BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79501_g1_i1 len=1780 path=[2:0-1779]

Length=1780
                                                                      Score     E

ref|XP_009621181.1|  PREDICTED: non-specific phospholipase C4-like      834   0.0      
ref|XP_009757037.1|  PREDICTED: non-specific phospholipase C4-like      831   0.0      
ref|XP_011086411.1|  PREDICTED: non-specific phospholipase C4-like      810   0.0      
emb|CDP19759.1|  unnamed protein product                                799   0.0      
gb|EYU40281.1|  hypothetical protein MIMGU_mgv1a004655mg                787   0.0      
ref|XP_010041093.1|  PREDICTED: non-specific phospholipase C3-like      778   0.0      
ref|XP_009361403.1|  PREDICTED: non-specific phospholipase C3-like      775   0.0      
ref|XP_006484721.1|  PREDICTED: non-specific phospholipase C4-like      775   0.0      
ref|XP_008375638.1|  PREDICTED: non-specific phospholipase C3-like      771   0.0      
ref|XP_006437377.1|  hypothetical protein CICLE_v10031213mg             770   0.0      
ref|XP_003633883.1|  PREDICTED: non-specific phospholipase C4-lik...    767   0.0      
gb|KDP39583.1|  hypothetical protein JCGZ_02603                         767   0.0      
ref|XP_010052602.1|  PREDICTED: non-specific phospholipase C3-like      765   0.0      
ref|XP_004307156.1|  PREDICTED: phospholipase C 3-like                  760   0.0      
ref|XP_007219020.1|  hypothetical protein PRUPE_ppa004364mg             760   0.0      
ref|XP_002265749.2|  PREDICTED: non-specific phospholipase C3-lik...    756   0.0      Vitis vinifera
ref|XP_011009223.1|  PREDICTED: non-specific phospholipase C4-like      753   0.0      
ref|XP_007029811.1|  Non-specific phospholipase C4                      751   0.0      
ref|XP_008232123.1|  PREDICTED: non-specific phospholipase C3-like      749   0.0      
ref|XP_010097705.1|  Phospholipase C 3                                  750   0.0      
ref|XP_008232121.1|  PREDICTED: non-specific phospholipase C3-lik...    746   0.0      
ref|XP_002319230.1|  phosphoesterase family protein                     746   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008232122.1|  PREDICTED: non-specific phospholipase C3-lik...    744   0.0      
ref|XP_010691936.1|  PREDICTED: non-specific phospholipase C4-like      744   0.0      
ref|XP_007219017.1|  hypothetical protein PRUPE_ppa004326mg             744   0.0      
ref|XP_010273152.1|  PREDICTED: non-specific phospholipase C4-lik...    744   0.0      
gb|KEH18078.1|  non-specific phospholipase C4                           743   0.0      
emb|CDP19760.1|  unnamed protein product                                741   0.0      
ref|XP_010919939.1|  PREDICTED: non-specific phospholipase C4-like      740   0.0      
ref|XP_011086397.1|  PREDICTED: non-specific phospholipase C3-like      739   0.0      
ref|XP_002524007.1|  Phospholipase C 3 precursor, putative              739   0.0      Ricinus communis
ref|XP_010273151.1|  PREDICTED: non-specific phospholipase C4-lik...    739   0.0      
ref|XP_003521010.1|  PREDICTED: non-specific phospholipase C4-lik...    738   0.0      
ref|XP_009361404.1|  PREDICTED: non-specific phospholipase C3-like      738   0.0      
gb|ACU18878.1|  unknown                                                 735   0.0      Glycine max [soybeans]
ref|XP_008796283.1|  PREDICTED: non-specific phospholipase C4-like      734   0.0      
gb|EYU40282.1|  hypothetical protein MIMGU_mgv1a004614mg                729   0.0      
ref|XP_010240874.1|  PREDICTED: non-specific phospholipase C4-like      727   0.0      
ref|XP_009388407.1|  PREDICTED: non-specific phospholipase C4-like      719   0.0      
gb|KFK38052.1|  hypothetical protein AALP_AA3G064000                    718   0.0      
ref|XP_010240876.1|  PREDICTED: non-specific phospholipase C3-like      717   0.0      
gb|KHN00001.1|  Phospholipase C 3                                       715   0.0      
ref|XP_003547754.1|  PREDICTED: non-specific phospholipase C4-like      714   0.0      
emb|CBI38061.3|  unnamed protein product                                711   0.0      
ref|XP_010691938.1|  PREDICTED: non-specific phospholipase C4-like      712   0.0      
ref|XP_010511520.1|  PREDICTED: non-specific phospholipase C4-like      712   0.0      
ref|XP_006838555.1|  hypothetical protein AMTR_s00002p00204300          711   0.0      
ref|XP_010463802.1|  PREDICTED: non-specific phospholipase C4 iso...    709   0.0      
ref|XP_004138997.1|  PREDICTED: phospholipase C 3-like                  709   0.0      
emb|CDY49947.1|  BnaCnng18570D                                          705   0.0      
ref|XP_010056549.1|  PREDICTED: non-specific phospholipase C3-like      704   0.0      
ref|XP_007029810.1|  Non-specific phospholipase C3                      704   0.0      
emb|CDY21204.1|  BnaA01g34350D                                          704   0.0      
ref|XP_006297391.1|  hypothetical protein CARUB_v10013415mg             703   0.0      
ref|XP_006650915.1|  PREDICTED: non-specific phospholipase C4-like      702   0.0      
ref|XP_010273149.1|  PREDICTED: non-specific phospholipase C3-lik...    701   0.0      
ref|XP_008457171.1|  PREDICTED: non-specific phospholipase C3-like      701   0.0      
ref|XP_010485693.1|  PREDICTED: non-specific phospholipase C4-like      701   0.0      
ref|XP_004981016.1|  PREDICTED: uncharacterized protein LOC101774034    700   0.0      
ref|XP_006408293.1|  hypothetical protein EUTSA_v10020472mg             700   0.0      
ref|XP_007134274.1|  hypothetical protein PHAVU_010G033400g             699   0.0      
ref|XP_009413233.1|  PREDICTED: non-specific phospholipase C4-like      698   0.0      
ref|XP_002884391.1|  hypothetical protein ARALYDRAFT_317234             698   0.0      
ref|XP_010525016.1|  PREDICTED: non-specific phospholipase C4-like      696   0.0      
ref|NP_566206.1|  non-specific phospholipase C4                         696   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119295.1|  PREDICTED: non-specific phospholipase C4           695   0.0      
ref|XP_010240877.1|  PREDICTED: non-specific phospholipase C3-like      693   0.0      
ref|NP_001051927.1|  Os03g0852800                                       691   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY92622.1|  hypothetical protein OsI_14367                          691   0.0      Oryza sativa Indica Group [Indian rice]
emb|CDM83453.1|  unnamed protein product                                689   0.0      
ref|XP_002466082.1|  hypothetical protein SORBIDRAFT_01g000860          687   0.0      Sorghum bicolor [broomcorn]
ref|XP_004979602.1|  PREDICTED: uncharacterized protein LOC101777961    676   0.0      
ref|XP_002884392.1|  phosphoesterase family protein                     676   0.0      
ref|XP_006484720.1|  PREDICTED: non-specific phospholipase C3-like      671   0.0      
ref|XP_006437378.1|  hypothetical protein CICLE_v10031241mg             668   0.0      
ref|XP_010258490.1|  PREDICTED: non-specific phospholipase C4-like      665   0.0      
ref|XP_008665763.1|  PREDICTED: non-specific phospholipase C2-like      666   0.0      
ref|XP_010485694.1|  PREDICTED: non-specific phospholipase C5           664   0.0      
ref|XP_010558682.1|  PREDICTED: non-specific phospholipase C3           664   0.0      
ref|NP_566207.1|  non-specific phospholipase C5                         663   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299135.1|  hypothetical protein CARUB_v10015277mg             662   0.0      
ref|XP_002884386.1|  phosphoesterase family protein                     658   0.0      
ref|XP_009130371.1|  PREDICTED: non-specific phospholipase C3           658   0.0      
ref|XP_003559120.1|  PREDICTED: non-specific phospholipase C4           658   0.0      
gb|KFK38053.1|  hypothetical protein AALP_AA3G064100                    658   0.0      
emb|CDY50647.1|  BnaC05g48190D                                          657   0.0      
ref|XP_002451037.1|  hypothetical protein SORBIDRAFT_05g023030          657   0.0      Sorghum bicolor [broomcorn]
ref|XP_006408294.1|  hypothetical protein EUTSA_v10020514mg             656   0.0      
ref|NP_187002.1|  non-specific phospholipase C3                         654   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297431.1|  hypothetical protein CARUB_v10013454mg             654   0.0      
ref|XP_010485692.1|  PREDICTED: non-specific phospholipase C3           652   0.0      
ref|XP_010511433.1|  PREDICTED: non-specific phospholipase C3-like      652   0.0      
gb|AAL38718.1|  unknown protein                                         651   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463801.1|  PREDICTED: non-specific phospholipase C3-like      649   0.0      
ref|XP_006663021.1|  PREDICTED: non-specific phospholipase C4-like      640   0.0      
gb|AGT17027.1|  phosphoesterase                                         627   0.0      
ref|XP_004228500.1|  PREDICTED: non-specific phospholipase C2           626   0.0      
emb|CDP08441.1|  unnamed protein product                                621   0.0      
ref|XP_007213924.1|  hypothetical protein PRUPE_ppa004282mg             619   0.0      
ref|XP_010273150.1|  PREDICTED: non-specific phospholipase C3-lik...    615   0.0      
ref|XP_006362756.1|  PREDICTED: uncharacterized protein LOC102580356    618   0.0      
ref|XP_004291735.1|  PREDICTED: phospholipase C 3-like                  617   0.0      
ref|XP_009790723.1|  PREDICTED: non-specific phospholipase C2           616   0.0      
gb|ABK24680.1|  unknown                                                 615   0.0      Picea sitchensis
gb|ABR16102.1|  unknown                                                 614   0.0      Picea sitchensis
ref|XP_006576659.1|  PREDICTED: non-specific phospholipase C4-lik...    610   0.0      
gb|KEH33501.1|  non-specific phospholipase C4                           612   0.0      
ref|XP_003556783.1|  PREDICTED: non-specific phospholipase C2-like      610   0.0      
ref|XP_007015279.1|  Non-specific phospholipase C2                      610   0.0      
ref|XP_007146120.1|  hypothetical protein PHAVU_006G014100g             607   0.0      
gb|KCW76686.1|  hypothetical protein EUGRSUZ_D010481                    600   0.0      
dbj|BAK03111.1|  predicted protein                                      604   0.0      
ref|XP_010276659.1|  PREDICTED: non-specific phospholipase C2-like      606   0.0      
ref|XP_004513953.1|  PREDICTED: non-hemolytic phospholipase C-like      606   0.0      
gb|ABR18107.1|  unknown                                                 605   0.0      Picea sitchensis
emb|CDY48187.1|  BnaA04g15510D                                          605   0.0      
ref|XP_010938556.1|  PREDICTED: non-specific phospholipase C2-like      605   0.0      
ref|XP_004154695.1|  PREDICTED: phospholipase C 3-like                  603   0.0      
ref|XP_004139131.1|  PREDICTED: phospholipase C 3-like                  603   0.0      
gb|KGN66548.1|  hypothetical protein Csa_1G629050                       603   0.0      
emb|CDY48054.1|  BnaA09g23040D                                          603   0.0      
ref|XP_009339440.1|  PREDICTED: non-specific phospholipase C2-like      598   0.0      
gb|KHG07474.1|  Phospholipase C 3                                       598   0.0      
ref|XP_008450341.1|  PREDICTED: non-specific phospholipase C2           598   0.0      
ref|XP_011024970.1|  PREDICTED: non-specific phospholipase C2           599   0.0      
ref|XP_010926985.1|  PREDICTED: non-specific phospholipase C2-like      597   0.0      
ref|XP_010249047.1|  PREDICTED: non-specific phospholipase C6-like      597   0.0      
ref|XP_009337051.1|  PREDICTED: non-specific phospholipase C2-like      597   0.0      
ref|XP_009140862.1|  PREDICTED: non-specific phospholipase C2           597   0.0      
gb|KDP43231.1|  hypothetical protein JCGZ_22783                         595   0.0      
ref|XP_006470553.1|  PREDICTED: non-specific phospholipase C2-lik...    595   0.0      
ref|XP_006854823.1|  hypothetical protein AMTR_s00063p00190060          597   0.0      
ref|XP_009411752.1|  PREDICTED: non-specific phospholipase C2           595   0.0      
ref|XP_002314000.2|  phosphoesterase family protein                     594   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002459116.1|  hypothetical protein SORBIDRAFT_03g046200          593   0.0      Sorghum bicolor [broomcorn]
ref|XP_011009118.1|  PREDICTED: non-specific phospholipase C2-lik...    593   0.0      
gb|ABK24597.1|  unknown                                                 593   0.0      Picea sitchensis
ref|XP_008782022.1|  PREDICTED: non-specific phospholipase C2-like      590   0.0      
ref|XP_010269437.1|  PREDICTED: non-specific phospholipase C2-like      591   0.0      
ref|XP_002276163.1|  PREDICTED: non-specific phospholipase C2           591   0.0      Vitis vinifera
emb|CBI24244.3|  unnamed protein product                                591   0.0      
gb|KDO54822.1|  hypothetical protein CISIN_1g009936mg                   591   0.0      
ref|XP_002298470.1|  phosphoesterase family protein                     591   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006446285.1|  hypothetical protein CICLE_v10014860mg             590   0.0      
ref|XP_010473071.1|  PREDICTED: non-specific phospholipase C2           590   0.0      
ref|XP_010673757.1|  PREDICTED: non-specific phospholipase C2           590   0.0      
ref|XP_010031720.1|  PREDICTED: non-specific phospholipase C2-like      589   0.0      
ref|XP_010557451.1|  PREDICTED: non-specific phospholipase C2           588   0.0      
ref|XP_006293962.1|  hypothetical protein CARUB_v10022952mg             589   0.0      
ref|XP_006408611.1|  hypothetical protein EUTSA_v10001963mg             588   0.0      
ref|XP_010417832.1|  PREDICTED: non-specific phospholipase C2-like      588   0.0      
ref|XP_002880842.1|  phosphoesterase family protein                     588   0.0      
ref|NP_180255.1|  non-specific phospholipase C2                         588   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ87922.1|  predicted protein                                      588   0.0      
ref|XP_008227281.1|  PREDICTED: LOW QUALITY PROTEIN: non-specific...    587   0.0      
ref|XP_002969128.1|  hypothetical protein SELMODRAFT_90880              587   0.0      
ref|XP_008220698.1|  PREDICTED: non-specific phospholipase C1           587   0.0      
ref|XP_004971305.1|  PREDICTED: uncharacterized protein LOC101755304    587   0.0      
emb|CDM86599.1|  unnamed protein product                                587   0.0      
dbj|BAJ98752.1|  predicted protein                                      584   0.0      
ref|NP_001146430.1|  hypothetical protein precursor                     586   0.0      Zea mays [maize]
ref|XP_008803348.1|  PREDICTED: LOW QUALITY PROTEIN: non-specific...    586   0.0      
ref|XP_003565100.1|  PREDICTED: non-specific phospholipase C2           586   0.0      
ref|XP_002973936.1|  hypothetical protein SELMODRAFT_267716             585   0.0      
ref|XP_009348348.1|  PREDICTED: non-specific phospholipase C2-like      585   0.0      
ref|NP_001045435.1|  Os01g0955000                                       583   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007205028.1|  hypothetical protein PRUPE_ppa004016mg             584   0.0      
gb|EAY77273.1|  hypothetical protein OsI_05247                          583   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010037407.1|  PREDICTED: non-specific phospholipase C6           582   0.0      
ref|XP_010487249.1|  PREDICTED: non-specific phospholipase C1-like      582   0.0      
gb|KFK32464.1|  hypothetical protein AALP_AA6G245200                    581   0.0      
ref|XP_001777798.1|  predicted protein                                  581   0.0      
emb|CDY06689.1|  BnaA10g04680D                                          581   0.0      
emb|CDY10260.1|  BnaC05g05030D                                          581   0.0      
ref|XP_010475476.1|  PREDICTED: non-specific phospholipase C1-like      580   0.0      
ref|XP_010482768.1|  PREDICTED: non-specific phospholipase C1-like      580   0.0      
ref|XP_010521945.1|  PREDICTED: non-specific phospholipase C1           580   0.0      
ref|XP_009118978.1|  PREDICTED: non-specific phospholipase C1           580   0.0      
ref|XP_002511167.1|  Phospholipase C 4 precursor, putative              578   0.0      Ricinus communis
ref|XP_010457889.1|  PREDICTED: non-specific phospholipase C1           579   0.0      
ref|XP_006645376.1|  PREDICTED: non-specific phospholipase C2-like      579   0.0      
ref|XP_006848189.1|  hypothetical protein AMTR_s00029p00239010          578   0.0      
ref|XP_006417823.1|  hypothetical protein EUTSA_v10007332mg             578   0.0      
ref|XP_007137903.1|  hypothetical protein PHAVU_009G165500g             577   0.0      
gb|KFK43042.1|  hypothetical protein AALP_AA1G070800                    577   0.0      
ref|XP_004138043.1|  PREDICTED: phospholipase C 3-like                  576   0.0      
ref|NP_172203.2|  non-specific phospholipase C1                         576   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464423.1|  PREDICTED: non-specific phospholipase C6           575   0.0      
ref|XP_011080409.1|  PREDICTED: non-specific phospholipase C2           573   0.0      
gb|AAF82197.1|AC067971_5  Contains similarity to an unknown prote...    573   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007037999.1|  Non-specific phospholipase C6                      573   0.0      
ref|XP_011035177.1|  PREDICTED: non-specific phospholipase C1-like      573   0.0      
ref|XP_009359424.1|  PREDICTED: non-specific phospholipase C6-like      572   0.0      
ref|XP_010923059.1|  PREDICTED: non-specific phospholipase C1           573   0.0      
ref|XP_002299814.1|  phospholipase family protein                       572   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009374252.1|  PREDICTED: non-specific phospholipase C1-like      572   0.0      
ref|XP_006307226.1|  hypothetical protein CARUB_v10008826mg             572   0.0      
ref|XP_004294247.1|  PREDICTED: phospholipase C 3-like                  572   0.0      
ref|XP_008239487.1|  PREDICTED: non-specific phospholipase C6           571   0.0      
gb|EYU46196.1|  hypothetical protein MIMGU_mgv1a004566mg                571   0.0      
ref|XP_004981202.1|  PREDICTED: uncharacterized protein LOC101779707    571   0.0      
ref|XP_006436856.1|  hypothetical protein CICLE_v10031232mg             570   0.0      
ref|XP_010685575.1|  PREDICTED: non-specific phospholipase C1           569   0.0      
ref|XP_002278413.1|  PREDICTED: non-specific phospholipase C1 iso...    570   0.0      Vitis vinifera
ref|XP_003523153.1|  PREDICTED: non-specific phospholipase C6-like      569   0.0      
ref|XP_008802791.1|  PREDICTED: non-specific phospholipase C1           569   0.0      
gb|KDO47309.1|  hypothetical protein CISIN_1g009875mg                   568   0.0      
ref|XP_008388521.1|  PREDICTED: non-specific phospholipase C6-like      568   0.0      
ref|XP_011082394.1|  PREDICTED: non-specific phospholipase C1           569   0.0      
ref|XP_009413800.1|  PREDICTED: non-specific phospholipase C1-like      569   0.0      
ref|XP_010026404.1|  PREDICTED: non-specific phospholipase C6-like      568   0.0      
ref|XP_008355188.1|  PREDICTED: non-specific phospholipase C1-like      568   0.0      
ref|XP_010031723.1|  PREDICTED: non-specific phospholipase C2-like      565   0.0      
ref|XP_010086965.1|  Phospholipase C 3                                  566   0.0      
ref|XP_011044122.1|  PREDICTED: non-specific phospholipase C6-like      566   0.0      
ref|XP_004500251.1|  PREDICTED: phospholipase C 4-like                  566   0.0      
ref|XP_009347571.1|  PREDICTED: non-specific phospholipase C1-like      566   0.0      
ref|XP_002318737.1|  phosphoesterase family protein                     565   0.0      Populus trichocarpa [western balsam poplar]
gb|KEH34259.1|  non-specific phospholipase C4                           566   0.0      
ref|XP_011032127.1|  PREDICTED: non-specific phospholipase C1           566   0.0      
ref|NP_190430.2|  non-specific phospholipase C6                         565   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006488503.1|  PREDICTED: non-specific phospholipase C1-like      565   0.0      
ref|XP_010043437.1|  PREDICTED: non-specific phospholipase C1           565   0.0      
ref|XP_006425054.1|  hypothetical protein CICLE_v10028112mg             566   0.0      
ref|XP_010519508.1|  PREDICTED: non-specific phospholipase C6           564   0.0      
ref|XP_008464045.1|  PREDICTED: non-specific phospholipase C1           564   0.0      
ref|XP_009375203.1|  PREDICTED: non-specific phospholipase C6-like      563   0.0      
ref|XP_004501711.1|  PREDICTED: phospholipase C 3-like                  563   0.0      
ref|XP_002314107.2|  phospholipase family protein                       563   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009419667.1|  PREDICTED: non-specific phospholipase C1-like      563   0.0      
ref|XP_010256564.1|  PREDICTED: non-specific phospholipase C1           563   0.0      
ref|XP_002877621.1|  predicted protein                                  562   0.0      
ref|XP_011023988.1|  PREDICTED: non-specific phospholipase C6-lik...    561   0.0      
gb|KDO66868.1|  hypothetical protein CISIN_1g009232mg                   562   0.0      
ref|XP_002322267.1|  phosphoesterase family protein                     561   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011073084.1|  PREDICTED: non-specific phospholipase C6           561   0.0      
ref|NP_001170209.1|  uncharacterized protein LOC100384160 precursor     562   0.0      Zea mays [maize]
ref|XP_004143151.1|  PREDICTED: phospholipase C 3-like                  562   0.0      
ref|XP_003526950.1|  PREDICTED: non-specific phospholipase C6-like      561   0.0      
ref|XP_008374231.1|  PREDICTED: non-specific phospholipase C6-like      561   0.0      
ref|XP_008349572.1|  PREDICTED: non-specific phospholipase C1-like      561   0.0      
ref|XP_008384816.1|  PREDICTED: non-specific phospholipase C1-like      561   0.0      
ref|XP_010104638.1|  Phospholipase C 4                                  561   0.0      
emb|CAN76213.1|  hypothetical protein VITISV_015975                     561   0.0      Vitis vinifera
ref|XP_004234306.1|  PREDICTED: non-specific phospholipase C6           560   0.0      
ref|XP_006351512.1|  PREDICTED: uncharacterized protein LOC102598393    560   0.0      
ref|XP_002525632.1|  hydrolase, acting on ester bonds, putative         560   0.0      Ricinus communis
ref|XP_006290899.1|  hypothetical protein CARUB_v10017011mg             560   0.0      
gb|KHG10805.1|  Phospholipase C 3                                       560   0.0      
ref|XP_002974695.1|  hypothetical protein SELMODRAFT_174501             559   0.0      
gb|EAZ09717.1|  hypothetical protein OsI_32003                          555   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004160171.1|  PREDICTED: phospholipase C 3-like                  560   0.0      
ref|XP_003563199.1|  PREDICTED: non-specific phospholipase C1           560   0.0      
ref|XP_010426358.1|  PREDICTED: non-specific phospholipase C6-like      560   0.0      
ref|XP_006404232.1|  hypothetical protein EUTSA_v10010294mg             558   0.0      
gb|EYU23082.1|  hypothetical protein MIMGU_mgv1a004730mg                557   0.0      
ref|XP_002466168.1|  hypothetical protein SORBIDRAFT_01g002750          558   0.0      Sorghum bicolor [broomcorn]
ref|XP_010503499.1|  PREDICTED: non-specific phospholipase C6           556   0.0      
ref|XP_009620986.1|  PREDICTED: non-specific phospholipase C6           556   0.0      
ref|XP_011083669.1|  PREDICTED: non-specific phospholipase C6-like      556   0.0      
emb|CDP15038.1|  unnamed protein product                                556   0.0      
gb|EYU43043.1|  hypothetical protein MIMGU_mgv1a004676mg                556   0.0      
ref|XP_002963410.1|  hypothetical protein SELMODRAFT_438555             555   0.0      
ref|XP_006366597.1|  PREDICTED: uncharacterized protein LOC102590193    556   0.0      
ref|XP_010515182.1|  PREDICTED: non-specific phospholipase C6-like      554   0.0      
gb|ACL54095.1|  unknown                                                 555   0.0      Zea mays [maize]
ref|XP_003602799.1|  Phospholipase C                                    553   0.0      
gb|EAY92414.1|  hypothetical protein OsI_14148                          554   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_003551286.1|  PREDICTED: non-specific phospholipase C1-like      553   0.0      
gb|KDP46506.1|  hypothetical protein JCGZ_08478                         552   0.0      
ref|XP_004246237.1|  PREDICTED: non-specific phospholipase C1           554   0.0      
gb|ACN31514.1|  unknown                                                 554   0.0      Zea mays [maize]
emb|CDY60104.1|  BnaAnng16500D                                          552   0.0      
gb|AAK82449.1|AC091247_16  putative phospholipase                       553   0.0      Oryza sativa [red rice]
ref|XP_002280206.1|  PREDICTED: non-specific phospholipase C6           552   0.0      Vitis vinifera
ref|NP_001152086.1|  LOC100285723 precursor                             552   0.0      Zea mays [maize]
ref|XP_010040799.1|  PREDICTED: non-specific phospholipase C6-like      552   0.0      
ref|XP_007016119.1|  Non-specific phospholipase C1                      552   0.0      
gb|EPS67588.1|  hypothetical protein M569_07187                         551   0.0      
gb|ACJ85771.1|  unknown                                                 551   0.0      
gb|KEH18079.1|  non-specific phospholipase C4                           545   0.0      
ref|XP_009151475.1|  PREDICTED: non-specific phospholipase C6-like      551   0.0      
ref|XP_009769939.1|  PREDICTED: non-specific phospholipase C1           551   0.0      
ref|XP_007146750.1|  hypothetical protein PHAVU_006G066600g             551   0.0      
gb|KDP22606.1|  hypothetical protein JCGZ_26437                         548   0.0      
emb|CDX83042.1|  BnaA01g20420D                                          550   0.0      
gb|EPS60770.1|  hypothetical protein M569_14031                         551   0.0      
ref|XP_003539282.1|  PREDICTED: non-specific phospholipase C1-like      550   0.0      
gb|EYU46195.1|  hypothetical protein MIMGU_mgv1a004923mg                549   0.0      
ref|XP_006848278.1|  hypothetical protein AMTR_s00013p00083070          549   0.0      
ref|XP_009371507.1|  PREDICTED: non-specific phospholipase C1-like      549   0.0      
ref|XP_009611203.1|  PREDICTED: non-specific phospholipase C1 iso...    549   0.0      
ref|XP_009149805.1|  PREDICTED: non-specific phospholipase C6           547   0.0      
emb|CDY05858.1|  BnaC08g20350D                                          546   0.0      
ref|XP_010695377.1|  PREDICTED: non-specific phospholipase C6           544   0.0      
ref|XP_009421063.1|  PREDICTED: non-specific phospholipase C6-like      543   0.0      
ref|XP_001777578.1|  predicted protein                                  543   0.0      
gb|KFK34165.1|  hypothetical protein AALP_AA5G109100                    538   0.0      
ref|XP_008807439.1|  PREDICTED: non-specific phospholipase C6           540   0.0      
ref|XP_006650828.1|  PREDICTED: non-specific phospholipase C1-like      538   0.0      
ref|XP_010905496.1|  PREDICTED: non-specific phospholipase C6           536   0.0      
gb|KDO54823.1|  hypothetical protein CISIN_1g009936mg                   532   0.0      
ref|XP_009383325.1|  PREDICTED: non-specific phospholipase C6           533   1e-180   
ref|XP_011009119.1|  PREDICTED: non-specific phospholipase C2-lik...    529   2e-180   
gb|KHN06239.1|  Phospholipase C 3                                       533   3e-180   
emb|CDY08085.1|  BnaA06g16410D                                          530   4e-180   
gb|EYU45733.1|  hypothetical protein MIMGU_mgv1a020087mg                527   1e-179   
ref|XP_002892389.1|  phosphoesterase family protein                     527   2e-178   
ref|XP_010650909.1|  PREDICTED: non-specific phospholipase C1 iso...    541   6e-178   
emb|CAB62350.1|  putative protein                                       523   8e-178   
ref|XP_010926854.1|  PREDICTED: non-specific phospholipase C6-like      520   6e-176   
ref|XP_008355128.1|  PREDICTED: non-specific phospholipase C1-like      514   2e-174   
ref|XP_010909833.1|  PREDICTED: non-specific phospholipase C6-like      514   1e-173   
ref|XP_002526040.1|  hydrolase, acting on ester bonds, putative         514   5e-173   
ref|XP_009611204.1|  PREDICTED: non-specific phospholipase C1 iso...    506   3e-171   
gb|AFN53667.1|  phosphoesterase family protein                          515   7e-170   
gb|EAZ18936.1|  hypothetical protein OsJ_34476                          500   9e-170   
ref|XP_011023989.1|  PREDICTED: non-specific phospholipase C6-lik...    501   1e-169   
ref|XP_009772356.1|  PREDICTED: non-specific phospholipase C6           499   1e-168   
ref|XP_001780602.1|  predicted protein                                  497   4e-167   
ref|XP_001760978.1|  predicted protein                                  496   2e-166   
ref|XP_001767460.1|  predicted protein                                  493   6e-165   
ref|XP_009630366.1|  PREDICTED: non-specific phospholipase C2           484   1e-163   
gb|EMT30190.1|  Phospholipase C 3                                       482   2e-162   
emb|CAN61893.1|  hypothetical protein VITISV_028790                     519   4e-162   
ref|NP_001051765.2|  Os03g0826600                                       479   3e-161   
ref|NP_001170605.1|  hypothetical protein precursor                     483   1e-160   
ref|XP_002455351.1|  hypothetical protein SORBIDRAFT_03g009070          482   1e-160   
gb|EMT04201.1|  Phospholipase C 2                                       483   2e-160   
gb|KGN47086.1|  hypothetical protein Csa_6G185840                       476   5e-160   
ref|XP_010106600.1|  Phospholipase C 3                                  470   2e-158   
gb|KHN07673.1|  Phospholipase C 3                                       470   1e-157   
ref|XP_004967909.1|  PREDICTED: uncharacterized protein LOC101763129    474   4e-157   
ref|XP_007209208.1|  hypothetical protein PRUPE_ppa006616mg             468   5e-157   
ref|XP_003565361.1|  PREDICTED: non-specific phospholipase C6-like      468   1e-154   
ref|XP_008354405.1|  PREDICTED: non-specific phospholipase C2-like      460   2e-154   
ref|XP_006645422.1|  PREDICTED: non-specific phospholipase C6-like      459   1e-151   
ref|NP_001041746.1|  Os01g0102000                                       457   9e-151   
gb|KCW85449.1|  hypothetical protein EUGRSUZ_B02259                     447   3e-149   
dbj|BAB62632.1|  P0402A09.15                                            454   9e-149   
emb|CAN73870.1|  hypothetical protein VITISV_001276                     447   8e-148   
gb|KCW49114.1|  hypothetical protein EUGRSUZ_K02713                     441   8e-147   
gb|KDO66869.1|  hypothetical protein CISIN_1g009232mg                   443   1e-146   
gb|KDO66870.1|  hypothetical protein CISIN_1g009232mg                   441   2e-146   
ref|XP_009599478.1|  PREDICTED: non-specific phospholipase C4-like      432   2e-145   
ref|XP_008359073.1|  PREDICTED: non-specific phospholipase C1-like      434   6e-144   
ref|XP_003552958.1|  PREDICTED: non-specific phospholipase C1-like      427   3e-141   
gb|KCW44913.1|  hypothetical protein EUGRSUZ_L01504                     420   2e-138   
gb|KGN61416.1|  hypothetical protein Csa_2G119380                       418   8e-138   
gb|EYU45732.1|  hypothetical protein MIMGU_mgv1a023692mg                407   4e-134   
ref|XP_004171114.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    409   6e-134   
gb|KDO42622.1|  hypothetical protein CISIN_1g046829mg                   401   2e-132   
gb|EMT03454.1|  Phospholipase C 3                                       402   1e-130   
gb|EMT27262.1|  Phospholipase C 3                                       397   3e-130   
gb|EMS52170.1|  Non-hemolytic phospholipase C                           397   3e-128   
gb|KHG20385.1|  Phospholipase C 4                                       393   1e-127   
ref|XP_004364648.1|  phosphoesterase                                    390   9e-125   
gb|EMS45693.1|  Phospholipase C 3                                       382   4e-124   
ref|NP_001068198.2|  Os11g0593000                                       381   6e-124   
gb|ABA94565.1|  phosphoesterase family protein, putative, expressed     377   1e-122   
emb|CDS14521.1|  hypothetical protein LRAMOSA06690                      388   2e-121   
emb|CDH56683.1|  acid phosphatase                                       385   1e-120   
gb|EMS44992.1|  Putative coatomer subunit beta'-3                       376   2e-119   
gb|KEH18088.1|  non-specific phospholipase C4                           363   3e-118   
gb|EMS57546.1|  Non-hemolytic phospholipase C                           361   3e-115   
ref|XP_004345994.1|  phosphoesterase family protein                     363   1e-114   
gb|KHN06241.1|  Phospholipase C 3                                       350   9e-113   
gb|EMS48359.1|  Non-hemolytic phospholipase C                           352   9e-112   
gb|ABR25827.1|  hydrolase                                               334   3e-107   
gb|KDO36274.1|  hypothetical protein CISIN_1g042607mg                   330   2e-105   
ref|XP_008347475.1|  PREDICTED: non-specific phospholipase C2-like      314   3e-99    
gb|KDO46831.1|  hypothetical protein CISIN_1g027351mg                   312   8e-99    
emb|CAN65837.1|  hypothetical protein VITISV_025817                     301   5e-95    
ref|XP_001007256.1|  Phosphoesterase family protein                     304   5e-92    
ref|XP_004173255.1|  PREDICTED: non-hemolytic phospholipase C-like      293   2e-91    
gb|KGN61414.1|  hypothetical protein Csa_2G119360                       293   2e-91    
ref|XP_001007255.1|  Phosphoesterase family protein                     302   3e-91    
gb|EYU40280.1|  hypothetical protein MIMGU_mgv1a017634mg                290   7e-91    
ref|XP_001007257.1|  Phosphoesterase family protein                     300   1e-90    
ref|XP_006680257.1|  hypothetical protein BATDEDRAFT_12700              292   4e-89    
ref|XP_010260873.1|  PREDICTED: non-specific phospholipase C4-like      280   1e-86    
ref|XP_001025081.1|  Phosphoesterase family protein                     288   5e-86    
gb|AFW67100.1|  hypothetical protein ZEAMMB73_724533                    279   9e-86    
ref|XP_006678617.1|  hypothetical protein BATDEDRAFT_36939              280   1e-83    
ref|XP_006675418.1|  hypothetical protein BATDEDRAFT_21920              279   1e-83    
gb|ABA94566.1|  phosphoesterase family protein, putative                271   5e-83    
ref|XP_001018131.1|  Phosphoesterase family protein                     271   1e-79    
ref|WP_031437139.1|  phosphoesterase                                    268   2e-78    
ref|WP_006890831.1|  phosphoesterase                                    267   3e-78    
ref|WP_027148323.1|  phosphoesterase                                    264   4e-77    
ref|XP_004035073.1|  phosphoesterase family protein, putative           265   1e-75    
emb|CDS13864.1|  hypothetical protein LRAMOSA06038                      256   6e-75    
ref|WP_036665727.1|  phosphoesterase                                    250   5e-72    
ref|WP_027679813.1|  phosphoesterase                                    242   4e-69    
ref|WP_004631352.1|  hypothetical protein                               242   7e-69    
ref|WP_024542141.1|  MULTISPECIES: phosphoesterase                      241   1e-68    
ref|WP_034485284.1|  phosphoesterase                                    239   1e-68    
ref|WP_009240052.1|  MULTISPECIES: phosphoesterase                      241   2e-68    
ref|WP_024977504.1|  phosphoesterase                                    240   2e-68    
ref|WP_037022364.1|  phosphoesterase                                    239   3e-68    
ref|WP_007396762.1|  phospholipase                                      240   3e-68    
ref|WP_037150550.1|  phosphoesterase                                    239   3e-68    
ref|WP_024974308.1|  phosphoesterase                                    240   3e-68    
ref|WP_009277071.1|  phosphoesterase                                    240   4e-68    
gb|AHI27585.1|  phosphoesterase                                         240   4e-68    
ref|WP_026446067.1|  hypothetical protein                               238   5e-68    
emb|CBI15963.3|  unnamed protein product                                231   1e-67    
ref|WP_018670197.1|  phosphoesterase                                    239   1e-67    
gb|ENN88281.1|  phosphoesterase family protein                          239   1e-67    
ref|WP_003339570.1|  phosphoesterase                                    235   4e-66    
ref|WP_028207156.1|  phosphoesterase                                    234   6e-66    
ref|WP_039596893.1|  phosphoesterase                                    234   7e-66    
ref|WP_038094652.1|  hypothetical protein                               232   1e-65    
gb|KEO80885.1|  hypothetical protein EL26_23860                         233   1e-65    
emb|CDP09181.1|  unnamed protein product                                225   2e-65    
ref|WP_025987468.1|  phosphoesterase                                    231   4e-65    
gb|AHI67228.1|  phosphoesterase family protein                          231   4e-65    
gb|AIG26903.1|  phospholipase C 2 precursor                             231   7e-65    
gb|EYE99314.1|  phosphoesterase                                         231   7e-65    
ref|WP_022584734.1|  phosphoesterase                                    231   7e-65    
ref|WP_011401150.1|  phosphoesterase                                    231   8e-65    
ref|WP_007883524.1|  phosphoesterase                                    230   1e-64    
ref|WP_038791057.1|  phosphoesterase                                    230   1e-64    
ref|WP_026386494.1|  hypothetical protein                               228   2e-64    
ref|WP_031328874.1|  phosphoesterase                                    230   2e-64    
gb|EPX99247.1|  phosphoesterase                                         229   3e-64    
gb|KGW23940.1|  phosphoesterase family protein                          229   3e-64    
gb|KGD51477.1|  phosphoesterase family protein                          229   3e-64    
ref|XP_003627296.1|  hypothetical protein MTR_8g020860                  221   4e-64    
ref|WP_038778946.1|  phosphoesterase                                    229   4e-64    
ref|WP_038735369.1|  phosphoesterase                                    229   4e-64    
ref|WP_004204226.1|  MULTISPECIES: phosphoesterase                      229   4e-64    
ref|WP_038733857.1|  phosphoesterase                                    229   4e-64    
ref|WP_038730254.1|  MULTISPECIES: phosphoesterase                      229   4e-64    
ref|WP_009925546.1|  phosphoesterase family protein                     229   4e-64    
gb|KGW37226.1|  phosphoesterase family protein                          229   4e-64    
ref|WP_004553460.1|  phosphoesterase                                    229   4e-64    
gb|EDU11265.1|  phosphoesterase family protein                          229   4e-64    
ref|WP_038735023.1|  phosphoesterase                                    229   4e-64    
ref|WP_038785249.1|  phosphoesterase                                    229   4e-64    
gb|KGD02774.1|  phosphoesterase family protein                          229   5e-64    
gb|KGW96672.1|  phosphoesterase family protein                          229   5e-64    
gb|KGS56321.1|  phosphoesterase family protein                          229   5e-64    
ref|WP_038757828.1|  phosphoesterase                                    229   5e-64    
ref|WP_038742370.1|  phosphoesterase                                    229   5e-64    
ref|WP_038736422.1|  phosphoesterase                                    229   5e-64    
ref|WP_028359120.1|  phosphoesterase                                    229   5e-64    
gb|KGS90716.1|  phosphoesterase family protein                          229   5e-64    
gb|AIO55227.1|  phosphoesterase family protein                          229   5e-64    
gb|KGS21024.1|  phosphoesterase family protein                          228   5e-64    
ref|WP_038749520.1|  phosphoesterase                                    228   5e-64    
ref|WP_024429173.1|  phosphoesterase                                    228   5e-64    
ref|WP_020850205.1|  phosphoesterase family protein                     228   5e-64    
gb|AIV75388.1|  phosphoesterase family protein                          228   6e-64    
gb|AIS90690.1|  phosphoesterase family protein                          228   6e-64    
gb|KGW01996.1|  phosphoesterase family protein                          228   7e-64    
ref|WP_038746662.1|  phosphoesterase                                    229   7e-64    
gb|KGC26721.1|  phosphoesterase family protein                          228   8e-64    
ref|XP_002560012.1|  Pc14g00170                                         227   8e-64    
ref|WP_038724593.1|  MULTISPECIES: phosphoesterase                      229   9e-64    
ref|WP_009940630.1|  phosphoesterase                                    229   9e-64    
ref|WP_009977196.1|  phosphoesterase                                    228   9e-64    
ref|WP_038762840.1|  phosphoesterase                                    229   9e-64    
ref|WP_038739164.1|  MULTISPECIES: phosphoesterase                      229   9e-64    
ref|WP_004557614.1|  phosphoesterase family protein                     228   1e-63    
gb|EDS82829.1|  phosphoesterase family protein                          228   1e-63    
ref|WP_038736596.1|  phosphoesterase                                    228   1e-63    
ref|WP_004528623.1|  phosphoesterase                                    228   1e-63    
ref|WP_004196385.1|  MULTISPECIES: phosphoesterase                      228   1e-63    
ref|WP_004184546.1|  phosphoesterase                                    228   1e-63    
ref|WP_038799577.1|  phosphoesterase                                    228   1e-63    
ref|WP_004199599.1|  phosphoesterase                                    228   1e-63    
ref|WP_038776622.1|  phosphoesterase                                    228   1e-63    
ref|WP_038755246.1|  phosphoesterase                                    228   1e-63    
ref|WP_004542308.1|  phosphoesterase                                    228   2e-63    
gb|AAX36075.1|  extracellular phospholipase C                           226   2e-63    
ref|WP_038722048.1|  phosphoesterase                                    228   2e-63    
ref|WP_038718990.1|  phosphoesterase                                    228   2e-63    
ref|WP_038793053.1|  phosphoesterase                                    227   2e-63    
gb|ABG20595.1|  PLC-A                                                   225   4e-63    
gb|EDP53506.1|  phosphatidylglycerol specific phospholipase, puta...    227   5e-63    
gb|KEY80907.1|  phosphatidylglycerol specific phospholipase C           227   5e-63    
ref|WP_038739848.1|  phosphoesterase                                    226   7e-63    
ref|WP_038750600.1|  phosphoesterase                                    226   7e-63    
ref|WP_038793361.1|  phosphoesterase                                    226   7e-63    
ref|XP_748474.1|  phosphatidylglycerol specific phospholipase           226   9e-63    
gb|ABG20599.1|  PLC-A                                                   224   9e-63    
ref|WP_019466167.1|  hypothetical protein                               226   1e-62    
ref|XP_001273746.1|  phosphatidylglycerol specific phospholipase,...    225   3e-62    
ref|WP_028211198.1|  phosphoesterase                                    223   4e-62    
ref|WP_028230153.1|  phosphoesterase                                    223   4e-62    
ref|XP_002385401.1|  phosphatidylglycerol specific phospholipase,...    224   7e-62    
ref|WP_006027040.1|  phosphoesterase                                    223   7e-62    
gb|KGO44330.1|  Phosphoesterase                                         221   1e-61    
gb|ETO91736.1|  phosphoesterase family protein                          222   2e-61    
gb|KFZ24346.1|  hypothetical protein V502_01177                         221   3e-61    
ref|WP_033350493.1|  phosphoesterase                                    219   3e-61    
gb|KGO58586.1|  Phosphoesterase                                         220   3e-61    
ref|XP_001560851.1|  hypothetical protein BC1G_00879                    220   5e-61    
ref|WP_015603920.1|  phosphoesterase family protein                     221   5e-61    



>ref|XP_009621181.1| PREDICTED: non-specific phospholipase C4-like [Nicotiana tomentosiformis]
Length=521

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/525 (77%), Positives = 443/525 (84%), Gaps = 10/525 (2%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEING-VAGKESNPLPTSGGAQNS  219
             SSE S  S FPIKTV+VLVQENRSFDHMLGWM +LNPEI G   GKESNP+ TS    N 
Sbjct  3     SSETSKPS-FPIKTVIVLVQENRSFDHMLGWMNTLNPEITGPTIGKESNPISTS----NQ  57

Query  220   TNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAG  399
              + +V FGN S YVD DPGHSIQDIYEQIFG PWSQD A KKLEP M+GFA NAERNQ G
Sbjct  58    NSSLVYFGNNSLYVDQDPGHSIQDIYEQIFGVPWSQDLANKKLEPAMKGFAQNAERNQKG  117

Query  400   MSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKK  579
             M+  VMNGF P AVPVYKELV EFAVCDRWFASVPASTQPNRLFVHSATSHG TSNDTK 
Sbjct  118   MAETVMNGFKPAAVPVYKELVTEFAVCDRWFASVPASTQPNRLFVHSATSHGLTSNDTKL  177

Query  580   LIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEG  759
             LI G PQKTIF+SMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFH FD+ FK HCKEG
Sbjct  178   LIHGLPQKTIFDSMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHPFDLSFKNHCKEG  237

Query  760   KLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDE  939
             KLPNYVV+E R++DLK+LPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLF+IIYDE
Sbjct  238   KLPNYVVIEPRFYDLKVLPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFIIIYDE  297

Query  940   HGGFYDHVPTPVTGVPNPDGLIGPQ-PYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGP  1116
             HGGF+DHVPTPVTGVP+PDG++G   PYNFQFDRLGVRVPAIM+SPWIERG VLH PSGP
Sbjct  298   HGGFFDHVPTPVTGVPSPDGIVGTTAPYNFQFDRLGVRVPAIMISPWIERGTVLHKPSGP  357

Query  1117  FPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRS  1296
             +  SE+EHSSIPATVKKIFNL++FLT+RDAWAGTFETVITR+TPR DCPETL EPV++R 
Sbjct  358   YATSEFEHSSIPATVKKIFNLDEFLTKRDAWAGTFETVITRSTPRTDCPETLPEPVRMRE  417

Query  1297  AEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGD  1476
             AEA+E+A LTE+Q EMVQM+AVLCGDHM +  YP+KLVE M+VAKAADY H AF KFL +
Sbjct  418   AEAQEEAKLTEFQAEMVQMSAVLCGDHMNKS-YPNKLVEGMTVAKAADYVHNAFKKFLDE  476

