  60   QGLLADEELQRRKFYFLLPMELLYSVLTHEEMSSLNYKASR-PTKHTSFNNLGKIFPVFT  118

Query  266  GDETPGNDVGRLGVTSGFVGQ-EYRHRLSLCRSKKPLLETIIEEP  135
                  +++ RL   +  V + E   R S  RS +P LETI E P
Sbjct  119  EFCMFPSELKRLEAANQVVREPEPVERYSKQRSWRPALETIDETP  163



>gb|EYU40372.1| hypothetical protein MIMGU_mgv1a026017mg [Erythranthe guttata]
Length=160

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 82/165 (50%), Gaps = 7/165 (4%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREP-VKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN+  C+        A  + + G ++   REP +KAAEIMLE+P  FL  +  L  G+R
Sbjct  1    MGNVALCAPSITSNGVAKVLTIDGRQLTYTREPAIKAAEIMLENPGQFLCESNQLIVGQR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE  270
               + A+++LE G+VY   PM+ L SV+T  +  +L     K   K       +K+ P E
Sbjct  61   IPGICAEEELEVGHVYFLLPMELLYSVLTDDEKKILSHKYSKEIMKL----KISKIFP-E  115

Query  269  GGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
                  GN    +   S  +G +   R S  RS +P LETI+E P
Sbjct  116  FCLFPNGNSDSSME-ESAEIGSQLVKRYSRQRSWQPALETIVETP  159



>ref|NP_001142659.1| hypothetical protein [Zea mays]
 gb|ACG25811.1| hypothetical protein [Zea mays]
 tpg|DAA58076.1| TPA: hypothetical protein ZEAMMB73_958259 [Zea mays]
Length=205

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 3/90 (3%)
 Frame = -2

Query  626  MGNLVSCSarkgr---kaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG  456
            MGN  SC+  +     +A+ + V+LP G +R++  P  AAE+ML+ P HFL +A +L  G
Sbjct  1    MGNFASCTLARTAGAGRASGSTVVLPDGRVRQVALPATAAELMLDAPGHFLADARALRPG  60

Query  455  RRFSPLSADQDLESGNVYAAFPMKRLSSVI  366
            RR   L+AD+ L  G +YA  PMKRL + +
Sbjct  61   RRIEALAADEGLVRGALYAVLPMKRLGAPV  90



>ref|XP_010045684.1| PREDICTED: uncharacterized protein LOC104434463 [Eucalyptus grandis]
 gb|KCW84015.1| hypothetical protein EUGRSUZ_B00885 [Eucalyptus grandis]
Length=163

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 86/171 (50%), Gaps = 14/171 (8%)
 Frame = -2

Query  626  MGNLVSCSarkgrk-aaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+       ++ A+V+   G+++    PV+AAE+MLE+P  FL N+ +L  G R
Sbjct  1    MGNAASCAPSIIISGSSVAKVLTSDGKMQIYTRPVRAAELMLENPGQFLCNSSTLRVGHR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA-  273
               L AD++LE    Y   PM+ L SV+T  +++ L   A K+  K  S  N +K+ P  
Sbjct  61   IHGLLADEELELRRFYFFLPMELLYSVLTYEEMSALTYRASKA-LKHGSFNNLSKIFPVC  119

Query  272  ---EGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
                    T G+D          V  E   R S  RS +P LETI+E P R
Sbjct  120  IFPSESKRTEGSDRD--------VVLEPIERYSKQRSWRPALETIVETPCR  162



>ref|XP_011039166.1| PREDICTED: uncharacterized protein LOC105135810 [Populus euphratica]
Length=163

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 81/167 (49%), Gaps = 7/167 (4%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILP-GGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+          +V+    G ++   +PVKAAE+MLE+P  F+ ++ SL  G R
Sbjct  1    MGNATSCAPSIISSNGVVKVLFSDNGNLQIYTKPVKAAELMLENPGQFVCDSTSLKVGCR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE  270
               LSAD +LE   +Y   PM+ L SV+T  +++     A K+    L   N  K+ P  
Sbjct  61   IHGLSADDELERRQLYFVLPMELLYSVLTHEELSSFTYKATKA----LKYNNFGKIFPVL  116

Query  269  GGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
                   ++   +G  S     +   R S  RS KP LETI+E P R
Sbjct  117  SEFCIFLSEGKTMG--SMVTEPQPMERYSKQRSWKPALETIVETPCR  161



>ref|XP_004969573.1| PREDICTED: uncharacterized protein LOC101758952 [Setaria italica]
Length=204

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaa-aRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+          ARV+LP G +R++  P  AAE+MLE P HFL +A +L  GRR
Sbjct  1    MGNFASCTLATTPGTGRGARVVLPDGRVRQVPLPATAAELMLEVPGHFLADARALRPGRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVI  366
               L AD+ L  G +YA  PMKRL + +
Sbjct  61   IEALPADEALVRGALYATLPMKRLGAPV  88



>ref|XP_002456164.1| hypothetical protein SORBIDRAFT_03g031490 [Sorghum bicolor]
 gb|EES01284.1| hypothetical protein SORBIDRAFT_03g031490 [Sorghum bicolor]
Length=294

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = -2

Query  629  NMGNLVSCSarkgrkaaaaR-----VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSL  465
            +MGN  SC+      A         V+LP G +R++  P  AAE+ML+ P HFL +A +L
Sbjct  79   SMGNFASCTMAGAAGAGGRASSGARVVLPDGRVRQVTLPATAAELMLDAPGHFLADARAL  138

Query  464  TAGRRFSPLSADQDLESGNVYAAFPMKRLSSVI  366
             AGRR   L AD+ L  G +YAA PMKRL + +
Sbjct  139  RAGRRIEALGADEALVRGALYAALPMKRLGAPV  171



>ref|XP_010034171.1| PREDICTED: uncharacterized protein LOC104423366 [Eucalyptus grandis]
 gb|KCW84099.1| hypothetical protein EUGRSUZ_B00987 [Eucalyptus grandis]
Length=163

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 84/171 (49%), Gaps = 14/171 (8%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPG-GEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+       ++   +L   G+++    PV+AAE+MLE+P  FL N+ +L  G R
Sbjct  1    MGNAASCAPSIIISGSSVAKVLSSDGKMQIYTRPVRAAELMLENPGQFLCNSSTLRVGHR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA-  273
               L AD++LE    Y   PM+ L SV+T  +++ L   A K+  K  S  N +K+ P  
Sbjct  61   IHGLLADEELELRRFYFFLPMELLYSVLTYEEMSALTYRASKA-LKHGSFNNLSKIFPVC  119

Query  272  ---EGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
                    T G+D          V  E   R S  RS +P LETI+E P R
Sbjct  120  IFPSESKRTEGSDRD--------VVLEPIERYSKQRSWRPALETIVETPCR  162



>emb|CBI15598.3| unnamed protein product [Vitis vinifera]
Length=167

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 75/160 (47%), Gaps = 0/160 (0%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+          +V+   G +     PVKAAE+ML+ P HF+ N+  L  G+R 
Sbjct  1    MGNATSCAPSILSNTGVVKVLSSDGRLEVYTRPVKAAELMLDKPGHFVCNSTDLKVGQRI  60

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              LSAD++LE   +Y   PM+ L SV+T  +++ L   A K    R ++ N  ++ P   
Sbjct  61   PGLSADEELELRQLYFLLPMEMLYSVLTHEEISSLSYKASKVVKHRSTSNNFGRIFPLGL  120

Query  266  GDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETI  147
             D        +   +      E   R S  RS  P LETI
Sbjct  121  SDFCMFPSETKTLASPTTDHPEPVQRYSRQRSWSPALETI  160



>gb|ABK25935.1| unknown [Picea sitchensis]
Length=206

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 4/92 (4%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaR----VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTA  459
            MG+ +SCS+              VI   G ++ L+  +KAAE+ML++P HF+ +A  L  
Sbjct  1    MGSYISCSSNSVTSGTVTSGTVKVINSNGSVQTLQRRIKAAELMLDNPQHFVCHANGLQI  60

Query  458  GRRFSPLSADQDLESGNVYAAFPMKRLSSVIT  363
            GRR +PL+AD++L+ G++Y   PM +L SV++
Sbjct  61   GRRINPLTADEELDFGHLYFLLPMAKLHSVLS  92



>ref|XP_002317865.1| hypothetical protein POPTR_0012s04290g [Populus trichocarpa]
 ref|XP_006387853.1| hypothetical protein POPTR_0520s00220g [Populus trichocarpa]
 gb|EEE96085.1| hypothetical protein POPTR_0012s04290g [Populus trichocarpa]
 gb|ERP46767.1| hypothetical protein POPTR_0520s00220g [Populus trichocarpa]
Length=163

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 83/169 (49%), Gaps = 11/169 (7%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILP-GGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC+          +V+    G ++   +PVKAAE+MLE+P  F+ ++ SL  G R
Sbjct  1    MGNATSCAPSIISSNGVVKVLFSDNGNLQIYTKPVKAAELMLENPGQFVCDSASLKVGYR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAE  270
               LSAD +LE   +Y   P + L SV+T  +++ L   A K+    L   N  K+ P  
Sbjct  61   IHCLSADDELERRQLYFVLPTELLYSVLTHEELSSLTYKATKA----LKYNNFGKIFPVL  116

Query  269  GGDETPGNDVGRLGVTSGFVGQEYR--HRLSLCRSKKPLLETIIEEPVR  129
                   ++    G T+  +  E +   R S  RS KP LETI+E P R
Sbjct  117  SEFCIFPSE----GKTTDSMATEPQPMERYSKQRSWKPALETIVETPCR  161



>emb|CDO98332.1| unnamed protein product [Coffea canephora]
Length=167

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 80/171 (47%), Gaps = 16/171 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN+  C+           V+   G +     PVKAAE+MLE+P  F+ ++  L  G R 
Sbjct  1    MGNVALCAPSIISSGVVK-VLFSDGRLVIYTRPVKAAELMLENPGQFVCDSSHLKIGHRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              LSAD++LE   +Y   PM+ L SV+T     +  +  K S A +  + + +K+ P  G
Sbjct  60   PGLSADEELEVRQIYYLLPMEMLYSVLT--SEEMGSLNDKSSKAFKQGSLSFSKIFPVLG  117