Query  1477  CENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              E A Q G H   S + + +        PRK KSFA+KF SCI C
Sbjct  477   GEKAIQSGAHE--STILIPRDQLLAERAPRKSKSFASKFFSCIVC  519



>ref|XP_009757037.1| PREDICTED: non-specific phospholipase C4-like [Nicotiana sylvestris]
Length=515

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/516 (77%), Positives = 437/516 (85%), Gaps = 12/516 (2%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEING-VAGKESNPLPTSGGAQNSTNDVVLFGN  246
             FPIKTVVVLVQENRSFDHMLGWM +LNPEI G   GKESNP+ TS    N  + +V FGN
Sbjct  8     FPIKTVVVLVQENRSFDHMLGWMNTLNPEITGPTTGKESNPISTS----NQNSSLVFFGN  63

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
              S YVD DPGHSIQDIYEQIFG PWSQD A KKLEP M+GFA NAERNQ GM+  VMNGF
Sbjct  64    NSLYVDQDPGHSIQDIYEQIFGVPWSQDLANKKLEPAMKGFAQNAERNQKGMAETVMNGF  123

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+AVPVYKELV EFAVCDRWFASVPASTQPNRLFVHSATSHG TSNDTK LI G PQKT
Sbjct  124   KPDAVPVYKELVTEFAVCDRWFASVPASTQPNRLFVHSATSHGLTSNDTKLLIHGLPQKT  183

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+SMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFH FD+ FK HCKEGKLPNYVV+E
Sbjct  184   IFDSMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHPFDLSFKNHCKEGKLPNYVVIE  243

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QR+FDLK+LPGNDDHPSHDVFEGQK VKEVYEALRSSPQWNEMLF+IIYDEHGGF+DHVP
Sbjct  244   QRFFDLKVLPGNDDHPSHDVFEGQKLVKEVYEALRSSPQWNEMLFIIIYDEHGGFFDHVP  303

Query  967   TPVTGVPNPDGLIGPQ-PYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             TP+TGVP+PDG++G   PYNFQFDRLGVRVPAIM+SPWIERG VLH P GP+  SE+EHS
Sbjct  304   TPITGVPSPDGIVGTTAPYNFQFDRLGVRVPAIMISPWIERGTVLHKPLGPYATSEFEHS  363

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             S+PATVKKIFNL++FLT+RDAWAGTFETVI R+TPR DCPETL +PV++R AEA+EDA L
Sbjct  364   SVPATVKKIFNLDEFLTKRDAWAGTFETVIARSTPRTDCPETLPDPVRMREAEAQEDAKL  423

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             TE+Q EMVQM+AVLCGD+MK+  YP+KLVE M+VAKAADY H AF KFL + E A Q G 
Sbjct  424   TEFQAEMVQMSAVLCGDYMKKS-YPNKLVEGMTVAKAADYVHNAFKKFLDEGEKAIQSGA  482

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             H    ++     P      PRK KSFA+KF SCI C
Sbjct  483   HESTILI-----PRPAERAPRKSKSFASKFFSCIVC  513



>ref|XP_011086411.1| PREDICTED: non-specific phospholipase C4-like [Sesamum indicum]
Length=523

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/534 (73%), Positives = 443/534 (83%), Gaps = 20/534 (4%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNST  222
             +SE +    FPIKTVVVLVQENRSFDHMLGWMK+LNPEI+GV G ESNPL T+    + T
Sbjct  2     ASETTSNPNFPIKTVVVLVQENRSFDHMLGWMKTLNPEIDGVTGSESNPLSTA----DPT  57

Query  223   NDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGM  402
             +  V +G+ S YVDPDPGHSIQDI+EQIFG PWSQDSA K  EP MQGFA NAER + GM
Sbjct  58    SKRVFYGDGSLYVDPDPGHSIQDIFEQIFGVPWSQDSAAK--EPNMQGFAQNAERKRNGM  115

Query  403   SGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKL  582
             S  VMNGF PEA+PVY+ELV EFAVCDRWFA+VPASTQPNRLFVHS TS+GATSND K L
Sbjct  116   SDTVMNGFKPEAIPVYRELVTEFAVCDRWFAAVPASTQPNRLFVHSGTSYGATSNDRKLL  175

Query  583   IEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYI-KNFHQFDIHFKTHCKEG  759
             IEG+PQKTIFES++EAG +FGIYYQYPP+TLFY+NLRKLKY+  NFHQFD+HFK HCKEG
Sbjct  176   IEGYPQKTIFESLEEAGCTFGIYYQYPPATLFYKNLRKLKYVLNNFHQFDLHFKRHCKEG  235

Query  760   KLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDE  939
             KLPNYVVVEQRYFDLK+LPGNDDHPSHDVFEGQKFVK+VYEALRSSPQWNEMLF+IIYDE
Sbjct  236   KLPNYVVVEQRYFDLKLLPGNDDHPSHDVFEGQKFVKKVYEALRSSPQWNEMLFIIIYDE  295

Query  940   HGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPF  1119
             HGGF+DHVPTPVTGVP+PDG++GP+PYNF+FDRLGVRVP IM+SPWIE+G VLHGPSGP 
Sbjct  296   HGGFFDHVPTPVTGVPSPDGIVGPEPYNFRFDRLGVRVPTIMISPWIEKGAVLHGPSGPH  355

Query  1120  PNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSA  1299
             P SE+EHSSIPAT+KKIFNL +FLT+RDAWAGTFETVI+R +PR DCPETL EPVKLR  
Sbjct  356   PTSEFEHSSIPATIKKIFNLKEFLTKRDAWAGTFETVISRKSPRTDCPETLPEPVKLRED  415

Query  1300  EAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDC  1479
             EAK++A L+E+Q+E+VQMAA LCGDH KE  +PHKLVENM+ +   +Y   AF KFL +C
Sbjct  416   EAKDEAKLSEFQEELVQMAASLCGDHRKEG-FPHKLVENMTASDGVEYVKGAFQKFLDEC  474

Query  1480  ENARQRGIHGDY-------SVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
             E AR+ G  G         S  + +   PSP     K KSFA+K  SCI C  N
Sbjct  475   EKARRNGADGSTICIPPVDSSTSTAVDAPSP-----KSKSFASKLFSCIVCSGN  523



>emb|CDP19759.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/495 (76%), Positives = 426/495 (86%), Gaps = 9/495 (2%)
 Frame = +1

Query  136   MKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGA  315
             M++LNPEING  G ESNPL T+     ++N+++LFG+KS YVDPDPGHSIQDI+EQIFG 
Sbjct  1     MRTLNPEINGATGTESNPLSTA----QTSNNLLLFGDKSVYVDPDPGHSIQDIFEQIFGV  56

Query  316   PWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFA  495
             PWSQD A KKLEP+MQGFA NAERN+ GMS  VMNGF PEAVPVYKELV EFAVCDRWFA
Sbjct  57    PWSQDVASKKLEPSMQGFAQNAERNEKGMSETVMNGFRPEAVPVYKELVSEFAVCDRWFA  116

Query  496   SVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTL  675
             +VPASTQPNRLFVHSATSHG TSNDTK L+EG PQKTIFES+DEAG+SFGIYYQYPPSTL
Sbjct  117   AVPASTQPNRLFVHSATSHGLTSNDTKILVEGLPQKTIFESLDEAGHSFGIYYQYPPSTL  176

Query  676   FYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEG  855
             FYRNLRKLKYIKNFH FD+ FK HCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEG
Sbjct  177   FYRNLRKLKYIKNFHPFDLTFKRHCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEG  236

Query  856   QKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFD  1035
             QKFVKEVYEALRSSPQWNEMLF+IIYDEHGGF+DHVPTPVTGVP+PD ++GP+PY FQFD
Sbjct  237   QKFVKEVYEALRSSPQWNEMLFIIIYDEHGGFFDHVPTPVTGVPSPDDIVGPEPYKFQFD  296

Query  1036  RLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAG  1215
             RLGVRVP+IMVSPWIE+G VLHGPSGP+P SE+EHSSIPATVKKIFNL +FLT+RDAWAG
Sbjct  297   RLGVRVPSIMVSPWIEKGTVLHGPSGPYPTSEFEHSSIPATVKKIFNLKEFLTKRDAWAG  356

Query  1216  TFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYY  1395
             TFE+VI+R TPR DCP TL EPV+LR  EAKEDA LT++QKE+VQM+AVL GDH+K D Y
Sbjct  357   TFESVISRETPRTDCPVTLPEPVRLRETEAKEDAKLTDFQKELVQMSAVLGGDHIK-DTY  415

Query  1396  PHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRKPK  1575
             PHKLVE+M+VA AADY H +F KFL +CE  R+ G   + ++ +L   PP       K  
Sbjct  416   PHKLVEDMTVATAADYVHNSFKKFLDECERLRENGA-DESTICSLPADPPEKQA---KSP  471

Query  1576  SFATKFLSCIACGRN  1620
             SF +KF SCIAC  +
Sbjct  472   SFVSKFFSCIACNNS  486



>gb|EYU40281.1| hypothetical protein MIMGU_mgv1a004655mg [Erythranthe guttata]
Length=516

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/533 (71%), Positives = 443/533 (83%), Gaps = 21/533 (4%)
 Frame = +1

Query  34    MGPSSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQ  213
             M  +S  S+ S  PIKT+VVLVQENRSFDHMLGWMK+LNPEINGV G ESNPL T+    
Sbjct  1     MAAASLASNTS--PIKTIVVLVQENRSFDHMLGWMKTLNPEINGVTGSESNPLSTATPDS  58

Query  214   NSTNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSA--GKKLEPT-MQGFAANAE  384
             N     + FG+ S YVDPDPGHSIQ+IYEQIFG  W+Q+SA  G+K EPT MQGFA +AE
Sbjct  59    NR----IFFGDGSVYVDPDPGHSIQEIYEQIFGVEWTQESAAAGEKKEPTTMQGFAQDAE  114

Query  385   RNQAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATS  564
             R  +GMS AVMNGF PE+VPVYKELV EFAVCDRWFA+VPASTQPNRLFVHSATSHGATS
Sbjct  115   RKASGMSTAVMNGFKPESVPVYKELVSEFAVCDRWFAAVPASTQPNRLFVHSATSHGATS  174

Query  565   NDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKY-IKNFHQFDIHFK  741
             N+ + L++G+PQKTIF+S+DE+G +FGIYYQYPP+TLFY+NLR+LKY I NFH FD+ FK
Sbjct  175   NNRELLLKGYPQKTIFDSLDESGRTFGIYYQYPPATLFYKNLRQLKYLINNFHPFDLDFK  234

Query  742   THCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLF  921
              HCKEGKLPNYVV+EQRYFDLKILPGNDDHPSHDV++GQKFVKEVYEALRSSPQWNEMLF
Sbjct  235   KHCKEGKLPNYVVIEQRYFDLKILPGNDDHPSHDVYQGQKFVKEVYEALRSSPQWNEMLF  294

Query  922   LIIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLH  1101
             +IIYDEHGGF+DHVPTPVTGVP+PDG+IGP+PYNFQFDRLGVRVPAIM+SPWIE+G VLH
Sbjct  295   IIIYDEHGGFFDHVPTPVTGVPSPDGIIGPEPYNFQFDRLGVRVPAIMISPWIEKGTVLH  354

Query  1102  GPSGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEP  1281
             GPSGP+P SE+EHSSI ATVKKIFNL +FLT+RDAWAG+FETVI+R +PR DCPETL EP
Sbjct  355   GPSGPYPTSEFEHSSIAATVKKIFNLKEFLTKRDAWAGSFETVISRNSPRTDCPETLPEP  414

Query  1282  VKLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFN  1461
             VK+R  EAKEDA L+E+Q+E+V M+AVLCGDH ++D +P KLV  M V+  ADY++ AF 
Sbjct  415   VKMRETEAKEDARLSEFQEELVHMSAVLCGDH-RDDTFPRKLVGKMKVSDGADYANKAFE  473

Query  1462  KFLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
             +FL +C  + + G  G    +     PP+      K +SFA+K  SCI CG +
Sbjct  474   RFLDECRKSMRNGADGTTICI-----PPA-----EKYRSFASKLCSCIVCGHH  516



>ref|XP_010041093.1| PREDICTED: non-specific phospholipase C3-like [Eucalyptus grandis]
 gb|KCW44651.1| hypothetical protein EUGRSUZ_L01820 [Eucalyptus grandis]
Length=514

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/516 (72%), Positives = 419/516 (81%), Gaps = 11/516 (2%)
 Frame = +1

Query  64    SIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFG  243
             S +P+KTVVVLVQENRSFDHMLGWMKSLNPEI+GV GKESNPL T+  +  S    V F 
Sbjct  8     SSYPVKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGKESNPLSTTDRSAGS----VSFS  63

Query  244   NKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNG  423
             + + YVDPDPGHSIQ IYEQ+FG PWS++SA KKL P M GFA NAER + GM+  VM+G
Sbjct  64    DGAAYVDPDPGHSIQAIYEQVFGEPWSEESASKKLPPKMDGFAQNAERTEKGMAQTVMSG  123

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F P++VPVYKELV EFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEG+PQK
Sbjct  124   FTPDSVPVYKELVSEFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGYPQK  183

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIFESMDEAG++FGIYYQYPP+TLFYRNLRKLKY+KNFHQFD+HFKTHC+EGKLPNYVVV
Sbjct  184   TIFESMDEAGFTFGIYYQYPPATLFYRNLRKLKYLKNFHQFDLHFKTHCREGKLPNYVVV  243

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRYFDL ILPGNDDHPSHDV +GQKFVKEVYEALRSSPQWNEMLF+I YDEHGGFYDHV
Sbjct  244   EQRYFDLSILPGNDDHPSHDVSQGQKFVKEVYEALRSSPQWNEMLFVITYDEHGGFYDHV  303

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTPV GVP+PDG++GP PY FQFDRLGVRVPAI +SPWI+RG VLH P GP   S+YEHS
Sbjct  304   PTPVHGVPSPDGIVGPDPYKFQFDRLGVRVPAIFISPWIDRGTVLHKPKGPRHTSQYEHS  363

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             SI ATVKKIFNL  FLT+RD WAGTFE V+ R++PR DCP TL++  KLR A AKEDA L
Sbjct  364   SIAATVKKIFNLRHFLTKRDEWAGTFEVVLNRSSPRTDCPVTLSDAAKLREAGAKEDAKL  423

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
              ++Q+ +VQMAA L GDH K+D YP KLVENM+V +AA Y   A   F   C  A   G 
Sbjct  424   NDFQEILVQMAATLNGDH-KKDIYPDKLVENMTVGEAAKYVKDAHEAFCDHCHKAIDSGA  482

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
               D  VV  ++      +T   PK+FA K  SCI C
Sbjct  483   DEDEIVVLATR------STRGTPKNFAQKLFSCIIC  512



>ref|XP_009361403.1| PREDICTED: non-specific phospholipase C3-like [Pyrus x bretschneideri]
Length=521

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/513 (71%), Positives = 424/513 (83%), Gaps = 11/513 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGWMKSLNPEINGV G ESNP+ TS    NST   V F + S
Sbjct  18    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVTGSESNPISTSDA--NSTQ--VFFRDNS  73

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDPGHSIQ IYEQ+FG PW++ S  K L P M GFA NAE+ Q G++  VM+GF P
Sbjct  74    AYVDPDPGHSIQAIYEQVFGEPWTEASTSKTLPPKMNGFAQNAEKTQTGLAETVMSGFKP  133

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E V VY+ELV+EFAVCDRWFASVPASTQPNR +VHSATSHG TSNDTKKLIEG PQKTIF
Sbjct  134   ENVAVYRELVKEFAVCDRWFASVPASTQPNRQYVHSATSHGLTSNDTKKLIEGMPQKTIF  193

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             ES+DE G+SFGIYYQYPP+TL YRNLRKLKY+KNFHQFD+ FK HCKEGKLPNYVVVEQR
Sbjct  194   ESLDEEGFSFGIYYQYPPATLLYRNLRKLKYVKNFHQFDLTFKKHCKEGKLPNYVVVEQR  253

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             +FDL  +PGNDDHPSHDV EGQKF+KEVYEALR+SPQW EMLF+IIYDEHGGFYDHVPTP
Sbjct  254   FFDLLSIPGNDDHPSHDVSEGQKFIKEVYEALRASPQWPEMLFVIIYDEHGGFYDHVPTP  313

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             VT VP+PD ++GP+PYNF+FDRLGVRVPAI++SPWIERG VLH PSGP+P+S++EHSSI 
Sbjct  314   VTDVPSPDDIVGPEPYNFKFDRLGVRVPAILISPWIERGTVLHAPSGPYPSSQFEHSSIS  373

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEY  1332
             ATVKKIFNL +FLT+RDAWAGTF+ V+ RT+PR DCP TL +P+KLR A +K+ A ++++
Sbjct  374   ATVKKIFNLKEFLTKRDAWAGTFDVVLNRTSPRTDCPATLPDPMKLREAVSKDGAKVSDF  433

Query  1333  QKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGD  1512
             Q+E+VQ+AA L GDH K D YPHKLVENM+V++A  Y   AFNKFL +CE AR+ G   D
Sbjct  434   QEELVQLAAALNGDHRK-DIYPHKLVENMTVSEAVKYCEEAFNKFLHECEKARESGT--D  490

Query  1513  YSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              S + +    P+P +T    KSFA K  SC+ C
Sbjct  491   ESEIVVCATSPTPPST----KSFAQKIFSCLVC  519



>ref|XP_006484721.1| PREDICTED: non-specific phospholipase C4-like [Citrus sinensis]
Length=530

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/526 (70%), Positives = 426/526 (81%), Gaps = 22/526 (4%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT+VVLVQENRSFDHM+GWMKSLNPE++GV G ESNP+ TS    +  + ++ FG+K
Sbjct  13    YPIKTIVVLVQENRSFDHMIGWMKSLNPELDGVTGSESNPISTS----DPNSPLIYFGDK  68

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKK-----------LEPTMQGFAANAERNQA  396
             S YVDPDPGHSIQ I+EQ+FG  W+Q ++              L P MQGFA NAE  Q 
Sbjct  69    SVYVDPDPGHSIQAIFEQVFGLTWAQYTSLSSSSSSNNEELHVLRPNMQGFAQNAESTQK  128

Query  397   GMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTK  576
             GM+ +VMNGF P+ VPVY+ELV EF VCDRWFASVPASTQPNRL+VHSATSHGATSNDT+
Sbjct  129   GMAASVMNGFKPDMVPVYRELVAEFGVCDRWFASVPASTQPNRLYVHSATSHGATSNDTE  188

Query  577   KLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKE  756
             KLIEGFPQKTIFES+DE+G SFGIYYQYPP+TLFYRNLRKLKY+K+FHQFD+HFK  C+E
Sbjct  189   KLIEGFPQKTIFESLDESGLSFGIYYQYPPATLFYRNLRKLKYLKHFHQFDLHFKKDCEE  248

Query  757   GKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYD  936
             GKLPNYVVVEQRYFDL  +P NDDHPSHDV EGQKFVKEVYEALRSSPQWNE+LF+I YD
Sbjct  249   GKLPNYVVVEQRYFDLLSVPANDDHPSHDVSEGQKFVKEVYEALRSSPQWNEILFIITYD  308

Query  937   EHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGP  1116
             EHGGFYDHVPTPVTGVP+PD ++GP+PYNF+FDRLGVRVP I +SPWI+RG +LHGPSGP
Sbjct  309   EHGGFYDHVPTPVTGVPSPDDIVGPEPYNFKFDRLGVRVPTIFISPWIQRGTLLHGPSGP  368

Query  1117  FPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEP-VKLR  1293
              P SE+EHSSIPATVKKIFNL +FLT+RDAWAGTFETV+ RT+PR DCP TL EP +KLR
Sbjct  369   SPTSEFEHSSIPATVKKIFNLKEFLTKRDAWAGTFETVLNRTSPRTDCPVTLPEPTLKLR  428

Query  1294  SAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLG  1473
               EA EDA LT++Q+E+VQMAA L GD+ K+D YPHKLVE M+VA+ A Y   AF KF G
Sbjct  429   DGEANEDAKLTDFQQELVQMAATLNGDY-KKDIYPHKLVEEMTVAEGAKYVEDAFKKFRG  487

Query  1474  DCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              CE A   G+     VV      P+P T  RK KSF  K LSC+AC
Sbjct  488   QCEKAEAEGVDESQIVVV-----PTPTTKQRKSKSFGRKLLSCLAC  528



>ref|XP_008375638.1| PREDICTED: non-specific phospholipase C3-like [Malus domestica]
Length=521

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/512 (71%), Positives = 423/512 (83%), Gaps = 11/512 (2%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVV LVQENRSFDHMLGWMKSLNPEINGV G ESNP+ TS    NST   V F + S 
Sbjct  19    IKTVVXLVQENRSFDHMLGWMKSLNPEINGVTGSESNPISTSDA--NSTQ--VFFRDNSA  74

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVPE  435
             YVDPDPGHSIQ IYEQ+FG PW++ SA K L P M GFA NAE+ Q G++  VM+GF PE
Sbjct  75    YVDPDPGHSIQAIYEQVFGEPWTEASASKTLPPKMNGFAQNAEKTQTGLAETVMSGFKPE  134

Query  436   AVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIFE  615
              V VY+ELV+EFAVCDRWFAS+PASTQPNR +VHSATSHG TSNDT+KLIEG PQKTIFE
Sbjct  135   NVAVYRELVKEFAVCDRWFASIPASTQPNRQYVHSATSHGLTSNDTQKLIEGMPQKTIFE  194

Query  616   SMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQRY  795
             S+DE G+SFGIYYQYPP+TL YRNLRKLKYIKNFHQFD+ FK HC+EGKLPNYVVVEQR+
Sbjct  195   SLDEEGFSFGIYYQYPPATLLYRNLRKLKYIKNFHQFDLTFKKHCEEGKLPNYVVVEQRF  254

Query  796   FDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTPV  975
             FDL  +PGNDDHPSHDV EGQKF+KEVYEALR+SPQW EMLF+IIYDEHGGFYDHVPTPV
Sbjct  255   FDLLSIPGNDDHPSHDVXEGQKFIKEVYEALRASPQWPEMLFVIIYDEHGGFYDHVPTPV  314

Query  976   TGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIPA  1155
             T VP+PD ++GP+PYNF+FDRLGVRVPAI++SPWIERG VLH PSGP+P+S++EHSSI A
Sbjct  315   TDVPSPDDIVGPEPYNFKFDRLGVRVPAILISPWIERGTVLHAPSGPYPSSQFEHSSISA  374

Query  1156  TVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEYQ  1335
             TVKKIFNL +FLT+RDAWAGTF+ V+ RT+PR DCP TL +P+KLR A +K+ A ++++Q
Sbjct  375   TVKKIFNLKEFLTKRDAWAGTFDVVLNRTSPRTDCPATLPDPMKLREAVSKDGAKISDFQ  434

Query  1336  KEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGDY  1515
             +E+VQ+AA L GDH K D YPHKLVENM+V++A  Y   AFNKFL +CE AR+ G   D 
Sbjct  435   EELVQLAAALNGDHRK-DIYPHKLVENMTVSEAVKYCEEAFNKFLHECEKARESGT--DE  491

Query  1516  SVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             S + +    P+P +T    KSFA K  SC+ C
Sbjct  492   SEIVVCATSPTPPST----KSFAQKIFSCLVC  519



>ref|XP_006437377.1| hypothetical protein CICLE_v10031213mg [Citrus clementina]
 gb|ESR50617.1| hypothetical protein CICLE_v10031213mg [Citrus clementina]
Length=530

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/526 (70%), Positives = 425/526 (81%), Gaps = 22/526 (4%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT+VVLVQENRSFDHM+GWMKSLNPE++GV G ESNP+ TS    +  + ++ FG+K
Sbjct  13    YPIKTIVVLVQENRSFDHMIGWMKSLNPELDGVTGSESNPISTS----DPNSPLIYFGDK  68

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKK-----------LEPTMQGFAANAERNQA  396
             S YVDPDPGHSIQ I+EQ+FG  W+Q ++              L P MQGFA NAE  Q 
Sbjct  69    SVYVDPDPGHSIQAIFEQVFGLTWAQYTSLSSSSSSNNEELHVLRPNMQGFAQNAESTQK  128

Query  397   GMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTK  576
             GM+ +VMNGF P+ VPVYKELV EF VCDRWFASVPASTQPNRL+VHSATSHGATSNDT+
Sbjct  129   GMAASVMNGFKPDMVPVYKELVAEFGVCDRWFASVPASTQPNRLYVHSATSHGATSNDTE  188

Query  577   KLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKE  756
             KLIEGFPQKTIFES+DE+G SFGIYYQYPP+TLFYRNLRKLKY+K+FHQFD+HFK  C+E
Sbjct  189   KLIEGFPQKTIFESLDESGLSFGIYYQYPPATLFYRNLRKLKYLKHFHQFDLHFKKDCEE  248

Query  757   GKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYD  936
             GKLPNYVVVEQRYFDL  +P NDDHPSHDV EGQKFVKEVYEALRSSPQWNE+LF+I YD
Sbjct  249   GKLPNYVVVEQRYFDLLSVPANDDHPSHDVSEGQKFVKEVYEALRSSPQWNEILFIITYD  308

Query  937   EHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGP  1116
             EHGGFYDHV TPVTGVP+PD ++GP+PYNF+FDRLGVRV  I +SPWI+RG +LHGPSGP
Sbjct  309   EHGGFYDHVQTPVTGVPSPDDIVGPEPYNFKFDRLGVRVLTIFISPWIQRGTLLHGPSGP  368

Query  1117  FPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEP-VKLR  1293
              P SE+EHSSIPATVKKIFNL +FLT+RDAWAGTFE+V+ RT+PR DCP TL EP +KLR
Sbjct  369   APTSEFEHSSIPATVKKIFNLKEFLTKRDAWAGTFESVLNRTSPRTDCPVTLPEPTLKLR  428

Query  1294  SAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLG  1473
               EAKEDA LT++Q+E+VQMAA L GD+ K+D YPHKLVE M+VA+ A Y   AF KF G
Sbjct  429   DGEAKEDAKLTDFQQELVQMAATLNGDY-KKDIYPHKLVEEMTVAEGAKYVEDAFKKFRG  487

Query  1474  DCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              CE A   G+     VV      P+P T  RK KSF  K LSC+AC
Sbjct  488   QCEKAEAEGVDESQIVVV-----PTPTTKQRKSKSFGRKLLSCLAC  528



>ref|XP_003633883.1| PREDICTED: non-specific phospholipase C4-like isoform X2 [Vitis 
vinifera]
Length=509

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/517 (70%), Positives = 426/517 (82%), Gaps = 11/517 (2%)
 Frame = +1

Query  61    GSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLF  240
              S +PIK VVVLVQENRSFDHMLGWMKSLNPEINGV G ESNP+ TS   QNS    V F
Sbjct  2     ASPYPIKNVVVLVQENRSFDHMLGWMKSLNPEINGVTGAESNPISTSD--QNSVR--VQF  57

Query  241   GNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMN  420
             G+ + YV+PDPGHS Q IYEQIFG PWS D+    L PTM+GF   AER + G+S  VMN
Sbjct  58    GDGAVYVEPDPGHSFQAIYEQIFGQPWSADNG--VLAPTMEGFVQEAERQKKGLSETVMN  115

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
             G+ PEA+ VY+ELV EF VCDRWFAS+PASTQPNRL+VHSATSHGAT NDT+KLI+G+PQ
Sbjct  116   GYKPEALAVYRELVGEFGVCDRWFASLPASTQPNRLYVHSATSHGATGNDTEKLIKGYPQ  175

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
             KTIFES++E+G+SFGIYYQ PP+TLFYRNLRKLKYI NFHQFD+ FK HC+EGKLPNYVV
Sbjct  176   KTIFESLEESGFSFGIYYQDPPATLFYRNLRKLKYIDNFHQFDLDFKRHCEEGKLPNYVV  235

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             +EQRYFD K+LP NDDHPSHDV +GQKFVK VYEALR+SPQWN++LF+IIYDEHGGFYDH
Sbjct  236   IEQRYFDTKLLPANDDHPSHDVSQGQKFVKHVYEALRASPQWNDILFVIIYDEHGGFYDH  295

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEH  1140
             VPTPVTGVP+PD ++GP+PYNF+FDRLGVRVPAI++SPWIERG VLHGPSGP+P SE+EH
Sbjct  296   VPTPVTGVPSPDDIVGPEPYNFRFDRLGVRVPAILISPWIERGTVLHGPSGPYPTSEFEH  355

Query  1141  SSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SSIPATVKK+FNL +FLT+RDAWAGTFE V+TR TPR DCP TL EPVKLR  EAK++A 
Sbjct  356   SSIPATVKKLFNLKEFLTKRDAWAGTFEGVLTRETPRTDCPVTLPEPVKLRETEAKDEAE  415

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q+E+VQMAA L GDH K D YPHKLV++M+V+ A  Y + AFN+FL +C+ A+  G
Sbjct  416   LSEFQQELVQMAAALKGDHRK-DIYPHKLVQDMNVSDATKYVNNAFNQFLDECQKAKTSG  474

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              H    +V   + PP   ++    KSFA K  SC+ C
Sbjct  475   THDSSDIVLCPQTPPKRTSS----KSFAHKLFSCLIC  507



>gb|KDP39583.1| hypothetical protein JCGZ_02603 [Jatropha curcas]
Length=523

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/525 (68%), Positives = 422/525 (80%), Gaps = 11/525 (2%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNST  222
             S+  +  + +PIKTVVVLVQENRSFDHMLGW+KSLNPEINGV G ESNP+ TS    +  
Sbjct  6     STSAATATQYPIKTVVVLVQENRSFDHMLGWLKSLNPEINGVTGSESNPISTS----DLN  61

Query  223   NDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQD--SAGKKLEPTMQGFAANAERNQA  396
             + ++ +G+ + YV+PDP HSIQ IYEQ+FG  W++   S+   L+P M GFA +AER Q 
Sbjct  62    SSIIFYGDNASYVEPDPPHSIQAIYEQVFGVEWTEAALSSENALQPQMNGFAQSAERTQK  121

Query  397   GMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTK  576
             GM+  VMNGF PE++PVYKEL   FA+CDRWFAS+P STQPNRL+VHSATSHGATSNDTK
Sbjct  122   GMAETVMNGFKPESIPVYKELAMNFAICDRWFASIPTSTQPNRLYVHSATSHGATSNDTK  181

Query  577   KLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKE  756
              L EG+PQKTIFESMDEAG SFGIYYQYPPSTLFYRNLRKLKY+KNFHQFD+HFK HC+E
Sbjct  182   LLAEGYPQKTIFESMDEAGLSFGIYYQYPPSTLFYRNLRKLKYLKNFHQFDLHFKKHCEE  241

Query  757   GKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYD  936
             GKLPNYVV+EQRYFDL  +P NDDHPSHDV EGQKFVKEVYE LR+SPQWNEMLF+IIYD
Sbjct  242   GKLPNYVVIEQRYFDLLSIPANDDHPSHDVSEGQKFVKEVYETLRASPQWNEMLFIIIYD  301

Query  937   EHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGP  1116
             EHGGFYDHVPTP TG+P+PD ++GP PY F+FDRLGVRVPA ++SPWIE G VLHGPSGP
Sbjct  302   EHGGFYDHVPTPATGIPSPDDIVGPAPYFFKFDRLGVRVPAFLISPWIEPGTVLHGPSGP  361

Query  1117  FPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRS  1296
             +P SEYEHSSI ATVKK+FNLN FLT+RDAWAGTF+ V+TRTTPR DCP TL EPVKLR 
Sbjct  362   YPTSEYEHSSIAATVKKLFNLNDFLTKRDAWAGTFDVVLTRTTPRTDCPVTLPEPVKLRE  421

Query  1297  AEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGD  1476
               A+ED NL+E+Q+E+VQMAAVL GDH K+D YPHK+ E M+V+ AA Y   AF KF+ +
Sbjct  422   GVAREDGNLSEFQQELVQMAAVLNGDH-KKDIYPHKIAEGMTVSVAAKYMESAFKKFIEE  480

Query  1477  CENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              E AR+ G+     +V  +  P    T  + P+SF  K  SC+ C
Sbjct  481   GEKARENGVDESEVIVIENFVP----TNHKSPRSFIQKLFSCLVC  521



>ref|XP_010052602.1| PREDICTED: non-specific phospholipase C3-like [Eucalyptus grandis]
Length=520

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/522 (71%), Positives = 416/522 (80%), Gaps = 17/522 (3%)
 Frame = +1

Query  64    SIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFG  243
             S +PIKTVVVLVQENRSFDHMLGWMKSLNPEI+GV GKESNPL T+  +  S    V F 
Sbjct  8     SSYPIKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGKESNPLSTTDPSAGS----VSFS  63

Query  244   NKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNG  423
             + + YVDPDPGHSIQ IYEQ+FG PWS++SA KKL P M GFA NAER + GM+  VM+G
Sbjct  64    DGAAYVDPDPGHSIQAIYEQVFGEPWSEESASKKLPPKMDGFAQNAERTEKGMAQTVMSG  123

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F P++VPVYKELV EFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK
Sbjct  124   FTPDSVPVYKELVSEFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  183

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIFESMDEAG++FGIYYQYPP+TLFYRNLRKLKY+KNFHQFD+HFKTHC+EGKLPNYVVV
Sbjct  184   TIFESMDEAGFTFGIYYQYPPATLFYRNLRKLKYLKNFHQFDLHFKTHCREGKLPNYVVV  243

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRY DL ILPGNDDHPSHDV +GQKFVKEVYEALRSSPQWNEMLFLI YDEHGGFYDHV
Sbjct  244   EQRYLDLSILPGNDDHPSHDVSQGQKFVKEVYEALRSSPQWNEMLFLITYDEHGGFYDHV  303

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPS------GPFPN  1125
             PTPV GVP+PDG++GP PY FQFDRLGVRVPAI +SPWI+RG  LH  S      G    
Sbjct  304   PTPVHGVPSPDGIVGPDPYKFQFDRLGVRVPAIFISPWIDRGTGLHELSIVDFSEGTHHT  363

Query  1126  SEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEA  1305
             S+YEHSSI ATVKKIFNL  FLT+RD WAGTFE V+ R++PR DCP TL++  KLR A A
Sbjct  364   SQYEHSSIAATVKKIFNLRHFLTKRDEWAGTFEVVLNRSSPRTDCPVTLSDAAKLREAGA  423

Query  1306  KEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCEN  1485
             KEDA L ++Q+ +VQMAA L GDH K+D YP KLVENM+V +AA Y   A   F   C  
Sbjct  424   KEDAKLNDFQEILVQMAATLNGDH-KKDIYPDKLVENMTVGEAAKYVKDAHEAFCDHCHK  482

Query  1486  ARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             A   G   D  VV  ++      +T   PK+FA K  SCI C
Sbjct  483   AIDSGADEDEIVVLATR------STRGTPKNFAQKLFSCIIC  518



>ref|XP_004307156.1| PREDICTED: phospholipase C 3-like [Fragaria vesca subsp. vesca]
Length=518

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/513 (70%), Positives = 415/513 (81%), Gaps = 11/513 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGWMKSLNPEI+GV G ESN L TS    +  +  V F + S
Sbjct  15    PIKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGAESNLLSTS----DPNSKRVFFADNS  70

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDPGHSIQD+YEQ+FG PWS+ SA K L PTM+GFA NAER QAG++  VMNGF P
Sbjct  71    AYVDPDPGHSIQDVYEQVFGEPWSEASASKNLTPTMEGFAQNAERKQAGLAETVMNGFKP  130

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E + VY+ELV EFAVCDRWFASVPASTQPNR +VHSATSHG + NDTK LIEG PQKTIF
Sbjct  131   ENIAVYRELVSEFAVCDRWFASVPASTQPNRQYVHSATSHGLSGNDTKLLIEGLPQKTIF  190

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             ESM+EAGYSFGIYYQ PP+TL YRNLRKLKYI NFHQFD+HFK HC+EGKLPNY VVEQR
Sbjct  191   ESMEEAGYSFGIYYQTPPATLLYRNLRKLKYIDNFHQFDLHFKKHCEEGKLPNYTVVEQR  250

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             +FD+   P NDDHPSHDV EGQKFVK+VYEALRSSPQWNEMLF+I+YDEHGGFYDHVPTP
Sbjct  251   FFDILSFPANDDHPSHDVSEGQKFVKKVYEALRSSPQWNEMLFIIVYDEHGGFYDHVPTP  310

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V  VP+PD + GP PYNF+FDRLGVRVPA ++SPWIERG VLHGPSGP+P+SE+EHSSI 
Sbjct  311   VKDVPSPDDIAGPAPYNFKFDRLGVRVPAFLISPWIERGTVLHGPSGPYPSSEFEHSSIA  370

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEY  1332
             ATVKKIFNL +FLT+RDAWAGTF+ ++TRTTPR DCP T+ EPVKLR A +K+DA ++++
Sbjct  371   ATVKKIFNLKEFLTKRDAWAGTFDVILTRTTPRTDCPVTMPEPVKLREAGSKDDAKISDF  430

Query  1333  QKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGD  1512
             Q+E+VQ+AA L GD+ K+D YPHKLVENM+ ++A  Y   AF KF  +CE AR+ G    
Sbjct  431   QEELVQLAAALNGDY-KKDTYPHKLVENMTCSEAHKYVEEAFKKFQDECEKARKNGTDES  489

Query  1513  YSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
               +V  +  P       +  KSFA K  SC+ C
Sbjct  490   KIIVCENSLP------LQSQKSFAHKIFSCLVC  516



>ref|XP_007219020.1| hypothetical protein PRUPE_ppa004364mg [Prunus persica]
 gb|EMJ20219.1| hypothetical protein PRUPE_ppa004364mg [Prunus persica]
Length=514

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/513 (69%), Positives = 420/513 (82%), Gaps = 11/513 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGWMKSLNPEINGV G ESNP+ TS    +  + +V FG+ S
Sbjct  11    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVTGSESNPISTS----DPNSALVFFGDNS  66

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDPGHSIQ +YEQ+FG PW++ SA K L PTM+GFA NAE+ Q G++  VMNGF P
Sbjct  67    AYVDPDPGHSIQAVYEQVFGEPWTEASATKTLAPTMKGFAQNAEKTQTGLAETVMNGFRP  126

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E V V++ELV+EFAVCD+WFASVPA+TQPNR ++HSATSHG T NDTK L+EG PQKTIF
Sbjct  127   ENVAVHRELVKEFAVCDQWFASVPAATQPNRQYIHSATSHGLTGNDTKTLVEGLPQKTIF  186

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE  +SFGIY+Q  PSTL YRNLRKLKYIKNFHQFD+ FK HC+EGKLPNYVVVEQR
Sbjct  187   QSLDEEDFSFGIYFQTFPSTLLYRNLRKLKYIKNFHQFDLQFKKHCEEGKLPNYVVVEQR  246

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             +FD+   P NDDHPSHDV EGQKF+KEVYEALR+SPQWNEMLF+IIYDEHGGFYDHVPTP
Sbjct  247   FFDVLSFPANDDHPSHDVSEGQKFIKEVYEALRASPQWNEMLFVIIYDEHGGFYDHVPTP  306

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             VT VP+PD + GP+PYNF+FDRLGVRVPAI++SPWIERG VLHGPSGP+P+SE+EHSSIP
Sbjct  307   VTDVPSPDDIAGPEPYNFKFDRLGVRVPAILISPWIERGTVLHGPSGPYPSSEFEHSSIP  366

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEY  1332
             ATVKKIFNL +FLT+RDAWAGTFE V++R+TPR DCP TL EPVKLR   +K+ A ++++
Sbjct  367   ATVKKIFNLKEFLTKRDAWAGTFEGVLSRSTPRTDCPVTLPEPVKLRETTSKDGAKMSDF  426

Query  1333  QKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGD  1512
             Q+E+VQ+AA + GDH K D YP+KLVE MSV+KA  Y   +F KF  +CE AR+ G   +
Sbjct  427   QEEVVQLAAAINGDHRK-DIYPNKLVEKMSVSKAVSYVEASFKKFSDECEKARESGA-DE  484

Query  1513  YSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             Y +V  +    SP+     PKSFA K  SC+ C
Sbjct  485   YEIVVCATSLGSPS-----PKSFAKKMFSCLVC  512



>ref|XP_002265749.2| PREDICTED: non-specific phospholipase C3-like isoform X1 [Vitis 
vinifera]
Length=513

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/515 (69%), Positives = 419/515 (81%), Gaps = 11/515 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGWMKSLNPEI+GV G ESNP+ TS    +  + VV F + +
Sbjct  6     PIKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGAESNPISTS----DPNSPVVHFTDDA  61

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKK--LEPTMQGFAANAERNQAGMSGAVMNGF  426
              YVDPDPGHS + IYEQ+FG PW  DSA     L PTM GFA  AE  + G+S  VM G 
Sbjct  62    GYVDPDPGHSFEAIYEQVFGRPWPADSAASSEPLRPTMDGFAQQAEAKEKGLSKTVMKGL  121

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PEA+PV+ ELV EF VCDRWFAS+PA TQPNRL+VHSATS+GAT N+T+ L +G+PQKT
Sbjct  122   KPEALPVFSELVAEFGVCDRWFASLPAETQPNRLYVHSATSYGATGNNTEMLAKGYPQKT  181

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES++E+G+SFGIYYQYPPSTLFYRNLRKLKYI NFHQFD+ FK HC+EGKLPNYVV+E
Sbjct  182   IFESLEESGFSFGIYYQYPPSTLFYRNLRKLKYIDNFHQFDLDFKRHCEEGKLPNYVVIE  241

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD K+LP NDDHPSHDV +GQKFVK VYEALR+SPQWN++LF+IIYDEHGGFYDHVP
Sbjct  242   QRYFDTKLLPANDDHPSHDVSQGQKFVKHVYEALRASPQWNDILFVIIYDEHGGFYDHVP  301

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPVTGVP+PD ++GP+PYNF+FDRLGVRVPAI++SPWIERG VLHGPSGP+P SE+EHSS
Sbjct  302   TPVTGVPSPDDIVGPEPYNFRFDRLGVRVPAILISPWIERGTVLHGPSGPYPTSEFEHSS  361

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKK+FNL +FLT+RDAWAGTFE V+TR TPR DCP TL EPVKLR  EAK++A L+
Sbjct  362   IPATVKKLFNLKEFLTKRDAWAGTFEGVLTRETPRTDCPVTLPEPVKLRETEAKDEAELS  421

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+E+VQMAA L GDH K D YPHKLV++M+V+ A  Y + AFN+FL +C+ A+  G H
Sbjct  422   EFQQELVQMAAALKGDHRK-DIYPHKLVQDMNVSDATKYVNNAFNQFLDECQKAKTSGTH  480

Query  1507  GDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
                 +V   + PP   ++    KSFA K  SC+ C
Sbjct  481   DSSDIVLCPQTPPKRTSS----KSFAHKLFSCLIC  511



>ref|XP_011009223.1| PREDICTED: non-specific phospholipase C4-like [Populus euphratica]
Length=523

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/517 (68%), Positives = 419/517 (81%), Gaps = 12/517 (2%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLVQENRSFDHMLGW+K+LNPEING  G ESNP+ +S    +S + +V FG+++ 
Sbjct  17    IKTVVVLVQENRSFDHMLGWLKTLNPEINGATGSESNPISSS----DSNSTLVFFGDQAA  72

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAG--KKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             YVDPDPGHSIQDIYEQ+FG  W++ S     K  P M GFA NAER Q GM+  VMNGF 
Sbjct  73    YVDPDPGHSIQDIYEQVFGVQWTEASLSDDNKPPPKMNGFAQNAERLQKGMAQTVMNGFK  132

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P+AVPVYKEL   FA+CDRWFASVPASTQPNRL+VHSATSHGATSN+ + LIEG+PQKTI
Sbjct  133   PDAVPVYKELAENFAICDRWFASVPASTQPNRLYVHSATSHGATSNNRQLLIEGYPQKTI  192

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES+DE+G++FGIYYQYPP+TLFYRNLRKLKY+  FHQFD+HFK HC+EGKLPNYVV+EQ
Sbjct  193   FESLDESGFTFGIYYQYPPATLFYRNLRKLKYLTKFHQFDLHFKKHCEEGKLPNYVVIEQ  252

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDL  +P NDDHPSHDV EGQKFVK+VYEALR+SPQWNE+LF+IIYDEHGGFYDHVPT
Sbjct  253   RYFDLLAIPANDDHPSHDVSEGQKFVKKVYEALRASPQWNEILFIIIYDEHGGFYDHVPT  312

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PVTGVP+PD ++GP PYNF+FDRLGVRVPA ++SPWI  G VLH PSGP+P SE+EHSSI
Sbjct  313   PVTGVPSPDDIVGPAPYNFKFDRLGVRVPAFLISPWIAPGTVLHAPSGPYPTSEFEHSSI  372

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTE  1329
              ATVKKIFNL +FLT+RDAWAGTFE ++TRT+PR DCP TL EPVKLR   AKEDA L+E
Sbjct  373   AATVKKIFNLKEFLTKRDAWAGTFEGILTRTSPRVDCPVTLVEPVKLREGAAKEDAKLSE  432

Query  1330  YQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHG  1509
             +Q+E+V+MAAVL GD +K+D YP +LV+ ++V   A Y   AF +F  +C+ A++ G+  
Sbjct  433   FQEELVEMAAVLNGD-LKKDIYPQQLVDGLNVLDGAKYVEKAFKRFCDECDKAKKNGV-D  490

Query  1510  DYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
             D  ++ L K    P TT +  KSF  K  SC+ C  N
Sbjct  491   DSEIICLEK----PATTHKASKSFVHKLFSCLVCDNN  523



>ref|XP_007029811.1| Non-specific phospholipase C4 [Theobroma cacao]
 gb|EOY10313.1| Non-specific phospholipase C4 [Theobroma cacao]
Length=516

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/513 (69%), Positives = 413/513 (81%), Gaps = 12/513 (2%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT+V+L+QENRSFDHMLGW KSLNP+INGV G ESNP+ TS    +S +  + F + 
Sbjct  11    YPIKTIVILIQENRSFDHMLGWFKSLNPDINGVTGSESNPISTS----DSNSSRIFFKDN  66

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQD-SAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
             ++YVDPDPGHSIQ IYEQ++G PWS D       EPTM GFA NAER + GM+ AVM GF
Sbjct  67    AEYVDPDPGHSIQAIYEQVYGKPWSSDHDPNPPHEPTMNGFAQNAERTEKGMAEAVMKGF  126

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PEA+PVYKEL   FA+CDRWFASVPASTQPNR+FVHSATSHG+TSNDT KLI+GFPQKT
Sbjct  127   RPEAIPVYKELALNFAICDRWFASVPASTQPNRMFVHSATSHGSTSNDTMKLIQGFPQKT  186

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES++E+G SFGIYYQYPPSTLF+RNLRKLKY+KNFHQFD+HFK HC+EGKLPNYVVVE
Sbjct  187   IFESLEESGLSFGIYYQYPPSTLFFRNLRKLKYLKNFHQFDLHFKEHCEEGKLPNYVVVE  246

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFDL  +P NDDHPSHDV EGQKFVKEVYEALR+SPQWNEML +I YDEHGGFYDHVP
Sbjct  247   QRYFDLLSVPANDDHPSHDVSEGQKFVKEVYEALRASPQWNEMLLVIAYDEHGGFYDHVP  306

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP  GVP+PD +IGP+PY F+FDRLGVRVP   +SPWIE G V+HGPSGP+P SE+EHSS
Sbjct  307   TPTIGVPSPDDIIGPEPYYFKFDRLGVRVPTFFISPWIEPGTVIHGPSGPYPTSEFEHSS  366

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVK IFNL +FLT+RDAWAGTFE VI R  PR DCP TL EPVK+R A AKE A L+
Sbjct  367   IPATVKTIFNLKEFLTKRDAWAGTFECVINRENPRTDCPVTLTEPVKMRDAAAKETAKLS  426

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+E+VQMAAVL GDH K+  YPHKLVENM+VA+A  Y   AF KF  +C+ A++RGI 
Sbjct  427   EFQQELVQMAAVLSGDH-KKKIYPHKLVENMTVAEAVKYVDGAFKKFCHECQKAKERGI-  484

Query  1507  GDYSVVALSKQPPSPNTTPRKPKSFATKFLSCI  1605
              +  +V L + P   N+     KS   K  SC 
Sbjct  485   DESEIVDLGELPQRLNS-----KSVVRKMFSCF  512



>ref|XP_008232123.1| PREDICTED: non-specific phospholipase C3-like [Prunus mume]
Length=514

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/514 (68%), Positives = 416/514 (81%), Gaps = 13/514 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGWMKSLNPEINGV G ESNP+ TS    +  + +V  G+ S
Sbjct  11    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVTGSESNPISTS----DPNSALVFLGDNS  66

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDPGHSIQ +YEQ+FG PW++ SA K L PTM+GFA NAE+ Q G++  VMNGF P
Sbjct  67    AYVDPDPGHSIQAVYEQVFGEPWTEASATKTLAPTMKGFAQNAEKTQTGLAETVMNGFRP  126

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E V V++ELV+EFAVCD+WFASVPA+TQPNR ++HSATSHG T NDTK L+EG PQKTIF
Sbjct  127   ENVAVHRELVKEFAVCDQWFASVPAATQPNRQYIHSATSHGLTGNDTKTLVEGLPQKTIF  186

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE  +SFGIY+Q  PSTL YRNLRKLKYIKNFHQFD+ FK HC+EGKLPNYVVVEQR
Sbjct  187   QSLDEEDFSFGIYFQTFPSTLLYRNLRKLKYIKNFHQFDLQFKKHCEEGKLPNYVVVEQR  246

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             +FD+   P NDDHPSHDV EGQKF+KEVYEALR+SPQWNEMLF+IIYDEHGGFYDHVPTP
Sbjct  247   FFDVLSFPANDDHPSHDVSEGQKFIKEVYEALRASPQWNEMLFVIIYDEHGGFYDHVPTP  306

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
              T VP+PD + GP PYNF+FDRLGVRVPAI++SPWIERG VLHGPSGP+P+SE+EHSSIP
Sbjct  307   ATDVPSPDDIAGPGPYNFKFDRLGVRVPAILISPWIERGTVLHGPSGPYPSSEFEHSSIP  366

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEY  1332
             ATVKKIFNL +FLT+RDAWAGTFE V++R+TPR DCP TL EPVKLR   +K+ A ++++
Sbjct  367   ATVKKIFNLKEFLTKRDAWAGTFEGVLSRSTPRTDCPVTLPEPVKLRETTSKDGAKMSDF  426

Query  1333  QKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI-HG  1509
             Q+E+VQ+AA + GDH K D YP+KLVE MSV+KA +Y   +F KF  +CE AR+ G    
Sbjct  427   QEEIVQLAAAINGDHRK-DIYPNKLVEKMSVSKAVNYVEASFKKFSDECEKAREGGADES  485

Query  1510  DYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             +  V A S + PS       PK FA K  SC+ C
Sbjct  486   EIVVCATSLESPS-------PKWFAKKMFSCLVC  512



>ref|XP_010097705.1| Phospholipase C 3 [Morus notabilis]
 gb|EXB70660.1| Phospholipase C 3 [Morus notabilis]
Length=527

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/531 (67%), Positives = 422/531 (79%), Gaps = 8/531 (2%)
 Frame = +1

Query  25    IYAMGPSSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSG  204
             + A   +S  +  S +PIKTVVVLVQENRSFDH+LGWMKSLNPEI+GV G ESNP+ TS 
Sbjct  1     MVAESSTSSTAGISSYPIKTVVVLVQENRSFDHILGWMKSLNPEIDGVTGSESNPISTSD  60

Query  205   GAQNSTNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAE  384
                N     V F + S YVDPDPGHSIQ IYEQ+FG PW+++SA K L P M+GFA NAE
Sbjct  61    PESNR----VFFRDGSAYVDPDPGHSIQAIYEQVFGEPWTEESAAKALAPKMEGFAQNAE  116

Query  385   RNQAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATS  564
             R Q GM+  VM+GF PEAVPVY+ELV EFAVCDRWFAS+P+STQ NRL++HSATSHG T 
Sbjct  117   RTQEGMAEVVMSGFRPEAVPVYRELVSEFAVCDRWFASLPSSTQSNRLYLHSATSHGLTG  176

Query  565   NDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKT  744
             NDT++LI+GFPQKT+FES+DE GYSFGIYYQ  P+  FYRNLRKLKY   FHQFD+HFK 
Sbjct  177   NDTEQLIKGFPQKTVFESLDEDGYSFGIYYQQFPNCFFYRNLRKLKYTNKFHQFDLHFKK  236

Query  745   HCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFL  924
             HCKEGKLPNYVV+E RY+DL   P NDDHPSHDV EGQ+F+KEVYEALR+SPQWNE+ FL
Sbjct  237   HCKEGKLPNYVVIEPRYYDLLSTPANDDHPSHDVSEGQRFIKEVYEALRASPQWNEIFFL  296

Query  925   IIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHG  1104
             I+YDEHGGFYDHVPTPVTGVP+PD ++GP PYNF FDRLGVRVPAI++SPWIERG VLHG
Sbjct  297   ILYDEHGGFYDHVPTPVTGVPSPDDIVGPAPYNFNFDRLGVRVPAILISPWIERGTVLHG  356

Query  1105  PSGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETV-ITRTTPRKDCPETLAEP  1281
             PSGP  +SE+EHSSI ATVKKIFNL  FLT+RD WAGTFE+V ++RT PR DCP TL EP
Sbjct  357   PSGPNASSEFEHSSIAATVKKIFNLKNFLTKRDEWAGTFESVFLSRTIPRTDCPVTLPEP  416

Query  1282  VKLRSA-EAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAF  1458
             ++LR A +AKEDA+++E+Q E+VQMAA L GDH K D YPHKLV+N++V++AA Y   A 
Sbjct  417   IRLREADQAKEDAHVSEFQAELVQMAATLNGDHNK-DVYPHKLVDNLTVSEAAKYCDGAI  475

Query  1459  NKFLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
               FL +CE A+Q G+   + VV  +   P+P      PKSFA K  SC+ C
Sbjct  476   KLFLDECEKAKQSGVDESHIVVCSASPVPAPKRQ-NSPKSFAQKIFSCLIC  525



>ref|XP_008232121.1| PREDICTED: non-specific phospholipase C3-like isoform X1 [Prunus 
mume]
Length=516

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/513 (70%), Positives = 412/513 (80%), Gaps = 11/513 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGWMKSLNPEINGV G ESN + TS    NST   V FG++S
Sbjct  13    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVTGSESNLISTSD--PNSTQ--VFFGDRS  68

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDP+PGHSIQ IYEQ+FG PW++ SA K L P M GFA NAE+ Q G++  VMNGF P
Sbjct  69    AYVDPNPGHSIQAIYEQVFGEPWTEASASKTLPPKMNGFAQNAEKTQTGLAETVMNGFKP  128

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E VPV  ELVREFAVCDRWFAS+P+STQPNR FVHSATSHG TSNDT+KL+EG PQKTIF
Sbjct  129   ENVPVSAELVREFAVCDRWFASIPSSTQPNRQFVHSATSHGLTSNDTQKLVEGLPQKTIF  188

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE   SFGIY+Q  PSTL YR LRKLKYI NFH FD+ FK HC+EGKLPNYVVVEQR
Sbjct  189   QSLDEEDLSFGIYFQSFPSTLLYRKLRKLKYIDNFHAFDLQFKKHCEEGKLPNYVVVEQR  248

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             +FD+   P NDDHPSHDV EGQKF+KEVYEALR+SPQWNEMLF+IIYDEHGGFYDHVPTP
Sbjct  249   FFDVLSFPANDDHPSHDVSEGQKFIKEVYEALRASPQWNEMLFVIIYDEHGGFYDHVPTP  308

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             VT VP+PD ++GP+PYNF+FDRLGVRVPAI++SPWIERG VLHGPSGP+P+SE+EHSSIP
Sbjct  309   VTDVPSPDDIVGPEPYNFKFDRLGVRVPAILISPWIERGTVLHGPSGPYPSSEFEHSSIP  368

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEY  1332
             ATVKKIFNL +FLT+RDAWAGTFE V++RT+PR DCP TL EP KLR     E A L+++
Sbjct  369   ATVKKIFNLKEFLTKRDAWAGTFEGVLSRTSPRTDCPVTLGEPTKLRETAPIEGAKLSDF  428

Query  1333  QKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGD  1512
             Q+E+VQ+AA L GDH K D YP+KLVEN+SV +A  Y   AF KF   CE AR+ G   D
Sbjct  429   QEELVQLAAALNGDHRK-DIYPNKLVENISVVEALRYVEAAFEKFSDACEKARESG--AD  485

Query  1513  YSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              S + + +  PSP   P   KSFA +  SC+ C
Sbjct  486   ESEIVVCETSPSP---PHH-KSFAQRIFSCLVC  514



>ref|XP_002319230.1| phosphoesterase family protein [Populus trichocarpa]
 gb|EEE95153.1| phosphoesterase family protein [Populus trichocarpa]
Length=536

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/530 (66%), Positives = 422/530 (80%), Gaps = 25/530 (5%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLVQENRSFDHMLGW+K++NPEING  G ESNP+ +S    +S + +V FG+++ 
Sbjct  17    IKTVVVLVQENRSFDHMLGWLKTINPEINGATGSESNPISSS----DSNSTLVFFGDQAA  72

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAG--KKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             YVDPDPGHSIQDIYEQ+FG PW++ S     K  P M GFA NAER Q GM+  VMNGF 
Sbjct  73    YVDPDPGHSIQDIYEQVFGVPWTEASLSDDNKPPPKMNGFAQNAERLQKGMAQTVMNGFK  132

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P+AVPVYKEL   FA+CDRWFASVPASTQPNRL+VHSATSHGATSN+ + LIEG+PQKTI
Sbjct  133   PDAVPVYKELAENFAICDRWFASVPASTQPNRLYVHSATSHGATSNNRQLLIEGYPQKTI  192

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES+DE+G++FGIYYQYPP+TLFYRNLRKLKY+  FHQFD+HFK HC+EGKLPNYVV+EQ
Sbjct  193   FESLDESGFTFGIYYQYPPATLFYRNLRKLKYLTKFHQFDLHFKKHCEEGKLPNYVVIEQ  252

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             R+FDL  +P NDDHPSHDV EGQKFVK+VYEALR+SPQWNE+LF+IIYDEHGGFYDHVPT
Sbjct  253   RFFDLLSIPANDDHPSHDVSEGQKFVKKVYEALRASPQWNEILFIIIYDEHGGFYDHVPT  312

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGK-------------VLHGPS  1110
             PVTGVP+PD ++GP PYNF+FDRLGVRVPA ++SPWIE G              +LH PS
Sbjct  313   PVTGVPSPDDIVGPAPYNFKFDRLGVRVPAFLISPWIEPGTGMFITSFLFMPFPMLHAPS  372

Query  1111  GPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKL  1290
             GP+P SE+EHSSI ATVKKIFNL +FLT+RDAWAGTFE ++TRT+PR DCP TL EPVKL
Sbjct  373   GPYPTSEFEHSSIAATVKKIFNLKEFLTKRDAWAGTFEGILTRTSPRVDCPVTLVEPVKL  432

Query  1291  RSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             R   AKEDA L+E+Q+E+V+MAAVL GD +K+D YP +LV+ ++V+  A Y   AF +F 
Sbjct  433   REGAAKEDAKLSEFQEELVEMAAVLNGD-LKKDIYPQQLVDGLNVSDGAKYVEKAFKRFC  491

Query  1471  GDCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
              +C+ A++ G+  D  ++ L K    P TT R  KSF  K  SC+ C  N
Sbjct  492   DECDKAKKNGV-DDSEIICLEK----PATTHRASKSFVQKLFSCLVCDNN  536



>ref|XP_008232122.1| PREDICTED: non-specific phospholipase C3-like isoform X2 [Prunus 
mume]
Length=516

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/513 (70%), Positives = 411/513 (80%), Gaps = 11/513 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGWMKSLNPEINGV G ESN + TS    NST   + FG+ +
Sbjct  13    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVTGSESNLISTSD--PNSTQ--LFFGDSA  68

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDP HSIQ IYEQ+FG PW++ SA KKL P M GFA NAE+ Q G++  VM+GF P
Sbjct  69    AYVDPDPDHSIQAIYEQVFGEPWTEASASKKLPPKMNGFAQNAEKTQTGLAETVMSGFKP  128

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E VPV  ELVREFAVCDRWFASVP+STQPNR FVHSATSHG TSNDT+KL+EG PQKTIF
Sbjct  129   ENVPVSAELVREFAVCDRWFASVPSSTQPNRQFVHSATSHGLTSNDTQKLVEGLPQKTIF  188

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE   SFGIY+Q  PSTL YR LRKLKYI NFH FD+ FK HC+EGKLPNYVVVEQR
Sbjct  189   QSLDEVDLSFGIYFQSVPSTLLYRKLRKLKYIDNFHAFDLQFKKHCEEGKLPNYVVVEQR  248

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             +FD+   P NDDHPSHDV EGQKF+KEVYEALR+SPQWNEMLF+IIYDEHGGFYDHVPTP
Sbjct  249   FFDVLSFPANDDHPSHDVSEGQKFIKEVYEALRASPQWNEMLFVIIYDEHGGFYDHVPTP  308

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             VT VP+PD ++GP+PYNF+FDRLGVRVPAI++SPWIERG VLHGPSGP+P+SE+EHSSIP
Sbjct  309   VTDVPSPDDIVGPEPYNFKFDRLGVRVPAILISPWIERGTVLHGPSGPYPSSEFEHSSIP  368

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEY  1332
             ATVKKIFNL +FLT+RDAWAGTFE V++RT+PR DCP TL EP KLR     E A L+++
Sbjct  369   ATVKKIFNLKEFLTKRDAWAGTFEGVLSRTSPRTDCPVTLGEPTKLRETAPIEGAKLSDF  428

Query  1333  QKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGD  1512
             Q+E+VQ+AA L GDH K D YP+KLVEN+SV +A  Y   AF KF   CE AR+ G   D
Sbjct  429   QEELVQLAAALNGDHRK-DIYPNKLVENISVVEALRYVEAAFEKFSDACEKARESG--AD  485

Query  1513  YSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              S + + +  PSP   P   KSFA +  SC+ C
Sbjct  486   ESEIVVCETSPSP---PHH-KSFAQRIFSCLVC  514



>ref|XP_010691936.1| PREDICTED: non-specific phospholipase C4-like [Beta vulgaris 
subsp. vulgaris]
Length=518

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/526 (69%), Positives = 414/526 (79%), Gaps = 11/526 (2%)
 Frame = +1

Query  34    MGPSSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQ  213
             M      +  S +PIKTVVVLVQENRSFDH+LGWMK LNP+I+GV G+ESNPL TS    
Sbjct  1     MASDESNTKSSPYPIKTVVVLVQENRSFDHILGWMKPLNPKIDGVTGQESNPLDTS----  56

Query  214   NSTNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQ  393
             N+ +  + FG+ S YVDPDPGHSIQ IYEQ+FG  W+Q+SA KK  PTMQGF  NA R Q
Sbjct  57    NTNSPRINFGDGSVYVDPDPGHSIQAIYEQVFGEQWTQESAQKKKAPTMQGFVQNANRIQ  116

Query  394   AGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDT  573
             +GM   VMNGF P+ VPV+KEL+ +FAVCDRWFASVPASTQPNRL+VHSATSHG TSNDT
Sbjct  117   SGMDETVMNGFKPDLVPVFKELMTQFAVCDRWFASVPASTQPNRLYVHSATSHGLTSNDT  176

Query  574   KKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCK  753
             KKLI G PQKTIFES+DEAG+SFGIYYQYPPSTLFYRNLR+LKYI  FHQFD+ FK HCK
Sbjct  177   KKLIGGLPQKTIFESLDEAGFSFGIYYQYPPSTLFYRNLRRLKYITKFHQFDLSFKKHCK  236

Query  754   EGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIY  933
             EGKLPNYVV+EQRYFDL  LPGNDDHPSHDV  GQKF+KEVYEALRSS QWNEMLF+I Y
Sbjct  237   EGKLPNYVVIEQRYFDLLTLPGNDDHPSHDVSIGQKFIKEVYEALRSSAQWNEMLFIITY  296

Query  934   DEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG  1113
             DEHGGF+DHVPTPV GVP+PD + G +PYNF+FDRLGVRVP  M+SPWIE G VLH P+G
Sbjct  297   DEHGGFFDHVPTPVEGVPSPDDITGSEPYNFKFDRLGVRVPTFMISPWIEPGTVLHEPTG  356

Query  1114  PFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLR  1293
             P+  S+YEHSSIPATVKKIFNL  FLT+RDAWAGTFE V  R +PR DCP TL EPVKLR
Sbjct  357   PYSTSQYEHSSIPATVKKIFNLKDFLTKRDAWAGTFEGVANRKSPRTDCPVTLPEPVKLR  416

Query  1294  SAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLG  1473
                  E+  L+++Q E+VQMAA L GDH K+  YP  LVE M+V +AA+Y H A+  FL 
Sbjct  417   EDLPLENRLLSDFQAELVQMAACLNGDHKKKT-YPDTLVEKMTVKEAAEYVHEAWKIFLH  475

Query  1474  DCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             +CE AR+RG   D S + +     S NT+    +S ATKF SCIAC
Sbjct  476   ECEEARKRG--EDDSAIVVVDGKHSKNTS----RSLATKFFSCIAC  515



>ref|XP_007219017.1| hypothetical protein PRUPE_ppa004326mg [Prunus persica]
 gb|EMJ20216.1| hypothetical protein PRUPE_ppa004326mg [Prunus persica]
Length=516

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/513 (69%), Positives = 412/513 (80%), Gaps = 11/513 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGWMKSLNPEINGV G ESN + TS    NST   V FG+ +
Sbjct  13    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVTGSESNLISTSD--PNSTQ--VFFGDSA  68

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDPGHSIQ IYEQ+FG PW++ SA K L P M GFA NAE+ Q G++  VMNGF P
Sbjct  69    AYVDPDPGHSIQAIYEQVFGEPWTEASASKTLPPKMNGFAQNAEKTQTGLAETVMNGFKP  128

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E V V  ELVREFAVCDRWFAS+P+STQPNR FVHSATSHG TSNDT+KL+EG PQKTIF
Sbjct  129   ENVAVSAELVREFAVCDRWFASIPSSTQPNRQFVHSATSHGLTSNDTQKLVEGLPQKTIF  188

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E   SFGIY+Q  PSTL YR+LRKLKYI NFH FD+ FK HC+EGKLPNYVVVEQR
Sbjct  189   QSLEEEDLSFGIYFQSFPSTLLYRSLRKLKYIDNFHAFDLQFKKHCEEGKLPNYVVVEQR  248

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             +FD+   P NDDHPSHDV EGQKF+KEVYEALR+SPQWNEMLF+IIYDEHGGFYDHVPTP
Sbjct  249   FFDVLSFPANDDHPSHDVSEGQKFIKEVYEALRASPQWNEMLFVIIYDEHGGFYDHVPTP  308

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             VT VP+PD ++GP+PYNF+FDRLGVRVPAI++SPWIER  VLHGPSGP+P+SE+EHSSIP
Sbjct  309   VTDVPSPDDIVGPEPYNFKFDRLGVRVPAILISPWIERETVLHGPSGPYPSSEFEHSSIP  368

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEY  1332
             ATVKKIFNL +FLT+RDAWAGTFE V++RT+PR DCP TL EP KLR   +KE A+L+++
Sbjct  369   ATVKKIFNLKEFLTKRDAWAGTFEGVLSRTSPRTDCPVTLGEPTKLRETASKEGAHLSDF  428

Query  1333  QKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGD  1512
             Q+E+VQ+AA L GDH K D YP+KLVEN+SV +A  Y   AF KF   CE AR+ G   D
Sbjct  429   QEELVQLAAALNGDHRK-DIYPNKLVENISVVEALKYVEAAFEKFSDACEKARESG--AD  485

Query  1513  YSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              S + + +  PSP       KSFA +  SC+ C
Sbjct  486   ESEIVVCETSPSPPYH----KSFAQRIFSCLVC  514



>ref|XP_010273152.1| PREDICTED: non-specific phospholipase C4-like isoform X2 [Nelumbo 
nucifera]
Length=524

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/521 (70%), Positives = 418/521 (80%), Gaps = 16/521 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKES--NPLPTSGGAQNSTNDVVLFGN  246
             PIKTVV+LVQENRS DH+LGWMK LNPEINGV+  +   N L T+    +  +  V FG+
Sbjct  10    PIKTVVLLVQENRSLDHILGWMKILNPEINGVSSGDEFYNSLSTT----DPNSKKVYFGD  65

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
             +S+YVDPDPGHS QDIYEQ+FG PW Q S+ ++    M GFA NAE  Q GMS  V+NGF
Sbjct  66    QSEYVDPDPGHSFQDIYEQVFGIPWGQ-SSSREQAVKMNGFAQNAENTQKGMSDTVINGF  124

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PEAVPVY+ELV +FAVCD WFASVP+STQPNRLFVHSATSHG  SNDTK+LIEG PQKT
Sbjct  125   RPEAVPVYRELVSQFAVCDHWFASVPSSTQPNRLFVHSATSHGLISNDTKRLIEGSPQKT  184

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+DEAG+SFGIYYQYPPSTLFYRNLRKLKYIKNFHQFD++FK+HCKEGKLPNYVVVE
Sbjct  185   IFESLDEAGFSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDMNFKSHCKEGKLPNYVVVE  244

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFDLK+LPGNDDHPSHDV EGQKFVKEVYEALR+SPQWNE+LF+I YDEHGGFYDHVP
Sbjct  245   QRYFDLKLLPGNDDHPSHDVSEGQKFVKEVYEALRASPQWNEILFIITYDEHGGFYDHVP  304

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP TGVP+PD +  P P+ F+FDRLGVRVPAI +SPWIERG VLH PSGP+P+SE+EHSS
Sbjct  305   TP-TGVPSPDDIASPGPFYFKFDRLGVRVPAIFISPWIERGTVLHRPSGPYPSSEFEHSS  363

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKKIFNL +FLT+RDAWAGTFETV+TR +PR DCP TL +P KLRS +A E A L+
Sbjct  364   IPATVKKIFNLKEFLTKRDAWAGTFETVLTRESPRTDCPVTLPQPRKLRSGDANEGAKLS  423

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q E+VQ+AA L GDH K D YP+KLVE M+V  A  Y   AF KFL  CE A++ G  
Sbjct  424   EFQVELVQLAAALKGDHRK-DIYPNKLVEKMTVKDAVSYCKDAFKKFLEGCEKAKKNGA-  481

Query  1507  GDYSVVALSKQPPSPNTTPR------KPKSFATKFLSCIAC  1611
              +  ++ L   PPS N+TP       K KSF  K  +C AC
Sbjct  482   DESEIIVLPSLPPSKNSTPVVEQPPPKSKSFVHKMFACFAC  522



>gb|KEH18078.1| non-specific phospholipase C4 [Medicago truncatula]
Length=523

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/522 (68%), Positives = 417/522 (80%), Gaps = 16/522 (3%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKTVV+LVQENRSFDHMLGWMKSLNP+INGV G ESN + TS    +S ++ VLF ++
Sbjct  12    YPIKTVVILVQENRSFDHMLGWMKSLNPKINGVIGTESNSISTS----DSNSNRVLFSDQ  67

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQ------AGMSGA  411
             S YVDPDPGHSIQDIYEQIFG PWS+ SA KKL P M GF  NA R +        M+ A
Sbjct  68    SIYVDPDPGHSIQDIYEQIFGEPWSEASAAKKLPPMMDGFVQNAVRQEIPKNATVTMTEA  127

Query  412   VMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEG  591
             VMNGF P+ VP+YKELV+EFAVCDRWFASVPASTQPNRL+VHSATSHG TSNDT KLI G
Sbjct  128   VMNGFKPDLVPIYKELVKEFAVCDRWFASVPASTQPNRLYVHSATSHGLTSNDTNKLIGG  187

Query  592   FPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPN  771
              PQKTIF+S+DE G++FGIYYQ PPSTLFYR+LRKLKYI+ FH++ + FK HC+EGKLPN
Sbjct  188   LPQKTIFDSLDENGFNFGIYYQQPPSTLFYRSLRKLKYIEKFHEYGLTFKKHCEEGKLPN  247

Query  772   YVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGF  951
             YVV+EQR+FDL  +PGNDDHPSHDV EGQKFVKEVYEALR SPQWNEMLF+I YDEHGGF
Sbjct  248   YVVIEQRFFDLLSIPGNDDHPSHDVGEGQKFVKEVYEALRGSPQWNEMLFVITYDEHGGF  307

Query  952   YDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSE  1131
             YDHVPTPV G+P+PD ++GP+P+ F+FDRLGVRVP I +SPWIE GKVLH PSGPFP S+
Sbjct  308   YDHVPTPVDGIPSPDDIVGPEPFKFKFDRLGVRVPTIFISPWIEPGKVLHEPSGPFPTSQ  367

Query  1132  YEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKE  1311
             YEHSSIPATVKKIFNL +FLT+RDAWAGTFE ++T ++PR DCPE L EP+KLR A AKE
Sbjct  368   YEHSSIPATVKKIFNLPEFLTKRDAWAGTFEGLLTLSSPRTDCPEKLPEPIKLREAAAKE  427

Query  1312  DANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENAR  1491
             +A L+E+Q+E+V MAA L GDH K   YP+KL+ENM V  A  Y  +AFN FL +CE A+
Sbjct  428   EAKLSEFQEELVLMAATLNGDHRKS-IYPNKLIENMCVLDAVKYVEVAFNTFLNECEKAK  486

Query  1492  QRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGR  1617
             Q G  G   +V  +       +T R  ++F  K LSCI C R
Sbjct  487   QNGADG-CDIVDCANT----CSTRRNSENFFHKMLSCITCDR  523



>emb|CDP19760.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/521 (68%), Positives = 415/521 (80%), Gaps = 15/521 (3%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT++VLVQENRSFDHMLGWMKSLNPEI+GV G ESNPL TS    N     + FG++
Sbjct  8     YPIKTILVLVQENRSFDHMLGWMKSLNPEIDGVTGTESNPLSTSDPDSNR----IYFGDQ  63

Query  250   SQYVDPDPGHSIQDIYEQIFGAPW-----SQDSAGKKLEPTMQGFAANAERNQAGMSGAV  414
             S  V+PDPGHS + IYEQ+FG PW     S  SA + L PTM+GFA NAER Q GM+  V
Sbjct  64    SGNVEPDPGHSFEAIYEQVFGVPWTGGQSSTSSASQNLPPTMEGFAQNAERIQKGMAEIV  123

Query  415   MNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGF  594
             MNGF PE++ VYKEL+ EFAVCDRWF+S+P  TQPNRLF+HSATS+GA +NDTK LI+G+
Sbjct  124   MNGFRPESLTVYKELISEFAVCDRWFSSIPTLTQPNRLFIHSATSYGAIANDTKMLIQGY  183

Query  595   PQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNY  774
             PQKTIFES++E G +FGIY+QYPPSTLF+RNLRKLKY KNFHQFDI FK HCKEGKLPNY
Sbjct  184   PQKTIFESLEECGCTFGIYHQYPPSTLFFRNLRKLKYTKNFHQFDIDFKRHCKEGKLPNY  243

Query  775   VVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFY  954
              VVEQRYF+ K++PGNDDHP HDV EGQKFVKEVYEA+RSSPQWNEMLF+IIYDEHGGFY
Sbjct  244   AVVEQRYFETKLVPGNDDHPPHDVSEGQKFVKEVYEAIRSSPQWNEMLFIIIYDEHGGFY  303

Query  955   DHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEY  1134
             DHVPTPVTG+P+PD  + P P+NF+FDRLG+RVPAI+VSPWIERG VLHGPSGP+P SE+
Sbjct  304   DHVPTPVTGIPSPDDKVAPAPHNFRFDRLGIRVPAILVSPWIERGTVLHGPSGPYPTSEF  363

Query  1135  EHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKED  1314
             EHSSIPATVKKIFNL +FLT+RDAWAGT E V+ R +PR DCP  L EPVKLR  EA E+
Sbjct  364   EHSSIPATVKKIFNLKEFLTKRDAWAGTLECVLNRGSPRSDCPVMLPEPVKLRDREANEE  423

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
             + L+E+Q+E+VQ+AAVL GD + +D YP K++ENM V +A +Y   AF KF  +C+NA +
Sbjct  424   SKLSEFQEELVQLAAVLSGD-LAKDIYPQKILENMKVIEAVNYVENAFQKFRVECDNAFK  482

Query  1495  RGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGR  1617
              G      V A     PSP     + KS A K LSCIAC R
Sbjct  483   TGADESNIVCA-----PSPPPEKHRSKSLAHKILSCIACHR  518



>ref|XP_010919939.1| PREDICTED: non-specific phospholipase C4-like [Elaeis guineensis]
Length=520

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/534 (67%), Positives = 425/534 (80%), Gaps = 22/534 (4%)
 Frame = +1

Query  40    PSSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNS  219
             P+  ++ G    IKTVVVLVQENRSFDHM+GWMKSLNPEI+GV G+ESNPL T+    + 
Sbjct  2     PAESLAQGG--QIKTVVVLVQENRSFDHMVGWMKSLNPEIDGVTGQESNPLSTT----DP  55

Query  220   TNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKK-------LEPTMQGFAAN  378
              + V+ FG+++ YVDPDPGHSIQ IYEQ++G P+S   AG+         EP M GFA  
Sbjct  56    NSPVIHFGDRATYVDPDPGHSIQAIYEQVYGIPFS---AGETPITPPGVTEPPMNGFAQE  112

Query  379   AERNQAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGA  558
             AER + GMS  VMNG+ P AVPVY+ LVREFAVCDRWFAS+PASTQPNRL+VHSATSHG 
Sbjct  113   AEREKEGMSETVMNGYPPAAVPVYEALVREFAVCDRWFASIPASTQPNRLYVHSATSHGL  172

Query  559   TSNDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHF  738
             TSNDTKKL+EG PQKTIF+S+ EAGYSFGIYYQYPPSTLFYRNLR+LKYI NFHQFD+ F
Sbjct  173   TSNDTKKLVEGLPQKTIFDSLYEAGYSFGIYYQYPPSTLFYRNLRQLKYIGNFHQFDLDF  232

Query  739   KTHCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEML  918
             K HCKEGKLPNYVV+EQRYFDLKILPGNDDHPSHDV EGQK VKEVYEALRSSPQW E+L
Sbjct  233   KRHCKEGKLPNYVVIEQRYFDLKILPGNDDHPSHDVSEGQKLVKEVYEALRSSPQWKEIL  292

Query  919   FLIIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVL  1098
             F++ YDEHGGFYDHVPTPV GVP+PD ++GP+P+ F+FDRLGVRVP + +SPWIE G V+
Sbjct  293   FIVTYDEHGGFYDHVPTPV-GVPSPDDIVGPEPFYFKFDRLGVRVPTLFISPWIEPGTVV  351

Query  1099  HGPSGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAE  1278
             H P GP+ +SE+EHSSIPATVKKIFNL +FLT+RDAWAGTFE V+TRTTPR DCPE L E
Sbjct  352   HRPLGPYSSSEFEHSSIPATVKKIFNLKEFLTKRDAWAGTFEIVLTRTTPRTDCPEVLPE  411

Query  1279  PVKLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAF  1458
             P K+R+ EA EDA L+E+Q+E+VQ+ A L GD  KE  YPHKLVE M+VA+ A Y   AF
Sbjct  412   PKKMRTTEAAEDAKLSEFQQELVQLGATLNGDCTKE-IYPHKLVEGMTVAEGAQYVRDAF  470

Query  1459  NKFLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
               FL +CEN +++G  GD  +V +    P+     R+ KSFA K  +C+ C ++
Sbjct  471   KTFLEECENCKKKGA-GDSHIVVVK---PAMEPVVRRKKSFAQKMFACLVCNQS  520



>ref|XP_011086397.1| PREDICTED: non-specific phospholipase C3-like [Sesamum indicum]
Length=512

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/517 (67%), Positives = 421/517 (81%), Gaps = 15/517 (3%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKTVVVLVQENRSFDH+LGWMKS+NP+I+GV GKESNP+        ST++ + + +K
Sbjct  8     YPIKTVVVLVQENRSFDHVLGWMKSINPDIDGVTGKESNPI--------STSERIHYSDK  59

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSA-GKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
             S +V+PDPGHS +  YEQI+G PW Q SA G  L PTM+GFA  AE  Q GM+  VMNGF
Sbjct  60    SGFVEPDPGHSFEATYEQIYGVPWDQASASGHNLSPTMEGFAQQAESIQKGMANIVMNGF  119

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE+VPVYKELV+EFAVCDRWF+S P  TQPNRLF+HS TS+GAT+NDTK L+EG+PQKT
Sbjct  120   RPESVPVYKELVQEFAVCDRWFSSAPTLTQPNRLFIHSGTSYGATANDTKMLVEGYPQKT  179

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES++E G+ FGIYYQYPPSTLFYRNLRKLKYI+ FHQFD+HFK HC+EGKLPNYVV+E
Sbjct  180   IFESVEEGGFEFGIYYQYPPSTLFYRNLRKLKYIRKFHQFDLHFKRHCEEGKLPNYVVIE  239

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYF+ K++PGNDDHP HD+ EGQKFVKE+YEALRSSPQWNE+LF+IIYDEHGGFYDHVP
Sbjct  240   QRYFETKLVPGNDDHPPHDISEGQKFVKEIYEALRSSPQWNEILFVIIYDEHGGFYDHVP  299

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
              PVTGVP+PD ++GP+PY F+FD LGVRVPAI+VSPWIE G VLHGPSGP+P SE+EHSS
Sbjct  300   PPVTGVPSPDDIVGPEPYKFKFDGLGVRVPAILVSPWIEPGTVLHGPSGPYPTSEFEHSS  359

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAK-EDANL  1323
             IPATVKKIFNL +FLT+RDAWAGTFE V+ RT+PR DCP +L EPVK+R  EA  EDA L
Sbjct  360   IPATVKKIFNLKEFLTKRDAWAGTFECVLNRTSPRTDCPVSLPEPVKMREIEANYEDAKL  419

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+ AVL G+H  +D++PH++V++M V +A +Y   AF KF+ DC+NA + G 
Sbjct  420   SEFQEELVQLCAVLKGEHA-QDHFPHRIVQDMKVLQAVEYVGGAFQKFMDDCDNAIRNG-  477

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACG  1614
               D S +  S  P  P    R  +SFA K  SC+ CG
Sbjct  478   -ADESHIVCSLAPHQPKR--RVSRSFARKLCSCLTCG  511



>ref|XP_002524007.1| Phospholipase C 3 precursor, putative [Ricinus communis]
 gb|EEF38375.1| Phospholipase C 3 precursor, putative [Ricinus communis]
Length=525

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/518 (67%), Positives = 414/518 (80%), Gaps = 10/518 (2%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKTVVVLVQENRSFDHMLGW+K+LNPEI+GV G+ESNP+ TS    +  + +V F ++
Sbjct  12    YPIKTVVVLVQENRSFDHMLGWLKTLNPEIDGVTGQESNPISTS----DLNSSLVFFRDQ  67

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQD--SAGKKLEPTMQGFAANAERNQAGMSGAVMNG  423
             + YVDPDPGHSIQ IYEQ+FG  W++   S+   + P M GFA NAER Q GM+  VMNG
Sbjct  68    AAYVDPDPGHSIQAIYEQVFGVEWTEAALSSENAVSPKMNGFAQNAERTQQGMAETVMNG  127

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F PEAVPVYKEL   FAVCDRWFAS+P STQPNRL++HSATSHGATSNDTK L EGFPQK
Sbjct  128   FRPEAVPVYKELAMNFAVCDRWFASIPTSTQPNRLYLHSATSHGATSNDTKMLAEGFPQK  187

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIFESM EAG+SFGIY+Q  P+TLFYRNLRK+KY+KNFHQFD+ FK HC++G+LPNYVV+
Sbjct  188   TIFESMHEAGFSFGIYFQQVPTTLFYRNLRKIKYLKNFHQFDLQFKKHCEKGELPNYVVI  247

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             E RY+DL  +P NDDHPSHDV EGQKFVKEVYEALR+SPQWNEMLF+IIYDEHGGFYDHV
Sbjct  248   EPRYYDLLSIPANDDHPSHDVSEGQKFVKEVYEALRASPQWNEMLFIIIYDEHGGFYDHV  307

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTP TG+P PD ++GP PY F+FDRLGVRVPA+++SPWIE G VLHGPSGP   SE+EHS
Sbjct  308   PTPATGIPTPDDIVGPAPYLFKFDRLGVRVPAVLISPWIEPGTVLHGPSGPQETSEFEHS  367

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             SI ATVKK+FNL +FLT+RD WAGTFE+V+TRT+PR DCP TL EPVKLRS  A E+AN+
Sbjct  368   SIAATVKKLFNLKEFLTKRDEWAGTFESVLTRTSPRTDCPVTLTEPVKLRSRGANEEANI  427

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+AAVL GDH   D YPHKLVE+M V++AA+Y   AF +F  + E AR  G+
Sbjct  428   SEFQQELVQLAAVLNGDH-GTDIYPHKLVESMKVSEAANYVENAFKRFYEEYEKARDGGV  486

Query  1504  HGDYSVVALSKQPPSP--NTTPRKPKSFATKFLSCIAC  1611
               +  V+AL K         T    KSF  K  SCI C
Sbjct  487   -DESEVIALVKTEALAIITNTSASSKSFIQKLFSCIVC  523



>ref|XP_010273151.1| PREDICTED: non-specific phospholipase C4-like isoform X1 [Nelumbo 
nucifera]
Length=525

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/522 (70%), Positives = 418/522 (80%), Gaps = 17/522 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKES--NPLPTSGGAQNSTNDVVLFGN  246
             PIKTVV+LVQENRS DH+LGWMK LNPEINGV+  +   N L T+    +  +  V FG+
Sbjct  10    PIKTVVLLVQENRSLDHILGWMKILNPEINGVSSGDEFYNSLSTT----DPNSKKVYFGD  65

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
             +S+YVDPDPGHS QDIYEQ+FG PW Q S+ ++    M GFA NAE  Q GMS  V+NGF
Sbjct  66    QSEYVDPDPGHSFQDIYEQVFGIPWGQ-SSSREQAVKMNGFAQNAENTQKGMSDTVINGF  124

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PEAVPVY+ELV +FAVCD WFASVP+STQPNRLFVHSATSHG  SNDTK+LIEG PQKT
Sbjct  125   RPEAVPVYRELVSQFAVCDHWFASVPSSTQPNRLFVHSATSHGLISNDTKRLIEGSPQKT  184

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+DEAG+SFGIYYQYPPSTLFYRNLRKLKYIKNFHQFD++FK+HCKEGKLPNYVVVE
Sbjct  185   IFESLDEAGFSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDMNFKSHCKEGKLPNYVVVE  244

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFDLK+LPGNDDHPSHDV EGQKFVKEVYEALR+SPQWNE+LF+I YDEHGGFYDHVP
Sbjct  245   QRYFDLKLLPGNDDHPSHDVSEGQKFVKEVYEALRASPQWNEILFIITYDEHGGFYDHVP  304

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGK-VLHGPSGPFPNSEYEHS  1143
             TP TGVP+PD +  P P+ F+FDRLGVRVPAI +SPWIERG  VLH PSGP+P+SE+EHS
Sbjct  305   TP-TGVPSPDDIASPGPFYFKFDRLGVRVPAIFISPWIERGTGVLHRPSGPYPSSEFEHS  363

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             SIPATVKKIFNL +FLT+RDAWAGTFETV+TR +PR DCP TL +P KLRS +A E A L
Sbjct  364   SIPATVKKIFNLKEFLTKRDAWAGTFETVLTRESPRTDCPVTLPQPRKLRSGDANEGAKL  423

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E+VQ+AA L GDH K D YP+KLVE M+V  A  Y   AF KFL  CE A++ G 
Sbjct  424   SEFQVELVQLAAALKGDHRK-DIYPNKLVEKMTVKDAVSYCKDAFKKFLEGCEKAKKNGA  482

Query  1504  HGDYSVVALSKQPPSPNTTPR------KPKSFATKFLSCIAC  1611
               +  ++ L   PPS N+TP       K KSF  K  +C AC
Sbjct  483   -DESEIIVLPSLPPSKNSTPVVEQPPPKSKSFVHKMFACFAC  523



>ref|XP_003521010.1| PREDICTED: non-specific phospholipase C4-like isoform X1 [Glycine 
max]
 gb|KHN45284.1| Non-hemolytic phospholipase C [Glycine soja]
Length=523

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/531 (68%), Positives = 417/531 (79%), Gaps = 16/531 (3%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNST  222
             S+  ++ + +PIKT+VVLVQENRSFDHMLGWMKSL+P+ING+ G ESNP+ TS    N  
Sbjct  3     SNSSTNNAGYPIKTIVVLVQENRSFDHMLGWMKSLDPKINGITGSESNPISTS----NPN  58

Query  223   NDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN----  390
             +++V F ++S YVDPDPGHSIQDIYEQIFG PWS+ S  KKL PTMQGFA NA R     
Sbjct  59    SNLVQFSDQSVYVDPDPGHSIQDIYEQIFGEPWSEASTAKKLPPTMQGFAQNAGRQAVPK  118

Query  391   --QAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATS  564
                A M   VMNGF P+ +PVYKELV+E+AVCD WFASVPASTQPNRL+VHSATSHG TS
Sbjct  119   NATATMMETVMNGFKPDLIPVYKELVKEYAVCDCWFASVPASTQPNRLYVHSATSHGLTS  178

Query  565   NDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKT  744
             NDT KLI G PQKTIF+S+DE G+SFGIYYQ PP+TLFYRNLRKLKY+ NF  FD+ FK 
Sbjct  179   NDTNKLIGGLPQKTIFDSLDENGFSFGIYYQSPPATLFYRNLRKLKYVDNFRPFDL-FKK  237

Query  745   HCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFL  924
             HCKEGKLPNYVV+EQR+FDL  +PGNDDHPSHDV EGQKFVKEVYEALR SPQWNE LF+
Sbjct  238   HCKEGKLPNYVVIEQRFFDLLSIPGNDDHPSHDVSEGQKFVKEVYEALRGSPQWNETLFV  297

Query  925   IIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHG  1104
             I+YDEHGGFYDHVPTPV GVP+PD ++GP+P+ FQFDRLGVR+PAI+VSPWIE G VLHG
Sbjct  298   IVYDEHGGFYDHVPTPVEGVPSPDDIVGPEPFKFQFDRLGVRIPAIIVSPWIEPGTVLHG  357

Query  1105  PSGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPV  1284
             PSGP P S+YEHSSIPATVKKIFNL +FLT+RDAWAGTFE ++TR++PR DCP  L EPV
Sbjct  358   PSGPSPTSQYEHSSIPATVKKIFNLPEFLTKRDAWAGTFEGLLTRSSPRTDCPVKLPEPV  417

Query  1285  KLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNK  1464
             KLR A A+E A L+E+Q+E+VQMAA L GDH K   YP KL ENMSV  A  Y   AFN 
Sbjct  418   KLREAPAQEKAKLSEFQEELVQMAATLNGDHRKS-IYPDKLTENMSVPDAVKYVEDAFNT  476

Query  1465  FLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGR  1617
             FL +CE A+Q G   D S +       S  + P   K+F    LSCI C R
Sbjct  477   FLNECEKAKQNG--ADESEIVDCADGCS--SAPPDSKNFFYNVLSCITCNR  523



>ref|XP_009361404.1| PREDICTED: non-specific phospholipase C3-like [Pyrus x bretschneideri]
Length=514

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/513 (67%), Positives = 414/513 (81%), Gaps = 11/513 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDH+LGWMKS+NPEINGV G ESNP+ TS    NST   + F + S
Sbjct  11    PIKTVVVLVQENRSFDHILGWMKSINPEINGVTGSESNPISTSD--PNSTQ--IFFRDNS  66

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDPGHSIQ +YEQ+FG PW++ SA K L PTM GFA NAE  Q G++  VMNGF P
Sbjct  67    AYVDPDPGHSIQAVYEQVFGEPWTEASASKTLPPTMNGFAQNAETTQTGLAETVMNGFRP  126

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E VPV++ELV+EFAVCDRWFASVPA+TQPNR ++HSATSHG T ND +KLIEG PQKTIF
Sbjct  127   ENVPVHRELVKEFAVCDRWFASVPAATQPNRQYIHSATSHGLTGNDNQKLIEGLPQKTIF  186

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+D+ G+SFGIY+Q  PSTL YRNLRKLKYI NFHQFD+ FK HCKEGKLPNYVVVEQR
Sbjct  187   QSLDDEGFSFGIYFQSFPSTLLYRNLRKLKYIDNFHQFDLQFKKHCKEGKLPNYVVVEQR  246

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             +FD+  +P NDDHPSHDV EGQKF+KEVYEALR+SPQWNEMLF+IIYDEHGGFYDHVPTP
Sbjct  247   FFDVLSMPANDDHPSHDVSEGQKFIKEVYEALRASPQWNEMLFIIIYDEHGGFYDHVPTP  306