Query  266  G-------DETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
                     ET  N      + S   G E   R +  RS KP LETIIE P
Sbjct  118  DFCLFPLTSETSKN------LDSATNGPEPAERYARQRSWKPALETIIEAP  162



>gb|AFG55392.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
Length=140

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI   G ++  +  +KAAE+ML++P HF+ +A  L  GRR +PLSAD+DL+ G++Y   P
Sbjct  1    VIHWDGSVQGFQRIIKAAELMLDNPQHFVCHANGLQIGRRINPLSADEDLDLGHLYFLLP  60

Query  389  MKRLSSVIT  363
            M +L SV++
Sbjct  61   MTKLHSVLS  69



>gb|AFG55379.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55382.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55387.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
Length=140

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI   G ++  +  +KAAE+ML++P HF+ +A  L  GRR +PLSAD+DL+ G++Y   P
Sbjct  1    VIHWDGSVQGFQRIIKAAELMLDNPQHFVCHANGLQIGRRINPLSADEDLDLGHLYFLLP  60

Query  389  MKRLSSVIT  363
            M +L SV++
Sbjct  61   MTKLHSVLS  69



>gb|AEW07701.1| hypothetical protein 0_9306_01, partial [Pinus radiata]
 gb|AFG55380.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55381.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55384.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55385.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55386.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55388.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55389.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55390.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
Length=140

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI   G ++  +  +KAAE+ML++P HF+ +A  L  GRR +PLSAD+DL+ G++Y   P
Sbjct  1    VIHWDGSVQGFQRIIKAAELMLDNPQHFVCHANGLQIGRRINPLSADEDLDLGHLYFLLP  60

Query  389  MKRLSSVIT  363
            M +L SV++
Sbjct  61   MTKLHSVLS  69



>gb|AFG55383.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
 gb|AFG55391.1| hypothetical protein 0_9306_01, partial [Pinus taeda]
Length=140

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI   G ++  +  +KAAE+ML++P HF+ +A  L  GRR +PLSAD+DL+ G++Y   P
Sbjct  1    VIHWDGSVQGFQRIIKAAELMLDNPQHFVCHANGLQIGRRINPLSADEDLDLGHLYFLLP  60

Query  389  MKRLSSVIT  363
            M +L SV++
Sbjct  61   MTKLHSVLS  69



>ref|XP_011035591.1| PREDICTED: uncharacterized protein LOC105133339 [Populus euphratica]
Length=163

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 79/166 (48%), Gaps = 10/166 (6%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN +SC+           +   GG ++   +PVKAAE+MLE+P  F+ ++ SL  G R 
Sbjct  1    MGNAISCAPSIISNGVVKVLFSNGGNLQIYTKPVKAAELMLENPGQFVCDSTSLKVGHRV  60

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              LSAD  L     Y   PM+ L SV+T  +++ L   A K+    L   N  K+ P   
Sbjct  61   HGLSADDQLVRRQFYFVLPMELLYSVLTHEEMSSLTYKATKA----LKYNNFGKIFPVLS  116

Query  266  GDETPGNDVGRLGVTSGFVGQEYR--HRLSLCRSKKPLLETIIEEP  135
                  ++    G T   +  E +   R S  RS KP LETI+E P
Sbjct  117  EFCIFPSE----GKTMDSMATEPQPMERYSKQRSWKPALETIVETP  158



>ref|XP_011084092.1| PREDICTED: uncharacterized protein LOC105166437 [Sesamum indicum]
Length=177

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 83/175 (47%), Gaps = 10/175 (6%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGE--IRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN   C+          +V+   G   I    EPV+AAEIMLE+P  FL  +  L  G+
Sbjct  1    MGNAALCAPSIISNNGVVKVLSADGRLMIYTRDEPVRAAEIMLENPGQFLCESRQLRVGQ  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAG--NAAKVS  279
            R + + A+++LE G  Y   PM+ L SV+T  ++  L+        K+ +A   N +K+ 
Sbjct  61   RIAGMCAEEELERGRDYFLLPMQMLYSVLTNEEMKSLISQKPSRGNKQQAAAALNFSKIF  120

Query  278  PA----EGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPVRT  126
            P       G E    +     V  G    ++  R S  RS +P LETIIE P R+
Sbjct  121  PEFCLFPNGAEAKAVEDQSAAVAGG--DSQHVERYSRQRSWQPALETIIETPPRS  173



>ref|XP_010253032.1| PREDICTED: uncharacterized protein LOC104594455 [Nelumbo nucifera]
Length=147

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VILP  +   L    +      E P +FLVN+ SL  GRRFS LS ++DLE GNVY  FP
Sbjct  22   VILPSAKSGNLTAMSRRRNSCFEIPNYFLVNSRSLQIGRRFSTLSVNEDLEMGNVYIMFP  81

Query  389  MKRLSSVI  366
            MKR++SVI
Sbjct  82   MKRVNSVI  89



>gb|ABK24016.1| unknown [Picea sitchensis]
 gb|ABK25096.1| unknown [Picea sitchensis]
 gb|ABK26172.1| unknown [Picea sitchensis]
Length=203

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MG+ +SC++     +    VI   G ++ L+  + AAE+ML++P HF+ +A  L  GRR 
Sbjct  1    MGSYISCASNTVPSSTVK-VIHWNGSVQDLQRRITAAELMLDNPQHFVCHANGLQIGRRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVIT  363
            +PL+AD++L+ G +Y   PM +L SV++
Sbjct  60   NPLTADEELDLGYLYFLLPMPKLHSVLS  87



>ref|NP_001145429.1| uncharacterized protein LOC100278798 [Zea mays]
 gb|ACG47511.1| hypothetical protein [Zea mays]
Length=177

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 8/93 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrk----aaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVN----AG  471
            MGN +SC+  K          ARVILP G +R++  P  AAE+M++ P HFLV+      
Sbjct  1    MGNYLSCTLAKAPGPRPGGKRARVILPDGGVRQVALPATAAELMMDAPGHFLVHVHARGA  60

Query  470  SLTAGRRFSPLSADQDLESGNVYAAFPMKRLSS  372
             L  G R + L AD++L+ G VYA FPMKRL +
Sbjct  61   GLGLGARLAALPADEELQLGAVYATFPMKRLGT  93



>gb|AFW81018.1| hypothetical protein ZEAMMB73_853883 [Zea mays]
Length=177

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 8/93 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrka----aaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVN----AG  471
            MGN +SC+  K          ARVILP G +R++  P  AAE+M++ P HFLV+      
Sbjct  1    MGNYLSCTLAKAPGPRPGGKRARVILPDGGVRQVALPATAAELMMDAPGHFLVHVHARGA  60

Query  470  SLTAGRRFSPLSADQDLESGNVYAAFPMKRLSS  372
             L  G R + L AD++L+ G VYA FPMKRL +
Sbjct  61   GLGLGARLAALPADEELQLGAVYATFPMKRLGT  93



>ref|XP_002530795.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31596.1| conserved hypothetical protein [Ricinus communis]
Length=160

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 76/162 (47%), Gaps = 3/162 (2%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+          +V+   G ++   +PVKAAE+MLE+P  F+ ++ SL  G R 
Sbjct  1    MGNAASCAPLIISSNGVVKVLPSNGTLQIYTKPVKAAELMLENPGQFVCDSSSLKVGHRI  60

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              +SAD++LE   +Y   PM  L SV+T  ++      A K   K ++ G    + P   
Sbjct  61   QGVSADEELERHQLYFLLPMDLLYSVLTQEEMTCFTCKATKG-LKYINLGKI--IFPVFS  117

Query  266  GDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIE  141
                  +++            +   R S  RS KP LETI+E
Sbjct  118  ELCIFPSEIKTKNHNPTCTDTQLVERFSKQRSWKPALETILE  159



>gb|ABK23724.1| unknown [Picea sitchensis]
Length=203

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MG+ +SC++     +    VI   G ++ L++ + AAE+ML++P HF+ +A  L  GRR 
Sbjct  1    MGSYISCASNTVPSSTVK-VIHWNGSVQVLQKRITAAELMLDNPQHFVCHANGLQIGRRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVIT  363
            +PL+AD+ L+ G +Y   PM +L SV++
Sbjct  60   NPLTADEKLDLGYLYFLLPMPKLHSVLS  87



>ref|XP_002322115.2| hypothetical protein POPTR_0015s04770g [Populus trichocarpa]
 gb|ABK94840.1| unknown [Populus trichocarpa]
 gb|EEF06242.2| hypothetical protein POPTR_0015s04770g [Populus trichocarpa]
Length=162

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 79/166 (48%), Gaps = 11/166 (7%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+           V+  GG ++   +PVKAAE+MLE+P  F+ ++ SL  G R 
Sbjct  1    MGNATSCAPSIISNGVVK-VLTNGGNLQIYTKPVKAAELMLENPGQFVCDSTSLKVGHRV  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              L AD  LE    Y   PM+ L SV+T  +++ L   A K+    L   N  K+ P   
Sbjct  60   HGLLADDQLERRQFYFVLPMELLYSVLTHEEMSSLTYKATKA----LKYNNFGKIFPVLS  115

Query  266  GDETPGNDVGRLGVTSGFVGQEYR--HRLSLCRSKKPLLETIIEEP  135
                  ++    G T   +  E +   R S  RS KP LETI+E P
Sbjct  116  EFCIFPSE----GKTMDSMATEPQPMERYSKQRSWKPALETIVETP  157



>ref|XP_006855288.1| hypothetical protein AMTR_s00057p00042010 [Amborella trichopoda]
 gb|ERN16755.1| hypothetical protein AMTR_s00057p00042010 [Amborella trichopoda]
Length=155

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 77/152 (51%), Gaps = 24/152 (16%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            +I  GG   R+ E  K AEIMLE+P H +     +   RR S L AD++L SG VY  FP
Sbjct  18   IIDLGGNTSRVLEHTKIAEIMLENPGHLVSPVAGILRTRRISALKADEELASGEVYFIFP  77

Query  389  MKRLSSVITaadvavllvaAKKSPAKRL--SAGNAA-------KVSPAEGGDETPGNDVG  237
              RL+S ++  ++A L    ++  ++++  ++G  A       K +  E GD        
Sbjct  78   ANRLNSRVSDEEMAFLDGKKREKSSRKVFPTSGEMAEKPVALPKFTVEEAGD--------  129