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             VT VP+PD ++GP+PYNF+FDRLGVRVPAI++SPWIE G VLHGPSGP+P+SE+EHSSIP
Sbjct  307   VTDVPSPDDVVGPEPYNFKFDRLGVRVPAILISPWIEPGTVLHGPSGPYPSSEFEHSSIP  366

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEY  1332
             ATVKKIFNL +FLT+RD WAGTFE V++RT+PR DCP TL +PVKLR A +K+    +++
Sbjct  367   ATVKKIFNLKEFLTKRDTWAGTFEGVLSRTSPRTDCPVTLPDPVKLREAASKDGTKKSDF  426

Query  1333  QKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGD  1512
             Q+E++Q+AA + GDH K D YP KLVE+++V++A  Y   AF  F  +CE AR+ G   +
Sbjct  427   QEELIQLAAAINGDHRK-DTYPDKLVEDITVSEALKYVEGAFKTFSDECEKARKTGT-DE  484

Query  1513  YSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
               ++  +  P  P +     KSFA K  SC+ C
Sbjct  485   SEIIVCATSPTLPTS-----KSFAQKIFSCLVC  512



>gb|ACU18878.1| unknown [Glycine max]
Length=523

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/531 (68%), Positives = 416/531 (78%), Gaps = 16/531 (3%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNST  222
             S+  ++ + +PIKT+VVLVQENRSFDHMLGWMKSL+P+ING+ G ESNP+ TS    N  
Sbjct  3     SNSSTNNAGYPIKTIVVLVQENRSFDHMLGWMKSLDPKINGITGSESNPISTS----NPN  58

Query  223   NDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN----  390
             +++V F ++S YVDPDPGHSIQDIYEQIFG PWS+ S  KKL PTMQGFA NA R     
Sbjct  59    SNLVQFSDQSVYVDPDPGHSIQDIYEQIFGEPWSEASTAKKLPPTMQGFAQNAGRQAVPK  118

Query  391   --QAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATS  564
                A M   VMNG  P+ +PVYKELV+E+AVCD WFASVPASTQPNRL+VHSATSHG TS
Sbjct  119   NATATMMETVMNGLKPDLIPVYKELVKEYAVCDCWFASVPASTQPNRLYVHSATSHGLTS  178

Query  565   NDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKT  744
             NDT KLI G PQKTIF+S+DE G+SFGIYYQ PP+TLFYRNLRKLKY+ NF  FD+ FK 
Sbjct  179   NDTNKLIGGLPQKTIFDSLDENGFSFGIYYQSPPATLFYRNLRKLKYVDNFRPFDL-FKK  237

Query  745   HCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFL  924
             HCKEGKLPNYVV+EQR+FDL  +PG+DDHPSHDV EGQKFVKEVYEALR SPQWNE LF+
Sbjct  238   HCKEGKLPNYVVIEQRFFDLLSIPGDDDHPSHDVSEGQKFVKEVYEALRGSPQWNETLFV  297

Query  925   IIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHG  1104
             I+YDEHGGFYDHVPTPV GVP+PD ++GP+P+ FQFDRLGVR+PAI+VSPWIE G VLHG
Sbjct  298   IVYDEHGGFYDHVPTPVEGVPSPDDIVGPEPFKFQFDRLGVRIPAIIVSPWIEPGTVLHG  357

Query  1105  PSGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPV  1284
             PSGP P S+YEHSSIPATVKKIFNL +FLT+RDAWAGTFE ++TR++PR DCP  L EPV
Sbjct  358   PSGPSPTSQYEHSSIPATVKKIFNLPEFLTKRDAWAGTFEGLLTRSSPRTDCPVKLPEPV  417

Query  1285  KLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNK  1464
             KLR A A+E A L+E+Q+E+VQMAA L GDH K   YP KL ENMSV  A  Y   AFN 
Sbjct  418   KLREAPAQEKAKLSEFQEELVQMAATLNGDHRKS-IYPDKLTENMSVPDAVKYVEDAFNT  476

Query  1465  FLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGR  1617
             FL +CE A+Q G   D S +       S  + P   K+F    LSCI C R
Sbjct  477   FLNECEKAKQNG--ADESEIVDCADGCS--SAPPDSKNFFYNVLSCITCNR  523



>ref|XP_008796283.1| PREDICTED: non-specific phospholipase C4-like [Phoenix dactylifera]
Length=520

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/534 (67%), Positives = 424/534 (79%), Gaps = 22/534 (4%)
 Frame = +1

Query  40    PSSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNS  219
             P+  ++ G    IKTVVVLVQENRSFDH+LGWMKSLNPEI+GV G+ESNPL T+    + 
Sbjct  2     PAESLAQGG--QIKTVVVLVQENRSFDHILGWMKSLNPEIDGVTGQESNPLSTT----DP  55

Query  220   TNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKK-------LEPTMQGFAAN  378
              + V+ FG++S+YV PDPGHSIQ IYEQ++G P+S   AG+          P M GF   
Sbjct  56    NSPVIHFGDRSEYVVPDPGHSIQAIYEQVYGIPFS---AGETPITPPGVAAPPMNGFVQE  112

Query  379   AERNQAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGA  558
             AER + GMS  VMNG+ P AVPVY+ELVREFAVC+RWFAS+P+STQPNRLFVHSATSHG 
Sbjct  113   AEREKEGMSETVMNGYKPGAVPVYEELVREFAVCNRWFASMPSSTQPNRLFVHSATSHGL  172

Query  559   TSNDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHF  738
             TSNDTKKL+EG PQKTIF+S+ EAGYSFGIYYQYPPSTLFYRNLR+LKYI NFH FD+ F
Sbjct  173   TSNDTKKLVEGLPQKTIFDSLHEAGYSFGIYYQYPPSTLFYRNLRQLKYIGNFHGFDLDF  232

Query  739   KTHCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEML  918
             K HCKEGKLPNYVV+EQRYFDLKILPGNDDHPSHDV EGQK VKEVYEALRSSPQW E+L
Sbjct  233   KRHCKEGKLPNYVVIEQRYFDLKILPGNDDHPSHDVSEGQKLVKEVYEALRSSPQWREIL  292

Query  919   FLIIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVL  1098
             F++ YDEHGGFYDHVPTPV GVP+PD ++GP+P+ F+FDRLGVRVP I +SPWIE G V+
Sbjct  293   FIVTYDEHGGFYDHVPTPV-GVPSPDDIVGPEPFYFKFDRLGVRVPTIFISPWIEPGTVV  351

Query  1099  HGPSGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAE  1278
             H P GP+P+SE+EHSSIPATVKKIFNL +FLT+RDAWAGTFE+V+TRTTPR DCPE L E
Sbjct  352   HRPLGPYPSSEFEHSSIPATVKKIFNLKEFLTKRDAWAGTFESVLTRTTPRTDCPEVLPE  411

Query  1279  PVKLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAF  1458
             P K+R+ EA E A L+E+Q+E+VQ+ A L GD  KE  YPHKLVE M+VA+ A Y   AF
Sbjct  412   PKKMRTTEAAEHAKLSEFQQELVQLGAALNGDCTKE-IYPHKLVEGMTVAEGAQYVRDAF  470

Query  1459  NKFLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
               FL +CEN R++G  GD  +V +    P+     +K KSFA K  +C+ C ++
Sbjct  471   KTFLEECENCRKKG-KGDSHIVVVE---PAMEPVVQKKKSFAQKMFACLVCNQS  520



>gb|EYU40282.1| hypothetical protein MIMGU_mgv1a004614mg [Erythranthe guttata]
Length=518

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/516 (65%), Positives = 414/516 (80%), Gaps = 10/516 (2%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT+V+LVQENRSFDHMLGWMKS+NPEI+GV GKESNPL     A + T+  + + ++
Sbjct  8     YPIKTIVILVQENRSFDHMLGWMKSINPEIDGVTGKESNPL----SATDPTSTRLHYSHQ  63

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKK-LEPTMQGFAANAERNQAGMSGAVMNGF  426
             S  V PDPGHS +  YEQI+G  W+++SA    L PTM+GFA  AE    GM+  VM GF
Sbjct  64    SANVQPDPGHSFEATYEQIYGVKWTEESASSNDLAPTMEGFAQQAESINKGMADVVMTGF  123

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE++PVYKEL+ EFAVCDRWF+S+P  TQPNRLF+HSATS+GAT+NDTK +++G+PQKT
Sbjct  124   KPESLPVYKELITEFAVCDRWFSSIPTLTQPNRLFIHSATSYGATANDTKTMVKGYPQKT  183

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+DE G+ FGIYYQYPPSTL YRNLRKLKY++ FHQFD+HFK HCKEGKLPNYVV+E
Sbjct  184   IFESVDEGGFEFGIYYQYPPSTLLYRNLRKLKYVRKFHQFDLHFKKHCKEGKLPNYVVIE  243

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYF+ K +PGNDDHP HD+ EGQ F+KEVYEALRSSPQWNE+LF+I+YDEHGGFYDHVP
Sbjct  244   QRYFETKKIPGNDDHPPHDISEGQNFIKEVYEALRSSPQWNEILFVILYDEHGGFYDHVP  303

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPVTGVP+PDG++GP PY F+FDRLGVRVPAI++SPWIE G VLHGPSGP+P SE+EHSS
Sbjct  304   TPVTGVPSPDGIVGPDPYKFKFDRLGVRVPAILISPWIEPGTVLHGPSGPYPTSEFEHSS  363

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKKIFNL  FLT+RDAWAGTFE V+TRTTPR DCP TL E  K+R  EA E+A LT
Sbjct  364   IPATVKKIFNLKDFLTKRDAWAGTFECVLTRTTPRTDCPVTLTEAPKMRETEANEEAKLT  423

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLV-ENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             E+Q+E+VQ+ AVL GD+  E+ +PH ++ ++M+V +A DY   AF KFL DC++A + G 
Sbjct  424   EFQEEIVQLCAVLKGDYHTEEDFPHDILKKDMNVVEAVDYMGGAFRKFLDDCDSAVKNGA  483

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
                + V   ++QP       R  KSF++K  SC+ C
Sbjct  484   DESHIVCDHAEQP----NRKRLGKSFSSKVFSCLTC  515



>ref|XP_010240874.1| PREDICTED: non-specific phospholipase C4-like [Nelumbo nucifera]
Length=521

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/528 (68%), Positives = 414/528 (78%), Gaps = 15/528 (3%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKES--NPLPTSGGAQN  216
             +SE+++   FPIKTVVVLVQENRSFDHMLGWMK+LNPEI+GV+  +   N L T+    +
Sbjct  2     ASEVTNTKPFPIKTVVVLVQENRSFDHMLGWMKTLNPEIDGVSSGDEYYNLLSTT----D  57

Query  217   STNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQA  396
               +  V FGN+S+YVDPDPGHS Q IYEQ+FG PW Q S G K    M GFA NAE  Q 
Sbjct  58    PNSKRVYFGNRSEYVDPDPGHSFQAIYEQVFGVPWGQSSLGVK----MNGFAQNAENTQE  113

Query  397   GMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTK  576
             GMS  VMNGF PEAVPVYKELV EFAVCD WFAS+P STQPNR++VHSATSHG  SNDTK
Sbjct  114   GMSDTVMNGFRPEAVPVYKELVSEFAVCDHWFASIPTSTQPNRMYVHSATSHGLISNDTK  173

Query  577   KLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKE  756
             KLIEG PQKTIFES++EAG+SFGIYYQ PPSTLFYRNLRKLKYI  FHQFD+ FK HCKE
Sbjct  174   KLIEGLPQKTIFESLEEAGFSFGIYYQDPPSTLFYRNLRKLKYINKFHQFDLDFKRHCKE  233

Query  757   GKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYD  936
             GKLPNYVV+EQR+FD K+ P NDDHPSHD  EGQKFVK+VYE LR+SPQWNEM+F+IIYD
Sbjct  234   GKLPNYVVIEQRFFDSKLRPANDDHPSHDASEGQKFVKQVYETLRASPQWNEMIFIIIYD  293

Query  937   EHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGP  1116
             EHGGFYDHVPTP TGVP+PDG+   +P+ F+FDRLGVRVPAI +SPWIERG VLH PSGP
Sbjct  294   EHGGFYDHVPTP-TGVPSPDGIASSEPFYFKFDRLGVRVPAIFISPWIERGTVLHRPSGP  352

Query  1117  FPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLA-EPVKLR  1293
             +  SE+EHSSIPATVKKIFNL +FLT+RDAWAGTFETV+ R +PR DCP TLA EP KLR
Sbjct  353   YSTSEFEHSSIPATVKKIFNLKEFLTKRDAWAGTFETVLNRESPRTDCPVTLAVEPRKLR  412

Query  1294  SAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLG  1473
             +AEA E A L+E+Q+E+VQ+AA L GDH K D YPHKLVENM+V  A+ Y   AF KFL 
Sbjct  413   AAEANEGAKLSEFQEELVQLAATLNGDHRK-DIYPHKLVENMTVKDASKYCEEAFKKFLE  471

Query  1474  DCENARQRGIHGDYSVV--ALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              CEN ++     +  V+  A  + PP  +T P K KS   K  +C  C
Sbjct  472   GCENVKKGADESEIVVLPTAAVQSPPEDSTPPSKSKSSTRKMFACFVC  519



>ref|XP_009388407.1| PREDICTED: non-specific phospholipase C4-like [Musa acuminata 
subsp. malaccensis]
Length=523

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/519 (66%), Positives = 405/519 (78%), Gaps = 11/519 (2%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLVQENRSFDHMLGWMKS+NP I+GV     +  P S    NS    V FG++S+
Sbjct  12    IKTVVVLVQENRSFDHMLGWMKSINPAIDGVGNDREHYNPLSTADSNSRR--VYFGDQSE  69

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKK----LEPTMQGFAANAERNQAGMSGAVMNG  423
             YVDPDPGHSIQ IYEQ++G P+S  +        + P M GFA  AE+ + GMS  VMNG
Sbjct  70    YVDPDPGHSIQAIYEQVYGVPFSAGATPITPPGVVHPPMNGFAQQAEKEKPGMSSTVMNG  129

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F P AVPVY+ LVREFAVCDRWFASVP STQPNRL+VHSATS+G TSNDT KL EG PQ+
Sbjct  130   FRPAAVPVYESLVREFAVCDRWFASVPTSTQPNRLYVHSATSYGLTSNDTMKLAEGLPQR  189

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIF+S+DEAG+SFGIYYQYPPSTLFYRNLR+LKY+ NFHQFD+ FK HCK+GKLPNYVV+
Sbjct  190   TIFDSLDEAGFSFGIYYQYPPSTLFYRNLRRLKYVGNFHQFDMAFKDHCKKGKLPNYVVI  249

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRYFDLKILPGNDDHPSHDV +GQK VKE+YEALRSSPQWNE+LF+I YDEHGGF+DHV
Sbjct  250   EQRYFDLKILPGNDDHPSHDVSQGQKLVKEIYEALRSSPQWNEILFIITYDEHGGFFDHV  309

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTPV GVP+PD + GP+P+ F+FDRLGVRVPA+ +SPWIE G V+H PSGP+P SE+EHS
Sbjct  310   PTPV-GVPSPDDIAGPEPFYFKFDRLGVRVPALFISPWIEPGTVIHRPSGPYPASEFEHS  368

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             SIPATVKK+FNL +FLT+RDAWAGTFETV+TRTTPR DCPETL EP KLR   A E A L
Sbjct  369   SIPATVKKLFNLKEFLTKRDAWAGTFETVLTRTTPRTDCPETLPEPKKLRPTGAAETAKL  428

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E+VQ+ A L GD+ K D YP +LVENM+VA+ A Y   AF  FL +CE  R+ G 
Sbjct  429   SEFQTELVQLGASLNGDYAK-DIYPRRLVENMTVAEGAQYVQDAFKTFLEECERCRKDGD  487

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
              G + VV     P      P+  +S   K  SC++C R+
Sbjct  488   DGSHVVVV---NPTKDAVGPKGKRSLVEKMFSCLSCNRS  523



>gb|KFK38052.1| hypothetical protein AALP_AA3G064000 [Arabis alpina]
Length=545

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/545 (65%), Positives = 422/545 (77%), Gaps = 23/545 (4%)
 Frame = +1

Query  34    MGPSSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQ  213
             M  +++ S GS +PIKTVVVLVQENRSFDH LGW K LN EI+GV   +S+P        
Sbjct  1     MAETTKGSSGSSYPIKTVVVLVQENRSFDHTLGWFKELNREIDGVT--KSDPKSNLVSTS  58

Query  214   NSTNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERN  390
             +  +  V+FG++SQYVDPDPGHSIQDIYEQ+FG PW+ D       P TM GFA NAE+N
Sbjct  59    DPNSLRVVFGDQSQYVDPDPGHSIQDIYEQVFGKPWNSDHPVPNPGPATMSGFAQNAEKN  118

Query  391   QAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSND  570
             + GMS AVMNGF P+++PVYKELV+ FA+CDRWFASVPASTQPNRL+VHSATSHGATSND
Sbjct  119   KKGMSSAVMNGFKPDSLPVYKELVQNFAICDRWFASVPASTQPNRLYVHSATSHGATSND  178

Query  571   TKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHC  750
              K LIEGFPQKTIFES+DEAG+SFGIY+Q+PP+TLFYRNLRKLKY+ +FHQ+ I FK  C
Sbjct  179   KKLLIEGFPQKTIFESLDEAGFSFGIYHQFPPATLFYRNLRKLKYLTHFHQYGIQFKKDC  238

Query  751   KEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLII  930
             KEGKLPNYVV+EQR+FDL  +P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I 
Sbjct  239   KEGKLPNYVVIEQRWFDLLSIPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIIT  298

Query  931   YDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPS  1110
             YDEHGGFYDHVPTPV GVPNPDGL+GP PYNF+F+RLGVRVP   +SPWIE G VLHGP+
Sbjct  299   YDEHGGFYDHVPTPVDGVPNPDGLLGPSPYNFEFNRLGVRVPTFFISPWIEPGTVLHGPN  358

Query  1111  GPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKL  1290
             GP+P S+YEHSSIPATVKKIFNL  FLT+RD+WAGTFE+VITR +PR+DCPETL+ PVKL
Sbjct  359   GPYPRSQYEHSSIPATVKKIFNLKDFLTKRDSWAGTFESVITRDSPRQDCPETLSTPVKL  418

Query  1291  RSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             R++ AKE+A+L+E+Q+E+V MAA L GD+  E+   HKL +   VA A+ Y   AF KF+
Sbjct  419   RASVAKENAHLSEFQEELVLMAAGLKGDYKNEELV-HKLCKETCVADASKYVTNAFEKFI  477

Query  1471  GDCENARQRGIHGDYSVVALSK----------QPPS------PNTTPRKPK---SFATKF  1593
              + +NAR+RG   +  V  +            Q PS      P+    KPK   SF  K 
Sbjct  478   EESKNARERGCDENDIVYCMDDDDVNDDNVVIQSPSQSQSEVPHDAGPKPKIRTSFFNKI  537

Query  1594  LSCIA  1608
              SC+A
Sbjct  538   FSCLA  542



>ref|XP_010240876.1| PREDICTED: non-specific phospholipase C3-like [Nelumbo nucifera]
Length=522

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/524 (66%), Positives = 408/524 (78%), Gaps = 7/524 (1%)
 Frame = +1

Query  46    SEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTN  225
             SE S+    PIKTVVVLVQENRSFDHMLGWMKSLNPEI+GV G+E N L T+    NST 
Sbjct  3     SESSNSKPCPIKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGQEYNLLSTTD--PNSTR  60

Query  226   DVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS  405
               V FG++S++VDPDPGHS   IYEQ+FG PW Q S+G     TM GF   AE  Q G+S
Sbjct  61    --VYFGDRSEFVDPDPGHSFDAIYEQVFGVPWGQSSSGDVKVATMNGFVQQAESVQKGLS  118

Query  406   GAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLI  585
               VMNGF PE VPV+KELV EFAVCDRWFAS+P  TQPNRLF+HSATSHG  +N+TKKLI
Sbjct  119   EVVMNGFRPEVVPVFKELVMEFAVCDRWFASIPTLTQPNRLFIHSATSHGIVNNETKKLI  178

Query  586   EGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKL  765
              GFPQKTIF+S+DEAG+SFGIYYQYPPSTLFYRNLRKLKY+KNFHQ+D+ FK HC+EGKL
Sbjct  179   HGFPQKTIFDSLDEAGFSFGIYYQYPPSTLFYRNLRKLKYVKNFHQYDLEFKRHCEEGKL  238

Query  766   PNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHG  945
             PNYVV+EQRYF  K++PGNDDHPSHD+ EGQK VK+VYEALR+SPQWNE+LFLI YDEHG
Sbjct  239   PNYVVIEQRYFGTKLIPGNDDHPSHDIAEGQKLVKQVYEALRASPQWNEILFLITYDEHG  298

Query  946   GFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPN  1125
             GFYDHVPTP TGVP+PD ++    + FQFDRLGVRVP I++SPWIE   VLH P+GP+P 
Sbjct  299   GFYDHVPTP-TGVPSPDDIVSDDSFKFQFDRLGVRVPTILISPWIEPATVLHRPAGPYPT  357

Query  1126  SEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSA-E  1302
             SE+EHSSIPATVKKIFNL +FLT+RDAWAGTF+ V+ R TPR DCP TL EPVKLR+A +
Sbjct  358   SEFEHSSIPATVKKIFNLKEFLTKRDAWAGTFDVVLNRETPRTDCPVTLPEPVKLRAAGD  417

Query  1303  AKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCE  1482
             A E+A L+++Q+++VQMAA L GDH  +D   H L+E M VA A +Y   AF KFL  CE
Sbjct  418   ANEEATLSDFQEQLVQMAATLKGDHGNDDISSHNLIEGMKVAGAVNYIEDAFKKFLDGCE  477

Query  1483  NARQRGI-HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             +A+++G    +  V+  +         P K KSF  K  +C+AC
Sbjct  478   DAKKKGSDESEIVVLTTTTPTTEEEPPPSKSKSFIHKMCACLAC  521



>gb|KHN00001.1| Phospholipase C 3 [Glycine soja]
Length=517

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/525 (65%), Positives = 412/525 (78%), Gaps = 13/525 (2%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNST  222
             SS  +  + +PIKT+VVLVQENRSFDHMLGWMKSLNPEI+GV G ESN + T     N  
Sbjct  3     SSSGTSATPYPIKTIVVLVQENRSFDHMLGWMKSLNPEIDGVTGLESNQVSTFDPNSNR-  61

Query  223   NDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGM  402
                V FG++S + +PDPGH+++D+YEQ+FG PWS+ SA  KL P M+GFA N+ + + G 
Sbjct  62    ---VYFGDQSGFEEPDPGHTVEDVYEQVFGEPWSESSAANKLSPRMKGFAQNSAKQKKGS  118

Query  403   SG-AVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKK  579
             +   VMNG+ P+ +PVYKELV+EFAVCDRWFASVP  TQPNRL+VHSATSHG T+ DTKK
Sbjct  119   TAETVMNGYKPDLLPVYKELVKEFAVCDRWFASVPGPTQPNRLYVHSATSHGLTTQDTKK  178

Query  580   LIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEG  759
             LI G PQKTIF+S+DE G+SFGIYYQYPPSTLF+RNLRKLKYI NFHQFD+ FK  CKEG
Sbjct  179   LIGGLPQKTIFDSLDENGFSFGIYYQYPPSTLFFRNLRKLKYIDNFHQFDLKFKKQCKEG  238

Query  760   KLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDE  939
             KLPNYVV+EQRYFDL  LP NDDHPSHDV EGQKFVKEVYEALR+SPQWNEMLF+IIYDE
Sbjct  239   KLPNYVVIEQRYFDLLSLPANDDHPSHDVAEGQKFVKEVYEALRASPQWNEMLFVIIYDE  298

Query  940   HGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPF  1119
             HGGFYDHVPTPV GVP+PD + GP+P+ FQFDRLGVRVP I++SPWIE GKVLH PSGPF
Sbjct  299   HGGFYDHVPTPVDGVPSPDDIAGPEPFKFQFDRLGVRVPTIIISPWIEAGKVLHEPSGPF  358

Query  1120  PNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLR-S  1296
             P S+YEHSSIPATVKKIFNL QFLT+RDAWAGT E +++ +TPR DCP  L +PVKLR +
Sbjct  359   PTSQYEHSSIPATVKKIFNLPQFLTKRDAWAGTLEDLLSLSTPRTDCPVKLPDPVKLREA  418

Query  1297  AEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGD  1476
             A A++   L+E+Q++++ MAA L GDH K  Y  HKL EN++V++A  Y   AF  FL +
Sbjct  419   ASAEQQTQLSEFQEDLIYMAATLNGDHNKSIY--HKLTENLTVSEAVKYCEDAFGTFLNE  476

Query  1477  CENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             CE A++        +V  ++    P+T P+  K+F  K LSCI C
Sbjct  477   CEKAKKSNRIDGSEIVYCAR----PHTAPQS-KNFWHKMLSCILC  516



>ref|XP_003547754.1| PREDICTED: non-specific phospholipase C4-like [Glycine max]
Length=517

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/525 (65%), Positives = 411/525 (78%), Gaps = 13/525 (2%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNST  222
             SS  +  + +PIKT+VVLVQENRSFDHMLGWMKSLN EI+GV G ESN + T     N  
Sbjct  3     SSSGTSATPYPIKTIVVLVQENRSFDHMLGWMKSLNREIDGVTGLESNQVSTFDPNSNR-  61

Query  223   NDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGM  402
                V FG++S + +PDPGH+++D+YEQ+FG PWS+ SA  KL P M+GFA N+ + + G 
Sbjct  62    ---VYFGDQSGFEEPDPGHTVEDVYEQVFGEPWSESSAANKLSPRMKGFAQNSAKQKKGS  118

Query  403   SG-AVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKK  579
             +   VMNG+ P+ +PVYKELV+EFAVCDRWFASVP  TQPNRL+VHSATSHG T+ DTKK
Sbjct  119   TAETVMNGYKPDLLPVYKELVKEFAVCDRWFASVPGPTQPNRLYVHSATSHGLTTQDTKK  178

Query  580   LIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEG  759
             LI G PQKTIF+S+DE G+SFGIYYQYPPSTLF+RNLRKLKYI NFHQFD+ FK  CKEG
Sbjct  179   LIGGLPQKTIFDSLDENGFSFGIYYQYPPSTLFFRNLRKLKYIDNFHQFDLKFKKQCKEG  238

Query  760   KLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDE  939
             KLPNYVV+EQRYFDL  LP NDDHPSHDV EGQKFVKEVYEALR+SPQWNEMLF+IIYDE
Sbjct  239   KLPNYVVIEQRYFDLLSLPANDDHPSHDVAEGQKFVKEVYEALRASPQWNEMLFVIIYDE  298

Query  940   HGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPF  1119
             HGGFYDHVPTPV GVP+PD + GP+P+ FQFDRLGVRVP I++SPWIE GKVLH PSGPF
Sbjct  299   HGGFYDHVPTPVDGVPSPDDIAGPEPFKFQFDRLGVRVPTIIISPWIEAGKVLHEPSGPF  358

Query  1120  PNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLR-S  1296
             P S+YEHSSIPATVKKIFNL QFLT+RDAWAGT E +++ +TPR DCP  L +PVKLR +
Sbjct  359   PTSQYEHSSIPATVKKIFNLPQFLTKRDAWAGTLEDLLSLSTPRTDCPVKLPDPVKLREA  418

Query  1297  AEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGD  1476
             A A++   L+E+Q++++ MAA L GDH K  Y  HKL EN++V++A  Y   AF  FL +
Sbjct  419   ASAEQQTQLSEFQEDLIYMAATLNGDHNKSIY--HKLTENLTVSEAVKYCEDAFGTFLNE  476

Query  1477  CENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             CE A+Q        +V  ++    P+T P+  K+F  K LSCI C
Sbjct  477   CEKAKQSNRIDGSEIVYCAR----PHTAPQS-KNFWHKMLSCILC  516



>emb|CBI38061.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/494 (67%), Positives = 398/494 (81%), Gaps = 11/494 (2%)
 Frame = +1

Query  136   MKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGA  315
             MKSLNPEI+GV G ESNP+ TS    +  + VV F + + YVDPDPGHS + IYEQ+FG 
Sbjct  1     MKSLNPEIDGVTGAESNPISTS----DPNSPVVHFTDDAGYVDPDPGHSFEAIYEQVFGR  56

Query  316   PWSQDSAGKK--LEPTMQGFAANAERNQAGMSGAVMNGFVPEAVPVYKELVREFAVCDRW  489
             PW  DSA     L PTM GFA  AE  + G+S  VM G  PEA+PV+ ELV EF VCDRW
Sbjct  57    PWPADSAASSEPLRPTMDGFAQQAEAKEKGLSKTVMKGLKPEALPVFSELVAEFGVCDRW  116

Query  490   FASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPS  669
             FAS+PA TQPNRL+VHSATS+GAT N+T+ L +G+PQKTIFES++E+G+SFGIYYQYPPS
Sbjct  117   FASLPAETQPNRLYVHSATSYGATGNNTEMLAKGYPQKTIFESLEESGFSFGIYYQYPPS  176

Query  670   TLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVF  849
             TLFYRNLRKLKYI NFHQFD+ FK HC+EGKLPNYVV+EQRYFD K+LP NDDHPSHDV 
Sbjct  177   TLFYRNLRKLKYIDNFHQFDLDFKRHCEEGKLPNYVVIEQRYFDTKLLPANDDHPSHDVS  236

Query  850   EGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQ  1029
             +GQKFVK VYEALR+SPQWN++LF+IIYDEHGGFYDHVPTPVTGVP+PD ++GP+PYNF+
Sbjct  237   QGQKFVKHVYEALRASPQWNDILFVIIYDEHGGFYDHVPTPVTGVPSPDDIVGPEPYNFR  296

Query  1030  FDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAW  1209
             FDRLGVRVPAI++SPWIERG VLHGPSGP+P SE+EHSSIPATVKK+FNL +FLT+RDAW
Sbjct  297   FDRLGVRVPAILISPWIERGTVLHGPSGPYPTSEFEHSSIPATVKKLFNLKEFLTKRDAW  356

Query  1210  AGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKED  1389
             AGTFE V+TR TPR DCP TL EPVKLR  EAK++A L+E+Q+E+VQMAA L GDH K D
Sbjct  357   AGTFEGVLTRETPRTDCPVTLPEPVKLRETEAKDEAELSEFQQELVQMAAALKGDHRK-D  415

Query  1390  YYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRK  1569
              YPHKLV++M+V+ A  Y + AFN+FL +C+ A+  G H    +V   + PP   ++   
Sbjct  416   IYPHKLVQDMNVSDATKYVNNAFNQFLDECQKAKTSGTHDSSDIVLCPQTPPKRTSS---  472

Query  1570  PKSFATKFLSCIAC  1611
              KSFA K  SC+ C
Sbjct  473   -KSFAHKLFSCLIC  485



>ref|XP_010691938.1| PREDICTED: non-specific phospholipase C4-like [Beta vulgaris 
subsp. vulgaris]
Length=515

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/512 (67%), Positives = 398/512 (78%), Gaps = 8/512 (2%)
 Frame = +1

Query  67    IFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGN  246
             ++PIKTVV+LV ENRSFDHMLGWMK LNPEI+GV G+ESNPL T+       N    FG+
Sbjct  9     VYPIKTVVLLVMENRSFDHMLGWMKPLNPEIDGVTGQESNPLNTTDPNSARIN----FGD  64

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
              S +VDP+PGHS QDIYEQ++G PWS +SA K   PTMQGFA NA R Q+GM   VMNGF
Sbjct  65    GSVFVDPNPGHSFQDIYEQLYGEPWSPESAEKTRPPTMQGFAQNANRIQSGMDATVMNGF  124

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYKELV +FAVCDRWFAS+PASTQPNRL+VHSATSHG   ND+KKL  G PQKT
Sbjct  125   KPDLVPVYKELVTQFAVCDRWFASMPASTQPNRLYVHSATSHGLIGNDSKKLNAGMPQKT  184

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+DEA +SFGIYYQ  PSTL+Y+NLRKLK+   FH FD+ FK HCK GKLPNYVV+E
Sbjct  185   IFDSLDEANHSFGIYYQSAPSTLYYKNLRKLKHATKFHPFDLTFKNHCKNGKLPNYVVIE  244

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
              RYFDL +LPGNDDHPSHDV  GQKF+KEVYEALRSSPQWNEMLF+I+YDEHGGFYDHVP
Sbjct  245   PRYFDLLVLPGNDDHPSHDVSTGQKFIKEVYEALRSSPQWNEMLFMIVYDEHGGFYDHVP  304

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP  GVPNPD LIGP PYNF+FDRLGVRVPA+ +SPWIE G VLH PSGP P S+YEHSS
Sbjct  305   TPTQGVPNPDDLIGPGPYNFKFDRLGVRVPAMFISPWIEPGTVLHTPSGPQPTSQYEHSS  364

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKK+FNL  FLT+RDAWAGTFE V  RT+PR DCP TL EP +LRS +AKED  L+
Sbjct  365   IPATVKKLFNLKDFLTKRDAWAGTFEVVCNRTSPRTDCPVTLPEPTRLRSFDAKEDKKLS  424

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             ++Q+E+VQ+AA L GD+   D    K ++ M+VA AA+YS+ AF  F+ +C  A+Q G  
Sbjct  425   DFQEELVQLAASLKGDNNIID----KPLDEMTVAHAAEYSNEAFKIFMDECAKAKQNGAA  480

Query  1507  GDYSVVALSKQPPSPNTTPRKPKSFATKFLSC  1602
              D  VV  S +    N    KPKSF  K  SC
Sbjct  481   EDSIVVVPSTEQDIINKDNPKPKSFIDKLFSC  512



>ref|XP_010511520.1| PREDICTED: non-specific phospholipase C4-like [Camelina sativa]
Length=534

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/529 (66%), Positives = 407/529 (77%), Gaps = 15/529 (3%)
 Frame = +1

Query  55    SDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVV  234
             S GS FPIKTVVVLVQENRSFDH LGW K LN +I+GV   +    P S    NS    V
Sbjct  7     SSGS-FPIKTVVVLVQENRSFDHTLGWFKELNRKIDGVTKSDPKSNPVSSSDPNSLG--V  63

Query  235   LFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERNQAGMSGA  411
             +FG++SQYVDPDPGHSIQDIYEQ+FG PW          P TM GFA NAERN+ GMS A
Sbjct  64    VFGDQSQYVDPDPGHSIQDIYEQVFGKPWDSGKPDPNPGPATMSGFAQNAERNKKGMSSA  123

Query  412   VMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEG  591
             VMNGF P+A+PVYKELV+ FA+CDRWFASVPASTQPNRL+VHSATSHGATSND K LIEG
Sbjct  124   VMNGFKPDALPVYKELVQNFAICDRWFASVPASTQPNRLYVHSATSHGATSNDKKLLIEG  183

Query  592   FPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPN  771
             FPQKTIFES+DEAG SFGIY+Q+PPSTLFYRNLRKLKY+  FHQ+ I FK  CKEGKLPN
Sbjct  184   FPQKTIFESLDEAGLSFGIYHQFPPSTLFYRNLRKLKYLTRFHQYGIQFKKDCKEGKLPN  243

Query  772   YVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGF  951
             YVVVEQR+FDL   P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHGGF
Sbjct  244   YVVVEQRWFDLLSTPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIITYDEHGGF  303

Query  952   YDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSE  1131
             YDHVPTP+ GVPNPDG++GP PYNF+F+RLGVRVP   +SPWIE G V+HGP+GP+P S+
Sbjct  304   YDHVPTPIDGVPNPDGILGPPPYNFEFNRLGVRVPTFFISPWIEPGTVIHGPNGPYPRSQ  363

Query  1132  YEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKE  1311
             YEHSSIPATVKKIFNL  FLT+RD+WAGTFE+VI+R +PR+DCPETL+ PVKLR+  AKE
Sbjct  364   YEHSSIPATVKKIFNLKDFLTKRDSWAGTFESVISRDSPRQDCPETLSTPVKLRATRAKE  423

Query  1312  DANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENAR  1491
             +A+L+E+Q+E+V MAA L GD+  E+   HKL +   VA A+ Y   AF+KF+ +   AR
Sbjct  424   NAHLSEFQEELVIMAAGLKGDYKNEELI-HKLCKETCVADASKYVTNAFDKFMEESRKAR  482

Query  1492  QRGI----------HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIA  1608
             +RG             D+ V     + P+    P+  +SF +K  SC  
Sbjct  483   ERGCDENDIVYCNDDDDHVVTPTHSEAPNAVPEPKIQRSFFSKLFSCFV  531



>ref|XP_006838555.1| hypothetical protein AMTR_s00002p00204300 [Amborella trichopoda]
 gb|ERN01124.1| hypothetical protein AMTR_s00002p00204300 [Amborella trichopoda]
Length=515

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/517 (68%), Positives = 408/517 (79%), Gaps = 20/517 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGWMKS+NPEI+GV GKE NPL TS    +  +  V FGN S
Sbjct  9     PIKTVVVLVQENRSFDHMLGWMKSINPEIDGVTGKEWNPLSTS----DPNSGRVYFGNNS  64

Query  253   QYVDPDPGHSIQDIYEQIFG--APWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
             +YV+PDPGHS Q + EQIFG  A    D +G   +P M GFA  AE  Q  MS  VMNGF
Sbjct  65    EYVNPDPGHSFQAVREQIFGVNAEIPSDFSG---DPPMNGFAQQAESEQKNMSQTVMNGF  121

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PEAVP+YK LV EFAV DRWFASVPASTQPNRL+VHSATSHGA SND+KKL++GFPQKT
Sbjct  122   KPEAVPIYKSLVSEFAVFDRWFASVPASTQPNRLYVHSATSHGAMSNDSKKLLQGFPQKT  181

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+DEAGY+F IYYQYPPST FY+NLRKLKY+ NF  FD+ FK  C++GKL NYVV+E
Sbjct  182   IFESLDEAGYTFRIYYQYPPSTFFYKNLRKLKYVGNFRPFDLEFKRDCEQGKLANYVVIE  241

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QR+FDLKIL GNDDHPSHDV EGQ+FVKEVYEALR SPQWNEM+F+I YDEHGGFYDHVP
Sbjct  242   QRWFDLKILHGNDDHPSHDVSEGQRFVKEVYEALRKSPQWNEMVFIITYDEHGGFYDHVP  301

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP+ GVPNPDGLIG +PYNF+FDRLGVRVPAI++SPWIE+G V+H PSGP+P SEYEHSS
Sbjct  302   TPIRGVPNPDGLIGGEPYNFKFDRLGVRVPAIVISPWIEKGTVVHRPSGPYPTSEYEHSS  361

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             IPATVKKIFNL  FLT+RDAWAGTFE ++ TRTTPR DCP TL EP K + ++  E A L
Sbjct  362   IPATVKKIFNLKDFLTKRDAWAGTFEHILHTRTTPRTDCPVTLHEPQKTQKSKPNEHAKL  421

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q ++VQ+AA L GDH K D YP ++VENM+V +AA Y   A   FLG CE AR+ G+
Sbjct  422   SEFQGDLVQLAAQLNGDHHK-DAYPDEMVENMTVKEAAKYVQDALATFLGACEEARKNGM  480

Query  1504  -HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
                +  +++L K+P S        KSF  K+ SC+AC
Sbjct  481   DESEIVLLSLLKEPTS--------KSFFHKWFSCLAC  509



>ref|XP_010463802.1| PREDICTED: non-specific phospholipase C4 isoform X1 [Camelina 
sativa]
 ref|XP_010463803.1| PREDICTED: non-specific phospholipase C4 isoform X2 [Camelina 
sativa]
Length=535

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/530 (65%), Positives = 404/530 (76%), Gaps = 16/530 (3%)
 Frame = +1

Query  55    SDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVV  234
             S GS +PIKTVVVLVQENRSFDH LGW K LN EI+GV   +    P S    NS    V
Sbjct  7     SSGS-YPIKTVVVLVQENRSFDHTLGWFKELNREIDGVTKSDPKSNPVSSSDPNSLG--V  63

Query  235   LFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERNQAGMSGA  411
             +FG++SQYVDPDPGHSIQDIYEQ+FG PW          P TM GFA NAERN+ GMS A
Sbjct  64    VFGDQSQYVDPDPGHSIQDIYEQVFGKPWDSGKPNPNPGPATMSGFAQNAERNKKGMSSA  123

Query  412   VMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEG  591
             VMNGF P+A+PVYKELV+ FA+CDRWFASVPASTQPNRL+VHSATSHGATSND K LIEG
Sbjct  124   VMNGFKPDALPVYKELVQNFAICDRWFASVPASTQPNRLYVHSATSHGATSNDKKLLIEG  183

Query  592   FPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPN  771
             FPQKTIFES+DEAG SFGIY+Q+PPSTLFYRNLRKLKY+  FHQ+ I FK  CKEGKLPN
Sbjct  184   FPQKTIFESLDEAGLSFGIYHQFPPSTLFYRNLRKLKYLTRFHQYGIQFKKDCKEGKLPN  243

Query  772   YVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGF  951
             YVVVEQR+FDL   P NDDHPSHDV +GQK VKEVYEALRSSPQWNE+LF+I YDEHGGF
Sbjct  244   YVVVEQRWFDLLSTPANDDHPSHDVSKGQKLVKEVYEALRSSPQWNEILFIITYDEHGGF  303

Query  952   YDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSE  1131
             YDHVPTP+ GVPNPDG++GP PYNF+F+RLGVRVP   +SPWIE G V+HGP+GP+P S+
Sbjct  304   YDHVPTPIDGVPNPDGILGPPPYNFEFNRLGVRVPTFFISPWIEPGTVIHGPNGPYPRSQ  363

Query  1132  YEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKE  1311
             YEHSSIPATVKKIF L  FLT+RD+WAGTFE+VITR +PR DCPETL+ PVKLR+  AKE
Sbjct  364   YEHSSIPATVKKIFKLKDFLTKRDSWAGTFESVITRDSPRLDCPETLSTPVKLRATVAKE  423

Query  1312  DANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENAR  1491
             +A L+E+Q+E+V MAA L GD+  E+   HKL +   VA A+ Y   AF+KF+ +   AR
Sbjct  424   NAQLSEFQEELVIMAAGLKGDYKNEELI-HKLCKETCVADASKYVTNAFDKFMEESRKAR  482

Query  1492  QRGI-----------HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIA  1608
             +RG              D+ V     + P+    P+  +SF +K  SC  
Sbjct  483   ERGCDENDIVYCNDDDDDHVVTPTHSEAPNAAPKPKTQRSFFSKLFSCFV  532



>ref|XP_004138997.1| PREDICTED: phospholipase C 3-like [Cucumis sativus]
Length=529

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/515 (68%), Positives = 393/515 (76%), Gaps = 9/515 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKE--SNPLPTSGGAQNSTNDVVLFGN  246
             PIKT+V+LVQENRSFDHMLGWMK+LNP+I+GV  +   SNP+ TS     S    + FGN
Sbjct  20    PIKTIVILVQENRSFDHMLGWMKTLNPKIDGVTNQTQFSNPISTSHPNSQS----IPFGN  75

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
              S +VDPDPGHSIQDIYEQ+F  PWS D       P+MQGFA NAER Q GMS  VMNGF
Sbjct  76    ASAFVDPDPGHSIQDIYEQVFAHPWS-DDLHPLPPPSMQGFAQNAERIQKGMSATVMNGF  134

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PEAVPV+KELV EF VCDRWFASVPA TQPNRLF+HSATS G TSNDTK+LIEG PQKT
Sbjct  135   KPEAVPVFKELVAEFGVCDRWFASVPAETQPNRLFLHSATSFGLTSNDTKQLIEGLPQKT  194

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES++E G+SFGIYYQY P+TLFYRNLRKLKYIKNFH FD+ FK  C+EGKLPNYVV+E
Sbjct  195   IFESLEEEGFSFGIYYQYFPATLFYRNLRKLKYIKNFHIFDLDFKRDCREGKLPNYVVIE  254

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFDL  LPGNDDHPSHDV EGQK +KEVYEALRS PQWNE+LFLI YDEHGGF+DHVP
Sbjct  255   QRYFDLASLPGNDDHPSHDVSEGQKLIKEVYEALRSCPQWNEILFLITYDEHGGFFDHVP  314

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
              P  GVPNPDG +GP PYNF FDRLG+RVP I VSPWIE G V+H P GP P SE+EHSS
Sbjct  315   PPSAGVPNPDGRLGPPPYNFNFDRLGLRVPTIFVSPWIEPGTVVHRPRGPDPTSEFEHSS  374

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKKIF L QFLT+RD WAGTF+ V+ R TPR DCP TL  PVKLR  EA E   ++
Sbjct  375   IPATVKKIFGLKQFLTKRDQWAGTFDIVLNRHTPRTDCPVTLNNPVKLRDVEANEMRQIS  434

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+E+VQ+AAVL GD  KE  YP KLVE MSV +AA Y   A   F  +CE A++ G  
Sbjct  435   EFQEELVQLAAVLRGDGKKE-IYPKKLVEKMSVVEAASYCENALKSFFNECEKAKENGA-  492

Query  1507  GDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              +  VV   K       +  KPKS A KF +C AC
Sbjct  493   DESQVVVCGKNNQILQPSNSKPKSLARKFFACFAC  527



>emb|CDY49947.1| BnaCnng18570D [Brassica napus]
Length=536

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/526 (65%), Positives = 403/526 (77%), Gaps = 16/526 (3%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT+VVLVQENRSFDHMLGW K LN EI+GV   +    P S    NS +  V+FG++
Sbjct  11    YPIKTIVVLVQENRSFDHMLGWFKELNQEIDGVTKSDPKSNPVSSSDPNSLH--VVFGDQ  68

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERNQAGMSGAVMNGF  426
             SQYVDPDPGHSIQDIYEQ+FG PW          P TM GFA NAERN+ GMS AVMNGF
Sbjct  69    SQYVDPDPGHSIQDIYEQVFGKPWDASHPDPNPGPATMSGFAQNAERNKTGMSSAVMNGF  128

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+A+ VYKELV+ FA+CDRWFASVPASTQPNRLFVHS TSHGA+SND K LIEGFPQKT
Sbjct  129   KPDALAVYKELVQNFAICDRWFASVPASTQPNRLFVHSGTSHGASSNDRKLLIEGFPQKT  188

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+DEAG+SFGIY+Q+PP+TLFYRNLRKLKY+ +FHQ+ + FK  C+EGKLPNYVVVE
Sbjct  189   IFESLDEAGFSFGIYHQFPPATLFYRNLRKLKYLTHFHQYGLQFKKDCREGKLPNYVVVE  248

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QR+FDL + P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHGGFYDHVP
Sbjct  249   QRWFDLLLTPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIITYDEHGGFYDHVP  308

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPV GVPNPDGL+GP+PYNF+F+RLGVRVP   +SPWIE G VLH P+GP+P S+YEHSS
Sbjct  309   TPVEGVPNPDGLLGPEPYNFEFNRLGVRVPTFFISPWIEPGTVLHVPNGPYPRSQYEHSS  368

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKKIFNL  FLT+RD+WAGTFE++ITR +PR+DCP TL+ PVKLR+  A+E A L+
Sbjct  369   IPATVKKIFNLKDFLTKRDSWAGTFESLITRDSPRQDCPATLSIPVKLRATVAEESAQLS  428

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E Q+++V MAA L GD+  E+   HKL +   VA A+ Y   AF+KFL +   AR+RG  
Sbjct  429   EIQEDLVIMAAGLKGDYKNEELM-HKLCKETCVADASKYVINAFDKFLEEARKARERGCD  487

Query  1507  GDYSVVAL------------SKQPPSPNTTPRKPKSFATKFLSCIA  1608
              +  V  +            S Q  +P+  P    SF  K  SC A
Sbjct  488   ENEIVYCMDDDDDDHAEMPSSSQSEAPHAGPTPKASFFNKLFSCFA  533



>ref|XP_010056549.1| PREDICTED: non-specific phospholipase C3-like [Eucalyptus grandis]
 gb|KCW73322.1| hypothetical protein EUGRSUZ_E01780 [Eucalyptus grandis]
Length=520

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/516 (66%), Positives = 403/516 (78%), Gaps = 14/516 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVV+LVQENRSFDHMLGWMKSLNP+I+GV G +SNPL  +    +S +  V FGN +
Sbjct  14    PIKTVVILVQENRSFDHMLGWMKSLNPDIDGVDGTQSNPLSVA----DSNSLRVTFGNSA  69

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQ-DSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
              YVDPDP HS Q IYEQ+FG PW    S  K L P M+GFA NAER Q G+S  VMNGF 
Sbjct  70    VYVDPDPDHSFQAIYEQVFGEPWDDATSPSKNLLPAMEGFAQNAERKQQGLSEFVMNGFR  129

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PEAVPVY+EL  EFAVCDRWFAS+P STQPNRL+VH+ATS GAT NDT+KL EG+PQ+T+
Sbjct  130   PEAVPVYRELASEFAVCDRWFASIPTSTQPNRLYVHAATSCGATGNDTQKLAEGYPQRTV  189

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FESM EAG+SFGIYY YPPSTL YRNLRK KY+K+FHQFD+HFK H KEGKLPNY V+EQ
Sbjct  190   FESMHEAGHSFGIYYAYPPSTLCYRNLRKPKYLKHFHQFDLHFKRHAKEGKLPNYTVIEQ  249

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYF+L  +PGNDDHPSHD+ EGQKFVKEVYEALRSSPQWNE+LF+I+YDEHGGFYDHVPT
Sbjct  250   RYFELSHIPGNDDHPSHDISEGQKFVKEVYEALRSSPQWNEILFVIVYDEHGGFYDHVPT  309

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVP+PDG++GP PY+F FDRLGVRVPAI+VSPWIE G VLH PSGP+P S++EHSSI
Sbjct  310   PVEGVPSPDGIVGPAPYSFNFDRLGVRVPAILVSPWIEPGTVLHEPSGPYPTSQFEHSSI  369

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETV--ITRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIFNL  FLT+RD WAGTF+ V  + RT+PR DCP TL +PVKLR +  KE A L
Sbjct  370   PATVKKIFNLPSFLTKRDEWAGTFDVVLNLNRTSPRTDCPVTLPDPVKLRESGPKEAAQL  429

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
              ++Q+++VQ+AA + GDH K+D YPHKLVENM+V +A  Y   AF  F  + E A + G 
Sbjct  430   NDFQEQLVQLAATMNGDH-KKDIYPHKLVENMTVVEAVKYVESAFEMFCREREEASEIG-  487

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
               D SV   + +   P +      +F  +  SC+ C
Sbjct  488   SNDASVDGQADESTRPAS-----GNFFQRLFSCVIC  518



>ref|XP_007029810.1| Non-specific phospholipase C3 [Theobroma cacao]
 gb|EOY10312.1| Non-specific phospholipase C3 [Theobroma cacao]
Length=513

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/524 (64%), Positives = 404/524 (77%), Gaps = 13/524 (2%)
 Frame = +1

Query  46    SEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTN  225
             +E S  +  PIKTVVVLVQENRSFDHMLGW K+LNPEI+GV G ESNP+ TS    +  +
Sbjct  3     AEASSTTSSPIKTVVVLVQENRSFDHMLGWFKTLNPEIDGVTGSESNPISTS----DPNS  58

Query  226   DVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS  405
               + F + + YVDPDP HS Q IYEQ+ G PW  ++     E  M GF  NAER QAG+S
Sbjct  59    AQLTFQDTAGYVDPDPDHSFQAIYEQVSGKPWDTNNPDPNPEIKMNGFVQNAERTQAGLS  118

Query  406   GAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLI  585
               VMNGF PEAVPV+KELV EFAVCDRWFAS+PASTQPNRL+VHSATSHGA SN+T++LI
Sbjct  119   ETVMNGFKPEAVPVFKELVTEFAVCDRWFASLPASTQPNRLYVHSATSHGAMSNNTQQLI  178

Query  586   EGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKL  765
             EGFPQKTIFES++E GYSFGIYYQ  PST FYR LR+LKY+ NFHQ+D+ FK HC++GKL
Sbjct  179   EGFPQKTIFESLEENGYSFGIYYQSFPSTAFYRTLRRLKYVDNFHQYDLSFKRHCEKGKL  238

Query  766   PNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHG  945
             PNYVV+E RYFD+     NDDHPSHDV EGQK VKE+YEALRSSPQWNE+LFL+IYDEHG
Sbjct  239   PNYVVIEPRYFDILTAAANDDHPSHDVSEGQKLVKEIYEALRSSPQWNEILFLVIYDEHG  298

Query  946   GFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPN  1125
             GFYDHVPTP TGVP+PD ++GP+PYNF+FDRLG RVPAIMVSPWIERG VLH PSGP P 
Sbjct  299   GFYDHVPTP-TGVPSPDDVVGPEPYNFKFDRLGCRVPAIMVSPWIERGTVLHRPSGPDPT  357

Query  1126  SEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEA  1305
             SE+EHSSI ATVK+IFNL +FLT+RDAWAG+F+ V+ R++PR DCPE L EPV++R  +A
Sbjct  358   SEFEHSSIAATVKRIFNLKEFLTKRDAWAGSFDIVVNRSSPRTDCPEKLPEPVRMRDTDA  417

Query  1306  KEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCEN  1485
             KE A L+++Q+E+VQ AA L GDH+K D YP KLVENM+V+    Y   AF KF  D + 
Sbjct  418   KETAKLSDFQEELVQAAAALNGDHLK-DIYPFKLVENMTVSSGLKYVEDAFKKFYDDGQK  476

Query  1486  ARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGR  1617
             A++  I+G    ++   QP    T     K+F  K  SC+ C +
Sbjct  477   AKE--INGAGDSLSADAQPTRTTT-----KTFMQKVFSCLVCDQ  513



>emb|CDY21204.1| BnaA01g34350D [Brassica napus]
Length=541

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/531 (65%), Positives = 405/531 (76%), Gaps = 21/531 (4%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT+VVLVQENRSFDHMLGW K LN EI+GV   +    P S    NS +  V+FG++
Sbjct  11    YPIKTIVVLVQENRSFDHMLGWFKELNQEIDGVTKSDPKSNPVSSSDPNSLH--VVFGDQ  68

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERNQAGMSGAVMNGF  426
             SQYVDPDPGHSIQDIYEQ+FG PW          P TM GFA NAERN+ GMS AVMNGF
Sbjct  69    SQYVDPDPGHSIQDIYEQVFGKPWDASHPDPNPGPATMSGFAQNAERNKTGMSSAVMNGF  128

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+A+ VYKELV+ FA+CDRWFASVPASTQPNRLFVHS TSHGA+SND K LIEGFPQKT
Sbjct  129   KPDALAVYKELVQNFAICDRWFASVPASTQPNRLFVHSGTSHGASSNDRKLLIEGFPQKT  188

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+DEAG+SFGIY+Q+PP+TLFYRNLRKLKY+ +FHQ+ + FK  CKEGKLPNYVVVE
Sbjct  189   IFESLDEAGFSFGIYHQFPPATLFYRNLRKLKYLTHFHQYGLQFKKDCKEGKLPNYVVVE  248

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QR+FDL + P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHGGFYDHVP
Sbjct  249   QRWFDLLLTPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIITYDEHGGFYDHVP  308

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPV GVPNPDGL+GP+PYNF+F+RLGVRVP   +SPWIE G VLH P+GP+P S+YEHSS
Sbjct  309   TPVEGVPNPDGLLGPEPYNFEFNRLGVRVPTFFISPWIEPGTVLHVPNGPYPRSQYEHSS  368

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKKIFNL  FLT+RD+WAGTFE+VITR +PR+DCP TL+ PVKLR+  A+E A L+
Sbjct  369   IPATVKKIFNLKDFLTKRDSWAGTFESVITRDSPRQDCPATLSIPVKLRATVAEESAQLS  428

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E Q+++V MAA L GD+  E+   HKL +   VA A+ Y   AF+KFL +   AR+RG  
Sbjct  429   EIQEDLVIMAAGLRGDYKNEELM-HKLCKETCVADASKYVINAFDKFLEEARKARERGCD  487

Query  1507  GDYSVVAL---------------SKQPPSPNT--TPRKPKSFATKFLSCIA  1608
              +  V  +               S Q  +P+    P+  +SF  K  SC A
Sbjct  488   ENEIVYCMDDDNDDDDDHAEMPSSSQSEAPHAGPKPKTQRSFFNKLFSCFA  538



>ref|XP_006297391.1| hypothetical protein CARUB_v10013415mg [Capsella rubella]
 gb|EOA30289.1| hypothetical protein CARUB_v10013415mg [Capsella rubella]
Length=536

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/531 (66%), Positives = 408/531 (77%), Gaps = 18/531 (3%)
 Frame = +1

Query  55    SDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKE--SNPLPTSGGAQNSTND  228
             S GS +PIKTVVVLVQENRSFDH LGW + LN EI+GV   +  SNP+ +S    NS   
Sbjct  7     SSGS-YPIKTVVVLVQENRSFDHTLGWFRELNREIDGVTKSDPKSNPV-SSSSDPNSLR-  63

Query  229   VVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKL-EPTMQGFAANAERNQAGMS  405
              V FG++SQYVDPDPGHSIQDIYEQ+FG PW  D       + TM GFA NAERN+ GMS
Sbjct  64    -VEFGDQSQYVDPDPGHSIQDIYEQVFGKPWDSDKPDPNPGQATMSGFAQNAERNKKGMS  122

Query  406   GAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLI  585
              AVMNGF P+A+PVY +LV+ FA+CDRWFASVPASTQPNRL+VHSATSHGATSND K LI
Sbjct  123   SAVMNGFKPDALPVYMDLVQNFAICDRWFASVPASTQPNRLYVHSATSHGATSNDKKLLI  182

Query  586   EGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKL  765
             EGFPQKTIFES+DEAG++FGIY+Q+PPSTLFYRNLRKLKY+  FHQ+ I FK  CKEGKL
Sbjct  183   EGFPQKTIFESLDEAGFTFGIYHQFPPSTLFYRNLRKLKYLTRFHQYGIQFKKDCKEGKL  242

Query  766   PNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHG  945
             PNYVVVEQR+FDL   P NDDHPSHDV +GQK VK+VYEALRSSPQWNE+LF+I YDEHG
Sbjct  243   PNYVVVEQRWFDLLSTPANDDHPSHDVSQGQKLVKDVYEALRSSPQWNEILFIITYDEHG  302

Query  946   GFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPN  1125
             GFYDHVPTP+ GVPNPDG++GP PYNF F+RLGVRVP   +SPWIE G VLHGP+GP+P 
Sbjct  303   GFYDHVPTPLGGVPNPDGILGPPPYNFGFNRLGVRVPTFFISPWIEPGTVLHGPNGPYPR  362

Query  1126  SEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEA  1305
             S+YEHSSIPATVKKIF L  FLT+RD+WAGTFE++ITR +PR DCPETL+ PVKLR+  A
Sbjct  363   SQYEHSSIPATVKKIFKLKDFLTKRDSWAGTFESIITRDSPRHDCPETLSTPVKLRATVA  422

Query  1306  KEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCEN  1485
             KE A L+E+Q+E+V MAA L GD+  ED   HKL +   VA A++Y   AF+KF+ +   
Sbjct  423   KEKAQLSEFQEELVIMAAGLKGDYKNEDLI-HKLCKETCVADASEYVTNAFDKFMEESRK  481

Query  1486  ARQRGIHGDYSVVALS---------KQPPSPNTTPRKPKSFATKFLSCIAC  1611
             AR RG  G+  V  +              +PN TP KPK+  + F    AC
Sbjct  482   ARDRGCDGNDIVYCMDDADVVTPTQSHSEAPNATP-KPKTQTSFFSKLFAC  531



>ref|XP_006650915.1| PREDICTED: non-specific phospholipase C4-like [Oryza brachyantha]
Length=521

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/520 (65%), Positives = 405/520 (78%), Gaps = 12/520 (2%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLV ENRSFDHMLGWMKSLNPEI+GV G E N L     A +S++  V FG+ S+
Sbjct  8     IKTVVVLVMENRSFDHMLGWMKSLNPEIDGVTGDEINHL----DAADSSSRAVRFGDGSE  63

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKL-----EPTMQGFAANAERNQAGMSGAVMN  420
             YVDPDPGHS+Q IYEQ++G P+    A          P M GFA  AE+ + GM+  VMN
Sbjct  64    YVDPDPGHSMQAIYEQVYGTPFVDARATPITPPGVSSPPMTGFAQQAEKEKPGMAETVMN  123

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
             GF PEAVPVY+ELVR+FAVCDRWFAS PASTQPNRLFVHSATSHG  SNDTK L+ G PQ
Sbjct  124   GFRPEAVPVYRELVRQFAVCDRWFASNPASTQPNRLFVHSATSHGLVSNDTKLLVAGLPQ  183

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
             +TIF+S+ + G+SFGIYYQYPPSTLFYR+LR+LKY+ NFH FD+ F+ HC EGKLPNYVV
Sbjct  184   RTIFDSLHDEGFSFGIYYQYPPSTLFYRSLRQLKYVGNFHPFDLAFRRHCAEGKLPNYVV  243

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             VEQRYFDLKILPGNDDHPSHDV EGQ+FVKEVYEALR+ PQW E L ++ YDEHGGFYDH
Sbjct  244   VEQRYFDLKILPGNDDHPSHDVSEGQRFVKEVYEALRAGPQWEETLLVVTYDEHGGFYDH  303

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEH  1140
             VPTPV GVP+PDG++   P+ F+FDRLGVRVPA+ +SPWIE G V+H PSGP+P SE+EH
Sbjct  304   VPTPV-GVPSPDGIVSAAPFFFEFDRLGVRVPALFISPWIEPGTVVHRPSGPYPTSEFEH  362

Query  1141  SSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SSIPAT+KK+FNL  FLT+RDAWAGTF+ V+TR TPR DCP TL EPVKLR  EA E A 
Sbjct  363   SSIPATMKKLFNLKSFLTKRDAWAGTFDVVLTRDTPRTDCPSTLPEPVKLRPTEAAEHAA  422

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LTE+Q+E+VQ+ AVL G+H  +D YPHKLVE M+VA+AA Y + AF  ++ +C+  R+ G
Sbjct  423   LTEFQEELVQLGAVLNGEHADKDVYPHKLVEGMTVAEAARYCNAAFKSWMEECDRCRKCG  482

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
               G +  +    +PP   ++     SFA+K LSC ACGR+
Sbjct  483   EDGSH--IPTVVKPPPSTSSSGSTSSFASKMLSCFACGRS  520



>ref|XP_010273149.1| PREDICTED: non-specific phospholipase C3-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/477 (70%), Positives = 385/477 (81%), Gaps = 8/477 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVV+LVQENRSFDHM GWMK++NPEI+GV GKE N + T+    ++ +  V FGN+S
Sbjct  10    PIKTVVILVQENRSFDHMFGWMKAINPEIDGVTGKEYNLVTTT----DANSSRVYFGNRS  65

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             +YVD DPGHS Q IYEQ+FG  W   S+   + P M GFA  AE  Q GMS  VMNGF P
Sbjct  66    EYVDADPGHSFQAIYEQVFGVAWGHSSSSNMV-PRMDGFAQQAESIQKGMSQTVMNGFRP  124

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             EAV VYKELV EFAVCDRWFAS+P STQPNR+FVHSATSHG  SNDTKKLIEGFPQKTIF
Sbjct  125   EAVAVYKELVSEFAVCDRWFASLPTSTQPNRMFVHSATSHGFVSNDTKKLIEGFPQKTIF  184

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             ES+DEAG SFGIYY   PSTLFYRNLRK+KY+KNFH +D+ FK HCKEGKLPNYVV+E R
Sbjct  185   ESLDEAGLSFGIYYASLPSTLFYRNLRKIKYMKNFHLYDLEFKRHCKEGKLPNYVVIEPR  244

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YF+ K+ P NDDHP HDV EGQK VK+VYEALR+SPQWNE+LF+I YDEHGGFYDHVPTP
Sbjct  245   YFEKKLQPANDDHPPHDVSEGQKLVKQVYEALRASPQWNEILFIITYDEHGGFYDHVPTP  304

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
              T VP+PD ++ P+P+NF+FDRLGVRVP IM+SPWIERG VLH PSGP P+SE+EHSSIP
Sbjct  305   -TRVPSPDDIVSPEPFNFKFDRLGVRVPTIMISPWIERGTVLHRPSGPHPSSEFEHSSIP  363

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEP-VKLRSAEAKEDANLTE  1329
             ATVKKIFNL +FLT+RDAWAGTF+ V+TR +PR DCP TL EP V+LRSA+A E+A L+E
Sbjct  364   ATVKKIFNLKEFLTKRDAWAGTFDIVLTRESPRTDCPVTLPEPTVELRSADASEEAKLSE  423

Query  1330  YQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
              Q+E+VQ+AA L GDH K D YP KLVENM V  AA Y+  AF KFL  CEN    G
Sbjct  424   LQEELVQLAATLNGDHSK-DIYPQKLVENMKVVDAASYAEDAFKKFLEICENTENNG  479



>ref|XP_008457171.1| PREDICTED: non-specific phospholipase C3-like [Cucumis melo]
Length=547

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/553 (64%), Positives = 409/553 (74%), Gaps = 9/553 (2%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKE--SNPLPTSGGAQN  216
             S EI+  S +PIKT+V+LVQENRSFDHMLGWMK+LNP+I+GV  +   SNP+ TS     
Sbjct  2     SLEITKPSAYPIKTIVILVQENRSFDHMLGWMKTLNPQIDGVTNQTQFSNPISTSHPNSQ  61

Query  217   STNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQA  396
             S    + FGN S +VDPDPGHSIQDIYEQ+F  PWS D       PTMQGFA NAER Q 
Sbjct  62    S----IPFGNASAFVDPDPGHSIQDIYEQVFAHPWSDDLHPLP-PPTMQGFAQNAERIQK  116

Query  397   GMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTK  576
             GMS  VMNGF PEAVPV+KELV EF VCDRWFASVPASTQPNRLF+HSATS G TSNDTK
Sbjct  117   GMSATVMNGFKPEAVPVFKELVAEFGVCDRWFASVPASTQPNRLFLHSATSFGLTSNDTK  176

Query  577   KLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKE  756
             +L+EG PQKTIFES++E G+SFGIYYQY P+TLFYRNLRKLKYI NFH FD+ FK  C+E
Sbjct  177   QLMEGVPQKTIFESLEEEGFSFGIYYQYFPATLFYRNLRKLKYIMNFHIFDLDFKRDCRE  236

Query  757   GKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYD  936
             GKLPNYVV+EQRYFDL  LPGNDDHPSHDV EGQKF+KEVYEALRSSPQWNE+LFLI YD
Sbjct  237   GKLPNYVVIEQRYFDLASLPGNDDHPSHDVSEGQKFIKEVYEALRSSPQWNEILFLITYD  296

Query  937   EHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGP  1116
             EHGGF+DHVP P  GVPNPD  +GP PYNF FDRLGVRVP I VSPWIE G V+H P+GP
Sbjct  297   EHGGFFDHVPPPSAGVPNPDARLGPPPYNFNFDRLGVRVPTIFVSPWIEPGTVVHRPTGP  356

Query  1117  FPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRS  1296
              P SE+EHSSI ATVKKIF L +FLT+RD WAGTF+ V+ R TPR DCP TL  PVKLR+
Sbjct  357   DPTSEFEHSSIAATVKKIFGLKEFLTKRDQWAGTFDIVLNRHTPRTDCPVTLNNPVKLRN  416

Query  1297  AEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGD  1476
              EA +   ++E+Q+E+VQ+AAVL GD +K++ YP KLVE MSV +AA Y   A   F  +
Sbjct  417   VEANDRRQISEFQEELVQLAAVLKGD-VKKEIYPKKLVEKMSVVEAASYCENALKSFFNE  475

Query  1477  CENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN*FISAALI*LYS  1656
             CE A++ G   +  VV   K       +  KPKS     L       +  I   ++ +  
Sbjct  476   CEKAKENGA-DESQVVVCGKNNQILQPSNSKPKSLLVSSLRVWLAMVDCKIIVPILFMPP  534

Query  1657  WFLWTILFFSCYL  1695
             + L   L FS Y+
Sbjct  535   FNLIVNLIFSGYI  547



>ref|XP_010485693.1| PREDICTED: non-specific phospholipase C4-like [Camelina sativa]
Length=540

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/538 (65%), Positives = 408/538 (76%), Gaps = 27/538 (5%)
 Frame = +1

Query  55    SDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVV  234
             S GS +PIKTVVVLVQENRSFDH LGW K LN EI+G    +    P S    N+    V
Sbjct  7     SSGS-YPIKTVVVLVQENRSFDHTLGWFKELNREIDGNTKSDPKSNPVSFSDPNALR--V  63

Query  235   LFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP---TMQGFAANAERNQAGMS  405
             +FG++SQYVD DPGHSIQDIYEQ+FG PW  DS    L P   TM GFA NAERN+ GMS
Sbjct  64    VFGDQSQYVDQDPGHSIQDIYEQVFGKPW--DSGKPDLNPGPATMSGFAQNAERNKKGMS  121

Query  406   GAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLI  585
              AVMNGF P+A+PVYKELV+ FA+CDRWFASVPASTQPNRL+VHSATSHGATSND K LI
Sbjct  122   SAVMNGFKPDALPVYKELVQNFAICDRWFASVPASTQPNRLYVHSATSHGATSNDKKLLI  181

Query  586   EGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKL  765
             EGFPQKTIFES+DEAG SFGIY+Q+PPSTLFYRNLRKLKY+  FHQ+ I FK  CKEGKL
Sbjct  182   EGFPQKTIFESLDEAGLSFGIYHQFPPSTLFYRNLRKLKYLTRFHQYGIQFKKDCKEGKL  241

Query  766   PNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHG  945
             PNYVVVEQR+FDL   P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHG
Sbjct  242   PNYVVVEQRWFDLLSTPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIITYDEHG  301

Query  946   GFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPN  1125
             GFYDHVPTP+ GVPNPDG++GP PYNF+F+RLGVRVP   +SPWIE G V+HGP+GP+P 
Sbjct  302   GFYDHVPTPIDGVPNPDGILGPPPYNFEFNRLGVRVPTFFISPWIEPGTVIHGPNGPYPR  361

Query  1126  SEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEA  1305
             S+YEHSSIPATVKKIFNL  FLT+RD+WAGTFE+VI+R +PR+DCPETL+ PVKLR+  A
Sbjct  362   SQYEHSSIPATVKKIFNLKDFLTKRDSWAGTFESVISRDSPRQDCPETLSTPVKLRATVA  421

Query  1306  KEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCEN  1485
             +E+A L+E+Q+E+V MAA L GD+  E+   HKL +   VA A+ Y   AF+ F+ +   
Sbjct  422   RENAQLSEFQEELVIMAAGLKGDYKNEELI-HKLCKETCVADASKYVTNAFDTFIEESRK  480

Query  1486  ARQRGIHGDYSVVAL--------------SKQPPSPNTTPRKPK---SFATKFLSCIA  1608
             AR+RG   +  +  +              S    +PN  P KPK   SF +K  SC  
Sbjct  481   ARERGCDENDIIYCVDDDDDHHHVVTPTQSSHSEAPNAAP-KPKTQRSFFSKLFSCFV  537



>ref|XP_004981016.1| PREDICTED: uncharacterized protein LOC101774034 [Setaria italica]
Length=518

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/524 (65%), Positives = 412/524 (79%), Gaps = 21/524 (4%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             IKTVVVLVQENRSFDHMLGWMK S+N +I+GV G E+N +     A + ++  V F ++S
Sbjct  5     IKTVVVLVQENRSFDHMLGWMKKSINTDIDGVTGDETNHV----DASDPSSRAVRFSDRS  60

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKL------EPTMQGFAANAERNQAGMSGAV  414
             QYVDPDPGHSIQ IYEQ++G  ++ D+A   +       P M GF   AE+ + GM+  V
Sbjct  61    QYVDPDPGHSIQAIYEQVYGVAFA-DAAATPITPPGVPAPPMSGFVQQAEKEKPGMADTV  119

Query  415   MNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGF  594
             M+GF+P+AVPVY+ELVREFAVCDRWFASVPASTQPNRLFVHSATSHG  SNDTK+L+ G 
Sbjct  120   MSGFLPDAVPVYRELVREFAVCDRWFASVPASTQPNRLFVHSATSHGLVSNDTKQLVWGL  179

Query  595   PQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNY  774
             PQ+TIF+++ + G+SFGIYYQYPPSTLFYRNLR+LKY  NFH FD+ F+ HC+EGKLPNY
Sbjct  180   PQRTIFDNLHDQGFSFGIYYQYPPSTLFYRNLRQLKYAGNFHPFDLDFRRHCREGKLPNY  239

Query  775   VVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFY  954
             VVVEQRYFDLKILPGNDDHPSHDV EGQ+FVKEVYEALRS PQW E L +I YDEHGGFY
Sbjct  240   VVVEQRYFDLKILPGNDDHPSHDVAEGQRFVKEVYEALRSGPQWGEALLVITYDEHGGFY  299

Query  955   DHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHG-PSGPFPNSE  1131
             DHVPTP  GVP+PDG+    P+ FQFDRLGVRVPA++VSPWIE G VLHG PSGP+P SE
Sbjct  300   DHVPTPAAGVPSPDGIASAPPFCFQFDRLGVRVPALLVSPWIEPGTVLHGPPSGPYPTSE  359

Query  1132  YEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKE  1311
             +EHSSIPATVKKIFNL+ FLT RDAWAGTF++V+TR TPR DCP TL EPVKLR A A E
Sbjct  360   FEHSSIPATVKKIFNLDGFLTRRDAWAGTFDSVLTRDTPRTDCPVTLPEPVKLRRAAAVE  419

Query  1312  DANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENAR  1491
              A L+E+Q+E+VQ+AAVL GDH K D YP+KL ++M+VA+AA Y   AF  FL +C+   
Sbjct  420   HAPLSEFQEELVQLAAVLNGDHTK-DSYPNKLADSMTVAEAARYCVDAFRAFLDECDRCN  478

Query  1492  QRGIHGDYSVVALSKQPPSPNTTPRKPK-SFATKFLSCIACGRN  1620
             + G  G +          +P+++P K K SFA+K L+C+ACG +
Sbjct  479   KCGEDGSHIPTV------TPSSSPEKNKSSFASKVLACLACGHS  516



>ref|XP_006408293.1| hypothetical protein EUTSA_v10020472mg [Eutrema salsugineum]
 gb|ESQ49746.1| hypothetical protein EUTSA_v10020472mg [Eutrema salsugineum]
Length=541

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/535 (65%), Positives = 403/535 (75%), Gaps = 29/535 (5%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKTVVVLVQENRSFDH LGW K LN EI+GV   +    P S    NS    V+FG++
Sbjct  11    YPIKTVVVLVQENRSFDHTLGWFKELNREIDGVTKSDPKSNPVSSSDPNSLR--VVFGDQ  68

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERNQAGMSGAVMNGF  426
             SQYVDPDPGHSIQDIYEQ+FG PW          P TM GFA NAERN+ GMS AVMNGF
Sbjct  69    SQYVDPDPGHSIQDIYEQVFGKPWDSGHPDPNPGPATMSGFAQNAERNKKGMSSAVMNGF  128

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+A+PVYKEL   +A+CDRWFASVPASTQPNRL+VHSATSHGATSND K LIEGFPQKT
Sbjct  129   KPDALPVYKELAHNYAICDRWFASVPASTQPNRLYVHSATSHGATSNDRKLLIEGFPQKT  188

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+DEAG +FGIYYQ+PPSTLFYRNLRKLKY+ +FHQ+ I FK  CKEGKLPNYVVVE
Sbjct  189   IFESLDEAGLTFGIYYQFPPSTLFYRNLRKLKYLTHFHQYGIRFKKDCKEGKLPNYVVVE  248

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QR+FDL   P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHGGFYDHVP
Sbjct  249   QRWFDLLSTPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIITYDEHGGFYDHVP  308

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPV GVPNPDG++GP PYNF+F+RLGVRVP   +SPWIE G V+HGP+GP+P S+YEHSS
Sbjct  309   TPVDGVPNPDGILGPPPYNFEFNRLGVRVPTFFISPWIEPGTVIHGPNGPYPRSQYEHSS  368

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKKIFNL  FLT+RD+WAGTFE+VITR +PR+DCP+TL+ PVKLR+  AKE+A L+
Sbjct  369   IPATVKKIFNLKDFLTKRDSWAGTFESVITRDSPRQDCPDTLSVPVKLRATVAKENAQLS  428

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI-  1503
             E+Q+E+V MAA L GD+  E+    KL +   VA A+ Y   AF+KF+ +   AR+RG  
Sbjct  429   EFQEELVIMAAGLKGDNKNEELI-RKLCKETCVADASKYVTNAFDKFMEEARKARERGCD  487

Query  1504  ------------HGDYSVVALSKQPPSPNTT--------PRKPKSFATKFLSCIA  1608
                           D  VVA+    PSP+ +        P+   SF  K  SC  
Sbjct  488   ENDIVYCFDADHDNDDHVVAI----PSPSHSEIPHAVPKPKTQMSFFRKLFSCFT  538



>ref|XP_007134274.1| hypothetical protein PHAVU_010G033400g [Phaseolus vulgaris]
 gb|ESW06268.1| hypothetical protein PHAVU_010G033400g [Phaseolus vulgaris]
Length=516

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/515 (64%), Positives = 402/515 (78%), Gaps = 13/515 (3%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT+VVLVQENRSFDHMLGWMKSLNPEI+GV G ESNP+ T   + N     V F +K
Sbjct  12    YPIKTIVVLVQENRSFDHMLGWMKSLNPEIDGVTGSESNPISTLEPSSNR----VYFSDK  67

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSG-AVMNGF  426
             S +V+PDPGH+++D+YEQ+FG PWS+ S  KK+   M+GFA N+ + + G +   VMNG+
Sbjct  68    SDFVEPDPGHTVEDVYEQVFGEPWSESSTRKKVSARMEGFAQNSVKQKKGSTAETVMNGY  127

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ +PVY+ELV+EFAVCDRWFASVP  TQPNRL+VHSATS+G T+ DT+KLI G PQKT
Sbjct  128   KPDLLPVYRELVKEFAVCDRWFASVPGPTQPNRLYVHSATSYGLTTQDTQKLIGGLPQKT  187

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+DE G+SFGIYYQYPPSTLFYRNLRK+KYI NFH FD+ FK HC+EG+L NYVV+E
Sbjct  188   IFDSLDENGFSFGIYYQYPPSTLFYRNLRKVKYIDNFHLFDLKFKKHCEEGRLENYVVIE  247

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYF+L  +  NDDHPSHDV EGQ+FVKEVYEALR+SPQWNE+LF+I YDEHGGFYDHVP
Sbjct  248   QRYFELLSVAANDDHPSHDVGEGQRFVKEVYEALRTSPQWNEILFVITYDEHGGFYDHVP  307

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPV GVPNPD + GP P+ FQFDRLGVRVP I++SPWI+ GKVLH PSGPFP S+YEHSS
Sbjct  308   TPVDGVPNPDDIAGPAPFKFQFDRLGVRVPTIIISPWIQAGKVLHEPSGPFPTSQYEHSS  367

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKKIFNL QFLT+RDAWAGTFE +++ TTPR DCP  + EPVKLR     E+A L+
Sbjct  368   IPATVKKIFNLPQFLTKRDAWAGTFENLLSLTTPRTDCPVKMPEPVKLREVGGDENAELS  427

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+E++ M A L GDH K  Y   KL +N++V++A  Y   AF  FL +CE A+Q  I 
Sbjct  428   EFQEELIYMTATLNGDHNKSTY--PKLTQNLTVSEAVKYCEDAFQTFLNECEKAKQSRID  485

Query  1507  GDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             G   +V  +K    P+T P+  K+F     SC+ C
Sbjct  486   GS-EIVHCAK----PHTAPQS-KTFLHNIFSCLLC  514



>ref|XP_009413233.1| PREDICTED: non-specific phospholipase C4-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/521 (67%), Positives = 405/521 (78%), Gaps = 16/521 (3%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKE--SNPLPTSGGAQNSTNDVVLFGNK  249
             IKTVVVLVQENRSFDH+LGWMKS+NP+I+GV+     SNPL     A +  + +V FGN+
Sbjct  14    IKTVVVLVQENRSFDHILGWMKSINPDIDGVSNDRELSNPL----SASDPNSSLVYFGNQ  69

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQD----SAGKKLEPTMQGFAANAERNQAGMSGAVM  417
             S YVDPDPGHSIQ IYEQI+G P++      +      P M GF   AE+ + GMS  VM
Sbjct  70    SVYVDPDPGHSIQAIYEQIYGVPFTAGVTPITPPGIDSPPMNGFVQQAEKEKPGMSSIVM  129

Query  418   NGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFP  597
             NGF PEAVPVY+ LVREFAVCDRWFAS+PASTQPNRLFVHSATSHG TSNDTKKL+ G P
Sbjct  130   NGFKPEAVPVYESLVREFAVCDRWFASMPASTQPNRLFVHSATSHGFTSNDTKKLVAGLP  189

Query  598   QKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYV  777
             QKTIF+S+ EAG SFGIYYQYPP+TLFYRNLR+LKY+ +FH FD+ FK HCK+GKLPNYV
Sbjct  190   QKTIFDSLHEAGLSFGIYYQYPPATLFYRNLRQLKYVGDFHPFDLKFKKHCKKGKLPNYV  249

Query  778   VVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYD  957
             V+EQRYFDLK+LPGNDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+IIYDEHGGF+D
Sbjct  250   VIEQRYFDLKLLPGNDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFVIIYDEHGGFFD  309

Query  958   HVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYE  1137
             HVPTPV  VP+PD ++GP+P+ F+FDRLGVRVP + +SPWIE G V+H PSGP P SE+E
Sbjct  310   HVPTPVR-VPSPDDIVGPEPFYFKFDRLGVRVPTLFISPWIEPGTVVHRPSGPHPTSEFE  368

Query  1138  HSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             HSSIPATVKKIFNL  FLT+RD WAGTFETV+TRTTPR DCPE L EP KLR  EA E A
Sbjct  369   HSSIPATVKKIFNLKDFLTKRDEWAGTFETVLTRTTPRTDCPEILPEPRKLRPTEAAETA  428

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q E+V + AVL GDH K D YPHKLVENM+VA  A Y   A   FL +CEN R  
Sbjct  429   KLSEFQTELVHLGAVLNGDHTK-DTYPHKLVENMTVADGAQYVQDALQTFLEECENCRNN  487

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
             G  G + VV      P+ + T +  +S   K LSC+ C R+
Sbjct  488   GFDGSHVVVV----NPARDATVQDTRSLLQKMLSCLLCNRS  524



>ref|XP_002884391.1| hypothetical protein ARALYDRAFT_317234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60650.1| hypothetical protein ARALYDRAFT_317234 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/537 (64%), Positives = 406/537 (76%), Gaps = 19/537 (4%)
 Frame = +1

Query  46    SEISDGS-IFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNST  222
             SE + GS  +PIKT+VVLVQENRSFDH LGW K LN EI+GV   +S+P   +  + +  
Sbjct  2     SETTKGSGSYPIKTIVVLVQENRSFDHALGWFKELNREIDGVT--KSDPKSNTVSSSDPK  59

Query  223   NDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERNQAG  399
             +  V+FG++SQYVDPDPGHSIQDIYEQ+FG PW          P TM GFA NAERN+ G
Sbjct  60    SLPVVFGDQSQYVDPDPGHSIQDIYEQVFGKPWDSGKPDPNPGPATMSGFAQNAERNKKG  119

Query  400   MSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKK  579
             MS AVMNGF P A+PVYKELV+ FA+CDRWFASVPASTQPNRL+VHSATSHGATSND K 
Sbjct  120   MSSAVMNGFKPNALPVYKELVQNFAICDRWFASVPASTQPNRLYVHSATSHGATSNDKKL  179

Query  580   LIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEG  759
             LIEGFPQKTIFES+ EAG+SFGIYYQ+PPSTLFYRNLRKLKY+ +FHQ+ I FK  CKEG
Sbjct  180   LIEGFPQKTIFESLHEAGFSFGIYYQFPPSTLFYRNLRKLKYLTHFHQYGIQFKKDCKEG  239

Query  760   KLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDE  939
             KLPNYVV+EQR+FDL  +P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDE
Sbjct  240   KLPNYVVIEQRWFDLLSIPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFVITYDE  299

Query  940   HGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPF  1119
             HGGFYDHVPTPV GVPNPDG++GP PYNF+F+RLGVRVP   +SPWIE G V+HGP+GPF
Sbjct  300   HGGFYDHVPTPVDGVPNPDGILGPPPYNFEFNRLGVRVPTFFISPWIEPGTVIHGPNGPF  359

Query  1120  PNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSA  1299
             P S+YEHSSIPATVKKIF L  FLT+RD+WAGTFE+VI R +PR+DCPETL+ PVKLR  
Sbjct  360   PRSQYEHSSIPATVKKIFKLKDFLTKRDSWAGTFESVIARDSPRQDCPETLSIPVKLRGT  419

Query  1300  EAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDC  1479
              AKE+A L+E+Q+E+V MAA L GD+  E+   HKL +   VA A+ Y   AF KFL + 
Sbjct  420   LAKENAQLSEFQEELVIMAAGLKGDYKNEELI-HKLCKETCVADASKYVTNAFEKFLEES  478

Query  1480  ENARQRGIHGDYSVVALSKQ-------PPSPNT-------TPRKPKSFATKFLSCIA  1608
               A+ RG   +  +  +          PP  ++        P+   SF  K  SC  
Sbjct  479   RKAKDRGCDENDIIYCVDDDHHHHVVIPPQSHSEASNAAPQPKTQTSFFNKLFSCFV  535



>ref|XP_010525016.1| PREDICTED: non-specific phospholipase C4-like [Tarenaya hassleriana]
Length=533

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/531 (65%), Positives = 399/531 (75%), Gaps = 13/531 (2%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNST  222
             S  +S     PIKTVVVLVQENRSFDHMLGW K LNP+I+GV        P SG   NS 
Sbjct  6     SGPVSSSRPCPIKTVVVLVQENRSFDHMLGWFKDLNPDIDGVERSNPKTNPKSGSDPNSP  65

Query  223   NDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKL-EPTMQGFAANAERNQAG  399
               V+ FG++SQYVDPDPGHSIQDIYEQ+FG PW  +        PTM GFA NAERN+ G
Sbjct  66    --VIEFGDRSQYVDPDPGHSIQDIYEQVFGKPWDPNHPDPNPGPPTMSGFAQNAERNKTG  123

Query  400   MSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKK  579
             MS AVMNGF P+A+PVYKELV  FA+CDRWFA+VPASTQPNRLFVHSATSHGATSND K 
Sbjct  124   MSSAVMNGFKPDALPVYKELVTNFAICDRWFAAVPASTQPNRLFVHSATSHGATSNDKKL  183

Query  580   LIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEG  759
             L EGFPQKTIFES+DEAG+SFGIYYQ+PPSTLFYRNLR  KY+ +FH++ IHFK  C++G
Sbjct  184   LAEGFPQKTIFESLDEAGFSFGIYYQFPPSTLFYRNLRNPKYLTHFHEYGIHFKNDCEKG  243

Query  760   KLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDE  939
             KLPNYVV+EQR+FDL  +PGNDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF++ YDE
Sbjct  244   KLPNYVVIEQRWFDLLSIPGNDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFVVTYDE  303

Query  940   HGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPF  1119
             HGGFYDHVPTPV GVP+PDG+ GP+PY F+F+RLGVRVP   +SPW+ERG ++HGP+GP+
Sbjct  304   HGGFYDHVPTPVHGVPSPDGIPGPEPYRFEFNRLGVRVPTFFISPWVERGTMVHGPNGPY  363

Query  1120  PNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSA  1299
             P S+YEHSSIPATVKKIFNL  FLT+RD WA TF++V+TR TPR DCPE L  PVKLR+ 
Sbjct  364   PTSQYEHSSIPATVKKIFNLKDFLTKRDEWAATFDSVLTRPTPRLDCPEKLPTPVKLRAT  423

Query  1300  EAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDC  1479
              AKEDA L+E+Q+E+V MAA L GD+  ED   HKL     V  AA Y   AF +FL D 
Sbjct  424   VAKEDAELSEFQQELVIMAAGLNGDYKDEDLM-HKLCCETCVLDAAKYVETAFEEFLKDS  482

Query  1480  ENARQRGIHGDYSVVALSKQ-------PPSPNTTPRKPKSFATKFLSCIAC  1611
               A  RG   +  VV++  Q         +     R   SF  K  SCI C
Sbjct  483   RQA--RGGRDENDVVSVPDQEAATQPQDAAAAAATRTQTSFLRKLFSCIVC  531



>ref|NP_566206.1| non-specific phospholipase C4 [Arabidopsis thaliana]
 sp|Q9SRQ7.1|NPC4_ARATH RecName: Full=Non-specific phospholipase C4 [Arabidopsis thaliana]
 gb|AAF01582.1|AC009895_3 hypothetical protein [Arabidopsis thaliana]
 gb|AAK59858.1| AT3g03530/T21P5_5 [Arabidopsis thaliana]
 gb|AAN28886.1| At3g03530/T21P5_5 [Arabidopsis thaliana]
 dbj|BAC22508.1| phosphatidylglycerol specific phospholipase C [Arabidopsis thaliana]
 gb|AEE73954.1| non-specific phospholipase C4 [Arabidopsis thaliana]
Length=538

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/526 (64%), Positives = 401/526 (76%), Gaps = 17/526 (3%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT+VVLVQENRSFDH LGW K LN EI+GV   +S+P   +  + ++ +  V+FG++
Sbjct  12    YPIKTIVVLVQENRSFDHTLGWFKELNREIDGVT--KSDPKSNTVSSSDTNSLRVVFGDQ  69

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKL-EPTMQGFAANAERNQAGMSGAVMNGF  426
             SQYV+PDPGHSIQDIYEQ+FG PW           P M GFA NAERN+ GMS AVMNGF
Sbjct  70    SQYVNPDPGHSIQDIYEQVFGKPWDSGKPDPNPGHPNMSGFAQNAERNKKGMSSAVMNGF  129

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P A+PVYKELV+ FA+CDRWFASVPASTQPNRL+VHSATSHGATSND K L+EGFPQKT
Sbjct  130   KPNALPVYKELVQNFAICDRWFASVPASTQPNRLYVHSATSHGATSNDKKLLLEGFPQKT  189

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+DEAG+SFGIYYQ+PPSTLFYRNLRKLKY+ +FHQ+ I FK  CKEGKLPNYVVVE
Sbjct  190   IFESLDEAGFSFGIYYQFPPSTLFYRNLRKLKYLTHFHQYGIQFKKDCKEGKLPNYVVVE  249

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QR+FDL   P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHGGFYDHVP
Sbjct  250   QRWFDLLSTPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIITYDEHGGFYDHVP  309

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPV GVPNPDG++GP PYNF+F+RLGVRVP   +SPWIE G V+HGP+GP+P S+YEHSS
Sbjct  310   TPVDGVPNPDGILGPPPYNFEFNRLGVRVPTFFISPWIEPGTVIHGPNGPYPRSQYEHSS  369

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVK IF L  FL++RD+WAGTFE+VITR +PR+DCPETL+ P+KLR   AKE+A L+
Sbjct  370   IPATVKTIFKLKDFLSKRDSWAGTFESVITRDSPRQDCPETLSTPIKLRGTMAKENAQLS  429

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+++V MAA L GD+  E+   HKL +   VA A+ Y   AF KFL +   AR RG  
Sbjct  430   EFQEDLVIMAAGLKGDYKNEELI-HKLCKETCVADASKYVTNAFEKFLEESRKARDRGCD  488

Query  1507  GDYSVVALSKQ------PPSPNT-------TPRKPKSFATKFLSCI  1605
              +  V  +         PP  ++        P+   SF  K  SC 
Sbjct  489   ENDIVYCVDDDDDHVVIPPQSHSEASNAAAQPKTQTSFFNKLFSCF  534



>ref|XP_009119295.1| PREDICTED: non-specific phospholipase C4 [Brassica rapa]
Length=541

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/539 (64%), Positives = 404/539 (75%), Gaps = 22/539 (4%)
 Frame = +1

Query  46    SEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTN  225
             + I  GS +PIKTVVVLVQENRSFDH LGW K LN +I+GV   +    P S    NS +
Sbjct  4     TTIGSGS-YPIKTVVVLVQENRSFDHTLGWFKELNQDIDGVTKSDPKSNPVSSSDPNSLH  62

Query  226   DVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERNQAGM  402
               V+FG++SQYVDPDPGHSIQDIYEQ+FG PW          P TM GF  NAERN+ GM
Sbjct  63    --VVFGDQSQYVDPDPGHSIQDIYEQVFGKPWDVSHPDPNPGPATMSGFTQNAERNKKGM  120

Query  403   SGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKL  582
             S AVMNGF P+A+PVYKELV+ FA+ D+WFASVPASTQPNR FVHSATSHGATSND K L
Sbjct  121   SSAVMNGFKPDALPVYKELVQNFAISDKWFASVPASTQPNRSFVHSATSHGATSNDKKLL  180