Query  236  RLGVTSGFVGQEYRHRLSLCRSKKPLLETIIE  141
                 +GF G    HRL++ R+  P+LETI E
Sbjct  130  ---CDTGFAG----HRLAVYRNWMPVLETISE  154



>ref|XP_002275699.1| PREDICTED: uncharacterized protein LOC100253802 [Vitis vinifera]
Length=163

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 82/170 (48%), Gaps = 17/170 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN ++C + +      A++    G +RR++ PV AAE+MLE P + +     L   RR 
Sbjct  1    MGNYMTCHSFQSSTPKTAKLFDAHGNLRRVKVPVTAAELMLEEPGYVVSRVDDLRRTRRI  60

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              + AD  L  G  Y   P+ R+  V++  ++A++  A+KK   KR      ++V PA G
Sbjct  61   PAMRADDVLLEGKAYLMMPVSRVHCVVSEVEMALIAAASKKRSKKR----GGSRVLPA-G  115

Query  266  GDETPGNDVGRLGVTSGFVGQ--------EYRHRLSLCRSKKPLLETIIE  141
             + T  N    L V S  +G           RHRL   R   P+LETI E
Sbjct  116  NEGTTEN----LEVQSRVLGSDGGGDVGFFGRHRLGNFRQWSPVLETISE  161



>ref|XP_010688542.1| PREDICTED: uncharacterized protein LOC104902448 [Beta vulgaris 
subsp. vulgaris]
Length=164

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC        +A +V+   G +R    PVKAAE+MLE+P HF+ +AG+L  G R 
Sbjct  1    MGN-TSCFPAIISSNSATKVLRWDGGLRVYPRPVKAAELMLENPGHFVCSAGTLQVGHRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            S L A+ +L+   +Y   PM  L SVIT  +V+ + + A K+ AK+ +  N  K+ P
Sbjct  60   SGLVANDELQPRTLYFLLPMDLLYSVITTDEVSHMDIKAHKA-AKQGNLHNLGKIFP  115



>ref|NP_001144445.1| uncharacterized protein LOC100277407 [Zea mays]
 gb|ACG40596.1| hypothetical protein [Zea mays]
Length=175

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 87/178 (49%), Gaps = 24/178 (13%)
 Frame = -2

Query  626  MGNLVSCSarkgrka----aaaRVILPG-GEIRRLREPVKAAEIMLEHPTHFLVN----A  474
            MGN +SC+  K          ARVILP  G +R++  P  AAE+M++ P HFLV+     
Sbjct  1    MGNYLSCTLAKAPGPRPGGKRARVILPDDGGVRQVALPATAAELMMDAPGHFLVHVHARG  60

Query  473  GSLTAGRRFSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGN  294
              L  G R + L AD++L+ G VYA FPMKRL + + A D+A L  AA +   +      
Sbjct  61   AGLGLGARLAALPADEELQLGAVYATFPMKRLGTPLAAPDLARLAAAAAREAHRSAKVAV  120

Query  293  AAKVSPAEGGDETPGNDVGRL---GVTSGFVGQEY---RHRLSLCRSKKPLLETIIEE  138
             A   P          D  RL    +       E    +HR S  RS++P LETI EE
Sbjct  121  VAAPPP---------EDAPRLRLEEMVDDAAAAEIAVTKHRASGARSRRPTLETIDEE  169



>gb|ABK21767.1| unknown [Picea sitchensis]
Length=180

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 83/182 (46%), Gaps = 24/182 (13%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MG+ VS +A     AA A++IL  G I    E V++ EI+ E+P HF+ N+  L AGR  
Sbjct  1    MGSCVSSTATSSVPAATAKLILMDGSILEFSEVVRSQEILQEYPGHFICNSDGLYAGRNI  60

Query  446  SPLSADQD-LESGNVYAAFPMKRLSSVITaa---------dvavllvaAKKSPAKRLSAG  297
            S +  D D L+ G +Y   P ++L  V+T +           A      KK  ++RLS G
Sbjct  61   SQVLRDDDQLQIGQLYFLLPQRKLQFVLTDSDMASLLFKISTAWQSAQKKKRQSRRLSCG  120

Query  296  ---NAAKVSP-------AEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETI  147
                 A+V P        E G E   + V  L           R RL      +P+LETI
Sbjct  121  FVKAQAQVQPFFNIHSQPECGPEYHSSSVCCLSRRPNIPISTDRQRLQY----QPMLETI  176

Query  146  IE  141
            +E
Sbjct  177  VE  178



>gb|KDP25973.1| hypothetical protein JCGZ_22703 [Jatropha curcas]
Length=158

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+      +   +V+   G  +   +PVKAAE+M+E+P  F+  + SL  G+R 
Sbjct  1    MGNATSCAPSIIPSSGVVKVLFSNGTFQIYTKPVKAAELMVENPGQFVCESTSLKVGQRV  60

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVIT  363
              L AD++LE   +Y   PM  L SV+T
Sbjct  61   QGLLADEELERRQLYFLLPMDLLYSVLT  88



>ref|XP_004503263.1| PREDICTED: uncharacterized protein LOC101493228 [Cicer arietinum]
Length=167

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 79/168 (47%), Gaps = 11/168 (7%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+   G       V+L  G I    +P++AAE+M+E+   F+ ++  L  G R 
Sbjct  1    MGNAASCTPTNGVFK----VLLLNGRIETYTKPIRAAELMVEYTGQFVCDSSYLKVGHRI  56

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              L AD++LE    Y   PM+ L SV+T  +++ L   A ++  K  S  N  K+ P   
Sbjct  57   QGLLADEELERRKFYFLLPMELLYSVLTHEEMSSLNYKASRA-TKHASFNNLGKIFPVFS  115

Query  266  GDETPGNDVGRLGVTSGFVGQEYRH------RLSLCRSKKPLLETIIE  141
                  ++  R+ + +    Q  R       R S  RS +P LETI E
Sbjct  116  EFCMFPSETKRITLEADHNNQVVREETEPVKRYSKQRSWRPALETIDE  163



>ref|XP_010243767.1| PREDICTED: uncharacterized protein LOC104587745 [Nelumbo nucifera]
Length=160

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 77/165 (47%), Gaps = 7/165 (4%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+       A   V+   G +     P+KAAE+MLE+P  F+  +  L  G R 
Sbjct  1    MGNTTSCAPTNASNGAVK-VLFCDGRMEVYTRPIKAAELMLENPCQFVCESSDLKVGHRV  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              L AD +LE  ++Y   P++ L SV+T  ++  L   A ++  KR S+ N  K+ P   
Sbjct  60   PGLGADVELEQRHLYFLLPIEMLYSVLTDEEMDSLSCRASRA-TKRGSSNNIGKIFPDFC  118

Query  266  GDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEPV  132
               +    +  L  +      E   R S  RS KP L+TI E P 
Sbjct  119  LFPSEFKTMDSLDRSP-----EPIERYSTQRSWKPSLDTIDETPC  158



>ref|XP_010921515.1| PREDICTED: uncharacterized protein LOC105045054 [Elaeis guineensis]
Length=202

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 45/90 (50%), Gaps = 8/90 (9%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaa-------RVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGS  468
            MGN VSC    G             +++L  G +     P+  AE+MLEHP  F+V   S
Sbjct  1    MGNFVSCQEADGGGGCGGSGGGGWGKIVLTNGTVHEFDRPISVAELMLEHPRRFVVEMHS  60

Query  467  LTAG-RRFSPLSADQDLESGNVYAAFPMKR  381
            L+AG    +PL AD  L+ GN Y  FPM R
Sbjct  61   LSAGATSVTPLPADHTLDPGNAYLMFPMTR  90



>ref|NP_001241321.1| uncharacterized protein LOC100792772 [Glycine max]
 gb|ACU23154.1| unknown [Glycine max]
 gb|KHN00141.1| hypothetical protein glysoja_028669 [Glycine soja]
Length=168

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 79/168 (47%), Gaps = 8/168 (5%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+          +++L  G +   ++P++AAE+MLE+P  F+ ++  L  G R 
Sbjct  1    MGNAASCTPSLISNNGVLKILLSDGRLEAYKKPMRAAELMLEYPGQFVCDSCYLKVGHRI  60

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              L AD  LE    Y   PM+ L SV+T  +++ L   A ++  K  +  N  K+ P   
Sbjct  61   HGLLADDQLERRKFYFLLPMELLYSVLTHEEMSSLNYKASRA-TKHATFNNLGKIFPVFS  119

Query  266  GDETPGNDVGRLGVTSGFVGQEYR------HRLSLCRSKKPLLETIIE  141
                  +++ RL      + Q  R       R S  RS +P LET+ E
Sbjct  120  ELCMFPSELKRLEEADNQL-QLVREPEPPVQRYSKQRSWRPALETVDE  166



>ref|XP_010259338.1| PREDICTED: uncharacterized protein LOC104598806 [Nelumbo nucifera]
Length=194

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN +S            +VILP G +    +P+  AE+MLEHP   +V   SL AG + 
Sbjct  1    MGNYIS----HQSAKGTGKVILPDGSVHEFDQPLAVAELMLEHPQQIVVEFHSLAAGNKP  56

Query  446  SPLSADQDLESGNVYAAFPMKR  381
            +PL AD  LE   VY   PMKR
Sbjct  57   APLPADTMLEMEKVYLMLPMKR  78



>ref|XP_003631129.1| hypothetical protein MTR_8g107420 [Medicago truncatula]
 gb|AET05605.1| DUF4228 domain protein [Medicago truncatula]
Length=166

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 82/170 (48%), Gaps = 9/170 (5%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN+ SC+  KG       V+L  G I    + ++AAE+M+E+P  F+ ++  L  G R 
Sbjct  1    MGNVASCTPTKGVFK----VLLLDGRIETHSKALRAAELMVEYPGQFVCDSSYLKVGHRI  56

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              L AD++LE+   Y   PM  L SV+T  +++ L   A ++  K  S  N  K+ P   
Sbjct  57   QGLLADEELETRKFYFLLPMDLLYSVLTHEEMSALNYKASRA-TKHASFNNLGKIFPVFS  115

Query  266  GDETPGNDVGRLGVTSG----FVGQEYRHRLSLCRSKKPLLETIIEEPVR  129
                  ++  ++ + S         E   R S  RS +P LETI E P R
Sbjct  116  EFCMFPSEAKKIVLESDNYEMLREAEPVKRYSKQRSWRPALETIDETPSR  165



>ref|XP_008786364.1| PREDICTED: uncharacterized protein LOC103704729 [Phoenix dactylifera]
Length=191

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAG-RR  450
            MGN VSC            V+L  G I     P+  AE+MLEHP  F+V+  SL+AG  +
Sbjct  1    MGNFVSCRTLDAGGGK---VVLFDGTIHEFDRPISVAELMLEHPRQFVVDMQSLSAGATK  57

Query  449  FSPLSADQDLESGNVYAAFPMKR  381
             +PL AD  L++  +Y   PM R
Sbjct  58   VTPLPADHTLDTNKIYLMLPMTR  80



>ref|XP_007210759.1| hypothetical protein PRUPE_ppa020619mg [Prunus persica]
 gb|EMJ11958.1| hypothetical protein PRUPE_ppa020619mg [Prunus persica]
Length=177

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 72/154 (47%), Gaps = 10/154 (6%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            V+   G +      VKAAE+MLE+P  F+  + SL  G R   L+AD++LE    Y   P
Sbjct  22   VLFLDGRLEVYTRAVKAAELMLENPGQFVCESSSLKVGNRVHGLTADEELERRQFYFLLP  81

Query  389  MKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEGGDETPGNDVGRLGVTSGFV  210
            M  L SV+T  +++ L   A ++   R S  + +K+ P  G      ++  RL    G V
Sbjct  82   MDLLYSVLTHEELSSLTYKASEALKHR-SFNSFSKIFPVLGEFCMFPSEAKRLDKNIGDV  140

Query  209  GQEYRH---------RLSLCRSKKPLLETIIEEP  135
                 H         R S  RS KP LETI E P
Sbjct  141  ISPSSHSEPMLVLVERYSKQRSWKPALETIAETP  174



>ref|XP_010087252.1| hypothetical protein L484_009761 [Morus notabilis]
 gb|EXB28602.1| hypothetical protein L484_009761 [Morus notabilis]
Length=205

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VIL  G +    +PV AAE+MLEHP   +V      AG+R +PL AD+ LE+  VY   P
Sbjct  19   VILWDGSVHEFDKPVTAAELMLEHPQQAVVEFQPAVAGKRPTPLPADKKLETRRVYLMLP  78

Query  389  MKRLSSVI  366
            MKR   V+
Sbjct  79   MKRARKVM  86



>ref|XP_002275655.1| PREDICTED: uncharacterized protein LOC100258949 [Vitis vinifera]
Length=196

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 47/87 (54%), Gaps = 12/87 (14%)
 Frame = -2

Query  626  MGNLVS---CSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLV--NAGSLT  462
            MGN VS   CSA          ++L  G +    +PV  AE+MLEHP   +V  N+G  +
Sbjct  1    MGNYVSFRSCSAAGK-------IVLSDGSVHEFIKPVTVAELMLEHPQQVVVELNSGKGS  53

Query  461  AGRRFSPLSADQDLESGNVYAAFPMKR  381
             G+R SPL AD  LE G VY   PMKR
Sbjct  54   GGKRPSPLPADMKLEMGKVYLMLPMKR  80



>ref|XP_008781326.1| PREDICTED: uncharacterized protein LOC103701130 [Phoenix dactylifera]
Length=203

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 46/89 (52%), Gaps = 7/89 (8%)
 Frame = -2

Query  626  MGNLVSCSa------rkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSL  465
            MGN VSC A        G      +V+L  G ++    P+  AE+MLEHP  F+V+  SL
Sbjct  1    MGNFVSCQAPDGGGGGGGGGGGGGKVVLSDGTVQEFDRPISVAELMLEHPRQFVVDMQSL  60

Query  464  TAG-RRFSPLSADQDLESGNVYAAFPMKR  381
            +AG  R +PL AD  L+    Y   PM R
Sbjct  61   SAGATRMAPLPADHTLDPDKAYLMLPMTR  89



>ref|XP_008235192.1| PREDICTED: uncharacterized protein LOC103334045 [Prunus mume]
Length=195

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  S S ++   +A  +VIL  G + +  +P+  AE+MLEHP   ++  G+  +G+R 
Sbjct  1    MGN--SISHKQLHASATGKVILSDGSVHQFNKPLTVAELMLEHPQQVVIEFGAAVSGKRP  58

Query  446  SPLSADQDLESGNVYAAFPMKR  381
            +PL AD  L+   +Y   PMKR
Sbjct  59   TPLPADMKLDKKKIYLMLPMKR  80



>ref|XP_008240290.1| PREDICTED: uncharacterized protein LOC103338811 [Prunus mume]
Length=177

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 71/154 (46%), Gaps = 10/154 (6%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            V+   G +      +KAAE+MLE+P  F+  + SL  G R   L+AD++LE    Y   P
Sbjct  22   VLFLDGRLEVYTRAMKAAELMLENPGQFVCESSSLKVGNRVHGLTADEELERRQFYFLLP  81

Query  389  MKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEGGDETPGNDVGRLGVTSGFV  210
            M  L SV+T  +++ L   A K+   R S  + +K+ P  G      ++  R     G V
Sbjct  82   MDLLYSVLTHEELSSLTYKASKALKHR-SFNSFSKIFPVLGEFCMFPSEAKRSDKNIGDV  140

Query  209  GQEYRH---------RLSLCRSKKPLLETIIEEP  135
                 H         R S  RS KP LETI E P
Sbjct  141  ISPSSHSEPMLVLVERYSKQRSWKPALETIAETP  174



>ref|XP_004137354.1| PREDICTED: uncharacterized protein LOC101203132 [Cucumis sativus]
 ref|XP_004165401.1| PREDICTED: uncharacterized protein LOC101223341 [Cucumis sativus]
 gb|KGN63887.1| hypothetical protein Csa_1G025190 [Cucumis sativus]
Length=170

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 79/175 (45%), Gaps = 22/175 (13%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+       A   + L  G ++   +PV AAE+M+EH   FL ++  L  G R 
Sbjct  1    MGNSASCAPSMASNGAPKVLSL-DGRLQSFSKPVTAAELMIEHSGKFLCDSSDLKVGHRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKV-----  282
              L  D+DLE   +Y   PM  L SV+T  +++ L   A K+    L  GN++       
Sbjct  60   QGLLPDEDLEWRRLYFLLPMDLLYSVLTLEEMSSLTFIATKA----LKQGNSSGFGRIFP  115

Query  281  --------SPAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIE  141
                    SPA+       +D  R   +S  V    +  +S  RS KP LETI E
Sbjct  116  VLISEFCNSPADVKGLKLEDDDDRENQSSKAV----KRLMSKQRSWKPALETIAE  166



>ref|XP_009382505.1| PREDICTED: uncharacterized protein LOC103970450 [Musa acuminata 
subsp. malaccensis]
Length=163

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 47/83 (57%), Gaps = 7/83 (8%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR-R  450
            MGNL+S  A  G+      V+LP G +  L  P   AE+MLEHP  ++++  SL+AG   
Sbjct  1    MGNLLSGQAHDGK------VVLPDGTVLELDRPTSVAELMLEHPRQYVLDLRSLSAGNSN  54

Query  449  FSPLSADQDLESGNVYAAFPMKR  381
             +PL AD  LE+G  Y   PM R
Sbjct  55   AAPLPADHMLEAGKAYVMLPMAR  77



>ref|XP_006837232.1| hypothetical protein AMTR_s00105p00150760 [Amborella trichopoda]
 gb|ERN00086.1| hypothetical protein AMTR_s00105p00150760 [Amborella trichopoda]
Length=178

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  554  GEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFPMKRLS  375
            G +     P++ AE+MLE+P +F+  +G L +GRR   + AD+ LE   +Y  FPM++L 
Sbjct  27   GRVEEYTRPIRVAELMLENPQNFVCFSGDLQSGRRIPAIPADEQLEGCKLYFLFPMEKLY  86

Query  374  SVI  366
            SV+
Sbjct  87   SVL  89



>ref|XP_002441485.1| hypothetical protein SORBIDRAFT_09g027770 [Sorghum bicolor]
 gb|EES19915.1| hypothetical protein SORBIDRAFT_09g027770 [Sorghum bicolor]
Length=191

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 9/91 (10%)
 Frame = -2

Query  626  MGNLVSCSarkg------rkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTH--FLVNA-  474
            MGN +SC+  K            ARVILP G +R++  P  AAE+M++ P H  FLV+A 
Sbjct  1    MGNYMSCTLAKAPGSGGGGGGKCARVILPDGGVRQVPLPATAAELMMDAPGHFLFLVDAR  60

Query  473  GSLTAGRRFSPLSADQDLESGNVYAAFPMKR  381
            G  + G R + + AD++L+ G VYA F MKR
Sbjct  61   GKPSLGARLAAVPADEELQLGAVYATFQMKR  91



>ref|XP_009401639.1| PREDICTED: uncharacterized protein LOC103985613 [Musa acuminata 
subsp. malaccensis]
Length=195

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 45/83 (54%), Gaps = 4/83 (5%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR-R  450
            MGNL+SC A  G       V+L  G +     P   AE+MLEHP  F+V+  SL+AG  +
Sbjct  1    MGNLLSCQAADGFDGK---VVLSDGTVHEFDHPTLVAELMLEHPHQFVVDVRSLSAGNSK  57

Query  449  FSPLSADQDLESGNVYAAFPMKR  381
             +PL AD  LE   VY   P+ R
Sbjct  58   AAPLPADYMLEPDKVYVMLPVAR  80



>ref|XP_006855290.1| hypothetical protein AMTR_s00057p00042470 [Amborella trichopoda]
 gb|ERN16757.1| hypothetical protein AMTR_s00057p00042470 [Amborella trichopoda]
Length=191

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN +S  +  G       ++ P G ++RL  PV  AE+MLE+P HF++  G   +  R 
Sbjct  1    MGNYISLGSSSGLAGK---IVFPDGTLQRLETPVTIAELMLENPNHFVIELGPDVSQNRL  57

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVIT  363
             PL AD        Y   PM+R +  +T
Sbjct  58   VPLPADHKATPNKAYLVLPMRRGNKALT  85



>ref|XP_003558091.1| PREDICTED: uncharacterized protein LOC100836996 [Brachypodium 
distachyon]
Length=193