Query  583   IEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGK  762
             IEGFPQKTIFES+DEAG+SFGIYYQ+PPSTLFYRNLRKLKY+ +FHQ+ + FK  CKEGK
Sbjct  181   IEGFPQKTIFESLDEAGFSFGIYYQFPPSTLFYRNLRKLKYLTHFHQYGLQFKKDCKEGK  240

Query  763   LPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEH  942
             LPNYVVVEQR+FDL   P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEH
Sbjct  241   LPNYVVVEQRWFDLLSTPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIITYDEH  300

Query  943   GGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFP  1122
             GGFYDHVPTPV GVPNPDGL+GP+PY F+F+RLGVRVP   +SPWIE G VLH P+GP+P
Sbjct  301   GGFYDHVPTPVEGVPNPDGLLGPEPYKFEFNRLGVRVPTFFISPWIEPGTVLHVPNGPYP  360

Query  1123  NSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAE  1302
              S+YEHSSIPATVKKIFNL  FLT+RD+WAGTFE+VITR +PR+DCP TL+ PVKLR+  
Sbjct  361   RSQYEHSSIPATVKKIFNLKDFLTKRDSWAGTFESVITRDSPRQDCPATLSIPVKLRATV  420

Query  1303  AKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCE  1482
             A+E A L+E Q+++V MAA L GD+  E+   HKL +   V  A+ Y   AF+KFL +  
Sbjct  421   AEESAQLSEIQEDLVIMAAGLKGDYKNEELM-HKLCKETCVTDASKYVINAFDKFLEEAR  479

Query  1483  NARQRGIHGDYSVVAL---------------SKQPPSPNT--TPRKPKSFATKFLSCIA  1608
              AR+RG   +  V  +               S Q  +P+    P+  +SF  K  SC A
Sbjct  480   KARERGCDENEIVYCMDDDNDDDDDHAEMPSSSQSEAPHAGPKPKTQRSFFNKLFSCFA  538



>ref|XP_010240877.1| PREDICTED: non-specific phospholipase C3-like [Nelumbo nucifera]
Length=560

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/534 (63%), Positives = 403/534 (75%), Gaps = 20/534 (4%)
 Frame = +1

Query  40    PSSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNS  219
             PS   S  +  PIKTVVVLVQENRSFDHMLGWMKS+NPEI+GV GKE N +     A++ 
Sbjct  35    PSDASSTVNSCPIKTVVVLVQENRSFDHMLGWMKSVNPEIDGVTGKEYNLI----SAKDP  90

Query  220   TNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSA----GKKLEPTMQGFAANAER  387
              ++ V FGN+S+YVDPDP HS Q IYEQ+FG PW Q S+       +  TM GFA  AE 
Sbjct  91    NSERVYFGNQSEYVDPDPAHSFQAIYEQVFGVPWGQQSSSVNKAGSVAMTMNGFAQQAES  150

Query  388   NQAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSN  567
              + G+S  VMNGF PE +PVYKELV +FAVCDRWFAS+P+STQPNRLFVHSATSHG  S+
Sbjct  151   VEKGLSETVMNGFRPEVIPVYKELVSQFAVCDRWFASLPSSTQPNRLFVHSATSHGYISH  210

Query  568   DTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTH  747
             DT KLI+GFPQKTIF+S+D+AG SFGIYY   PSTL YR+LR+LKYIKNF+ +D+ FK H
Sbjct  211   DTMKLIQGFPQKTIFDSLDDAGLSFGIYYANLPSTLLYRSLRRLKYIKNFYPYDVEFKKH  270

Query  748   CKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLI  927
             C++GKLPNYVV+E RYF+ K +PGNDDHPSHD+ +GQK VKEVYEALR+SPQWNE+LF+I
Sbjct  271   CEQGKLPNYVVIEPRYFETKSMPGNDDHPSHDISQGQKLVKEVYEALRASPQWNEILFII  330

Query  928   IYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGP  1107
              YDEHGGFYDHVPTP TGVP+PD ++    + F+FDRLGVRVP I++SPWIERG VLH P
Sbjct  331   TYDEHGGFYDHVPTP-TGVPSPDDIVSDDSFKFKFDRLGVRVPTILISPWIERGMVLHRP  389

Query  1108  SGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVK  1287
             SGP+P+SE+EHSSIPATVKKIFNL +FLT+RDAWAGT + V+TR +PR DCPETL   VK
Sbjct  390   SGPYPSSEFEHSSIPATVKKIFNLKEFLTKRDAWAGTLDIVLTRESPRTDCPETLPNSVK  449

Query  1288  LRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKF  1467
             LRS    EDA L+E+Q+E+VQ+AA L GDH K D YP KLVENM+ A A +Y   A  KF
Sbjct  450   LRSVSGNEDAKLSEFQEELVQLAAALNGDHTK-DIYPVKLVENMNAAAACNYVEDALKKF  508

Query  1468  LGDCENARQRGIHGDYSVVALSK------QPPSPNTTPRKPKSFATKFLSCIAC  1611
             L  C  A + G++    +V ++       QPPS +    K  S   K  SC  C
Sbjct  509   LEGCGTAMKNGVNESDEIVVMATPTGHGPQPPSSS----KFSSLVNKISSCFFC  558



>ref|NP_001051927.1| Os03g0852800 [Oryza sativa Japonica Group]
 gb|AAO20061.1| putative phosphoesterase [Oryza sativa Japonica Group]
 gb|AAO66550.1| putative phosphoesterase [Oryza sativa Japonica Group]
 gb|ABF99945.1| phosphoesterase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13841.1| Os03g0852800 [Oryza sativa Japonica Group]
 gb|EAZ29339.1| hypothetical protein OsJ_13406 [Oryza sativa Japonica Group]
Length=527

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/520 (65%), Positives = 402/520 (77%), Gaps = 12/520 (2%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLV ENRSFDHMLGWMKSLNPEI+GV G E N L     A + T+  + FG+ ++
Sbjct  10    IKTVVVLVMENRSFDHMLGWMKSLNPEIDGVTGDEINHL----DAADPTSRAIRFGDGAE  65

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKL-----EPTMQGFAANAERNQAGMSGAVMN  420
             YVDPDPGHS+Q IYEQ++G P+    A          P M GFA  AE+ + GM+  VMN
Sbjct  66    YVDPDPGHSMQAIYEQVYGTPFVDARATPITPPGVPSPPMAGFAQQAEKEKPGMADTVMN  125

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
             GF PEAVPVY+ELVR+FAVCDRWFAS PASTQPNRLFVHSATSHG  SNDTK L+ G PQ
Sbjct  126   GFRPEAVPVYRELVRQFAVCDRWFASNPASTQPNRLFVHSATSHGLVSNDTKLLVAGLPQ  185

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
             +TIF+S+ +AG+SFGIYYQYPPSTLFYR+LR+LKY  NFH FD+ F+ HC EGKLPNYVV
Sbjct  186   RTIFDSLHDAGFSFGIYYQYPPSTLFYRSLRQLKYAGNFHPFDLAFRRHCAEGKLPNYVV  245

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             VEQRYFDLK+LPGNDDHPSHDV EGQ+FVKEVYEALR  PQW E L ++ YDEHGGFYDH
Sbjct  246   VEQRYFDLKMLPGNDDHPSHDVSEGQRFVKEVYEALRGGPQWEEALLVVTYDEHGGFYDH  305

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEH  1140
             VPTPV  VP+PDG++   P+ F+F+RLGVRVPA+ +SPWIE G V+H PSGP+P SE+EH
Sbjct  306   VPTPVD-VPSPDGIVSAAPFFFEFNRLGVRVPALFISPWIEPGTVVHRPSGPYPTSEFEH  364

Query  1141  SSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSA-EAKEDA  1317
             SSIPATVKK+FNL  FLT RDAWAGTF+ V+TR  PR DCP TL EPVK+R A EA E A
Sbjct  365   SSIPATVKKLFNLKSFLTNRDAWAGTFDVVLTRDAPRTDCPATLPEPVKMRPATEAAEQA  424

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              LTE+Q+E+VQ+ AVL GDH  ED YP KLVE M+VA+AA Y + AF  ++ +C+  R+ 
Sbjct  425   ALTEFQEELVQLGAVLNGDHADEDVYPRKLVEGMTVAEAASYCNAAFKAWMDECDRCRKC  484

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGR  1617
             G  G + +  + K PP P+T+     SFA+K LSC ACGR
Sbjct  485   GEDGSH-IPTVVKPPPPPSTSSSGSSSFASKLLSCFACGR  523



>gb|EAY92622.1| hypothetical protein OsI_14367 [Oryza sativa Indica Group]
Length=528

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/520 (65%), Positives = 399/520 (77%), Gaps = 11/520 (2%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLV ENRSFDHMLGWMKSLNPEI+GV G E N L     A + T+  + FG+ ++
Sbjct  10    IKTVVVLVMENRSFDHMLGWMKSLNPEIDGVTGDEINHL----DAADPTSRAIRFGDGAE  65

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKL-----EPTMQGFAANAERNQAGMSGAVMN  420
             YVDPDPGHS+Q IYEQ++G P+    A          P M GFA  AE+ + GM+  VMN
Sbjct  66    YVDPDPGHSMQAIYEQVYGTPFVDARATPITPPGVPSPPMAGFAQQAEKEKPGMADTVMN  125

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
             GF PEAVPVY+ELVR+FAVCDRWFAS PASTQPNRLFVHSATSHG  SNDTK L+ G PQ
Sbjct  126   GFRPEAVPVYRELVRQFAVCDRWFASNPASTQPNRLFVHSATSHGLVSNDTKLLVAGLPQ  185

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
             +TIF+S+ + G+SFGIYYQYPPSTLFYR+LR+LKY  NFH FD+ F+ HC EGKLPNYVV
Sbjct  186   RTIFDSLHDVGFSFGIYYQYPPSTLFYRSLRQLKYAGNFHPFDLAFRRHCAEGKLPNYVV  245

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             VEQRYFDLK+LPGNDDHPSHDV EGQ+FVKEVYEALR  PQW E L ++ YDEHGGFYDH
Sbjct  246   VEQRYFDLKMLPGNDDHPSHDVSEGQRFVKEVYEALRGGPQWEEALLVVTYDEHGGFYDH  305

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEH  1140
             VPTPV  VP+PDG++   P+ F+F+RLGVRVPA+ +SPWIE G V+H PSGP+P SE+EH
Sbjct  306   VPTPVD-VPSPDGIVSAAPFFFEFNRLGVRVPALFISPWIEPGTVVHRPSGPYPTSEFEH  364

Query  1141  SSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSA-EAKEDA  1317
             SSIPATVKK+FNL  FLT RDAWAGTF+ V+TR  PR DCP TL EPVK+R A EA E A
Sbjct  365   SSIPATVKKLFNLKSFLTNRDAWAGTFDVVLTRDAPRTDCPATLPEPVKMRPATEAAEQA  424

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              LTE+Q+E+VQ+ AVL GDH  ED YP KLVE M+VA+AA Y + AF  ++ +C+  R+ 
Sbjct  425   ALTEFQEELVQLGAVLNGDHADEDVYPRKLVEGMTVAEAASYCNAAFKAWMDECDRCRKC  484

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGR  1617
             G  G +    +   PP P+T+     SFA+K LSC ACGR
Sbjct  485   GEDGSHIPTVVKPPPPPPSTSSSGSSSFASKLLSCFACGR  524



>emb|CDM83453.1| unnamed protein product [Triticum aestivum]
Length=513

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/520 (64%), Positives = 396/520 (76%), Gaps = 17/520 (3%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVV+VQENRSFDHMLGWMKSLNP+I+GV G E+N +  +    + ++  V F + SQ
Sbjct  5     IKTVVVVVQENRSFDHMLGWMKSLNPDIDGVTGAETNRVVVA----DPSSKAVPFRDGSQ  60

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKL-----EPTMQGFAANAERNQAGMSGAVMN  420
             YVDPDPGHSIQ IYEQ++G P+    A          P M GFA  AE+ + GM+  VM+
Sbjct  61    YVDPDPGHSIQAIYEQVYGTPFVDAQATPITPPGIPAPPMSGFAQQAEKEKPGMAETVMS  120

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
             GF P+AVPVY+EL +EFAVCDRWFAS PASTQPNRLFVHSATSHG  SN+TK L+ G PQ
Sbjct  121   GFRPDAVPVYRELAQEFAVCDRWFASNPASTQPNRLFVHSATSHGLVSNNTKALVAGLPQ  180

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
              TIF+S+ +AG+SFG+YYQYPPS LFYRNLR+LKYI NFH FD+ F+ HC+EGKLPNYVV
Sbjct  181   TTIFDSLHDAGHSFGVYYQYPPSVLFYRNLRQLKYIGNFHPFDLEFRRHCREGKLPNYVV  240

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             VEQRYFDLKILPGNDDHPSHDV EGQ+FVKEVYEALRS PQW E L +I YDEHGGFYDH
Sbjct  241   VEQRYFDLKILPGNDDHPSHDVSEGQRFVKEVYEALRSGPQWEETLLVITYDEHGGFYDH  300

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEH  1140
             VPTPV GVP+PDG+I   P+ F FDRLGVRVPA  +SPWIE G V+H PSGP P SE+EH
Sbjct  301   VPTPV-GVPSPDGIISDAPFFFNFDRLGVRVPAFFISPWIEPGTVVHRPSGPHPTSEFEH  359

Query  1141  SSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SSIPATVKKIFNL  FLT+RDAWAGTF+ V+TR TPR DCP TL EPVK+R  EA E A 
Sbjct  360   SSIPATVKKIFNLGSFLTKRDAWAGTFDVVLTRDTPRTDCPATLPEPVKMRPTEAAEHAT  419

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             ++++Q E+VQ+ A L GDH K D YPHKLVE M+VA AA Y + AF  F  +CE  ++ G
Sbjct  420   ISDFQAELVQLGAALNGDHAK-DTYPHKLVEGMTVADAARYCNGAFKAFQDECERCKKCG  478

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
               G +    +   PP P +  +K   FA+K L+C ACG +
Sbjct  479   KDGSH----IPTMPPLPPS--KKRSGFASKMLACFACGHS  512



>ref|XP_002466082.1| hypothetical protein SORBIDRAFT_01g000860 [Sorghum bicolor]
 gb|EER93080.1| hypothetical protein SORBIDRAFT_01g000860 [Sorghum bicolor]
Length=540

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/488 (66%), Positives = 387/488 (79%), Gaps = 13/488 (3%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVV+VQENRSFDHMLGWMK+LNP+I+GV G E+N +     A + T+  V F + ++
Sbjct  18    IKTVVVVVQENRSFDHMLGWMKTLNPDIDGVTGVETNHV----DASDPTSRAVRFSDGAE  73

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSA------GKKLEPTMQGFAANAERNQAGMSGAVM  417
             YVDPDPGHS+Q IYEQ++G P+   +       G    P M GFA  AE+ + GMSG VM
Sbjct  74    YVDPDPGHSMQAIYEQVYGTPFVDAATTPITPPGVPAAPPMSGFAQQAEKEKPGMSGTVM  133

Query  418   NGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFP  597
             +GF P+AVPVY+ELV+EFAVCDRWFAS PASTQPNRLFVHSATSHG  SNDTK L+ G P
Sbjct  134   SGFRPDAVPVYRELVKEFAVCDRWFASNPASTQPNRLFVHSATSHGLVSNDTKALVAGLP  193

Query  598   QKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYV  777
             Q+TIF+++ + G+SFGIYYQYPPSTLFYRNLR+LKY+ +FH FD+ F+ HC+EGKLPNYV
Sbjct  194   QRTIFDALHDEGFSFGIYYQYPPSTLFYRNLRQLKYVGSFHAFDLDFRRHCREGKLPNYV  253

Query  778   VVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYD  957
             VVEQRYFDL+ILPGNDDHPSHDV EGQ+F+KEVYEALRS PQW E L ++ YDEHGGFYD
Sbjct  254   VVEQRYFDLEILPGNDDHPSHDVAEGQRFIKEVYEALRSGPQWEETLLVVTYDEHGGFYD  313

Query  958   HVPTPVTG--VPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSE  1131
             HVPTP     VP+PDG++   P+ F FDRLGVRVPA++VSPWIE G VLHGPSGP+P SE
Sbjct  314   HVPTPAGAGVVPSPDGIVSASPFFFGFDRLGVRVPALLVSPWIEPGTVLHGPSGPYPTSE  373

Query  1132  YEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKE  1311
             +EHSSIPATVKK+FNL  FLT+RDAWAGTF+ V+TR TPR DCP TL EPVKLR   A E
Sbjct  374   FEHSSIPATVKKLFNLRSFLTKRDAWAGTFDCVLTRDTPRTDCPRTLPEPVKLRRTVAAE  433

Query  1312  DANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENAR  1491
              A L+E+Q+E+VQ+AAVL GDH K D YPHKLVE M+VA+AA Y   AF  F  +CE  +
Sbjct  434   HAPLSEFQEELVQLAAVLNGDHTK-DSYPHKLVEGMTVAEAARYCVDAFKAFRDECEKCK  492

Query  1492  QRGIHGDY  1515
             +RG  G +
Sbjct  493   KRGEDGSH  500



>ref|XP_004979602.1| PREDICTED: uncharacterized protein LOC101777961 [Setaria italica]
Length=512

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/517 (62%), Positives = 385/517 (74%), Gaps = 17/517 (3%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLVQENRSFDHMLGWMKSLNPEI+GV G E N       A ++T+  V FGN SQ
Sbjct  5     IKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGAELN----HAVAGDATSPAVHFGNASQ  60

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLE-----PTMQGFAANAERNQAGMSGAVMN  420
             YVDPDPGHS   IYEQ++G P++  S     +     P M GFA  AE+ + GMS  VMN
Sbjct  61    YVDPDPGHSFMAIYEQVYGDPYTWGSGAPATKAGVAAPPMSGFAQQAEKERPGMSATVMN  120

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
             GF P+AVPVY+ELVREFAVCDRWFASVP STQPNR+FVHSATSHG   ND K L  G PQ
Sbjct  121   GFRPDAVPVYRELVREFAVCDRWFASVPTSTQPNRMFVHSATSHGLVGNDKKLLRAGMPQ  180

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
             +TIF+++ +AG+SFGIYYQ+PP+ LFYRN+R+LKY+  FH +D+ FK HCKEGKLPNYVV
Sbjct  181   RTIFDALHDAGHSFGIYYQFPPAVLFYRNMRQLKYMSKFHPYDLDFKRHCKEGKLPNYVV  240

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             +EQRY DLK+ PGNDDHPSHDV  GQ+ VKEVYEALRSSPQW+E L +I YDEHGGF+DH
Sbjct  241   IEQRYLDLKLFPGNDDHPSHDVAHGQRLVKEVYEALRSSPQWHETLLVITYDEHGGFFDH  300

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEH  1140
             VPTP  GVP+PDG++   P  F FDRLGVRVPA+ +SPWIE   V+H PSGP P S+YEH
Sbjct  301   VPTPTEGVPSPDGIVSAPPIGFAFDRLGVRVPAMFISPWIEPSTVIHRPSGPEPTSQYEH  360

Query  1141  SSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SSIPATVKKIFNL +FLT+RDAWAGTFE+V+TR TPR DCPE L EPV+LRS EA+E   
Sbjct  361   SSIPATVKKIFNLKEFLTKRDAWAGTFESVLTRATPRTDCPEKLPEPVRLRSVEAEEHRE  420

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             ++E+Q E+VQ+ A L GDH +E Y   +LVE M+VA+AADY H AF +F  +C    + G
Sbjct  421   ISEFQSELVQLGAALNGDHAREAYDTGELVEGMTVAEAADYCHGAFARFREECRRCHECG  480

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             + G +      +   +P        S + +  SC+ C
Sbjct  481   MDGSHVPTVQPEAAVAP--------SASKQLCSCLPC  509



>ref|XP_002884392.1| phosphoesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60651.1| phosphoesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/482 (67%), Positives = 385/482 (80%), Gaps = 8/482 (2%)
 Frame = +1

Query  64    SIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFG  243
             S +PIKT+VVLVQENRSFDH LGW K LN EI+GV   +    P     QNS N  ++FG
Sbjct  10    SSYPIKTIVVLVQENRSFDHTLGWFKELNREIDGVVKSDLKFNPVLSSDQNSHN--IVFG  67

Query  244   NKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP---TMQGFAANAERNQAGMSGAV  414
             ++SQYVDP+PGHSI+DIYEQ+FG PW  DS      P    M GFA NAER   GMS AV
Sbjct  68    DQSQYVDPNPGHSIRDIYEQVFGKPW--DSVHPDPNPGPAKMSGFAQNAERKMKGMSSAV  125

Query  415   MNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGF  594
             MNGF P+A+PVYKELV++FA+CDRWFASVP +TQPNRLFVHSATSHG T+N+ K LIEGF
Sbjct  126   MNGFKPDALPVYKELVQKFAICDRWFASVPGATQPNRLFVHSATSHGTTNNERKLLIEGF  185

Query  595   PQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNY  774
             PQKTIFES+DEAG++FGIYYQ  P+TLFYRNLRKLKY+  FH + + FK  CKEGKLPNY
Sbjct  186   PQKTIFESLDEAGFTFGIYYQCFPTTLFYRNLRKLKYLTRFHDYGLQFKKDCKEGKLPNY  245

Query  775   VVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFY  954
             VVVEQR++DL   P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHGGFY
Sbjct  246   VVVEQRWYDLLSNPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIITYDEHGGFY  305

Query  955   DHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEY  1134
             DHVPTPV GVPNPDG++GP PYNF+F+RLGVRVPA  +SPWIE G ++HGPSGP+P S+Y
Sbjct  306   DHVPTPVDGVPNPDGILGPPPYNFEFNRLGVRVPAFFISPWIEPGTIIHGPSGPYPMSQY  365

Query  1135  EHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKED  1314
             EHSSIPATVKKIF L  FLT+RD+WAGTFE+VITR +PR+DCPETL+ PVK+R+  AKE+
Sbjct  366   EHSSIPATVKKIFKLRNFLTKRDSWAGTFESVITRDSPRQDCPETLSNPVKMRTTVAKEN  425

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
             A L+++Q+E+V +AA L GD+  E+   HKL +   VA A+ Y    F+KF+ +   AR+
Sbjct  426   AELSDFQEELVIVAAGLKGDYKNEELM-HKLCKETCVADASKYVTNVFDKFIEESRKARE  484

Query  1495  RG  1500
             RG
Sbjct  485   RG  486



>ref|XP_006484720.1| PREDICTED: non-specific phospholipase C3-like [Citrus sinensis]
Length=520

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/516 (62%), Positives = 392/516 (76%), Gaps = 10/516 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGW KSLNPEI+GV G ESNP+  S    NST+  + F N +
Sbjct  10    PIKTVVVLVQENRSFDHMLGWFKSLNPEIDGVTGSESNPV--SASDPNSTH--LQFKNTA  65

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLE--PTMQGFAANAERNQAGMSGAVMNGF  426
              ++DPDPGHS Q IYEQ+FG PW  ++     E  P M GF  NAE  Q GMS  VMNGF
Sbjct  66    AHIDPDPGHSFQAIYEQVFGKPWDWNNPDPNPETGPKMNGFVQNAESIQKGMSEIVMNGF  125

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE +PVYKEL  EFAVCDRWF+S+P+STQ NRL++HSATSHGATSNDT KLI G+PQKT
Sbjct  126   KPETLPVYKELATEFAVCDRWFSSIPSSTQSNRLYLHSATSHGATSNDTNKLIAGYPQKT  185

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             +FES++E G+SFGIYYQ   +  FY+NLRKLKYI NFHQFD+ FK HCKEGKLPNYVV+E
Sbjct  186   VFESLEENGHSFGIYYQSFSACFFYKNLRKLKYIDNFHQFDVSFKRHCKEGKLPNYVVIE  245

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
              RYFDL  L  NDDHP HD+ +GQ+ VKE+YEALR+SPQWNE LFLIIYDEHGGFYDHVP
Sbjct  246   PRYFDLLSLAANDDHPKHDIAQGQQLVKEIYEALRASPQWNETLFLIIYDEHGGFYDHVP  305

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPVTGVP+PD ++GP+P+ F+FDRLGVRVPAI+VSPWI+ G VLHGPSGP P S++EHSS
Sbjct  306   TPVTGVPSPDDIVGPEPFFFKFDRLGVRVPAILVSPWIKPGTVLHGPSGPHPTSQFEHSS  365

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             I AT+KKIFNL +FLT+RDAWAGTFE V+ R+T R DCP  L+EPV+ R  +A+ED  L+
Sbjct  366   IAATLKKIFNLKEFLTKRDAWAGTFEGVLNRSTARADCPVKLSEPVRTRDFDAREDDELS  425

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+E+VQ+AA + GD +  D+ P  L++ M+V     Y   AF KF  + + AR+ G  
Sbjct  426   EFQQELVQLAAAVKGD-LNSDFLPDDLLKTMNVGGGLSYVEDAFKKFFDEGKKARENG--  482

Query  1507  GDYSVVALSKQPPSPNTTPR-KPKSFATKFLSCIAC  1611
              D S V L     + + + R  PK++  +  SC+ C
Sbjct  483   ADESEVVLMPNSTTQSGSQRAAPKTYLQQVFSCLIC  518



>ref|XP_006437378.1| hypothetical protein CICLE_v10031241mg [Citrus clementina]
 gb|ESR50618.1| hypothetical protein CICLE_v10031241mg [Citrus clementina]
Length=520

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/516 (62%), Positives = 391/516 (76%), Gaps = 10/516 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGW KSLNPEI+GV G ESNP+  S    NST+  + F N +
Sbjct  10    PIKTVVVLVQENRSFDHMLGWFKSLNPEIDGVTGSESNPV--SASDPNSTH--LQFKNTA  65

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLE--PTMQGFAANAERNQAGMSGAVMNGF  426
              ++DPDPGHS Q IYEQ+FG PW  ++     E  P M GF  NAE  Q GMS  VMNGF
Sbjct  66    AHIDPDPGHSFQAIYEQVFGKPWDWNNPDPNPETGPKMNGFVQNAESIQKGMSEIVMNGF  125

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE +PVYKEL  EFAVCDRWF+S+P+STQ NRL++HSATSHGATSND  KLI G+PQKT
Sbjct  126   KPETLPVYKELATEFAVCDRWFSSIPSSTQSNRLYLHSATSHGATSNDRNKLIAGYPQKT  185

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             +FES++E G+SFGIYYQ   +  FY+NLRKLKYI NFHQFD+ FK HCKEGKLPNYVV+E
Sbjct  186   VFESLEENGHSFGIYYQSFSACFFYKNLRKLKYIDNFHQFDVSFKRHCKEGKLPNYVVIE  245

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
              RYFDL  L  NDDHP HD+ +GQ+ VKE+YEALR+SPQWNE LFLIIYDEHGGFYDHVP
Sbjct  246   PRYFDLLSLAANDDHPKHDIAQGQQLVKEIYEALRASPQWNETLFLIIYDEHGGFYDHVP  305

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPVTGVP+PD ++GP+P+ F+FDRLGVRVPAI+VSPWI+ G VLHGPSGP P S++EHSS
Sbjct  306   TPVTGVPSPDDIVGPEPFFFKFDRLGVRVPAILVSPWIKPGTVLHGPSGPHPTSQFEHSS  365

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             I AT+KKIFNL +FLT+RDAWAGTFE V+ R+T R DCP  L+EPV+ R  +A+ED  L+
Sbjct  366   IAATLKKIFNLKEFLTKRDAWAGTFEGVLNRSTARADCPVKLSEPVRTRDFDAREDDELS  425

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+E+VQ+AA + GD +  D+ P  L++ M+V     Y   AF KF  + + AR+ G  
Sbjct  426   EFQQELVQLAAAVKGD-LNSDFLPDDLLKTMNVGGGLSYVEDAFKKFFDEGKKARENG--  482

Query  1507  GDYSVVALSKQPPSPNTTPR-KPKSFATKFLSCIAC  1611
              D S V L     + + + R  PK++  +  SC+ C
Sbjct  483   ADESEVVLMPNSTTQSGSQRAAPKTYLQQVFSCLIC  518



>ref|XP_010258490.1| PREDICTED: non-specific phospholipase C4-like [Nelumbo nucifera]
Length=497

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/496 (65%), Positives = 385/496 (78%), Gaps = 13/496 (3%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKES--NPLPTSGGAQNSTNDVVLFG  243
             FPIKTVVVL+QENRSFDHMLGWMK+LNPEI+GV+  +   N L T+    + ++  V FG
Sbjct  10    FPIKTVVVLIQENRSFDHMLGWMKTLNPEIDGVSSADEFYNSLSTT----DPSSKKVYFG  65

Query  244   NKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNG  423
             ++S Y+DPDP HS Q I EQ+FG+PW Q S+G +    M GFA NAE  + G+S  VMNG
Sbjct  66    DQSNYIDPDPAHSFQAICEQVFGSPWGQSSSGDEQVVKMNGFAQNAETTRKGLSDTVMNG  125

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F PEA+PVY+ELV +FAVCD WF+S P  TQPNRLFVHSATSHG  +ND KKL+EGFPQK
Sbjct  126   FRPEALPVYRELVSQFAVCDHWFSSAPTFTQPNRLFVHSATSHGLITNDVKKLVEGFPQK  185

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIF+S+DEAG++FGIY Q  P TLFYRNLRK KY  NFH FD+ FK+HCKEGKLPNYVV+
Sbjct  186   TIFDSLDEAGFTFGIYNQQFPFTLFYRNLRKHKYKNNFHNFDVEFKSHCKEGKLPNYVVI  245

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRYFDL +LP NDDHP HDV +GQKFVKEVYEALR+SPQWNE+LF+I YDEHGGFYDHV
Sbjct  246   EQRYFDLILLPANDDHPPHDVSQGQKFVKEVYEALRTSPQWNEILFIITYDEHGGFYDHV  305

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTP TGVP+PD +  P+P+NF FDRLGVRVP I +SPWIERG VLH P GP+ +SE+EHS
Sbjct  306   PTP-TGVPSPDDIASPEPFNFNFDRLGVRVPTIFISPWIERGTVLHRPLGPYLSSEFEHS  364

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEP---VKLRSAEAKED  1314
             SIPATVKKIFNL +FLT+RDAWAGTFETV+ R +PR DCP TL  P   +KL+  +A E 
Sbjct  365   SIPATVKKIFNLKEFLTKRDAWAGTFETVLMRESPRTDCPVTLPLPLQSLKLQLGDANER  424

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
             ANL+E+Q E+V++AA L  D+ K+D YP KLV +M+V  AA Y   AF KFL  C NA+ 
Sbjct  425   ANLSEFQAELVRVAATLKRDY-KKDIYPEKLVVDMTVKDAAAYCEDAFKKFLEGCGNAQN  483

Query  1495  RGIHGDYSVVALSKQP  1542
                 G+  ++ L   P
Sbjct  484   GA--GESKIILLPASP  497



>ref|XP_008665763.1| PREDICTED: non-specific phospholipase C2-like [Zea mays]
 tpg|DAA52547.1| TPA: hypothetical protein ZEAMMB73_537939 [Zea mays]
Length=541

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/482 (65%), Positives = 380/482 (79%), Gaps = 12/482 (2%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLVQENRSFDHMLGWMKSLNP+I+GV G E+N +  S  A ++    V F + ++
Sbjct  22    IKTVVVLVQENRSFDHMLGWMKSLNPDIDGVTGAETNHVDASDPASHA----VRFSDGAE  77

Query  256   YVDPDPGHSIQDIYEQIFGAPW----SQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNG  423
             YVDPDPGHS+Q IYEQ++G P+    +  +    + P+M GFA  AE+ + GMS  VM+G
Sbjct  78    YVDPDPGHSMQAIYEQVYGTPFVDAATTPATPPGVAPSMSGFAQQAEKERPGMSATVMSG  137

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F P+AVPVY++LVREFAVCDRWFAS PASTQPNRLFVHSATSHG  SND++ L+ G PQ+
Sbjct  138   FRPDAVPVYRDLVREFAVCDRWFASNPASTQPNRLFVHSATSHGLVSNDSRALVAGLPQR  197

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIF+++ + G SFG+YYQYPPSTLFYR+LR+LKY  +FH FD+HF  HC+EG+LP+YVVV
Sbjct  198   TIFDALHDEGLSFGVYYQYPPSTLFYRSLRQLKYAASFHAFDLHFARHCREGRLPSYVVV  257

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRYFDL+ LPGNDDHPSHDV EGQ+FVKEVYEALRS PQW + L ++ YDEHGGFYDHV
Sbjct  258   EQRYFDLRFLPGNDDHPSHDVAEGQRFVKEVYEALRSGPQWPQTLLVVTYDEHGGFYDHV  317

Query  964   PTPVTG--VPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHG-PSGPFPNSEY  1134
             PTP     VP+PDG++  +P++F FDRLGVRVPA++VSPWIE G VLHG PSGP P SE+
Sbjct  318   PTPAGAGVVPSPDGIVSAKPFSFAFDRLGVRVPALLVSPWIEPGTVLHGPPSGPCPTSEF  377

Query  1135  EHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKED  1314
             EHSSIPATVKK+FNL  FLT RDAWAGTF+ V+TR  PR DCP TL EPVKLR   A E 
Sbjct  378   EHSSIPATVKKLFNLRSFLTRRDAWAGTFDCVLTRDIPRTDCPLTLPEPVKLRRTAAAEH  437

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
             A L+E+Q+E+VQ+AAVL GDH KE  YP  LVE M+VA+AA Y   AF  FL +CE  + 
Sbjct  438   APLSEFQEELVQLAAVLNGDHTKES-YPQGLVEGMTVAEAARYCVDAFKAFLDECEKCKD  496

Query  1495  RG  1500
             RG
Sbjct  497   RG  498



>ref|XP_010485694.1| PREDICTED: non-specific phospholipase C5 [Camelina sativa]
Length=514

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 379/483 (78%), Gaps = 7/483 (1%)
 Frame = +1

Query  64    SIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFG  243
             S +PIKTVVVLVQENRSFDH LGW K LN EI GV   +    P      NS++ +V+F 
Sbjct  10    SSYPIKTVVVLVQENRSFDHTLGWFKELNREIGGVIKSDQKFNPVLSSDLNSSH-IVVFD  68

Query  244   NKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP---TMQGFAANAERNQAGMSGAV  414
             ++SQYVDP+PGHSI+DIYEQ+FG PW  DS      P   TM GFA NAER   GMS AV
Sbjct  69    DQSQYVDPNPGHSIRDIYEQVFGKPW--DSVHPDPNPGPATMSGFAQNAERKMKGMSSAV  126

Query  415   MNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGF  594
             MNGF P+A+PVYK+LV+ +A+CD+WFASVP +TQPNRLFVHSATSHG T ND K LIEGF
Sbjct  127   MNGFKPDALPVYKDLVQNYAICDKWFASVPGATQPNRLFVHSATSHGTTCNDRKLLIEGF  186

Query  595   PQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNY  774
             PQKTIFES+DEAG++FGIYYQ  P+TLFYRN+RKLKY+ +FH + + FK  CKEGKLPNY
Sbjct  187   PQKTIFESLDEAGFTFGIYYQCFPTTLFYRNMRKLKYLTHFHDYGLKFKKDCKEGKLPNY  246

Query  775   VVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFY  954
             VVVEQR++DL   P NDDHPSHDV +GQK VKEVYEALRSSPQWNE+LF+I YDEHGGFY
Sbjct  247   VVVEQRWYDLLSNPANDDHPSHDVSQGQKLVKEVYEALRSSPQWNEILFIITYDEHGGFY  306

Query  955   DHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEY  1134
             DHVPTPV GVPNPDG +G  PYNF+F+RLGVRVP   +SPWIE G V+HGP+GPFP S+Y
Sbjct  307   DHVPTPVDGVPNPDGFLGSPPYNFEFNRLGVRVPTFFISPWIEPGTVIHGPNGPFPMSQY  366

Query  1135  EHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKED  1314
             EHSSIPATVKKIFNL  FLT+RD+WAGTFE+VITR +PR+DCPETL+ P+K+R   AK++
Sbjct  367   EHSSIPATVKKIFNLKDFLTKRDSWAGTFESVITRDSPRQDCPETLSNPIKMRGTVAKQN  426

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
             A L+++Q+E+V +A  L GD+  E+   HKL +   +A A  Y   AF KFL +   AR+
Sbjct  427   AELSDFQEELVIVAVGLKGDYKNEELI-HKLCKQTCIADACKYVTNAFEKFLQESRKARE  485

Query  1495  RGI  1503
             RG 
Sbjct  486   RGC  488



>ref|XP_010558682.1| PREDICTED: non-specific phospholipase C3 [Tarenaya hassleriana]
Length=523

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/522 (62%), Positives = 386/522 (74%), Gaps = 13/522 (2%)
 Frame = +1

Query  58    DGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVL  237
             D S  PIKTVVVLVQENRSFDHMLGW K LNPEI+GV   E    P S    NS    + 
Sbjct  9     DSSSCPIKTVVVLVQENRSFDHMLGWFKELNPEIDGVTESEPKSNPVSTSDPNSAQ--IF  66

Query  238   FGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAV  414
             FG  SQ +DPDPGHS Q IYEQ+FG P+S +      E  M GF  NAE    GM+   V
Sbjct  67    FGKDSQIIDPDPGHSFQAIYEQVFGKPFSPEYPYP--EAKMNGFVQNAEAITPGMAEKVV  124

Query  415   MNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGF  594
             M GF PE +PV+ ELV+EF VCDRWF+S+P+STQPNRLFVHSATSHGA SNDT KL+ GF
Sbjct  125   MQGFPPEKLPVFMELVKEFGVCDRWFSSLPSSTQPNRLFVHSATSHGAFSNDTNKLVNGF  184

Query  595   PQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNY  774
             PQKT+FES++E+G+SFGIYYQ  P+ LFYRNLRKLKY+ NFHQ+ + FK HCKEGKLPNY
Sbjct  185   PQKTVFESLEESGFSFGIYYQSFPNCLFYRNLRKLKYVDNFHQYSLSFKRHCKEGKLPNY  244

Query  775   VVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFY  954
             VV+E RYF +   P NDDHP +DV EGQK VKE+YEALR+SPQWNE LF+++YDEHGG+Y
Sbjct  245   VVIEPRYFKVVSAPANDDHPKNDVREGQKLVKEIYEALRASPQWNETLFVVVYDEHGGYY  304

Query  955   DHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEY  1134
             DHVPTP+ GVPNPDGL+GP+PYNF+FDRLGVRVP +++SPWI+ G VLH P GP P S++
Sbjct  305   DHVPTPINGVPNPDGLVGPEPYNFKFDRLGVRVPVLLISPWIQPGTVLHEPLGPEPTSQF  364

Query  1135  EHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEA---  1305
             EHSSIPAT+KKIFNL  FLT+RDAWAGTFE+VI +T+PR DCP TL EP + R  +    
Sbjct  365   EHSSIPATLKKIFNLKSFLTKRDAWAGTFESVINKTSPRTDCPVTLPEPPRDRDLDVGTQ  424

Query  1306  KEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCEN  1485
             +ED  LTE+Q E++Q AAVL GDH+K D YP K+VENM V   A Y   AF  F  +   
Sbjct  425   EEDEELTEFQTELIQAAAVLKGDHIK-DIYPFKIVENMKVLDGAKYVEEAFTSFYDESRK  483

Query  1486  ARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             A++RG+H ++ +V L+K      T    PKS   K  SC+ C
Sbjct  484   AKERGVH-EHDIVDLAKH---GGTRSSNPKSLIEKLFSCLIC  521



>ref|NP_566207.1| non-specific phospholipase C5 [Arabidopsis thaliana]
 sp|Q9S816.1|NPC5_ARATH RecName: Full=Non-specific phospholipase C5 [Arabidopsis thaliana]
 gb|AAF01581.1|AC009895_2 unknown protein [Arabidopsis thaliana]
 gb|AAF03477.1|AC009327_16 putative phospholipase [Arabidopsis thaliana]
 dbj|BAC22509.1| phosphatidylglycerol specific phospholipase C [Arabidopsis thaliana]
 gb|AEE73955.1| non-specific phospholipase C5 [Arabidopsis thaliana]
Length=521

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/478 (66%), Positives = 379/478 (79%), Gaps = 4/478 (1%)
 Frame = +1

Query  70    FPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             +PIKT+VVLVQENRSFDH LGW K LN EI+GV   +    P      NS N  V+FG++
Sbjct  11    YPIKTIVVLVQENRSFDHTLGWFKELNREIDGVMKSDQKFNPGFSSDLNSHN--VVFGDQ  68

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERNQAGMSGAVMNGF  426
             SQYVDP+PGHSI+DIYEQ+FG PW          P TM GFA NAER   GMS AVMNGF
Sbjct  69    SQYVDPNPGHSIRDIYEQVFGKPWDSGHPDPNPGPATMSGFAQNAERKMKGMSSAVMNGF  128

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+A+PVYKELV+ FA+CDRWFASVP +TQPNRLF+HSATSHG T+N+ K LIEGFPQKT
Sbjct  129   KPDALPVYKELVQNFAICDRWFASVPGATQPNRLFIHSATSHGTTNNERKLLIEGFPQKT  188

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+DEAG++FGIYYQ  P+TLFYRNLRKLKY+  FH + + FK  CKEG LPNYVVVE
Sbjct  189   IFESLDEAGFTFGIYYQCFPTTLFYRNLRKLKYLTRFHDYGLQFKKDCKEGNLPNYVVVE  248

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QR++DL + P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHGGFYDHVP
Sbjct  249   QRWYDLLLNPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEILFIITYDEHGGFYDHVP  308

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP+ GVPNPDG++GP PYNF+F+RLGVRVP   +SPWIE G VLHG +GP+  S+YEHSS
Sbjct  309   TPLDGVPNPDGILGPPPYNFEFNRLGVRVPTFFISPWIEPGTVLHGSNGPYLMSQYEHSS  368

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKKIF L  FLT+RD+WAGTFE+VITR +PR+DCPETL+ PVK+R   AKE+A L+
Sbjct  369   IPATVKKIFKLKDFLTKRDSWAGTFESVITRNSPRQDCPETLSNPVKMRGTVAKENAELS  428

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             ++Q+E+V +AA L GD+  E+   +KL +   V+ A+ Y   AF+KF+ + + AR+RG
Sbjct  429   DFQEELVIVAAGLKGDYKNEELL-YKLCKKTCVSDASKYVTKAFDKFVEESKKARERG  485



>ref|XP_006299135.1| hypothetical protein CARUB_v10015277mg [Capsella rubella]
 gb|EOA32033.1| hypothetical protein CARUB_v10015277mg [Capsella rubella]
Length=512

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/482 (66%), Positives = 381/482 (79%), Gaps = 7/482 (1%)
 Frame = +1

Query  64    SIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFG  243
             S +PIKT+VVLVQENRSFDH LGW K LN EI+GV   +    P      NS++ +V F 
Sbjct  10    SSYPIKTIVVLVQENRSFDHTLGWFKELNREIDGVIKSDQKFNPVLSSDINSSH-IVPFN  68

Query  244   NKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP---TMQGFAANAERNQAGMSGAV  414
             ++SQYVDP+PGHSI++IYEQ+FG PW  DS      P   TM GFA NAER   GMS AV
Sbjct  69    DQSQYVDPNPGHSIREIYEQVFGKPW--DSVHPDPNPGPATMSGFAQNAERKMKGMSSAV  126

Query  415   MNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGF  594
             MNGF P+A+PVYKELV+ FA+CDRWFASVP +TQPNRLFVHSATSHG T+N+ K LIEGF
Sbjct  127   MNGFKPDALPVYKELVQNFAICDRWFASVPGATQPNRLFVHSATSHGTTNNERKLLIEGF  186

Query  595   PQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNY  774
             PQKTIFES+DEAG++FG+YYQ  P+TL YRNLRKLKY+ +FH++ + FK  CKEGKLPNY
Sbjct  187   PQKTIFESLDEAGFTFGVYYQCFPTTLVYRNLRKLKYLTHFHEYGLQFKKDCKEGKLPNY  246

Query  775   VVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFY  954
             VVVEQR++DL + P NDDHPSHDV +GQK VKEVYEALRSSPQWNE+LF+I YDEHGGFY
Sbjct  247   VVVEQRWYDLFLNPANDDHPSHDVSQGQKLVKEVYEALRSSPQWNEILFIITYDEHGGFY  306

Query  955   DHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEY  1134
             DHVPTPV GVPNPDG++GP PY+F+F+RLGVRVP   +SPWIE G V+H P GP+P S+Y
Sbjct  307   DHVPTPVEGVPNPDGILGPPPYHFEFNRLGVRVPTFFISPWIEPGTVIHEPKGPYPKSQY  366

Query  1135  EHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKED  1314
             EHSSIPATVK+IF L  FLT+RD+WAGTFE VITR +PR+DCPETL+ P+K+R   AKED
Sbjct  367   EHSSIPATVKQIFKLKDFLTKRDSWAGTFEYVITRDSPRQDCPETLSNPIKMRETVAKED  426

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
             A L+++Q+E+V +AA L GD+  E+   HKL +   VA A+ Y   AF KFL +   AR+
Sbjct  427   AELSDFQEELVIVAAGLKGDYKNEELI-HKLCKETCVADASKYVTNAFEKFLQESRKARE  485

Query  1495  RG  1500
             RG
Sbjct  486   RG  487



>ref|XP_002884386.1| phosphoesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60645.1| phosphoesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/517 (62%), Positives = 393/517 (76%), Gaps = 14/517 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGW K LNPEI+GV+  E    P S    NS    V FG +S
Sbjct  15    PIKTVVVLVQENRSFDHMLGWFKELNPEIDGVSESEPRSNPISTSDPNSAQ--VFFGKES  72

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNGFV  429
             Q +DPDPGHS Q IYEQ+FG P+S +S      P M GF  NAE    GMS   VM GF 
Sbjct  73    QNIDPDPGHSFQAIYEQVFGKPFSDESPYPY--PKMNGFVQNAEAITKGMSEKVVMQGFP  130

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+VH+ATS+GA SNDT  L+ GFPQ+T+
Sbjct  131   PEKLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVHAATSNGAFSNDTNTLVRGFPQRTV  190

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES++E+G++FGIYYQ  P+ LFYRN+RKLKY+ NFHQ+ + FK HCKEGKLPNYVV+E 
Sbjct  191   FESLEESGFTFGIYYQSFPNCLFYRNMRKLKYVDNFHQYHLSFKRHCKEGKLPNYVVIEP  250

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYF++   P NDDHP +DV EGQ  VKE+YEALR+SPQWN++LF+++YDEHGG+YDHVPT
Sbjct  251   RYFNILSAPANDDHPKNDVAEGQNLVKEIYEALRASPQWNQILFVVVYDEHGGYYDHVPT  310