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 48/93 (52%), Gaps = 14/93 (15%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSL------  465
            MGNLVS +  K        V++  G +R L EPV  AE+M++HP HF+V+A +L      
Sbjct  1    MGNLVSAAGAKSGGGK---VVMADGSVRALSEPVSVAELMMDHPRHFVVDAHALRQQEKH  57

Query  464  -----TAGRRFSPLSADQDLESGNVYAAFPMKR  381
                  A  + +PL AD  L +G VY   P  R
Sbjct  58   HQQQRKAATKVAPLPADHVLGAGGVYVLLPAVR  90



>ref|XP_007199315.1| hypothetical protein PRUPE_ppa023376mg [Prunus persica]
 gb|EMJ00514.1| hypothetical protein PRUPE_ppa023376mg [Prunus persica]
Length=195

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  S S ++   +A  +VIL  G + +  +P+  AE+MLEHP   +V  G+  + +R 
Sbjct  1    MGN--SISHKQLHASATGKVILSNGSVHQFNKPLTVAELMLEHPQQVVVEFGAAVSEKRP  58

Query  446  SPLSADQDLESGNVYAAFPMKR  381
            +PL AD  L+   +Y   PMKR
Sbjct  59   TPLPADMKLDKKKIYLMLPMKR  80



>ref|XP_009380315.1| PREDICTED: uncharacterized protein LOC103968736 [Musa acuminata 
subsp. malaccensis]
Length=153

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 78/165 (47%), Gaps = 13/165 (8%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  +C+        + +VI   G+       V+A E+M+E+P  F+ +A  L+ G R 
Sbjct  1    MGN-TACAPYATGSGGSIKVISSDGKFEEYVHSVRAEELMVENPGEFVCDADHLSVGCRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGN-AAKVSPAE  270
              L AD++LE   +Y   PM  L SV+T  ++A L   A  +  KR  A N   ++ P  
Sbjct  60   PGLVADEELERRRLYFLLPMDLLFSVLTEEEMAALSRRASTATKKRGVAKNFGRRILPVL  119

Query  269  GGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEEP  135
            G       +  R   T+  V      R+S  RS KP L+TI E P
Sbjct  120  GA------EAKRASETTSSV-----KRMSTQRSWKPALDTIEEVP  153



>ref|XP_007051081.1| Multidrug resistance protein ABC transporter family protein, 
putative [Theobroma cacao]
 gb|EOX95238.1| Multidrug resistance protein ABC transporter family protein, 
putative [Theobroma cacao]
Length=199

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN +S    +     A +VIL  G +++   P+ AAE+MLEHP   +V   S    +R 
Sbjct  1    MGNYISTVTCRPTSDTAGKVILWDGSVQQFNWPLTAAELMLEHPQQVVVEFHSAVNEKRP  60

Query  446  SPLSADQDLESGNVYAAFPMKR  381
             PL AD  L+   VY   P+KR
Sbjct  61   IPLPADSKLDMNKVYVMLPVKR  82



>ref|XP_008453692.1| PREDICTED: uncharacterized protein LOC103494340 [Cucumis melo]
Length=169

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+       AA  + L  G ++   +PV AAE+M+EH   FL ++  L  G R 
Sbjct  1    MGNSASCAPSIASNGAAKVLSL-DGTLQSFTKPVTAAELMIEHSGKFLCDSSDLKVGHRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVIT  363
              L  D+DLE   +Y   PM  L SV+T
Sbjct  60   QGLLPDEDLEWRRLYFLLPMDLLYSVLT  87



>ref|XP_009384419.1| PREDICTED: uncharacterized protein LOC103971974 [Musa acuminata 
subsp. malaccensis]
Length=166

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 81/167 (49%), Gaps = 10/167 (6%)
 Frame = -2

Query  626  MGNLVSC-SarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  SC    +  +A  A+V+ P G +RR+  P  AAEIM+E+P H +  A  +   RR
Sbjct  1    MGNGASCVPRIRRAEAGTAKVVGPDGVLRRIEAPAGAAEIMMEYPGHVVARAEEVARTRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRL----SAGNAAKV  282
             + + AD++L +G  Y   PM R+   ++   + VLL   +    ++     S G   +V
Sbjct  61   VAGMRADEELLAGGAYLLLPMDRVGCRLSDGQIEVLLDVVRGRRQRKGRKEGSCGGGGRV  120

Query  281  SPAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIE  141
             P     E  G + G+  V  G V      R+  CR  +P L+TI E
Sbjct  121  FP-----EVAGGEEGKTAVLGGEVTGFSGKRVGGCRQWRPALDTIHE  162



>ref|XP_010095648.1| hypothetical protein L484_008805 [Morus notabilis]
 gb|EXB61737.1| hypothetical protein L484_008805 [Morus notabilis]
Length=178

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 76/180 (42%), Gaps = 14/180 (8%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+       A   V+   G +     PVKAAE+MLE+P  F+ ++ SL  G R 
Sbjct  1    MGNAASCAPSIISNGATK-VLSQDGAMEVYTRPVKAAELMLENPGKFVCDSSSLVVGHRI  59

Query  446  SPLSADQDLE---------SGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGN  294
              LSAD +LE            +Y+    + +SS  T             +     S  N
Sbjct  60   QGLSADGELEKRQLYLLLPMELLYSVLTHEEMSS-FTTFGGTNSKPPNSNNKNNGGSLAN  118

Query  293  AAKVSPAEGGDET--PGNDVGRLGVTSGFVGQEYRHRL-SLCRSKKPLLETIIEEPVRTR  123
              K+ P+ G   T  P ++   LG    +       RL S  RS +P LETI E P R+ 
Sbjct  119  FGKIFPSLGEFCTFLPNSESKTLGSPVNYHSDPVDQRLYSKQRSWRPALETIFETPRRSH  178



>ref|XP_003519749.1| PREDICTED: uncharacterized protein LOC100798099 [Glycine max]
 gb|KHN08644.1| hypothetical protein glysoja_024553 [Glycine soja]
Length=180

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            +++  G ++ + +P+  AE+MLEHP   +V   S    +R +PL AD  LE+  VY   P
Sbjct  12   IVMWDGSVQEIEQPLTVAELMLEHPEQVVVELHSAVKQKRATPLPADNKLETNKVYLMLP  71

Query  389  MKR  381
            +KR
Sbjct  72   IKR  74



>ref|XP_006492320.1| PREDICTED: uncharacterized protein LOC102625981 [Citrus sinensis]
 gb|KDO87026.1| hypothetical protein CISIN_1g045769mg [Citrus sinensis]
Length=198

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 3/82 (4%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN ++C   +    A  +VIL  G +    + +  AE+MLEHP   +V   S  + +R 
Sbjct  1    MGNYITC---RPSTDATGKVILSDGRVHEFDKALTVAELMLEHPQQVVVELRSAVSEKRP  57

Query  446  SPLSADQDLESGNVYAAFPMKR  381
             PL AD+ LE   VYA  PMKR
Sbjct  58   CPLPADKKLEIRKVYAMLPMKR  79



>ref|XP_007051082.1| Uncharacterized protein TCM_004789 [Theobroma cacao]
 gb|EOX95239.1| Uncharacterized protein TCM_004789 [Theobroma cacao]
Length=161

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 82/167 (49%), Gaps = 13/167 (8%)
 Frame = -2

Query  626  MGNLVS-CSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR  450
            MGN  S C  +       A+VI   G +R+++ P KAAE+MLE P H +     L   RR
Sbjct  1    MGNCTSGCFIQDSGHKKMAKVIDSQGNLRKVKLPAKAAELMLEEPGHIISPVEELKQTRR  60

Query  449  FSPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP--  276
             + + AD +L +G  Y   P+ R+   +T AD+A++      +  +R  +G  AKVSP  
Sbjct  61   VAAMRADDELLAGKFYVLVPIGRVHCKVTDADMAIIEAVC--NGKRRRKSG--AKVSPTV  116

Query  275  AEGGDETPGNDVGRLG--VTSGFVGQEYRHRLSLCRSKKPLLETIIE  141
             EG  E   ++V  LG     G  G    +RL   R   P+LE I E
Sbjct  117  TEGLREEDESEVKVLGAKCMKGIPG----YRLGNHRPWTPVLEPISE  159



>gb|KCW58369.1| hypothetical protein EUGRSUZ_H01054, partial [Eucalyptus grandis]
Length=194

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -2

Query  569  VILPGGEIRRLREP-VKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAF  393
            VIL  G + RL  P + AAE+MLEHP   +V   S  +G+R +PL ADQ+L+   +Y   
Sbjct  18   VILWDGTVHRLEGPGLTAAELMLEHPQQVVVEFDSKASGKRPTPLPADQELDPRKIYLML  77

Query  392  PMKR  381
            P+KR
Sbjct  78   PVKR  81



>ref|XP_009356023.1| PREDICTED: uncharacterized protein LOC103946923 [Pyrus x bretschneideri]
Length=183

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 67/157 (43%), Gaps = 12/157 (8%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            V+   G +      VKAAE+M+E+P  FL  + +L  G R   L+AD+ LE    Y   P
Sbjct  24   VLFLDGRMEIFARQVKAAELMVENPGQFLCESTTLKVGNRIHGLTADEPLERRRFYFLLP  83

Query  389  MKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEGG------DETPGNDVGRLG  228
            M  L SV+T  +++ L   A K+        N +K+ P  G        E+  +D     
Sbjct  84   MDLLYSVLTHEELSSLTYRASKALKNSRGFNNFSKIFPVFGDFRMFNLSESKRSDCDEDH  143

Query  227  VTSGFVGQEYRH------RLSLCRSKKPLLETIIEEP  135
            V                 R S  RS KP LETI E P
Sbjct  144  VIISVNSSHNSEPVVLLGRYSKQRSWKPALETIDETP  180



>ref|XP_010069866.1| PREDICTED: uncharacterized protein LOC104456709 [Eucalyptus grandis]
Length=200

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -2

Query  569  VILPGGEIRRLREP-VKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAF  393
            VIL  G + RL  P + AAE+MLEHP   +V   S  +G+R +PL ADQ+L+   +Y   
Sbjct  18   VILWDGTVHRLEGPGLTAAELMLEHPQQVVVEFDSKASGKRPTPLPADQELDPRKIYLML  77