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PVTGVPNPDGL+GP+PYNF+FDRLGVRVPA+++SPWIE   VLH P+GP P S++EHSSI
Sbjct  311   PVTGVPNPDGLVGPEPYNFKFDRLGVRVPALLISPWIEPKTVLHEPNGPEPTSQFEHSSI  370

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAE---AKEDAN  1320
             PAT+KKIFNL  FLT+RD WAGTF+ VI RT+PR DCP TL E  + R  +    +ED +
Sbjct  371   PATLKKIFNLKSFLTKRDEWAGTFDAVINRTSPRTDCPVTLPELPRARDIDIETQEEDED  430

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LT++Q E++Q AAVL GDH+K D YP KL +NM V  AA Y   AF +F G+ + A++ G
Sbjct  431   LTDFQIELIQAAAVLNGDHIK-DIYPFKLADNMKVLDAARYVEEAFTRFHGESKKAKEGG  489

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             +  ++ +V LSK     +T    PKSF  KF SC+ C
Sbjct  490   L-DEHEIVDLSKG----STRHSSPKSFVQKFFSCLIC  521



>ref|XP_009130371.1| PREDICTED: non-specific phospholipase C3 [Brassica rapa]
 emb|CDY51764.1| BnaA05g32880D [Brassica napus]
Length=521

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/515 (62%), Positives = 391/515 (76%), Gaps = 12/515 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLVQENRSFDHMLGW K LNPEI+GV+  E    P S    NS    V FG +S
Sbjct  15    PIKTIVVLVQENRSFDHMLGWFKELNPEIDGVSESEPRSNPISTSDPNSAQ--VFFGKES  72

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNGFV  429
             Q +DPDPGHS Q IYEQ+FG P+S +S      PTM GF  NAE    GMS   VM GF 
Sbjct  73    QNIDPDPGHSFQAIYEQVFGKPFSDESPYPA--PTMNGFVQNAEAITPGMSEKVVMQGFP  130

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +PV+KEL++EFAVCDRWF+S+P+STQPNRL+VHSATS+GA SNDT  L+ GFPQKT+
Sbjct  131   PERLPVFKELIQEFAVCDRWFSSLPSSTQPNRLYVHSATSNGAFSNDTNTLVRGFPQKTV  190

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES++E+G++FGIYYQ  P+ LFYRN+RKLKY+ NFHQ+ + FK HCKEGKLPNYVV+E 
Sbjct  191   FESLEESGFTFGIYYQSFPNCLFYRNMRKLKYVDNFHQYHLSFKRHCKEGKLPNYVVIEP  250

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYF +   P NDDHP +DV EGQ  VKE+YEALR+SPQWNE LF+++YDEHGG+YDHVPT
Sbjct  251   RYFKVLSAPANDDHPKNDVAEGQNLVKEIYEALRASPQWNETLFVVVYDEHGGYYDHVPT  310

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PVTGVPNPDGL+G  P+NF+FDRLGVRVPA+++SPWIE G VLH P+GP P S++EHSSI
Sbjct  311   PVTGVPNPDGLVGGPPFNFKFDRLGVRVPALLISPWIEPGTVLHEPNGPEPTSQFEHSSI  370

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRS-AEAKEDANLT  1326
             PAT+KKIFNL  FLT+RD WAGTF+ VI RT+PR DCP TL E  + R+    +ED +LT
Sbjct  371   PATLKKIFNLKSFLTKRDEWAGTFDAVINRTSPRTDCPVTLPELPRARAIGTQEEDEDLT  430

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             ++Q E++Q AAV+ GDH+K D YP KLV+NM V+ AA Y   AF KF G+ + A++ G  
Sbjct  431   DFQIELIQAAAVIRGDHIK-DIYPLKLVDNMKVSDAAKYVEEAFTKFYGESKKAKEVG-R  488

Query  1507  GDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              ++ +V LS+      T    PKSF  KF SC+ C
Sbjct  489   DEHEIVDLSQG----TTRHSSPKSFMQKFFSCLIC  519



>ref|XP_003559120.1| PREDICTED: non-specific phospholipase C4 [Brachypodium distachyon]
Length=523

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/526 (62%), Positives = 394/526 (75%), Gaps = 18/526 (3%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLVQENRSFDHMLGWMKSLNPEI+GV G E+N +     A ++++  V+F +KS+
Sbjct  5     IKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGTETNHVI----AGDASSKAVVFSDKSE  60

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP----TMQGFAANAERNQAGMSGAVMNG  423
             YVDPDPGHSIQ IYEQ++G P+  D+    + P    TM GFA  AE+ + GMS  VM+G
Sbjct  61    YVDPDPGHSIQAIYEQVYGTPFV-DATATPITPSSPATMAGFAQQAEKEKPGMSETVMSG  119

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F P+AVPVYKEL +EFAVCDRWFAS PASTQPNRLFVHS TSHG  SNDTK L+ G PQK
Sbjct  120   FKPDAVPVYKELAKEFAVCDRWFASNPASTQPNRLFVHSGTSHGLVSNDTKTLVAGLPQK  179

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIF+S+D+AG SFGIYYQ+PP+TL YRNLR+LKY+ NFHQ+D+ F+ HC+EGKLPNYVVV
Sbjct  180   TIFDSLDDAGLSFGIYYQFPPATLLYRNLRQLKYLDNFHQYDLSFRRHCREGKLPNYVVV  239

Query  784   EQRYFDLKI--LPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYD  957
             EQRYFDL    LPGNDDHPSHDV EGQ+FVKEVYEALR+  QW E L ++ YDEHGGFYD
Sbjct  240   EQRYFDLANIGLPGNDDHPSHDVGEGQRFVKEVYEALRAGKQWEETLLVVTYDEHGGFYD  299

Query  958   HVPTPVTG--VPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPS-GPFPNS  1128
             HVP P     VP+PDG++   P+ F FDRLGVRVPA  +SPWIE G V+H P+ GP P S
Sbjct  300   HVPPPSGAGVVPSPDGIVSAPPFFFNFDRLGVRVPAFFISPWIEPGTVVHRPAHGPEPTS  359

Query  1129  EYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLR--SAE  1302
             E+EHSSIPATVK IF L  FLT+RDAWAGTF+TV+TR TPRKDCP  L EPVK++  +A 
Sbjct  360   EFEHSSIPATVKAIFGLPSFLTKRDAWAGTFDTVLTRQTPRKDCPTKLPEPVKMKRLTAV  419

Query  1303  AKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCE  1482
             A     ++E+Q E+VQ+AA L GDH +ED YP KLVE M+V +A  Y + AF  F  +CE
Sbjct  420   AAAAPVISEFQAELVQLAAALNGDHARED-YPEKLVEGMTVPEAVSYCNDAFKAFRDECE  478

Query  1483  NARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGRN  1620
               +  G+ G + V  L    P     P K  SF +K L+C ACGR+
Sbjct  479   RCKSCGMDGSH-VPILPLPAPPAPPAPEKKNSFPSKILACFACGRS  523



>gb|KFK38053.1| hypothetical protein AALP_AA3G064100 [Arabis alpina]
Length=523

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/517 (61%), Positives = 390/517 (75%), Gaps = 14/517 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLVQENRSFDHMLGW K LNPEI+GV+  E    P S    NS    + FG +S
Sbjct  15    PIKTIVVLVQENRSFDHMLGWFKELNPEIDGVSESEPRSNPISTSDPNSAR--IFFGKES  72

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNGFV  429
             Q +DPDPGHS Q IYEQ+FG P++ +S     +PTM GF  NAE    GMS   VM GF 
Sbjct  73    QNIDPDPGHSFQAIYEQVFGKPFTDESPYP--DPTMNGFVQNAEAITVGMSEKVVMQGFP  130

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+VH+ATS+GA SNDT  L+ GFPQKT+
Sbjct  131   PERLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVHAATSNGAFSNDTNTLVRGFPQKTV  190

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES++E+G++FGIY+Q  P+ LFYRN+RKLKY+ NFHQ+ + FK HCKEGKLPNYVV+E 
Sbjct  191   FESLEESGFTFGIYHQSFPNCLFYRNMRKLKYVDNFHQYHLSFKRHCKEGKLPNYVVIEP  250

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYF +   P NDDHP +DV EGQ  VKE+YEALR+SPQWNE LF+++YDEHGG+YDHVPT
Sbjct  251   RYFKILSAPANDDHPKNDVVEGQNLVKEIYEALRASPQWNETLFIVVYDEHGGYYDHVPT  310

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PVTGVPNPDGL+GP PYNF+FDRLGVRVPA+++SPWIE G VLH P+GP P S++EHSSI
Sbjct  311   PVTGVPNPDGLVGPPPYNFKFDRLGVRVPALLISPWIEPGTVLHEPNGPQPTSQFEHSSI  370

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAE---PVKLRSAEAKEDAN  1320
             PAT+KKIFNL  FLT+RD WAGT + VI RT+PR DCP TL E   P  +     +ED +
Sbjct  371   PATLKKIFNLKSFLTKRDEWAGTLDAVINRTSPRTDCPVTLPELPRPRDIDIGTQEEDED  430

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LT++Q E++Q AAV+ GDH+K D YP KL +NM V  AA Y   AF KF G+ + A++ G
Sbjct  431   LTDFQIELIQAAAVIKGDHIK-DIYPFKLADNMKVYDAAKYVEEAFTKFYGESKKAKEIG  489

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              H ++ +V LSK     +T    PKSF  K  SC+ C
Sbjct  490   -HDEHEIVDLSKG----STRHSHPKSFIQKLFSCLIC  521



>emb|CDY50647.1| BnaC05g48190D [Brassica napus]
Length=521

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/515 (62%), Positives = 392/515 (76%), Gaps = 12/515 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLVQENRSFDHMLGW K LNPEI+GV+  E    P S    NS    V FG +S
Sbjct  15    PIKTIVVLVQENRSFDHMLGWFKELNPEIDGVSESEPRSNPISTSDPNSAQ--VFFGKES  72

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNGFV  429
             Q +DPDPGHS Q IYEQ+FG P+S +S      PTM GF  NAE   +GMS   VM GF 
Sbjct  73    QNIDPDPGHSFQAIYEQVFGKPFSDESPYPA--PTMNGFVQNAEAITSGMSEKVVMQGFP  130

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+VHSATS+GA SNDT  L+ GFPQKT+
Sbjct  131   PERLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVHSATSNGAFSNDTNTLVRGFPQKTV  190

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES++E+ ++FGIYYQ  P+ LFYRN+RKLKY+ NFHQ+ + FK HCKEGKLPNYVV+E 
Sbjct  191   FESLEESKFTFGIYYQSFPNCLFYRNMRKLKYVDNFHQYHLSFKRHCKEGKLPNYVVIEP  250

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYF +   P NDDHP +DV EGQ  VKE+YEALR+SPQWNE+LF+++YDEHGG+YDHVPT
Sbjct  251   RYFKVLSAPANDDHPKNDVAEGQNLVKEIYEALRASPQWNEILFVVVYDEHGGYYDHVPT  310

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PVTGVPNPDGL+G  P+NF+FDRLGVRVPA+++SPWIE G VLH P+GP P S++EHSSI
Sbjct  311   PVTGVPNPDGLVGGPPFNFKFDRLGVRVPALLISPWIEPGTVLHEPNGPEPTSQFEHSSI  370

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRS-AEAKEDANLT  1326
             PAT+KKIFNL  FLT+RD WAGTF+ +I RT+PR DCP TL E  + R+    +ED +LT
Sbjct  371   PATLKKIFNLKSFLTKRDEWAGTFDAIINRTSPRTDCPVTLPELPRARAIGTQEEDEDLT  430

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             ++Q E++Q AAV+ GDH+K D YP KLV+NM V+ AA Y   AF KF G+ + A++ G  
Sbjct  431   DFQIELIQAAAVIRGDHIK-DIYPLKLVDNMKVSDAAKYVEEAFTKFYGESKKAKEVG-R  488

Query  1507  GDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              ++ +V LS+      T    PKSF  KF SC+ C
Sbjct  489   DEHEIVDLSQG----TTRHSSPKSFMQKFFSCLIC  519



>ref|XP_002451037.1| hypothetical protein SORBIDRAFT_05g023030 [Sorghum bicolor]
 gb|EES10025.1| hypothetical protein SORBIDRAFT_05g023030 [Sorghum bicolor]
Length=510

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/520 (62%), Positives = 382/520 (73%), Gaps = 26/520 (5%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLVQENRSFDHMLGWMKSLN EI+GV G E N       A ++T+  V FGN SQ
Sbjct  5     IKTVVVLVQENRSFDHMLGWMKSLNSEIDGVTGAEVN----YTVAGDATSTAVHFGNASQ  60

Query  256   YVDPDPGHSIQDIYEQIFGAP--WSQDSAGKK---LEPTMQGFAANAERNQAGMSGAVMN  420
             YVDPDPGHS   IYEQI+G    W   +   K     P M GFA  AE  + G   AVMN
Sbjct  61    YVDPDPGHSFMAIYEQIYGDAFTWGVTAPATKPGVTVPPMSGFAQQAEAEKPGTPHAVMN  120

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
             GF P+AVPVY+ELV EFAVCDRWFASVP STQPNR+FVHSATSHG   ND K L EG PQ
Sbjct  121   GFRPDAVPVYRELVGEFAVCDRWFASVPTSTQPNRMFVHSATSHGLVGNDKKLLREGMPQ  180

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
             +TIF+++ +AG+SFGIYYQ+PP+ L YRN+R+LKYI  FH++++HFK HC+EGKLPNYVV
Sbjct  181   RTIFDALHDAGHSFGIYYQFPPAVLLYRNMRQLKYIGKFHEYELHFKRHCREGKLPNYVV  240

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             +EQRY D K+LPGNDDHPSHDV  GQ+ VKEVYEALRSSPQWNE+LF+I YDEHGGF+DH
Sbjct  241   IEQRYLDWKLLPGNDDHPSHDVAHGQRLVKEVYEALRSSPQWNEILFVITYDEHGGFFDH  300

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHG-PSGPFPNSEYE  1137
             VPTPV GVP+PDG++   P NF FDRLGVRVPA+ +SPWIE G V+H  PSGP P S+YE
Sbjct  301   VPTPVDGVPSPDGIVSAAPINFAFDRLGVRVPAMFISPWIEPGTVIHRPPSGPEPTSQYE  360

Query  1138  HSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             HSSIPATVKKIF L +FLT+RDAWAGTFE V+TR TPR DCPETL EPV+LR A+A+ED 
Sbjct  361   HSSIPATVKKIFGLKEFLTKRDAWAGTFEHVLTRATPRTDCPETLPEPVRLREAKAEEDQ  420

Query  1318  N--LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENAR  1491
                ++E+Q E+VQ+ A L GDH  E Y   KLV+ M+VA+A+DY   AF +F  +C+   
Sbjct  421   RREVSEFQAELVQLGAALNGDHATEAYESDKLVKGMTVAEASDYCRAAFARFREECQRCH  480

Query  1492  QRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             + G+   +               P  P   A+K   C+ C
Sbjct  481   EGGMDECH--------------VPALPPPTASKLCGCLPC  506



>ref|XP_006408294.1| hypothetical protein EUTSA_v10020514mg [Eutrema salsugineum]
 gb|ESQ49747.1| hypothetical protein EUTSA_v10020514mg [Eutrema salsugineum]
Length=521

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/526 (61%), Positives = 392/526 (75%), Gaps = 15/526 (3%)
 Frame = +1

Query  49    EISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTND  228
             E S G   PIKT+VVLVQENRSFDHMLGW K LNPEI+GV+  E    P S    NS   
Sbjct  4     ETSSGGSSPIKTIVVLVQENRSFDHMLGWFKELNPEIDGVSESEPRSNPISTSDPNSAQ-  62

Query  229   VVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-  405
              V FG +SQ +DPDPGHS Q IYEQ+FG P+S +S     +P M GF  NAE    GMS 
Sbjct  63    -VFFGKESQNIDPDPGHSFQAIYEQVFGKPFSDESPYP--DPKMNGFVQNAEAITKGMSE  119

Query  406   GAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLI  585
               VM GF PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+V+SATS+GA SNDT  L+
Sbjct  120   KVVMQGFPPERLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVNSATSNGAFSNDTNTLV  179

Query  586   EGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKL  765
              GFPQKT+FES++E+G++FGIYYQ  P+ LFYRN+RKLKY+ NF+Q+D+ FK HCKEGKL
Sbjct  180   RGFPQKTVFESLEESGFTFGIYYQSFPNCLFYRNMRKLKYVDNFNQYDLSFKRHCKEGKL  239

Query  766   PNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHG  945
             PNYV +E RYF +   P NDDHP +DV EGQ  VKE+YEALR+SPQWNE LF+++YDEHG
Sbjct  240   PNYVFIEPRYFKVLTAPANDDHPKNDVVEGQNLVKEIYEALRASPQWNETLFVVVYDEHG  299

Query  946   GFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPN  1125
             G+YDHVPTPV GVPNPDGL+GP+PYNF+F+RLGVRVPA+++SPWIE G VLH P GP   
Sbjct  300   GYYDHVPTPVIGVPNPDGLVGPEPYNFKFNRLGVRVPALLISPWIEPGTVLHEPKGPEAT  359

Query  1126  SEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRS---  1296
             S++EHSSIPAT+KK+FNL  FLT+RD WAGTF+ VI RT+PR DCP TL E  + R    
Sbjct  360   SQFEHSSIPATLKKVFNLKSFLTKRDEWAGTFDAVINRTSPRTDCPVTLPELPRKRDIDI  419

Query  1297  -AEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLG  1473
               + +E+ NLT++Q E++Q AAVL GDH+K D YP KL ENM V  AA Y   AFNKF G
Sbjct  420   GTQEEEEENLTDFQIELIQAAAVLKGDHIK-DIYPFKLAENMKVLDAAKYVEEAFNKFHG  478

Query  1474  DCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
             + + A++ G   ++ +V LS      +T    PKSF  KF SC+ C
Sbjct  479   ESKKAKEGGCD-EHEIVDLSNG----STRHSNPKSFIQKFFSCLIC  519



>ref|NP_187002.1| non-specific phospholipase C3 [Arabidopsis thaliana]
 sp|Q9SRQ6.1|NPC3_ARATH RecName: Full=Non-specific phospholipase C3 [Arabidopsis thaliana]
 gb|AAF01583.1|AC009895_4 unknown protein [Arabidopsis thaliana]
 gb|AAN13002.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC22510.1| phosphatidylglycerol specific phospholipase C [Arabidopsis thaliana]
 gb|AEE73953.1| non-specific phospholipase C3 [Arabidopsis thaliana]
Length=523

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/519 (61%), Positives = 393/519 (76%), Gaps = 18/519 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKE--SNPLPTSGGAQNSTNDVVLFGN  246
             PIKT+VVLVQENRSFDHMLGW K LNPEI+GV+  E  SNPL TS    +  +  + FG 
Sbjct  15    PIKTIVVLVQENRSFDHMLGWFKELNPEIDGVSESEPRSNPLSTS----DPNSAQIFFGK  70

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNG  423
             +SQ +DPDPGHS Q IYEQ+FG P+S +S     +P M GF  NAE    GMS   VM G
Sbjct  71    ESQNIDPDPGHSFQAIYEQVFGKPFSDESPYP--DPKMNGFVQNAEAITKGMSEKVVMQG  128

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+VH+ATS+GA SNDT  L+ GFPQ+
Sbjct  129   FPPEKLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVHAATSNGAFSNDTNTLVRGFPQR  188

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             T+FES++E+G++FGIYYQ  P+ LFYRN+RKLKY+ NFHQ+ + FK HCKEGKLPNYVV+
Sbjct  189   TVFESLEESGFTFGIYYQSFPNCLFYRNMRKLKYVDNFHQYHLSFKRHCKEGKLPNYVVI  248

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             E RYF +   P NDDHP +DV EGQ  VKE+YEALR+SPQWNE+LF+++YDEHGG+YDHV
Sbjct  249   EPRYFKILSAPANDDHPKNDVVEGQNLVKEIYEALRASPQWNEILFVVVYDEHGGYYDHV  308

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTPV GVPNPDGL+GP+PYNF+FDRLGVRVPA+++SPWIE G VLH P+GP P S++EHS
Sbjct  309   PTPVIGVPNPDGLVGPEPYNFKFDRLGVRVPALLISPWIEPGTVLHEPNGPEPTSQFEHS  368

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAE---AKED  1314
             SIPAT+KKIFNL  FLT+RD WAGT + VI RT+PR DCP TL E  + R  +    +ED
Sbjct  369   SIPATLKKIFNLKSFLTKRDEWAGTLDAVINRTSPRTDCPVTLPELPRARDIDIGTQEED  428

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
              +LT++Q E++Q AAVL GDH+K D YP KL + M V  AA Y   AF +F G+ + A++
Sbjct  429   EDLTDFQIELIQAAAVLKGDHIK-DIYPFKLADKMKVLDAARYVEEAFTRFHGESKKAKE  487

Query  1495  RGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              G   ++ +V LSK     +T    PKSF  K  SC+ C
Sbjct  488   EG-RDEHEIVDLSKG----STRHSTPKSFVQKLFSCLIC  521



>ref|XP_006297431.1| hypothetical protein CARUB_v10013454mg [Capsella rubella]
 gb|EOA30329.1| hypothetical protein CARUB_v10013454mg [Capsella rubella]
Length=523

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/517 (61%), Positives = 389/517 (75%), Gaps = 14/517 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGW K LNPEI+GV+  E    P S    NS    + FG +S
Sbjct  15    PIKTVVVLVQENRSFDHMLGWFKELNPEIDGVSESEPRSNPISTSDPNSPQ--IFFGKES  72

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNGFV  429
             Q +DPDPGHS Q IYEQ+FG P+S ++     +P M GF  NAE    GMS   VM GF 
Sbjct  73    QNIDPDPGHSFQAIYEQVFGKPFSDETPYP--DPKMNGFVQNAEAITKGMSEKVVMQGFP  130

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+VH+ATS+GA SNDT  L+ GFPQ+T+
Sbjct  131   PERLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVHAATSNGAFSNDTNTLVRGFPQRTV  190

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES++E+G++FGIYYQ  P+ LFYRN+RKLKY+ NFH++ + FK HCK GKLPNYVV+E 
Sbjct  191   FESLEESGFTFGIYYQSFPNCLFYRNMRKLKYVDNFHEYHLSFKRHCKAGKLPNYVVIEP  250

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYF +   P NDDHP +DV EGQ  VKE+YEALR+SPQWNE+LF+++YDEHGG+YDHVPT
Sbjct  251   RYFKIMSAPANDDHPKNDVAEGQNLVKEIYEALRASPQWNEILFVVVYDEHGGYYDHVPT  310

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVPNPDGL+GP+PYNF+FDRLGVRVPA+++SPWIE G VLH P+GP P S+YEHSSI
Sbjct  311   PVIGVPNPDGLVGPEPYNFKFDRLGVRVPALLISPWIEPGTVLHEPNGPEPTSQYEHSSI  370

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAE---PVKLRSAEAKEDAN  1320
             PAT+KKIFNL  FLT+RD WAGT + VI RT+PR DCP TL E   P  +     + D +
Sbjct  371   PATLKKIFNLKSFLTKRDEWAGTLDAVINRTSPRTDCPVTLPELPRPRDIDIGTQEGDED  430

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LT++Q E++Q AAVL GDH+K D YP KLVENM V  AA Y   AF +F G+ + A++ G
Sbjct  431   LTDFQIELIQAAAVLKGDHIK-DIYPLKLVENMKVLDAAKYVEEAFTRFYGESKKAKEGG  489

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
                ++ +V LSK     +T    PKSF  KF SC+ C
Sbjct  490   -RDEHEIVDLSKG----STRHSNPKSFVQKFFSCLIC  521



>ref|XP_010485692.1| PREDICTED: non-specific phospholipase C3 [Camelina sativa]
Length=523

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/517 (61%), Positives = 390/517 (75%), Gaps = 14/517 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFDHMLGW K LNP+I+GV+  E    P S    NS    V FG +S
Sbjct  15    PIKTVVVLVQENRSFDHMLGWFKELNPDIDGVSESEPRSNPFSTSDPNSAQ--VFFGKES  72

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNGFV  429
             Q +DPDPGHS Q IYEQ+FG P+S +S     +P M GF  NAE    GMS   VM GF 
Sbjct  73    QNIDPDPGHSFQAIYEQVFGKPFSHESPYP--DPKMNGFVQNAEAITKGMSEKVVMQGFP  130

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+VHSATS+GA SNDT  L+ GFPQ+T+
Sbjct  131   PERLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVHSATSNGAFSNDTNTLVRGFPQRTV  190

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES++E+G++FGIYYQ  P+ LFYRN+RKLKY+ NFH++ + FK HCK GKLPNYVV+E 
Sbjct  191   FESLEESGFTFGIYYQSFPNCLFYRNIRKLKYVDNFHEYHLSFKRHCKAGKLPNYVVIEP  250

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYF +   P NDDHP +DV +GQ  VKE+YEALR+SPQWNE+LF+++YDEHGG+YDHVPT
Sbjct  251   RYFKIMSAPANDDHPKNDVADGQNLVKEIYEALRASPQWNEILFVVVYDEHGGYYDHVPT  310

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVPNPDGL+GP+PYNF+FDRLGVRVPA+++SPWIE G VLH P+GP P S++EHSSI
Sbjct  311   PVIGVPNPDGLVGPEPYNFKFDRLGVRVPALLISPWIEPGTVLHEPNGPEPTSQFEHSSI  370

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAE---AKEDAN  1320
             PAT+KKIFNL  FLT+RD WAGT + VI RT+PR DCP TL E  +LR  +    +ED +
Sbjct  371   PATLKKIFNLKSFLTKRDEWAGTLDAVINRTSPRTDCPVTLPELPRLRDIDIGTQEEDED  430

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LT++Q E++Q AAVL GDH+K D YP KL ENM V  AA Y   AF +F G+ + A++ G
Sbjct  431   LTDFQIELIQAAAVLKGDHIK-DIYPLKLTENMKVLDAAKYVEEAFTRFYGESKKAKEGG  489

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
                ++ ++ LSK     +T    PKSF  K  SC+ C
Sbjct  490   -RDEHEILDLSKG----STRHSNPKSFIQKLFSCLIC  521



>ref|XP_010511433.1| PREDICTED: non-specific phospholipase C3-like [Camelina sativa]
Length=523

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/519 (61%), Positives = 392/519 (76%), Gaps = 18/519 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKE--SNPLPTSGGAQNSTNDVVLFGN  246
             PIKT+VVLVQENRSFDHMLGW K LNP+I+GV+  E  SNP  TS    N  +  V FG 
Sbjct  15    PIKTIVVLVQENRSFDHMLGWFKELNPKIDGVSESEPRSNPFSTS----NPNSAQVFFGK  70

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNG  423
             +SQ +DPDPGHS Q IYEQ+FG P+S ++     +P M GF  NAE    GMS   VM G
Sbjct  71    ESQNIDPDPGHSFQAIYEQVFGKPFSHENPYP--DPKMNGFVQNAEAITKGMSEKVVMQG  128

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+VHSATS+GA SNDT  L+ GFPQ+
Sbjct  129   FPPERLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVHSATSNGAFSNDTNTLVRGFPQR  188

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             T+FES++E+G++FGIYYQ  P+ LFYRN+RKLKY+ NFH++ + FK HCK GKLPNYVV+
Sbjct  189   TVFESLEESGFTFGIYYQSFPNCLFYRNMRKLKYVDNFHEYHLSFKRHCKAGKLPNYVVI  248

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             E RYF +   P NDDHP +DV +GQ  VKE+YEALR+SPQWNE+LF+++YDEHGG+YDHV
Sbjct  249   EPRYFKIMSAPANDDHPKNDVADGQNLVKEIYEALRASPQWNEILFVVVYDEHGGYYDHV  308

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTPV GVPNPDGL+GP+PYNF+FDRLGVRVPA+++SPWIE G VLH P+GP P S++EHS
Sbjct  309   PTPVIGVPNPDGLVGPEPYNFKFDRLGVRVPALLISPWIEPGTVLHEPNGPEPTSQFEHS  368

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAE---PVKLRSAEAKED  1314
             SIPAT+KKIFNL  FLTERD WAGT + VI RT+PR DCP TL E   P  +     +ED
Sbjct  369   SIPATLKKIFNLKSFLTERDEWAGTLDAVINRTSPRTDCPVTLPELPRPRDIDIGTQEED  428

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
              +LT++Q E++Q AAVL GDH+K D YP KL ENM V  AA Y   AF +F G+ + A++
Sbjct  429   EDLTDFQIELIQAAAVLKGDHIK-DIYPLKLAENMKVLDAAKYVEEAFTRFYGESKKAKE  487

Query  1495  RGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              G   ++ ++ LSK+    +T    PKSF  K  SC+ C
Sbjct  488   GG-RDEHEILDLSKR----STRHSNPKSFIQKLFSCLIC  521



>gb|AAL38718.1| unknown protein [Arabidopsis thaliana]
Length=523

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/519 (61%), Positives = 392/519 (76%), Gaps = 18/519 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKE--SNPLPTSGGAQNSTNDVVLFGN  246
             PIKT+VVLVQENRSFDHMLGW K LNPEI+GV+  E  SNPL TS    +  +  + FG 
Sbjct  15    PIKTIVVLVQENRSFDHMLGWFKELNPEIDGVSESEPRSNPLSTS----DPNSAQIFFGK  70

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNG  423
             +SQ +DPDPGHS Q IYEQ+FG P+S +S     +P M GF  NAE    GMS   VM G
Sbjct  71    ESQNIDPDPGHSFQAIYEQVFGKPFSDESPYP--DPKMNGFVQNAEAITKGMSEKVVMQG  128

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+VH+ATS+GA SNDT  L+ GFPQ+
Sbjct  129   FPPEKLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVHAATSNGAFSNDTNTLVRGFPQR  188

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             T+FES++E+G++FGIYYQ  P+ LFYRN+RKLKY+ NFHQ+ + FK HCKEGKLPNYVV+
Sbjct  189   TVFESLEESGFTFGIYYQSFPNCLFYRNMRKLKYVDNFHQYHLSFKRHCKEGKLPNYVVI  248

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             E RYF +   P NDDHP +DV EGQ  VKE+YEALR+SPQWNE+LF+++YDEHGG+YDHV
Sbjct  249   EPRYFKILSAPANDDHPKNDVVEGQNLVKEIYEALRASPQWNEILFVVVYDEHGGYYDHV  308

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTPV GVPNPDGL+GP+PYNF+FDRLGVRVPA+++SPWIE G VLH P+GP P S++EHS
Sbjct  309   PTPVIGVPNPDGLVGPEPYNFKFDRLGVRVPALLISPWIEPGTVLHEPNGPEPTSQFEHS  368

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAE---AKED  1314
             SIPAT+KKIFNL  FLT+RD WAGT + VI RT+PR DCP TL    + R  +    +ED
Sbjct  369   SIPATLKKIFNLKSFLTKRDEWAGTLDAVINRTSPRTDCPVTLPGLPRARDIDIGTQEED  428

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
              +LT++Q E++Q AAVL GDH+K D YP KL + M V  AA Y   AF +F G+ + A++
Sbjct  429   EDLTDFQIELIQAAAVLKGDHIK-DIYPFKLADKMKVLDAARYVEEAFTRFHGESKKAKE  487

Query  1495  RGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
              G   ++ +V LSK     +T    PKSF  K  SC+ C
Sbjct  488   EG-RDEHEIVDLSKG----STRHSTPKSFVQKLFSCLIC  521



>ref|XP_010463801.1| PREDICTED: non-specific phospholipase C3-like [Camelina sativa]
Length=523

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/517 (61%), Positives = 387/517 (75%), Gaps = 14/517 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLVQENRSFD+MLGW K LNPEI+GV+  E    P S    NS    V FG +S
Sbjct  15    PIKTVVVLVQENRSFDNMLGWFKELNPEIDGVSESEPRSNPISTSDPNSAQ--VFFGKES  72

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMS-GAVMNGFV  429
             Q +DPDPGHS Q IYEQ+FG P+S +S     +P M GF  NAE    GMS   VM GF 
Sbjct  73    QNIDPDPGHSFQAIYEQVFGKPFSHESPYP--DPKMNGFVQNAEAITKGMSEKVVMQGFP  130

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +PV+KELV+EFAVCDRWF+S+P+STQPNRL+VHSATS+GA SNDT  L+ GFPQKT+
Sbjct  131   PERLPVFKELVQEFAVCDRWFSSLPSSTQPNRLYVHSATSNGAFSNDTNALVRGFPQKTV  190

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES++E+G++FGIYYQ  P+ LFYRN+RKLKY+ NFHQ+ + FK HCK GKLPNYVV+E 
Sbjct  191   FESLEESGFTFGIYYQSFPNCLFYRNMRKLKYVDNFHQYHLSFKRHCKAGKLPNYVVIEP  250

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYF +   P NDDHP +DV +GQ  VKE+YEALR+SPQWNE+LF+++YDEHGG+YDHVPT
Sbjct  251   RYFKIMSAPANDDHPKNDVADGQNLVKEIYEALRASPQWNEILFVVVYDEHGGYYDHVPT  310

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVPNPDGL+ P+PYNF+FDRLGVRVPA+++SPWIE G VLH P+GP P S++EHSSI
Sbjct  311   PVIGVPNPDGLVRPEPYNFKFDRLGVRVPALLISPWIEPGTVLHEPNGPEPTSQFEHSSI  370

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAE---PVKLRSAEAKEDAN  1320
             PAT+KKIFNL  FLT+RD WAGT + VI RT+PR DCP TL E   P  +     +ED +
Sbjct  371   PATLKKIFNLKSFLTKRDEWAGTLDAVINRTSPRTDCPVTLPELPRPRDIDIGTQEEDED  430

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LT++Q E++Q AAVL GDH+K D YP KL ENM V  AA Y   AF +F G+ + A++ G
Sbjct  431   LTDFQIELIQAAAVLKGDHVK-DIYPLKLAENMKVLDAAKYVEEAFTRFNGESKKAKEGG  489

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIAC  1611
               G + ++ LSK     +T    PKSF  K  SC+ C
Sbjct  490   RDG-HEILDLSKG----STRHSNPKSFIQKLFSCLIC  521



>ref|XP_006663021.1| PREDICTED: non-specific phospholipase C4-like [Oryza brachyantha]
Length=526

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/485 (64%), Positives = 372/485 (77%), Gaps = 9/485 (2%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLVQENRSFDHMLGWMKSLNPEI+GV G E N       A + T+  V FG+ S 
Sbjct  5     IKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGAEFN----RATAGDETSPAVHFGDGSV  60

Query  256   YVDPDPGHSIQDIYEQIFGAP--WSQDSAGKKLE---PTMQGFAANAERNQAGMSGAVMN  420
             YVDPDPGHS Q IYEQ++G    W   S   K     P M GF   AE+ +AGMS  VMN
Sbjct  61    YVDPDPGHSFQAIYEQVYGDAYTWGVTSPATKPGVPVPPMSGFVQEAEKERAGMSRTVMN  120

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
             GF P+AVPVY+ELV+EFAVCDRWFASVP+STQPNR+FVHSATSHG  SND K+L  G PQ
Sbjct  121   GFRPDAVPVYRELVKEFAVCDRWFASVPSSTQPNRMFVHSATSHGLVSNDGKQLRAGLPQ  180

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
             +TIF+++ +AG+SFG+YYQ+PPS LFYRN+R+LKY+ N+H +D+ FK  C+EGKLPNYVV
Sbjct  181   RTIFDALHDAGHSFGVYYQFPPSVLFYRNMRQLKYLGNYHPYDVAFKRDCREGKLPNYVV  240

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             +EQRYFDLK+LPGNDDHPSHDV +GQ+ VKEVYEALRS PQW+E L ++ YDEHGGF+DH
Sbjct  241   IEQRYFDLKLLPGNDDHPSHDVAQGQRLVKEVYEALRSGPQWHETLLVVTYDEHGGFFDH  300

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEH  1140
             VPTPVTGVP+PDG++   P  F FD LGVRVP ++VSPW+E G V+H P GP P S+YEH
Sbjct  301   VPTPVTGVPSPDGIVSAAPVLFGFDPLGVRVPTLLVSPWVEPGTVVHAPDGPEPTSQYEH  360

Query  1141  SSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SSIPATVKKIF L +FLT RDAWAGTF+TV+TR TPR DCP  L EPV+LR AEA+E   
Sbjct  361   SSIPATVKKIFGLKEFLTRRDAWAGTFDTVLTRATPRADCPAKLPEPVRLREAEAEEHRE  420

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             ++E+Q E+VQ+ A L GDH KE Y P  LV+ M+VA AA Y   AF+ F  +C   R  G
Sbjct  421   ISEFQAELVQLGAALNGDHDKEGYDPEGLVQGMTVAAAAAYCGDAFDLFREECHRCRDSG  480

Query  1501  IHGDY  1515
             + G +
Sbjct  481   MDGSH  485



>gb|AGT17027.1| phosphoesterase [Saccharum hybrid cultivar R570]
Length=489

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/517 (61%), Positives = 370/517 (72%), Gaps = 45/517 (9%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLVQENRSFDHMLGWMKSLNP I+GV G E+N +     A + T+  V F + ++
Sbjct  13    IKTVVVLVQENRSFDHMLGWMKSLNPHIDGVTGIETNHM----DASDPTSRAVRFSDGAE  68

Query  256   YVDP-DPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             YVDP   GH                               A AE+ + GMSG VM+GF P
Sbjct  69    YVDPLHAGH-----------------------------LRAGAEKEKPGMSGTVMSGFRP  99

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             +AVPVY+ELV EFAVCDRWFAS PASTQPNRLFVHSATSHG  SNDTK L+ G PQ+TIF
Sbjct  100   DAVPVYRELVPEFAVCDRWFASNPASTQPNRLFVHSATSHGLVSNDTKALVAGLPQRTIF  159

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +++ + G+SFGIYYQYPPSTLFYRNLR+LKY  +FH FD+ F+ HC+EGKLP+YVVVEQR
Sbjct  160   DALHDEGFSFGIYYQYPPSTLFYRNLRQLKYAGSFHAFDLDFRRHCREGKLPSYVVVEQR  219

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFDLKILPGNDDHPSHDV EGQ+FVKEVYEALRS PQW E L      EHGGFYDHVPTP
Sbjct  220   YFDLKILPGNDDHPSHDVAEGQRFVKEVYEALRSGPQWEETL------EHGGFYDHVPTP  273

Query  973   VTG--VPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
                  VP+P G++   P+ F FDRLGVRVPA++VSPWIE G VLH PSGP+P SE+EHSS
Sbjct  274   AGAGVVPSPHGIVSAAPFFFGFDRLGVRVPALLVSPWIEPGTVLHRPSGPYPTSEFEHSS  333

Query  1147  IPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             IPATVKK+FNL  FLT+RDAWAGTF+ V+TR TPR DCP TL EPVKLR     E A L+
Sbjct  334   IPATVKKLFNLRSFLTKRDAWAGTFDCVLTRDTPRTDCPLTLPEPVKLRRTAVAEHAPLS  393

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+E+VQ+AAV  GDH KE  YPHKLVE M+VA+AA Y   AF  F  +CE  ++RG  
Sbjct  394   EFQEELVQLAAVFNGDHTKES-YPHKLVEGMTVAEAARYCVDAFKAFQDECEKCKKRGED  452

Query  1507  GDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGR  1617
             G +  +   K   S     +   SF +K L+C+ C R
Sbjct  453   GSH--IPTVKPSSSGKDKDKSKSSFVSKALACLPCAR  487



>ref|XP_004228500.1| PREDICTED: non-specific phospholipase C2 [Solanum lycopersicum]
Length=533

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 367/480 (76%), Gaps = 13/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK +NPEINGV G ESNP+ TS    +  +  + FG++S
Sbjct  41    PIKTVVVLVMENRSFDHMLGWMKKMNPEINGVDGSESNPISTS----DPNSRRIFFGDQS  96

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDPGHS Q I EQIFG+    + + KKL P M GF   A      M   VMNGF P
Sbjct  97    HYVDPDPGHSFQAIREQIFGS----NQSSKKLAP-MNGFVQQALSMDTNMPEQVMNGFQP  151

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             + V VYK LV EFAV DRWFASVPASTQPNRL+VHS TSHGATSN  + L +G+PQ+TIF
Sbjct  152   QMVSVYKTLVSEFAVFDRWFASVPASTQPNRLYVHSGTSHGATSNIAELLAKGYPQRTIF  211

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             E++D+AG +FGIYYQ  P+TLFY NLRKLKYI  FH +D+ FK+  K GKLP YVVVEQR
Sbjct  212   ENLDDAGVNFGIYYQNIPATLFYLNLRKLKYIGKFHPYDLTFKSDAKSGKLPGYVVVEQR  271

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K++P NDDHPSHDV++GQ FVKEVYE LR+SPQWN+ LF+I YDEHGGF+DHVPTP
Sbjct  272   YMDSKLIPANDDHPSHDVYQGQMFVKEVYETLRASPQWNQTLFIITYDEHGGFFDHVPTP  331

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             VTGVP+PDG+IGP+P+NF+FDRLGVRVP IM+SPWIE+G V+HGP+G PFP SEYEHSSI
Sbjct  332   VTGVPSPDGIIGPEPFNFEFDRLGVRVPTIMISPWIEKGTVVHGPNGSPFPTSEYEHSSI  391

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIF+L + FLT+RDAWAGTFE ++  R  PR DCPE L  P K+R  EA ED N+
Sbjct  392   PATVKKIFDLPSPFLTKRDAWAGTFEHILQIRKEPRTDCPEKLPTPTKIRKGEANEDKNI  451

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+AAVL GDH+    YP K+ + M+V +   Y   A  +F      A++ G+
Sbjct  452   SEFQEELVQLAAVLKGDHLLTS-YPEKIGKGMTVREGKAYMEDAVKRFFEAGLAAKKIGV  510



>emb|CDP08441.1| unnamed protein product [Coffea canephora]
Length=519

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/504 (62%), Positives = 369/504 (73%), Gaps = 16/504 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LN EINGV G ESNP+ T+    +  +  + FGN+S
Sbjct  26    PIKTVVVLVMENRSFDHMLGWMKKLNREINGVDGSESNPISTA----DPNSPRIFFGNQS  81

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VDPDPGHS Q I EQIFG   S D++     P M GFA  A      M+ +VMNGFVP
Sbjct  82    HFVDPDPGHSFQAIREQIFG---SNDTSANP--PPMDGFAQQARSMDPNMTQSVMNGFVP  136

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             + V VYK LV EFAV DRWFASVPASTQPNRL+VHSATSHGATSN    L +G+PQ+TIF
Sbjct  137   DMVGVYKSLVSEFAVFDRWFASVPASTQPNRLYVHSATSHGATSNIAALLAKGYPQRTIF  196

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +++ +AG SFGIY+Q  P+TLFYRNLRK+KY+ NFH +D+ FK   K GKLPNYVVVEQR
Sbjct  197   DNLSDAGLSFGIYFQNIPATLFYRNLRKIKYLGNFHPYDLSFKNDAKNGKLPNYVVVEQR  256

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K+ P NDDHPSHDV++GQ FVKEVYE LR+SPQWN  L +I YDEHGGF+DHV TP
Sbjct  257   YMDSKLEPANDDHPSHDVYQGQMFVKEVYETLRASPQWNRTLLIITYDEHGGFFDHVATP  316

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             V+GVP+PDG++GP P+ F+FDRLGVRVP IM SPWIE+G V+HGP G P+  SEYEHSSI
Sbjct  317   VSGVPSPDGIVGPDPFFFKFDRLGVRVPTIMASPWIEKGSVVHGPKGSPYKTSEYEHSSI  376

Query  1150  PATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
              ATVKKIFNL  FLT RD WAGTFE+V+ TR  PR DCPE L  PVK+R  EAKEDA LT
Sbjct  377   SATVKKIFNLPSFLTRRDEWAGTFESVLQTRKEPRTDCPEQLPTPVKIRQGEAKEDAKLT  436

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+E+VQ+AAVL G+ +    YP ++ + M+V +   Y   A   F     +A++ G+H
Sbjct  437   EFQQELVQLAAVLKGEDILAS-YPQQIGKEMTVKEGKQYMKDAVKSFFEAGFSAKRMGVH  495

Query  1507  GDYSVVALSKQPPSPNTTPRKPKS  1578
              D  V    K  PS  T   KP S
Sbjct  496   EDQIV----KMRPSLTTRKSKPSS  515



>ref|XP_007213924.1| hypothetical protein PRUPE_ppa004282mg [Prunus persica]
 gb|EMJ15123.1| hypothetical protein PRUPE_ppa004282mg [Prunus persica]
Length=518

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/505 (62%), Positives = 376/505 (74%), Gaps = 19/505 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGWMK +NPEINGV G E+NPL T+    +  +    F N+S
Sbjct  25    PIKTIVVIVMENRSFDHMLGWMKRINPEINGVDGSEANPLSTT----DPNSKRFFFKNES  80

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S +++     P M GFA  A    N   MS  VMNGF
Sbjct  81    HYVDPDPGHSFQAIREQIFG---SDNTSADP--PPMNGFAQQAFSMDNTTNMSQDVMNGF  135

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAVCDRWFASVP+STQPNRL+VHS TS GATSN    L +G+PQ+T
Sbjct  136   NPDMVAVYKTLVSEFAVCDRWFASVPSSTQPNRLYVHSGTSAGATSNIPALLAKGYPQRT  195

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  P+TLFYRNLRKLKYI  FH +D  FK+H K+GKLP Y VVE
Sbjct  196   IFENVDDAGISFGIYYQNIPATLFYRNLRKLKYISKFHMYDT-FKSHAKQGKLPGYTVVE  254

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD+KI P NDDHPSHDVF+GQ FVKEVYE LR+SPQWN+ L +I YDEHGGFYDHV 
Sbjct  255   QRYFDVKIAPANDDHPSHDVFQGQMFVKEVYETLRASPQWNDTLLIITYDEHGGFYDHVA  314

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP+P+ FQFDRLGVRVP IMVSPWIE+G VLHGP+G PFP SE+EHS
Sbjct  315   TPVHGVPSPDGIVGPEPFLFQFDRLGVRVPTIMVSPWIEKGTVLHGPNGSPFPTSEFEHS  374

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SIPATV+KIFNL+  LT+RD WAGTFE ++ TRT PR DCPE L  PVK+R++E KEDA 
Sbjct  375   SIPATVRKIFNLSAPLTKRDEWAGTFEGIVQTRTEPRTDCPEQLPTPVKIRTSEPKEDAK  434

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LTE+Q+EM Q+AAVL GD++    YP K  + M+V    +Y+  A  +F      A++ G
Sbjct  435   LTEFQQEMTQLAAVLKGDNIFTS-YPKKTGKEMTVKDGKEYADDAVKRFFEAGLYAKRMG  493