Query  392  PMKR  381
            P+KR
Sbjct  78   PVKR  81



>gb|KCW58368.1| hypothetical protein EUGRSUZ_H01053 [Eucalyptus grandis]
Length=166

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGNL SC AR  RK AA  +  P G++ RL  PVKAAE+MLE P H +V    +   +R 
Sbjct  1    MGNLPSCCARPCRKEAA--LFDPDGKLWRLPTPVKAAEVMLEVPGHIVVPVEEIWRSQRI  58

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNA--AKVSPA  273
              + AD +L  G  Y A P ++++  +   ++A +    K+   KR+  G    AK + +
Sbjct  59   VAMHADDELALGKAYLAVPARQMNRKVDEVELAAIESTLKR---KRIGTGKQGEAKTTKS  115

Query  272  EGG  264
            +GG
Sbjct  116  KGG  118



>ref|NP_192118.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC78701.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAB57800.1| AGAA.5 [Arabidopsis thaliana]
 emb|CAB80702.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAC41964.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63287.1| At4g02090 [Arabidopsis thaliana]
 gb|AEE82123.1| uncharacterized protein AT4G02090 [Arabidopsis thaliana]
Length=202

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 45/91 (49%), Gaps = 9/91 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLV---------NA  474
            MGN+           AA +V+L  G ++ L E    AEIMLE+P H +V         N 
Sbjct  1    MGNVAGSRKLDAAGMAAGKVVLSDGRVQNLEEETTVAEIMLENPQHVVVEFDPSSISFNN  60

Query  473  GSLTAGRRFSPLSADQDLESGNVYAAFPMKR  381
             + T  R+ +PL AD+ LE G +Y   P KR
Sbjct  61   DAKTVKRKLAPLPADKTLEPGKIYLVLPAKR  91



>ref|XP_008367622.1| PREDICTED: uncharacterized protein LOC103431264 [Malus domestica]
Length=182

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 70/156 (45%), Gaps = 11/156 (7%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            V+   G +      VKAAE+M+E+P  FL  + +L  G R   L+AD+ LE   +Y   P
Sbjct  24   VLTLDGRMEVFTRQVKAAELMVENPGQFLCESTTLKVGNRIHGLTADKPLERRRLYFLLP  83

Query  389  MKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG---------GDETPGNDVG  237
            M  L SV+T  +++ L   A K+        N +++ P  G               +D  
Sbjct  84   MDLLYSVLTHEELSSLAYKASKALKNSRGFKNFSRIFPVFGDFRLFNVSESKRLDCDDYV  143

Query  236  RLGVTSGFVGQE--YRHRLSLCRSKKPLLETIIEEP  135
             + VTS    +      R S  RS KP LETI E P
Sbjct  144  IISVTSNNNPEPVILLERYSKQRSWKPALETIDETP  179



>ref|XP_006444471.1| hypothetical protein CICLE_v10021856mg [Citrus clementina]
 gb|ESR57711.1| hypothetical protein CICLE_v10021856mg [Citrus clementina]
Length=250

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 3/82 (4%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN ++C   +    A  +VIL  G +    + +  AE+MLEHP   +V   S  + +R 
Sbjct  1    MGNYITC---RPSTDATGKVILSDGRVHEFDKALTVAELMLEHPQQVVVELRSAVSEKRP  57

Query  446  SPLSADQDLESGNVYAAFPMKR  381
             PL AD+ LE   VYA  PMKR
Sbjct  58   CPLPADKKLEIRKVYAMLPMKR  79



>ref|XP_010938298.1| PREDICTED: uncharacterized protein LOC105057397 [Elaeis guineensis]
Length=160

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 82/163 (50%), Gaps = 6/163 (4%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC   +  +   A+++   G +R +  PV  AE+MLE P H +     + + RR 
Sbjct  1    MGNHASC-IPRSTRPRTAKLVDAEGNLRSVEIPVGVAELMLEAPGHVVARGEEMVSTRRV  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAK-RLSAGNAAKVSPAE  270
            S L AD++L  G VY   P++R+ S ++   +AV++ A +    K + S G+A +V P  
Sbjct  60   SGLRADEELRPGEVYLLLPVERVGSRLSDRQMAVVVEAVEGGRRKGKKSCGSANRVFPEA  119

Query  269  GGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIE  141
             G E            +GF GQ    R+   R  +P+L+TI E
Sbjct  120  AGREEEEEKGFLEREVTGFPGQ----RVGGYRPWRPVLDTIHE  158



>ref|XP_008786238.1| PREDICTED: uncharacterized protein LOC103704646 [Phoenix dactylifera]
Length=161

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 81/167 (49%), Gaps = 13/167 (8%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC   +  +   A+++   G +RR+  P   AE+MLE P H +  A  +   RR 
Sbjct  1    MGNHASC-IPRSTRPRTAKLVDAEGNLRRVDIPAVTAELMLEAPGHVVARAEEVVRTRRV  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGN-----AAKV  282
            S L A ++L  G VY   P +R+ S ++   +AV++ A +    +R   GN      ++V
Sbjct  60   SGLRAHEELRPGEVYLLLPAERVGSRLSDLQMAVVVGAVEGGRRRRRRKGNKSLGFGSRV  119

Query  281  SPAEGGDETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIE  141
             P   G E  G      G  +GF GQ    R+   R  +P+L+TI E
Sbjct  120  LPEAAGREEEGF---LEGTVTGFSGQ----RIGGYRQWRPVLDTIHE  159



>gb|AFG53536.1| hypothetical protein UMN_2119_01, partial [Pinus taeda]
Length=92

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN + C       AAA  + L  G      E V   ++M+++P  F+ + G+L AGRR 
Sbjct  1    MGNQMCCVQPSRTTAAAKVIRLEDGSFEEFWETVNVGKVMMDNPQQFVCDYGNLQAGRRI  60

Query  446  SPLSADQDLESGNVYAAFPMKR  381
            + L+A++ L  G+VY   PM++
Sbjct  61   AALNAEEHLALGSVYFLLPMQK  82



>ref|XP_004968104.1| PREDICTED: uncharacterized protein LOC101774883 [Setaria italica]
Length=208

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI   G + RL  PV+A+E+ML+HP  F+ ++G L  G R   ++AD+ L   + Y   P
Sbjct  28   VIHADGTVTRLARPVRASELMLDHPGQFVCDSGRLAVGCRVPGVAADELLRPRHAYFLLP  87

Query  389  MKRLSSVIT  363
            M  L SV+T
Sbjct  88   MDMLYSVLT  96



>ref|XP_009378703.1| PREDICTED: uncharacterized protein LOC103967164 [Pyrus x bretschneideri]
Length=197

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VIL  G +    +P+  AE+MLE+P   +V  GS  + +R +PL AD  L+   VY   P
Sbjct  16   VILSDGSVHEFNKPLTVAELMLENPQQVVVEFGSAVSQKRATPLPADMKLDMKKVYLMLP  75

Query  389  MKR  381
            MKR
Sbjct  76   MKR  78



>tpg|DAA53777.1| TPA: hypothetical protein ZEAMMB73_618286 [Zea mays]
Length=197

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI   G + RL  PV+A+E+ML+HP  F+ ++G L  G R   ++AD+ L   + Y   P
Sbjct  29   VIHADGTVTRLARPVRASELMLDHPGRFVCDSGRLAVGCRVPGVAADELLRPRHAYFLLP  88

Query  389  MKRLSSVIT  363
            M  L SV+T
Sbjct  89   MDMLYSVLT  97



>ref|XP_010938299.1| PREDICTED: uncharacterized protein LOC105057398 [Elaeis guineensis]
Length=191

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (51%), Gaps = 4/81 (5%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR-R  450
            MGN VSC            V+L  G I     P+  AE+MLEHP  F+V+  S++AG  +
Sbjct  1    MGNFVSCRTVDAGGGK---VVLFDGTIHEFDRPISVAELMLEHPRLFVVDMQSISAGETK  57

Query  449  FSPLSADQDLESGNVYAAFPM  387
             +PL AD  ++    Y   PM
Sbjct  58   VTPLPADHTMDPDKCYLMLPM  78



>gb|AEW09278.1| hypothetical protein UMN_2119_01, partial [Pinus radiata]
Length=92

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN + C       AAA  +    G      E V   E+M+++P  F+ + G+L AGRR 
Sbjct  1    MGNQMCCVQPSRTTAAAKVIRWEDGSFEEFWETVNVGEMMMDNPQQFVCDYGNLQAGRRI  60

Query  446  SPLSADQDLESGNVYAAFPMKR  381
            + L+A++ L  G+VY   PM++
Sbjct  61   AALNAEEHLALGSVYFLLPMQK  82



>ref|XP_009339786.1| PREDICTED: uncharacterized protein LOC103931978 [Pyrus x bretschneideri]
Length=196

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VIL  G +     P+  AE+MLE+P   +V  GS    +R +PL AD  L+   VY   P
Sbjct  16   VILSNGSVHEFNHPITVAELMLENPQQVVVEFGSAVPEKRATPLPADMQLDMKKVYLMLP  75

Query  389  MKR  381
            MKR
Sbjct  76   MKR  78



>ref|XP_007163168.1| hypothetical protein PHAVU_001G212200g [Phaseolus vulgaris]
 gb|ESW35162.1| hypothetical protein PHAVU_001G212200g [Phaseolus vulgaris]
Length=196

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            ++   G +R  REP+ AAE+M+EHP   +++  S    +R +PL ADQ LE    Y   P
Sbjct  14   IVYWDGSVREFREPLTAAELMMEHPQQVVLDFHSAVKQKRPAPLPADQKLEMKKTYVMVP  73

Query  389  MK  384
            +K
Sbjct  74   VK  75



>ref|XP_008386728.1| PREDICTED: uncharacterized protein LOC103449220 [Malus domestica]
Length=205

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VIL  G +     P+  AE+MLE+P   +V  GS    +R +PL AD  L+   VY   P
Sbjct  16   VILSNGSVHEFNHPITVAELMLENPQQVVVEFGSAVPEKRATPLPADMQLDLKKVYLMLP  75

Query  389  MKR  381
            MKR
Sbjct  76   MKR  78



>ref|XP_002874940.1| hypothetical protein ARALYDRAFT_490371 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51199.1| hypothetical protein ARALYDRAFT_490371 [Arabidopsis lyrata subsp. 
lyrata]
Length=204

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 9/91 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLV---------NA  474
            MGN+           AA +V+L  G ++ L E    AEIMLE+P H +V         N 
Sbjct  1    MGNVAGSRKLNAASMAARKVVLSDGRVQNLEEETTVAEIMLENPQHVVVEFDPSSISFNN  60

Query  473  GSLTAGRRFSPLSADQDLESGNVYAAFPMKR  381
             + T  ++ +PL AD+ LE G +Y   P KR
Sbjct  61   DAKTVKKKLAPLPADKTLEPGKIYLVLPAKR  91



>gb|KCW86192.1| hypothetical protein EUGRSUZ_B02882 [Eucalyptus grandis]
Length=192

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = +3

Query  336  HEEDRHIGGGDNGAQPLHRERGVDVPGLQVLVRRQRRESPAGGQRSGVDQEVGWVFQHDL  515
            HE   H+  GD+G  P H E  VDV  LQ+L+R +  + P   +  G  +EV    QH+L
Sbjct  89   HEHRGHVASGDHGVHPPHGEHEVDVAELQLLIRAEGGKPPPDVEGPGAGEEVAGALQHEL  148

Query  516  RRLDRLSKPPDFPAGED  566
             R+DRL +    PAGED
Sbjct  149  GRVDRLPELLHLPAGED  165



>emb|CDY22028.1| BnaA09g00570D [Brassica napus]
Length=205

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 43/91 (47%), Gaps = 9/91 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLV---------NA  474
            MGN +     +    +  +V+L  G ++ L E    AEIMLE+P H +V         N 
Sbjct  1    MGNTIGSRKLETAAMSGGKVVLSDGRVQNLEEETTVAEIMLENPQHVVVEFDPSSITFNK  60

Query  473  GSLTAGRRFSPLSADQDLESGNVYAAFPMKR  381
               T  ++ +PL AD  LE G +Y   P KR
Sbjct  61   DGKTVKKKLTPLPADNTLEPGKIYLVLPAKR  91



>ref|XP_004967549.1| PREDICTED: uncharacterized protein LOC101757450 isoform X1 [Setaria 
italica]
Length=161

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGNLVS         A   V+ P G   R+ E    AE+M++ P H +  A  +T  RR 
Sbjct  1    MGNLVSQCVVASGAGARPVVVAPDGSRTRVEEHTGVAELMIDAPGHVVARASDVTRERRV  60

Query  446  SPLSADQDLESGNVYAAFPMKR  381
             P++AD+ L +G VY   P  R
Sbjct  61   RPMAADELLHAGEVYLLVPAGR  82



>ref|XP_009404718.1| PREDICTED: uncharacterized protein LOC103987965 [Musa acuminata 
subsp. malaccensis]
Length=218

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 72/154 (47%), Gaps = 11/154 (7%)
 Frame = -2

Query  554  GEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFPMKRLS  375
            G +R    PV AAE+M EHP H +  + +   G++  PL+A   L+ G+ Y   P     
Sbjct  48   GRVRVYHRPVAAAELMKEHPCHLVCRSDAFFIGQKVPPLAAGDQLQPGHSYFLLPSHFFH  107

Query  374  SVITaadvavllvaAKKSPAKRL--------SAGNAAKVSPAEGGDETPGNDVGRLGVTS  219
            SV++   +A  L+A   +  + L        +A    ++  A+   E    D     VT+
Sbjct  108  SVLSFVTLATSLLAPSGAGKRALLRPFDIQKTASGTLQIRVADEFLEEESRDGTSRLVTT  167

Query  218  GFVGQEYRHRLSLCRSK--KPLLETIIEEPVRTR  123
              + +EYR  L  CRS   KP LETI E   R+R
Sbjct  168  DALEKEYR-TLVRCRSSQWKPKLETIRESERRSR  200



>ref|XP_004967550.1| PREDICTED: uncharacterized protein LOC101757450 isoform X2 [Setaria 
italica]
Length=147

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGNLVS         A   V+ P G   R+ E    AE+M++ P H +  A  +T  RR 
Sbjct  1    MGNLVSQCVVASGAGARPVVVAPDGSRTRVEEHTGVAELMIDAPGHVVARASDVTRERRV  60

Query  446  SPLSADQDLESGNVYAAFPMKR  381
             P++AD+ L +G VY   P  R
Sbjct  61   RPMAADELLHAGEVYLLVPAGR  82



>emb|CCG48018.1| conserved hypothetical protein [Triticum aestivum]
Length=201

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI   G + RL  PV+A+E+ML+HP  F+ +A  L  G R   ++AD+ L+    Y   P
Sbjct  27   VIHADGRVTRLARPVRASELMLDHPGKFVCDACRLAVGCRVPGVAADELLQPRRAYFLLP  86

Query  389  MKRLSSVIT  363
            M  L SV+T
Sbjct  87   MDMLYSVLT  95



>ref|XP_008673802.1| PREDICTED: uncharacterized protein LOC103649897 [Zea mays]
Length=280

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI   G + RL  PV+A+E+ML+HP  F+ ++G L  G R   ++AD+ L   + Y   P
Sbjct  112  VIHADGTVTRLARPVRASELMLDHPGRFVCDSGRLAVGCRVPGVAADELLRPRHAYFLLP  171

Query  389  MKRLSSVIT  363
            M  L SV+T
Sbjct  172  MDMLYSVLT  180



>ref|XP_010916301.1| PREDICTED: uncharacterized protein LOC105041154 [Elaeis guineensis]
Length=163

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC+       +   VI   G ++     V+AAE+M+E+P  F+ ++  L  G R 
Sbjct  1    MGNTTSCTPFAVPTGSIK-VIDDNGGVQEYMHTVRAAELMVENPGQFVCDSNYLNVGCRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVIT  363
              L AD++LE   +Y   PM  L SV+T
Sbjct  60   PGLVADEELEPHRLYFLLPMDMLYSVLT  87



>emb|CBH32659.1| conserved hypothetical protein [Triticum aestivum]
 emb|CDM83263.1| unnamed protein product [Triticum aestivum]
Length=197

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            VI   G + RL  PV+A+E+ML+HP  F+ +A  L  G R   ++AD+ L+    Y   P
Sbjct  30   VIHADGRVTRLARPVRASELMLDHPGKFVCDACRLAVGCRVPGVAADELLQPRRAYFLLP  89

Query  389  MKRLSSVIT  363
            M  L SV+T
Sbjct  90   MDMLYSVLT  98



>ref|XP_008374862.1| PREDICTED: uncharacterized protein LOC103438096 [Malus domestica]
 ref|XP_008346870.1| PREDICTED: uncharacterized protein LOC103409862 [Malus domestica]
Length=183

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 67/157 (43%), Gaps = 12/157 (8%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            V+   G +      VKA+E+M+EHP  FL ++  L  G R   L+AD+ LE    Y   P
Sbjct  24   VLCLDGRLEVFGRQVKASELMVEHPGQFLCDSTILKVGNRIHGLTADEPLERRRFYFLLP  83

Query  389  MKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP----------AEGGDETPGNDV  240
            M  L SV+T  +++ L   A  +        N +++ P          +E        D 
Sbjct  84   MDLLYSVLTHEELSSLTYRASXALKNSRGFNNFSRIFPVFGDFRMFNLSESKRLDCNEDH  143

Query  239  GRLGVTSGFVGQE--YRHRLSLCRSKKPLLETIIEEP  135
              + V S    +      R S  RS KP LETI E P
Sbjct  144  AIISVNSSHNSEPVVLLERYSKQRSWKPALETIDETP  180



>ref|XP_003525184.1| PREDICTED: uncharacterized protein LOC100820022 [Glycine max]
 gb|KHN10534.1| hypothetical protein glysoja_040689 [Glycine soja]
Length=167

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 76/168 (45%), Gaps = 9/168 (5%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN+ SC+           + L  G +    +P++AAE+MLE+   F+ ++  L  G R 
Sbjct  1    MGNVASCTPSLTPNGVFKVLFL-DGRLEAYTKPMRAAELMLEYSGQFVCDSSYLKVGHRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPAEG  267
              L AD  LE    Y   P++ L SV+T  +++ L   A ++  K  S  N  K+ P   
Sbjct  60   HGLLADDQLEKRKFYFLLPIELLFSVLTHEEMSSLNYKASRA-TKHASFNNLGKIFPVFS  118

Query  266  GDETPGNDVGRLGVTSGFVGQEYRH------RLSLCRSKKPLLETIIE  141
                  +++ RL      + Q  R       R S  RS +P LETI E
Sbjct  119  EFCMFPSELKRLEEADNQL-QVVRDPEPAVKRYSKQRSWRPALETIDE  165



>gb|KGN45009.1| hypothetical protein Csa_7G407620 [Cucumis sativus]
Length=165

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 49/97 (51%), Gaps = 5/97 (5%)
 Frame = -2

Query  563  LPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFPMK  384
            + GG I + + PVKAAE+MLE P H +     L   RR S L AD +L  G +Y    + 
Sbjct  21   IDGGLIGKFKLPVKAAELMLESPGHVISPVDVLRRTRRISALKADDELLGGKIYVVVAVG  80

Query  383  RLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
            R+ S ++ A++    +  K    K     N +KV PA
Sbjct  81   RIGSKVSMAELENFDLTCKNRVKK-----NGSKVQPA  112



>gb|AFK42156.1| unknown [Medicago truncatula]
 gb|KEH30373.1| DUF4228 domain protein [Medicago truncatula]
Length=140

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/63 (27%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            ++L  G++++ +EP+KA  ++ ++P HF+ ++ S+  G  F P+  +Q+L+  ++Y   P
Sbjct  23   IVLSNGKLQQFKEPIKAWHVLSQNPNHFICSSESMYVGSPFHPVLPNQELQLDHIYFLLP  82

Query  389  MKR  381
            + +
Sbjct  83   LSK  85



>ref|XP_006381252.1| hypothetical protein POPTR_0006s10620g [Populus trichocarpa]
 gb|ABK95458.1| unknown [Populus trichocarpa]
 gb|ERP59049.1| hypothetical protein POPTR_0006s10620g [Populus trichocarpa]
Length=167

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 81/171 (47%), Gaps = 13/171 (8%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaa--aaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN  SC A     +    A++I   G +R++  PVKAAE+MLE P H +     L    
Sbjct  1    MGNYTSCCAVVTLSSKPKTAKLINSQGNLRQVSLPVKAAELMLEEPGHVIAPVDELKQRS  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaad----vavllvaAKKSPAKRLSAGNAAK  285
            R   + AD +L  G VY + P+ + +  I+A++     + +   AK+S  KR    + AK
Sbjct  61   RTIAMRADDELLPGKVYLSVPLSKANCKISASELAIIESTIAACAKRSSKKR----SGAK  116

Query  284  VSPAEGGD--ETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
            V PA   D  E  G++ G + V  G       +RL   R     LE I EE
Sbjct  117  VLPAMAVDLWEEKGSESG-VKVLEGNDTSSTSYRLVNYRQWTLALEPIPEE  166



>ref|XP_009111318.1| PREDICTED: uncharacterized protein LOC103836776 [Brassica rapa]
Length=238

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 43/91 (47%), Gaps = 9/91 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLV---------NA  474
            MGN +     +    +  +V+L  G ++ L E    AEIMLE+P H +V         N 
Sbjct  34   MGNTIGSRKLETAAMSGGKVVLSDGRVQNLEEETTVAEIMLENPKHVVVEFDPSSITFNK  93

Query  473  GSLTAGRRFSPLSADQDLESGNVYAAFPMKR  381
               T  ++ +PL AD  LE G +Y   P KR
Sbjct  94   DGKTVKKKLTPLPADNTLEPGKIYLVLPAKR  124



>ref|XP_010921514.1| PREDICTED: uncharacterized protein LOC105045053 [Elaeis guineensis]
Length=167

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN  SC  R+  ++  A+V+   G +RR+  P   A++MLE P H +  A  +   RR 
Sbjct  1    MGNHASC-IRRSTRSCTAKVVDSEGNLRRVEIPAGVADLMLEAPGHVVARAEEVVRTRRV  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVIT  363
            S L AD++L  G VY   P+ R+ S I+
Sbjct  60   SGLRADEELRPGEVYLLLPVDRVGSKIS  87



>ref|XP_010456083.1| PREDICTED: uncharacterized protein LOC104737574 isoform X2 [Camelina 
sativa]
Length=195

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 16/98 (16%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLV-----------  480
            MGN+           AA +V+L  G ++ L E    AEIMLE+P H +V           
Sbjct  1    MGNVAGSRKLDAAAMAAGKVVLSDGRVQNLEEETTVAEIMLENPQHVVVEFDPSSISFNN  60

Query  479  -----NAGSLTAGRRFSPLSADQDLESGNVYAAFPMKR  381
                 N  + T  ++ +PL AD+ LE G +Y   P KR
Sbjct  61   HHRKNNDAAKTVKKKLAPLPADKTLEPGKIYLVLPAKR  98



>ref|XP_002308239.1| hypothetical protein POPTR_0006s10630g [Populus trichocarpa]
 gb|EEE91762.1| hypothetical protein POPTR_0006s10630g [Populus trichocarpa]
Length=167

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 80/171 (47%), Gaps = 13/171 (8%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaa--aaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGR  453
            MGN  SC A          A++I   G +R++  PVKAAE+MLE P H +     L    
Sbjct  1    MGNYTSCCAVVTLSRKPKTAKLINSQGNLRQVSLPVKAAELMLEEPGHVIAPVDELKQRS  60

Query  452  RFSPLSADQDLESGNVYAAFPMKRLSSVITaad----vavllvaAKKSPAKRLSAGNAAK  285
            R   + AD +L  G VY + P+ + +  I+A++     + +   AK+S  KR    + AK
Sbjct  61   RTIAMRADDELLPGKVYLSVPLSKANCKISASELAIIESTIAACAKRSSKKR----SGAK  116

Query  284  VSPAEGGD--ETPGNDVGRLGVTSGFVGQEYRHRLSLCRSKKPLLETIIEE  138
            V PA   D  E  G++ G + V  G       +RL   R     LE I EE
Sbjct  117  VLPAMAVDLWEEKGSESG-VKVLEGNDTSSTSYRLVNYRQWTLALEPIPEE  166



>emb|CDY07095.1| BnaCnng01100D [Brassica napus]
Length=409

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 44/91 (48%), Gaps = 9/91 (10%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLV---------NA  474
            MGN +     +    AA +V+L  G ++ L E    AEIMLE+P H +V         N 
Sbjct  204  MGNAIGSRKLETAAMAAGKVVLSDGRVQNLEEETTVAEIMLENPQHVVVEFDPSSITFNK  263

Query  473  GSLTAGRRFSPLSADQDLESGNVYAAFPMKR  381
               T  ++ +PL AD  LE G +Y   P KR
Sbjct  264  DGKTVKKKLTPLPADNTLEPGKIYLVLPAKR  294



>gb|ACU24427.1| unknown [Glycine max]
Length=167

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 57/118 (48%), Gaps = 2/118 (2%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN+ SC+           + L  G +    +P++AAE+MLE+   F+ ++  L  G R 
Sbjct  1    MGNVASCTPSLTPNGVFKVLFL-DGRLEAYTKPMRAAELMLEYSGQFVCDSSYLKVGHRI  59

Query  446  SPLSADQDLESGNVYAAFPMKRLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSPA  273
              L AD  LE    Y   P++ L SV+T  +++ L   A ++  K  S  N  K+ P 
Sbjct  60   HGLLADDQLEKRKFYFLLPIELLFSVLTHEEMSSLNYKASRA-TKHASFNNLGKIFPV  116



>gb|ABR17317.1| unknown [Picea sitchensis]
Length=197

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 83/194 (43%), Gaps = 32/194 (16%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRF  447
            MGN +  +       A   +    G I   +E +K  E+M+++P  F+ +   L AGRR 
Sbjct  1    MGNHLGRAKSSISTTATKVIRWDDGGIEEFKEAIKVGELMVDNPQKFVCDFRDLQAGRRI  60

Query  446  SPLSADQDLESGNVYAAFPMKR-LSSVITaadvavllvaA-------KKSPAKR-----L  306
            + L A++DL  G VY   PM++ L  V++ +D+A + + +       +K P        +
Sbjct  61   TALRAEEDLALGGVYLLLPMQKYLRCVLSPSDMASINLLSLQCNSGCRKLPCNSRIFPAV  120

Query  305  SAGNAAKVS----PAEGGDETPGNDVGRLGVTS-------------GFVGQEYRHRLSLC  177
              GN +  S     AE  D+       R  V               GFV     H+L   
Sbjct  121  CTGNLSDFSSMNDSAERSDQLQVKSTDRFMVPKLELDEDEDWPTRFGFVLSH--HKLRGF  178

Query  176  RSKKPLLETIIEEP  135
            RS KP LETI E P
Sbjct  179  RSWKPALETISESP  192



>ref|XP_004494418.1| PREDICTED: uncharacterized protein LOC101499148 [Cicer arietinum]
Length=163

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -2

Query  557  GGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFPMKRL  378
             G IR +  PVK+AE+M+E   H +  A  +   RR +PL AD++L +G VY   P+ R+
Sbjct  38   NGNIREINLPVKSAELMIELIGHVITPADEIRRTRRITPLGADKELLAGKVYLLAPVSRV  97

Query  377  SS  372
            +S
Sbjct  98   NS  99



>gb|EAZ10340.1| hypothetical protein OsJ_00176 [Oryza sativa Japonica Group]
Length=182

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  569  VILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFP  390
            +I   G + RL  PV+A+E+M+++P  F+ ++G L  G R   ++AD+ LE    Y   P
Sbjct  24   IIHVDGTVTRLARPVRASELMVDYPGQFVCDSGRLAVGCRVPGVAADELLEPRRAYFLLP  83

Query  389  MKRLSSVIT  363
            M  L SV+T
Sbjct  84   MDMLYSVLT  92



>ref|NP_001049881.1| Os03g0305200 [Oryza sativa Japonica Group]
 gb|ABF95519.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11795.1| Os03g0305200 [Oryza sativa Japonica Group]
 gb|EAZ26646.1| hypothetical protein OsJ_10549 [Oryza sativa Japonica Group]
 dbj|BAG98408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=209

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 46/93 (49%), Gaps = 15/93 (16%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR-  450
            MGNL+S  A  G       V++  G +R L EPV  AE+M++HP HF+++A  L   RR 
Sbjct  1    MGNLISSGAVVGASGGGK-VVMADGSVRALSEPVSVAELMMDHPRHFVIDARDLQQQRRH  59

Query  449  -------------FSPLSADQDLESGNVYAAFP  390
                          +PL AD  L +G VY   P
Sbjct  60   KGKAGAPPPPGGKVAPLPADHVLGAGGVYVLLP  92



>ref|XP_008451488.1| PREDICTED: uncharacterized protein LOC103492762 [Cucumis melo]
Length=165

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 5/96 (5%)
 Frame = -2

Query  563  LPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRRFSPLSADQDLESGNVYAAFPMK  384
            + GG I +++ PVKAAE+MLE P H +     L   RR S L AD +L  G +Y    + 
Sbjct  21   IDGGLIGKVKLPVKAAELMLESPGHVISPVDVLRRTRRISALKADDELVGGKIYVVVAVG  80

Query  383  RLSSVITaadvavllvaAKKSPAKRLSAGNAAKVSP  276
            R+ S ++ A++    +  K    K     N +KV P
Sbjct  81   RIGSKVSMAELENFDLTCKNRVKK-----NGSKVQP  111



>gb|EAY89690.1| hypothetical protein OsI_11225 [Oryza sativa Indica Group]
Length=211

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 46/94 (49%), Gaps = 16/94 (17%)
 Frame = -2

Query  626  MGNLVSCSarkgrkaaaaRVILPGGEIRRLREPVKAAEIMLEHPTHFLVNAGSLTAGRR-  450
            MGNL+S  A  G       V++  G +R L EPV  AE+M++HP HF+V+A  L   RR 
Sbjct  1    MGNLISSGAAVGASGGGK-VVMADGSVRALSEPVSVAELMMDHPRHFVVDARDLQQQRRR  59

Query  449  --------------FSPLSADQDLESGNVYAAFP  390
                           +PL AD  L +G VY   P
Sbjct  60   HKGKAGAPPPPGGKVAPLPADHVLGAGGVYVLLP  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1664082826224