Query  1501  IHGDYSVV---ALSKQP-PSPNTTP  1563
             +  +  V    +L+ +P P  N TP
Sbjct  494   VSEEQIVQMRPSLTTRPSPIVNQTP  518



>ref|XP_010273150.1| PREDICTED: non-specific phospholipase C3-like isoform X2 [Nelumbo 
nucifera]
Length=415

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/398 (72%), Positives = 331/398 (83%), Gaps = 6/398 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVV+LVQENRSFDHM GWMK++NPEI+GV GKE N + T+    ++ +  V FGN+S
Sbjct  10    PIKTVVILVQENRSFDHMFGWMKAINPEIDGVTGKEYNLVTTT----DANSSRVYFGNRS  65

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             +YVD DPGHS Q IYEQ+FG  W   S+   + P M GFA  AE  Q GMS  VMNGF P
Sbjct  66    EYVDADPGHSFQAIYEQVFGVAWGHSSSSN-MVPRMDGFAQQAESIQKGMSQTVMNGFRP  124

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             EAV VYKELV EFAVCDRWFAS+P STQPNR+FVHSATSHG  SNDTKKLIEGFPQKTIF
Sbjct  125   EAVAVYKELVSEFAVCDRWFASLPTSTQPNRMFVHSATSHGFVSNDTKKLIEGFPQKTIF  184

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             ES+DEAG SFGIYY   PSTLFYRNLRK+KY+KNFH +D+ FK HCKEGKLPNYVV+E R
Sbjct  185   ESLDEAGLSFGIYYASLPSTLFYRNLRKIKYMKNFHLYDLEFKRHCKEGKLPNYVVIEPR  244

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YF+ K+ P NDDHP HDV EGQK VK+VYEALR+SPQWNE+LF+I YDEHGGFYDHVPTP
Sbjct  245   YFEKKLQPANDDHPPHDVSEGQKLVKQVYEALRASPQWNEILFIITYDEHGGFYDHVPTP  304

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
              T VP+PD ++ P+P+NF+FDRLGVRVP IM+SPWIERG VLH PSGP P+SE+EHSSIP
Sbjct  305   -TRVPSPDDIVSPEPFNFKFDRLGVRVPTIMISPWIERGTVLHRPSGPHPSSEFEHSSIP  363

Query  1153  ATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPE  1266
             ATVKKIFNL +FLT+RDAWAGTF+ V+TR +PR DCP+
Sbjct  364   ATVKKIFNLKEFLTKRDAWAGTFDIVLTRESPRTDCPD  401



>ref|XP_006362756.1| PREDICTED: uncharacterized protein LOC102580356 [Solanum tuberosum]
Length=537

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/480 (63%), Positives = 364/480 (76%), Gaps = 13/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNPEINGV G ESNP+ TS    +  +  + FG++S
Sbjct  45    PIKTVVVLVMENRSFDHMLGWMKKLNPEINGVDGSESNPISTS----DPKSRRIFFGDQS  100

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDPGHS Q I EQIFG+    + + KK  P M GFA  A      M   VMNGF P
Sbjct  101   HYVDPDPGHSFQAIREQIFGS----NESSKKPAP-MNGFAQQALSMDPNMPDQVMNGFQP  155

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E V VYK LV EFAV DRWFASVPASTQPNRL+VHS TSHGATSN    L +G+PQ+TIF
Sbjct  156   EMVSVYKTLVSEFAVFDRWFASVPASTQPNRLYVHSGTSHGATSNIASLLAKGYPQRTIF  215

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             E++D+AG +FGIYYQ  P+TLFY NLRKLKY+  FH +D+ FK+  K GKLP YVVVEQR
Sbjct  216   ENLDDAGVNFGIYYQNIPATLFYLNLRKLKYVGKFHPYDLTFKSDAKSGKLPGYVVVEQR  275

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K++P NDDHPSHDV++GQ FVKEVYE LR+SPQWN+ LF+I YDEHGGF+DHVPTP
Sbjct  276   YMDSKLIPANDDHPSHDVYQGQMFVKEVYETLRASPQWNQTLFVITYDEHGGFFDHVPTP  335

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             VTGVP+PDG++GP P+ F+FDRLGVRVP IM+SPWIE+G V+HGP+G PFP SEYEHSSI
Sbjct  336   VTGVPSPDGIVGPDPFYFKFDRLGVRVPTIMISPWIEKGTVVHGPNGSPFPTSEYEHSSI  395

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIF+L + FLT+RDAWAGTFE ++  R  PR DCPE L  P K+R  EA ED N+
Sbjct  396   PATVKKIFDLPSPFLTKRDAWAGTFEHILHIRKVPRTDCPEKLPTPTKIRKGEANEDKNI  455

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+AAVL GDH+    YP K+ + M+V +   Y   A  +F      A++ G+
Sbjct  456   SEFQEELVQLAAVLKGDHLLTS-YPEKIGKGMTVREGKAYMEDAVKRFFEAGFAAKKIGV  514



>ref|XP_004291735.1| PREDICTED: phospholipase C 3-like [Fragaria vesca subsp. vesca]
Length=522

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/507 (61%), Positives = 377/507 (74%), Gaps = 18/507 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHM+GWMK LNPEINGV G ESN L T+    +  +  + F N+S
Sbjct  24    PIKTMVVLVMENRSFDHMIGWMKRLNPEINGVDGSESNALNTT----DPNSKRIFFKNQS  79

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER--NQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG+     S+G    P M GFA  A    N   MS  VMNGF
Sbjct  80    HYVDPDPGHSFQAIREQIFGSDADNTSSGTP--PPMNGFAQQAYSMDNTTTMSQDVMNGF  137

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ + VYK LV EFAV DRWFASVP+STQPNRLFVHS TS GATSN    L +G+PQ+T
Sbjct  138   DPDILAVYKTLVSEFAVFDRWFASVPSSTQPNRLFVHSGTSAGATSNIAALLAKGYPQRT  197

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+ G SFGIYYQ  P+TLFYRNLRKLKY+ NFH +D  FK H K+GKLP+Y VVE
Sbjct  198   IFENLDDEGISFGIYYQNIPTTLFYRNLRKLKYMGNFHLYDSTFKAHAKQGKLPSYTVVE  257

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFDLK+ P NDDHPSHDV+ GQ FVKEVYE LR+SPQWN+ L +I YDEHGGFYDHVP
Sbjct  258   QRYFDLKLAPANDDHPSHDVYHGQMFVKEVYEILRASPQWNQTLLVITYDEHGGFYDHVP  317

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP+P+ FQF++LGVRVP IMVSPWI++  V+HGPSG PFPNSE+EHS
Sbjct  318   TPVHGVPSPDGIVGPEPFLFQFNQLGVRVPTIMVSPWIDKSTVVHGPSGSPFPNSEFEHS  377

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAGTFE ++ TRT PR DCPE L EPV  R +EAKEDA
Sbjct  378   SIPATVKKVFNLSAPFLTKRDEWAGTFEGIVQTRTQPRTDCPEQLPEPVPTRKSEAKEDA  437

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+E++Q+AAVL GD++    YP K  + M+V +  +Y+  A  +F      A++ 
Sbjct  438   KLSEFQQEIMQLAAVLKGDNLFTS-YPEKTGKKMTVKEGKEYTEDALERFFEAGLYAKRM  496

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKS  1578
             G++ +  +V +      P+ T R  KS
Sbjct  497   GVNEE-QIVQM-----RPSLTTRSSKS  517



>ref|XP_009790723.1| PREDICTED: non-specific phospholipase C2 [Nicotiana sylvestris]
Length=525

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 366/480 (76%), Gaps = 14/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNPEINGV G ESNP+ T+          +LFG++S
Sbjct  35    PIKTVVVLVMENRSFDHMLGWMKKLNPEINGVDGSESNPISTTDPKARR----ILFGDQS  90

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVDPDPGHS Q I EQIFG   S DS+  K    M GFA  A    + M   VMNGF P
Sbjct  91    HYVDPDPGHSFQAIREQIFG---SNDSS--KNPAPMNGFAQQALSMDSNMPEQVMNGFQP  145

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             + V VYK LV EFAV DRWFASVPASTQPNRL+VHSATSHGATSN+   L +G+PQ+TIF
Sbjct  146   DMVAVYKTLVSEFAVFDRWFASVPASTQPNRLYVHSATSHGATSNNASLLAKGYPQRTIF  205

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             E++D+AG +FGIYYQ  P+TLFYRNLRKLKYI  FH +D+ FK   K GKLP YVVVEQR
Sbjct  206   ENLDDAGINFGIYYQNIPATLFYRNLRKLKYIGKFHPYDLTFKNDAKSGKLPGYVVVEQR  265

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K+ P NDDHPSHDV++GQ FVKEVYE LR+SPQWN+ L +I YDEHGGF+DHVPTP
Sbjct  266   YMDSKLQPANDDHPSHDVYQGQIFVKEVYETLRASPQWNQTLLVITYDEHGGFFDHVPTP  325

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             V+GVPNPDG+IG +P++F+FDRLGVRVP IM+SPWIE+G V+HGP+G PFP SEYEHSSI
Sbjct  326   VSGVPNPDGIIG-EPFDFKFDRLGVRVPTIMISPWIEKGTVVHGPNGSPFPTSEYEHSSI  384

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIF+L + FLT+RD WA TFE ++ TR  PR DCP+ L  P K+R AEA EDAN+
Sbjct  385   PATVKKIFDLPSPFLTKRDEWAATFEHILQTRKEPRTDCPDKLPTPTKIRKAEANEDANI  444

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+AAVL GDH+    YP K+ + M+V +   Y   A  +F     +A++ G+
Sbjct  445   SEFQQELVQLAAVLKGDHLLTS-YPEKIGKKMTVREGKAYMEDAVKRFFEAGFSAKKFGV  503



>gb|ABK24680.1| unknown [Picea sitchensis]
Length=503

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/508 (61%), Positives = 380/508 (75%), Gaps = 16/508 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+V+LV ENRSFDHMLGWMK LNP+I+GV G+ESNP+ TS    NS    V F N++
Sbjct  7     PIKTIVILVMENRSFDHMLGWMKRLNPQIDGVTGQESNPVSTSD--LNSAR--VFFQNEA  62

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER-NQAGMSGAVMNGFV  429
             +YVDPDPGHS Q I EQIFG   S D++       M GFA  A       MS  VMNGF 
Sbjct  63    EYVDPDPGHSFQAIREQIFG---SVDTSANPAP--MNGFAQQATSLGGPNMSQTVMNGFR  117

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE VPVY  LV EFAV DRWFASVPASTQPNRL+VHSATSHGATSN  K L +G+PQKTI
Sbjct  118   PEVVPVYNTLVNEFAVFDRWFASVPASTQPNRLYVHSATSHGATSNIPKLLADGYPQKTI  177

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES+DE+G SFGIYY+  P+T+FYRNLRKLKYI  F  +   FK H K+GKLPNYVVVEQ
Sbjct  178   FESIDESGLSFGIYYEDIPATMFYRNLRKLKYIGKFRSYSTEFKLHAKQGKLPNYVVVEQ  237

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RY D K+LP NDDHPSHDV EGQKFVKEVYE LRSSPQWN+ LFLI YDEHGGF+DHVPT
Sbjct  238   RYTDTKLLPANDDHPSHDVAEGQKFVKEVYETLRSSPQWNQTLFLITYDEHGGFFDHVPT  297

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV  VP+PD ++GP P+ F+FDRLGVRVP IM+SPWI++G V+HGP+GP+P+S++EHSSI
Sbjct  298   PVKDVPSPDDIVGPDPFFFKFDRLGVRVPTIMISPWIDKGTVIHGPNGPYPSSQFEHSSI  357

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
              ATVKK+FNL + FLT+RDAWAGTFE V+  R++PR DCPETLA+P K+R +EA E+A +
Sbjct  358   AATVKKLFNLKSDFLTKRDAWAGTFEDVVQKRSSPRTDCPETLADPPKIRKSEANEEAKI  417

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+AA L GD+  +  YP ++ + M+V +A  Y   +  +F      A++ G 
Sbjct  418   SEFQEELVQLAAQLNGDYTLKS-YPEEIGKKMNVREAKKYMGDSVRRFFEAGRLAKRLGA  476

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFAT  1587
               D+ +V +  +P     +   PKS  T
Sbjct  477   D-DHEIVKM--RPSLTTRSTSGPKSKTT  501



>gb|ABR16102.1| unknown [Picea sitchensis]
Length=529

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/508 (61%), Positives = 380/508 (75%), Gaps = 16/508 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+V+LV ENRSFDHMLGWMK LNP+I+GV G+ESNP+ TS    NS    V F N++
Sbjct  33    PIKTIVILVMENRSFDHMLGWMKRLNPQIDGVTGQESNPVSTSD--LNSAR--VFFQNEA  88

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER-NQAGMSGAVMNGFV  429
             +YVDPDPGHS Q I EQIFG   S D++       M GFA  A       MS  VMNGF 
Sbjct  89    EYVDPDPGHSFQAIREQIFG---SVDTSANPAP--MNGFAQQATSLGGPNMSQTVMNGFR  143

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE VPVY  LV EFAV DRWFASVPASTQPNRL+VHSATSHGATSN  K L +G+PQKTI
Sbjct  144   PEVVPVYNTLVNEFAVFDRWFASVPASTQPNRLYVHSATSHGATSNIPKLLADGYPQKTI  203

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES+DE+G SFGIYY+  P+T+FYRNLRKLKYI  F  +   FK H K+GKLPNYVVVEQ
Sbjct  204   FESIDESGLSFGIYYEDIPATMFYRNLRKLKYIGKFRSYSTEFKLHAKQGKLPNYVVVEQ  263

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RY D K+LP NDDHPSHDV EGQKFVKEVYE LRSSPQWN+ LFLI YDEHGGF+DHVPT
Sbjct  264   RYTDTKLLPANDDHPSHDVAEGQKFVKEVYETLRSSPQWNQTLFLITYDEHGGFFDHVPT  323

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV  VP+PD ++GP P+ F+FDRLGVRVP IM+SPWI++G V+HGP+GP+P+S++EHSSI
Sbjct  324   PVKDVPSPDDIVGPDPFFFKFDRLGVRVPTIMISPWIDKGTVIHGPNGPYPSSQFEHSSI  383

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
              ATVKK+FNL + FLT+RDAWAGTFE V+  R++PR DCPETLA+P K+R +EA E+A +
Sbjct  384   AATVKKLFNLKSDFLTKRDAWAGTFEDVVQKRSSPRTDCPETLADPPKIRKSEANEEAKI  443

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+AA L GD+  +  YP ++ + M+V +A  Y   +  +F      A++ G 
Sbjct  444   SEFQEELVQLAAQLNGDYTLKS-YPEEIGKKMNVREAKKYMGDSVRRFFEAGRLAKRLGA  502

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFAT  1587
               D+ +V +  +P     +   PKS  T
Sbjct  503   D-DHEIVKM--RPSLTTRSTSGPKSKTT  527



>ref|XP_006576659.1| PREDICTED: non-specific phospholipase C4-like isoform X2 [Glycine 
max]
Length=466

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/531 (59%), Positives = 365/531 (69%), Gaps = 73/531 (14%)
 Frame = +1

Query  43    SSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNST  222
             S+  ++ + +PIKT+VVLVQENRSFDHMLGWMKSL+P+ING+ G ESNP+ TS    N  
Sbjct  3     SNSSTNNAGYPIKTIVVLVQENRSFDHMLGWMKSLDPKINGITGSESNPISTS----NPN  58

Query  223   NDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN----  390
             +++V F ++S YVDPDPGHSIQDIYEQIFG PWS+ S  KKL PTMQGFA NA R     
Sbjct  59    SNLVQFSDQSVYVDPDPGHSIQDIYEQIFGEPWSEASTAKKLPPTMQGFAQNAGRQAVPK  118

Query  391   --QAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATS  564
                A M   VMNGF P+ +PVYKELV+E+AVCD WFASVPASTQPNRL+VHSATSHG TS
Sbjct  119   NATATMMETVMNGFKPDLIPVYKELVKEYAVCDCWFASVPASTQPNRLYVHSATSHGLTS  178

Query  565   NDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKT  744
             NDT KLI G PQKTIF+S+DE G+SFGIYYQ PP+TLFYRNLRKLKY+ NF  FD+ FK 
Sbjct  179   NDTNKLIGGLPQKTIFDSLDENGFSFGIYYQSPPATLFYRNLRKLKYVDNFRPFDL-FKK  237

Query  745   HCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFL  924
             HCKEGKLPNYVV+EQR+FDL  +PGNDDHPSHDV EGQKFVKEVYEALR SPQWNE LF+
Sbjct  238   HCKEGKLPNYVVIEQRFFDLLSIPGNDDHPSHDVSEGQKFVKEVYEALRGSPQWNETLFV  297

Query  925   IIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHG  1104
             I+YDEHGGFYDHVPTPV GVP+PD ++GP+P+ FQFDRLGVR+PAI+VSPWIE G V   
Sbjct  298   IVYDEHGGFYDHVPTPVEGVPSPDDIVGPEPFKFQFDRLGVRIPAIIVSPWIEPGTV---  354

Query  1105  PSGPFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPV  1284
                           +P  VK                                        
Sbjct  355   -------------KLPEPVK----------------------------------------  361

Query  1285  KLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNK  1464
              LR A A+E A L+E+Q+E+VQMAA L GDH K   YP KL ENMSV  A  Y   AFN 
Sbjct  362   -LREAPAQEKAKLSEFQEELVQMAATLNGDHRKS-IYPDKLTENMSVPDAVKYVEDAFNT  419

Query  1465  FLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCIACGR  1617
             FL +CE A+Q G   D S +       S  + P   K+F    LSCI C R
Sbjct  420   FLNECEKAKQNG--ADESEIVDCADGCS--SAPPDSKNFFYNVLSCITCNR  466



>gb|KEH33501.1| non-specific phospholipase C4 [Medicago truncatula]
Length=530

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/511 (61%), Positives = 376/511 (74%), Gaps = 22/511 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+V+LV ENRSFDHMLGWMK LNP INGV G ES+ L  S    +  +  + F N++
Sbjct  36    PIKTIVILVMENRSFDHMLGWMKKLNPNINGVTGLESSQLSVS----DPNSKRIFFKNEA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAER--NQAGMSGAVMNG  423
             QYVDPDPGHS Q I EQIFG   S+D++   ++P  M GFA  A    N   MS  VMNG
Sbjct  92    QYVDPDPGHSFQAIREQIFG---SEDTS---VDPAPMNGFAQQAYSMDNTTKMSQEVMNG  145

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F P+ V VYK LV EFAV DRWFASVPASTQPNRL+VHSATS GATSN    L +G+PQ+
Sbjct  146   FEPDHVAVYKTLVSEFAVFDRWFASVPASTQPNRLYVHSATSGGATSNVASLLAKGYPQQ  205

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIF+S+ + G+ FGIYYQ  P+TLFYRNLRKLKYI  FH +D+ FK H KEGKLPNYVVV
Sbjct  206   TIFDSLHDNGFDFGIYYQNIPATLFYRNLRKLKYIPKFHLYDLTFKHHAKEGKLPNYVVV  265

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRY D K+ P NDDHPSHDV++GQ FVKEVYE LR+SPQWNE LFLI YDEHGGF+DHV
Sbjct  266   EQRYTDTKLFPANDDHPSHDVYQGQMFVKEVYETLRASPQWNETLFLITYDEHGGFFDHV  325

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEH  1140
              TPV GVP+PDG++GP+P+NF F+RLGVRVP I +SPWIE+G V+HGP+G P P SEYEH
Sbjct  326   ATPVRGVPSPDGIVGPEPFNFTFNRLGVRVPTIAISPWIEKGTVVHGPNGSPTPTSEYEH  385

Query  1141  SSIPATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SSI ATVKKIFNL +FLT+RD WAGTFE ++  RT PR DCPE L  P+KLR  EA EDA
Sbjct  386   SSIAATVKKIFNLPKFLTKRDEWAGTFEGIVQIRTEPRTDCPEQLPTPIKLRKGEANEDA  445

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+E++Q+AAVL GD++    YP+ + ++MSV +   Y   A  +F      A++ 
Sbjct  446   KLSEFQQELIQLAAVLKGDNIFTS-YPNTIGKDMSVKQGKYYMDEAVKRFFEAGRYAKKM  504

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKSFATK  1590
             G+  D ++V +      P+ T R  KS  TK
Sbjct  505   GV-SDENIVKM-----KPSLTTRSSKSSNTK  529



>ref|XP_003556783.1| PREDICTED: non-specific phospholipase C2-like [Glycine max]
Length=530

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/505 (61%), Positives = 368/505 (73%), Gaps = 18/505 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNP I+GV G ESNPL  S    +  +    F +++
Sbjct  36    PIKTVVVLVMENRSFDHMLGWMKRLNPAIDGVTGSESNPLSVS----DPDSKRFFFRDRA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER--NQAGMSGAVMNGF  426
              +VDPDPGHS Q I EQIFG   S DS+     P M GF   A    N + MS  VMNGF
Sbjct  92    HFVDPDPGHSFQAIREQIFG---SNDSSLDP--PPMNGFVQQAYSMDNTSHMSENVMNGF  146

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAV DRWFASVPASTQPNRLFVHSATS GATSN   KL  G+PQ+T
Sbjct  147   DPDLVAVYKTLVSEFAVFDRWFASVPASTQPNRLFVHSATSGGATSNVAAKLTAGYPQQT  206

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+ +AG+ FGIYYQ  P+TLFYRNLRKLKY+  FH +D+ FK H KEGKLP+Y VVE
Sbjct  207   IFDSLHDAGHDFGIYYQNIPATLFYRNLRKLKYVLKFHIYDVSFKQHAKEGKLPSYTVVE  266

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K+LP NDDHPSHDV+EGQ FVKEVYE LR+SPQWNE LFLI YDEHGGFYDHVP
Sbjct  267   QRYMDTKLLPANDDHPSHDVYEGQVFVKEVYETLRASPQWNETLFLITYDEHGGFYDHVP  326

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TP  GVP+PDG++GP+P+NF F+RLGVRVP I +SPWIE+G V+HGP+G P P SEYEHS
Sbjct  327   TPARGVPSPDGIVGPEPFNFTFNRLGVRVPTIAISPWIEKGTVVHGPNGSPSPTSEYEHS  386

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SIPATVKK+FNL  FLT RDAWAGTFE ++ TRT PR DCPE L  P K+R  E  EDA 
Sbjct  387   SIPATVKKLFNLPSFLTNRDAWAGTFEGIVQTRTEPRTDCPEKLPTPEKIRKGEPNEDAK  446

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q+E++Q+AAV+ GD++    +P  + ++M+V +   Y   A   F      AR+ G
Sbjct  447   LSEFQQELIQLAAVIKGDNILTS-FPGTIGKDMTVKQGKYYMDDAVRSFFEAGRYARKMG  505

Query  1501  IHGDYSV----VALSKQPPSPNTTP  1563
             ++ ++ V       ++   SPNT P
Sbjct  506   VNEEHIVQMKPSLTTRSSKSPNTNP  530



>ref|XP_007015279.1| Non-specific phospholipase C2 [Theobroma cacao]
 gb|EOY32898.1| Non-specific phospholipase C2 [Theobroma cacao]
Length=536

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/517 (59%), Positives = 379/517 (73%), Gaps = 26/517 (5%)
 Frame = +1

Query  37    GPSSEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQN  216
             GPS   S     PIKT+VVLV ENRSFDHMLGWMK +NPEINGV G E NPL T+    +
Sbjct  34    GPSHAAS-----PIKTIVVLVMENRSFDHMLGWMKKINPEINGVDGTEWNPLSTT----D  84

Query  217   STNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER--N  390
               +  + F N++Q+VDPDPGHS Q I EQIFG   S D++     P M GFA  A     
Sbjct  85    PNSKKLFFQNQAQFVDPDPGHSFQAIREQIFG---SNDTSANP--PPMNGFAQQAYSMDQ  139

Query  391   QAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSND  570
                MS +VMNGF PE V VYK LV EFAV DRWFASVP+STQPNRL+VHSATS GATSN 
Sbjct  140   STNMSQSVMNGFEPEMVAVYKALVSEFAVFDRWFASVPSSTQPNRLYVHSATSAGATSNI  199

Query  571   TKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHC  750
                L++G+PQ+TIFE++D+AG S+GIYYQ  P+TLFY+NLRKLKY+  F  + + FK H 
Sbjct  200   PSLLVKGYPQRTIFENLDDAGISWGIYYQNIPATLFYKNLRKLKYLLRFRPYGLTFKKHA  259

Query  751   KEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLII  930
             ++GKLP YVVVEQRY D K+ P NDDHPSHDV++GQ FVKEVYE LR SPQWNE L +I 
Sbjct  260   RDGKLPGYVVVEQRYMDTKLDPANDDHPSHDVYQGQMFVKEVYETLRGSPQWNETLLIIT  319

Query  931   YDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPS  1110
             YDEHGGF+DHV TPV+GVP+PDG++GP P+ F+FDRLGVRVP IMVSPWI++G V+HGPS
Sbjct  320   YDEHGGFFDHVATPVSGVPSPDGIVGPDPFFFKFDRLGVRVPTIMVSPWIDKGTVVHGPS  379

Query  1111  G-PFPNSEYEHSSIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEP  1281
             G PFP SE+EHSSIPATVKK+FNL+  FLT+RD WAGTFE+++ TRT PR DCPE L  P
Sbjct  380   GRPFPTSEFEHSSIPATVKKVFNLSSPFLTKRDEWAGTFESIVQTRTEPRTDCPEQLPTP  439

Query  1282  VKLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFN  1461
              ++R  EA E+A L+E+Q+E++Q+AAVL GDH+    YP ++ + MSV +  +Y   A  
Sbjct  440   ARIRQGEANEEAKLSEFQQELLQLAAVLKGDHILTS-YPDEIGKEMSVEQGNEYMEDAVK  498

Query  1462  KFLGDCENARQRGIHGDY------SVVALSKQPPSPN  1554
             +F     +A++ G+ G+       S+   S QP SP+
Sbjct  499   RFFDAGRSAKKMGVDGEQIVQMKPSLTTRSSQPSSPH  535



>ref|XP_007146120.1| hypothetical protein PHAVU_006G014100g [Phaseolus vulgaris]
 gb|ESW18114.1| hypothetical protein PHAVU_006G014100g [Phaseolus vulgaris]
Length=520

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/505 (60%), Positives = 369/505 (73%), Gaps = 18/505 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNP INGV G ESN L  +    +  +    F +++
Sbjct  26    PIKTVVVLVMENRSFDHMLGWMKRLNPAINGVTGSESNALSVT----DPNSKRFFFKDQA  81

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S D++     P M GFA  A    N + MS  VMNGF
Sbjct  82    HYVDPDPGHSFQAIREQIFG---SNDTS--TYPPPMNGFAQQAFSMDNTSHMSQNVMNGF  136

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
             +P+ VPVYK LV EFAV DRWFASVPASTQPNRLFVHSATS GATSN   KL  G+PQ+T
Sbjct  137   IPDLVPVYKTLVSEFAVFDRWFASVPASTQPNRLFVHSATSGGATSNVAAKLAAGYPQQT  196

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+++ EAG  FGIYYQ  P+TLFYRNLRKLKY+  FH +D+ FK H KEGKLP+Y VVE
Sbjct  197   IFDNVHEAGLDFGIYYQNIPATLFYRNLRKLKYLLKFHLYDLSFKLHAKEGKLPSYTVVE  256

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K+LP NDDHPSHDV++GQ FVKEVYE LR+SPQWNE LFLI YDEHGGFYDHVP
Sbjct  257   QRYMDTKVLPANDDHPSHDVYQGQMFVKEVYETLRASPQWNETLFLITYDEHGGFYDHVP  316

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TP  GVP+PDG++GP+P+NF F+RLGVRVP I +SPWI++G V+HGP+G P   SEYEHS
Sbjct  317   TPARGVPSPDGIVGPEPFNFTFNRLGVRVPTIAISPWIQKGTVVHGPNGSPTSTSEYEHS  376

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SI ATVKK+FNL  FLT+RDAWAGTFE ++ TRT PR DCPE L  PVK+R     EDA 
Sbjct  377   SISATVKKLFNLPSFLTKRDAWAGTFEGIVQTRTEPRTDCPEKLPTPVKIREGGPNEDAQ  436

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             ++E+Q+E++Q+AAVL GD++    +P K+ ++M+V +   Y   A  +F      A++ G
Sbjct  437   MSEFQQELIQLAAVLKGDNILTS-FPGKIGKDMTVKQGKYYMDDAVRRFFEAGRYAKKMG  495

Query  1501  IHGDYSV----VALSKQPPSPNTTP  1563
             ++ ++ V       ++   SPN  P
Sbjct  496   VNEEHIVQMKPSLTTRSSKSPNRNP  520



>gb|KCW76686.1| hypothetical protein EUGRSUZ_D010481, partial [Eucalyptus grandis]
Length=346

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/342 (82%), Positives = 306/342 (89%), Gaps = 4/342 (1%)
 Frame = +1

Query  64    SIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFG  243
             S +PIKTVVVLVQENRSFDHMLGWMKSLNPEI+GV GKESNPL T+  +  S    V F 
Sbjct  8     SSYPIKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGKESNPLSTTDPSAGS----VSFS  63

Query  244   NKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNG  423
             + + YVDPDPGHSIQ IYEQ+FG PWS++SA KKL P M GFA NAER + GM+  VM+G
Sbjct  64    DGAAYVDPDPGHSIQAIYEQVFGEPWSEESASKKLPPKMDGFAQNAERTEKGMAQTVMSG  123

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F P++VPVYKELV EFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK
Sbjct  124   FTPDSVPVYKELVSEFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  183

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIFESMDEAG++FGIYYQYPP+TLFYRNLRKLKY+KNFHQFD+HFKTHC+EGKLPNYVVV
Sbjct  184   TIFESMDEAGFTFGIYYQYPPATLFYRNLRKLKYLKNFHQFDLHFKTHCREGKLPNYVVV  243

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRY DL ILPGNDDHPSHDV +GQKFVKEVYEALRSSPQWNEMLFLI YDEHGGFYDHV
Sbjct  244   EQRYLDLSILPGNDDHPSHDVSQGQKFVKEVYEALRSSPQWNEMLFLITYDEHGGFYDHV  303

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERG  1089
             PTPV GVP+PDG++GP PY FQFDRLGVRVPAI +SPWI+RG
Sbjct  304   PTPVHGVPSPDGIVGPDPYKFQFDRLGVRVPAIFISPWIDRG  345



>dbj|BAK03111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/471 (62%), Positives = 354/471 (75%), Gaps = 18/471 (4%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVV++QENRSFDHMLGWMKSLNPEI+GV G E N +  +     + N    FGN+S+
Sbjct  5     IKTVVVVMQENRSFDHMLGWMKSLNPEIDGVTGAEFNRVVVTDPLSKTIN----FGNQSE  60

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-----MQGFAANAERNQAGMSGAVMN  420
             YVD DPGHS +  YEQ++G P+          P      M GFA  AE+ + GM+  VMN
Sbjct  61    YVDLDPGHSAEATYEQVYGVPFVDAETTPMTRPDVPSPPMSGFAQQAEKEKTGMADTVMN  120

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIE----  588
             GF PEAVPVY+EL REFA+CDRWF+S PASTQPNR F+HSATSHG  S+D + ++     
Sbjct  121   GFRPEAVPVYRELAREFALCDRWFSSNPASTQPNRQFLHSATSHGLVSDDNQDILPLVLV  180

Query  589   GFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLP  768
             G PQ TIF+S+ +AGYSFGIY Q  P+ LFYR+LR+ KY+ NFH FD+ F+ HC+EGKLP
Sbjct  181   GSPQATIFDSLYDAGYSFGIYCQTLPTVLFYRSLRQPKYVGNFHSFDLEFRRHCQEGKLP  240

Query  769   NYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGG  948
             NYVV+EQRYFDL  LPGNDDHPSHDV EGQ+FVKEVYEALRS PQW EML ++ YDEHGG
Sbjct  241   NYVVLEQRYFDLPALPGNDDHPSHDVSEGQRFVKEVYEALRSGPQWEEMLLVVTYDEHGG  300

Query  949   FYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNS  1128
             FYDHVPTPV GVP+PDG++   PY F FDRLGVRVPA  +SPWI+ G ++H PSGP P S
Sbjct  301   FYDHVPTPVVGVPSPDGIVSRAPYLFNFDRLGVRVPAFFISPWIDPGTLVHTPSGPQPTS  360

Query  1129  EYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCPETLAEPVKLR-SAEA  1305
             ++EHSSIPAT+KK+FNLN FLT+RDAWAGTF+TV+TR TPR DCP TL EP+KLR S  A
Sbjct  361   QFEHSSIPATLKKLFNLNTFLTKRDAWAGTFDTVLTRDTPRTDCPVTLPEPLKLRQSTVA  420

Query  1306  KEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAF  1458
              E A +T++Q ++VQ+AAVL     K+      LV+ M+VA AA Y + AF
Sbjct  421   TEQAPITDFQAQLVQLAAVLTKGKGKDKL----LVQGMTVADAAKYCNDAF  467



>ref|XP_010276659.1| PREDICTED: non-specific phospholipase C2-like [Nelumbo nucifera]
Length=526

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/502 (61%), Positives = 368/502 (73%), Gaps = 19/502 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+V+LV ENRSFDHMLGWMK +NP INGV G ESNPL T+    + ++  + F ++S
Sbjct  31    PIKTLVILVMENRSFDHMLGWMKRINPRINGVDGTESNPLSTT----DPSSPRIFFKDQS  86

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER--NQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S D++     P M GFA  A    N   MS +VMNGF
Sbjct  87    HYVDPDPGHSFQAIREQIFG---SSDTSA--FPPPMNGFAQQAFSMINSTNMSESVMNGF  141

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAV DRWFASVP+STQPNRLFVHSATS GATSN    L +G+PQ+T
Sbjct  142   NPDMVAVYKSLVTEFAVFDRWFASVPSSTQPNRLFVHSATSGGATSNIPSLLAKGYPQRT  201

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  P+TLFYRNLRKLKY+  FH + + FK+H K GKLPNYVV E
Sbjct  202   IFENIDDAGLSFGIYYQNIPATLFYRNLRKLKYLTKFHSYGLSFKSHAKAGKLPNYVVFE  261

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             Q+Y D K+ P NDDHPSHDV++GQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHVP
Sbjct  262   QQYMDTKLSPANDDHPSHDVYQGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVP  321

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG+IGP P+ F+FDRLGVRVP IMVSPWIE+G V+HGP+G PF  SE+EHS
Sbjct  322   TPVRGVPSPDGIIGPAPFLFRFDRLGVRVPTIMVSPWIEKGTVVHGPNGSPFSKSEFEHS  381

Query  1144  SIPATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL + FLT RD WAGTFE V+ TRT PR DCPE L  PVK+R     E+A
Sbjct  382   SIPATVKKLFNLPSPFLTRRDEWAGTFEGVVQTRTQPRTDCPEKLPTPVKIRQGGPNENA  441

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+E++Q+AAVL GD +    YP K+ + M+V +   Y   A  +FL     A++ 
Sbjct  442   KLSEFQQELLQLAAVLKGDDILTS-YPEKIGKQMTVKEGKKYMEDALKRFLEAGLLAKRM  500

Query  1498  GIHGDYSVVALSKQPPSPNTTP  1563
             G+  +  V    K  PS  T P
Sbjct  501   GVDEEQIV----KMRPSLTTRP  518



>ref|XP_004513953.1| PREDICTED: non-hemolytic phospholipase C-like [Cicer arietinum]
Length=531

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/517 (60%), Positives = 374/517 (72%), Gaps = 24/517 (5%)
 Frame = +1

Query  46    SEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTN  225
             S   +G+  PIKTVVVLV ENRSFDHMLGWMK LNPEINGV G ES  L  +    +  +
Sbjct  28    SPTCNGTNNPIKTVVVLVMENRSFDHMLGWMKKLNPEINGVDGSESALLSVT----DPNS  83

Query  226   DVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAER--NQA  396
             + + F N++QYVDPDPGHS Q I EQIFG   S+D++    +P  M GFA  A    N  
Sbjct  84    ERIFFKNQAQYVDPDPGHSFQAIREQIFG---SEDTSA---DPAPMNGFAQQAYSMDNTT  137

Query  397   GMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTK  576
              MS  VMNGF P+ VPVYK LV EFAV DRWFA+VPASTQPNRLF+HSATS GAT N   
Sbjct  138   TMSHDVMNGFEPDMVPVYKALVSEFAVFDRWFAAVPASTQPNRLFIHSATSGGATGNKAS  197

Query  577   KLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKE  756
              L++G+ Q+TIF+S+ +AG  FGIYYQ  P+TLFYRNLRKLKY   FH F    K H KE
Sbjct  198   LLVKGYAQQTIFDSIHDAGLDFGIYYQNIPATLFYRNLRKLKYAFKFH-FYSTLKRHAKE  256

Query  757   GKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYD  936
             GKLPNYVVVEQRY D K+LP NDDHPSHDV+ GQ FVKEVYE LR+SPQWNE LFLI YD
Sbjct  257   GKLPNYVVVEQRYMDTKLLPANDDHPSHDVYYGQMFVKEVYETLRASPQWNETLFLITYD  316

Query  937   EHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-  1113
             EHGGFYDHV TPV GVP+PDG++GP+P+NF F+RLGVRVP I +SPWIE+G V+HGP+G 
Sbjct  317   EHGGFYDHVSTPVRGVPSPDGIVGPEPFNFTFNRLGVRVPTIAISPWIEKGTVVHGPNGS  376

Query  1114  PFPNSEYEHSSIPATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKL  1290
             P P SEYEHSSI ATVKKIFNL  FLT+RD WAGTFE ++ TRT PR DCPE L  P KL
Sbjct  377   PTPTSEYEHSSIAATVKKIFNLPSFLTKRDEWAGTFENIVQTRTEPRTDCPEQLPTPTKL  436

Query  1291  RSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             R  EAKEDA ++E+Q+E++Q+AAVL GD++    YP+ + ++M+V +  +Y   A  +F 
Sbjct  437   RKGEAKEDAKMSEFQQELIQLAAVLKGDNIFTS-YPNTIGKDMTVIQGKNYMDEAVKRFF  495

Query  1471  GDCENARQRGIHGDYSVVALS------KQPPSPNTTP  1563
                  A++ G+  D ++V +           SPNT P
Sbjct  496   EAGVYAKKMGV-SDENIVQMKPSLTTRSSSKSPNTNP  531



>gb|ABR18107.1| unknown [Picea sitchensis]
Length=529

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/489 (61%), Positives = 369/489 (75%), Gaps = 14/489 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+V+LV ENRSFDHMLGWMK LNP+INGV G+ESNP+ T    ++ ++  V F +++
Sbjct  33    PIKTIVILVMENRSFDHMLGWMKRLNPQINGVTGQESNPIST----KDPSSARVFFQDEA  88

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER-NQAGMSGAVMNGFV  429
             +YVDPDPGHS Q I EQIFG+    D+      P M GFA  A     + MS  VMNGF 
Sbjct  89    EYVDPDPGHSFQAIREQIFGS----DNTSANPAP-MNGFAQQATSLGGSNMSQTVMNGFR  143

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE VPVY  LV EFAV DRWFAS+PASTQPNRL+VHSATSHGATSN  K L +G+PQKTI
Sbjct  144   PEVVPVYNTLVNEFAVFDRWFASMPASTQPNRLYVHSATSHGATSNIPKLLADGYPQKTI  203

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES+DE+G SFGIYY+  P+TLFY+NLRKLKYI  F  +   FK H K+GKLPNYVVVEQ
Sbjct  204   FESIDESGLSFGIYYEDIPATLFYKNLRKLKYIGKFRSYSTQFKLHAKQGKLPNYVVVEQ  263

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RY D K+LP NDDHPSHDV EGQKFVKEVYE LRSSPQWN+ LFLI YDEHGGF+DHVPT
Sbjct  264   RYTDTKLLPANDDHPSHDVAEGQKFVKEVYETLRSSPQWNQTLFLITYDEHGGFFDHVPT  323

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV  VP+PD ++GP P+ F+FDRLGVRVP IM+SPWI++G V+HGP+GP+P+S++EHSSI
Sbjct  324   PVKDVPSPDDIVGPDPFFFKFDRLGVRVPTIMISPWIDKGTVVHGPNGPYPSSQFEHSSI  383

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
              ATVKK+FNL + FLT+RDAWAGTFE V+  R++PR DCP TL  P K+R + A E+A L
Sbjct  384   AATVKKLFNLKSDFLTKRDAWAGTFEDVVQKRSSPRTDCPATLPNPPKIRQSGANEEAKL  443

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +++QKE+VQ+AA+L GD+     YP ++ + M+V +   Y   +  +F      A+  G 
Sbjct  444   SDFQKELVQLAAILNGDYTLRS-YPDEIGKKMNVREGKKYMGDSVRRFFEAGRLAKSLGA  502

Query  1504  HGDYSVVAL  1530
               D+ +V +
Sbjct  503   D-DHEIVKM  510



>emb|CDY48187.1| BnaA04g15510D [Brassica napus]
Length=519

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/471 (63%), Positives = 357/471 (76%), Gaps = 15/471 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGWMK LNPEINGV G ESNP+     A + ++  + FG+ S
Sbjct  31    PIKTIVVLVMENRSFDHMLGWMKKLNPEINGVDGSESNPV----SASDPSSKKIQFGSGS  86

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S D++  K  P M GF   A  E     MS +VMNGF
Sbjct  87    HYVDPDPGHSFQAIREQIFG---SNDTS--KDPPPMNGFVQQAYSEDPTGNMSASVMNGF  141

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYK LV EFAV DRWFASVP+STQPNR+FVHS TS GATSND K L  G+PQ+T
Sbjct  142   EPDKVPVYKTLVSEFAVFDRWFASVPSSTQPNRMFVHSGTSGGATSNDPKSLALGYPQRT  201

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++DEA  SFGIY+Q  P+ LFYRNLRKLKYI  FH + + FK H K+GKLP Y V+E
Sbjct  202   IFENLDEADISFGIYFQNIPAVLFYRNLRKLKYIPKFHSYSLSFKDHAKKGKLPGYAVIE  261

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D    P NDDHPSHDV++GQKF+KEVYE LR+SPQWNE L LI YDEHGG++DHVP
Sbjct  262   QRYMDTTFEPANDDHPSHDVYQGQKFIKEVYETLRASPQWNETLLLITYDEHGGYFDHVP  321

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++GP+P+ F+F+RLG+RVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  322   TPVRNVPSPDGIVGPEPFLFEFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  381

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAGTFE ++  R  PR DCPETL EPVK+R  EA E+A
Sbjct  382   SIPATVKKLFNLSTPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVKIRMTEANENA  441

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
              L+E+Q+E+VQ+AAVL GD +    YP ++ + M+V +   Y   A  +FL
Sbjct  442   KLSEFQQELVQLAAVLKGDDVLT-AYPKEIGKGMTVIQGKKYMEDAVKRFL  491



>ref|XP_010938556.1| PREDICTED: non-specific phospholipase C2-like [Elaeis guineensis]
Length=525

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/480 (62%), Positives = 363/480 (76%), Gaps = 14/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNPEINGV G E NP+ TS  A       V FG+ +
Sbjct  34    PIKTVVVLVMENRSFDHMLGWMKRLNPEINGVTGSEWNPVSTSDPASPR----VYFGDGA  89

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VDPDPGHS Q I EQIFG   S D++     P M GF   A    A M+ +VMNGFVP
Sbjct  90    HFVDPDPGHSFQAIREQIFG---SNDTSAAP--PPMNGFVQQARSMSANMTESVMNGFVP  144

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E VPVYK LV EFA+ DRWFASVPASTQPNRL+VHSATSHGATSN    L +G+PQ+TIF
Sbjct  145   ELVPVYKALVEEFALFDRWFASVPASTQPNRLYVHSATSHGATSNIASMLAKGYPQRTIF  204

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             E++ +AG SFGIYYQ  P+TLFYRNLRKLKY+  FH +D  FK    +G LPNYVV+EQ+
Sbjct  205   ENIYDAGLSFGIYYQSIPTTLFYRNLRKLKYLTKFHSYD-KFKDQASKGSLPNYVVIEQQ  263

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K  P NDDHPSHDV++GQ FVKEVYE LRSSPQWN+ L +I YDEHGGF+DHVPTP
Sbjct  264   YLDSKSEPANDDHPSHDVYQGQMFVKEVYETLRSSPQWNQTLLIITYDEHGGFFDHVPTP  323

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             V GVP+PD ++GP P++F FDRLGVRVP I+VSPWIE+G V+HGP+G P P SEYEHSSI
Sbjct  324   VGGVPSPDDVVGPDPFDFTFDRLGVRVPTILVSPWIEKGTVIHGPNGVPSPTSEYEHSSI  383

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFE-TVITRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIF+L + +LT+RDAWAGTFE  V++RT PR DCPE L  PVK+R++EA EDA L
Sbjct  384   PATVKKIFDLPSPYLTKRDAWAGTFEGIVLSRTGPRTDCPEQLPTPVKIRNSEANEDAKL  443

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+ Q+A+VL GDH+   +   K+++ M+V +   Y+  A  +F     +A++ G+
Sbjct  444   SEFQQELTQLASVLNGDHLITSFE-QKILKPMNVREGIAYTENAVKRFFEAGMSAKKMGV  502



>ref|XP_004154695.1| PREDICTED: phospholipase C 3-like, partial [Cucumis sativus]
Length=520

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/488 (61%), Positives = 365/488 (75%), Gaps = 15/488 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PI T+VVLV ENRSFDHMLGWMK LNP+INGV G ESN L T+    +  +    F ++S
Sbjct  25    PITTIVVLVMENRSFDHMLGWMKKLNPQINGVDGSESNLLSTT----DPNSKRFFFQDQS  80

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S +++     P M GFA  A    N + MSG VMNGF
Sbjct  81    HYVDPDPGHSFQAIREQIFG---SDNTSANP--PPMNGFAQQAFSMDNTSAMSGDVMNGF  135

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
             +P+ V VYK LV EFAV DRWFASVPASTQPNRL+VHSATS GATSN    L +G+PQ+T
Sbjct  136   LPDKVAVYKTLVSEFAVFDRWFASVPASTQPNRLYVHSATSAGATSNIPALLAKGYPQRT  195

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  P+TLFYRNLRKLKY+  FH + ++FK   K+GKLPNYVVVE
Sbjct  196   IFENLDDAGMSFGIYYQNIPATLFYRNLRKLKYVNKFHDYGLNFKKDAKQGKLPNYVVVE  255

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY DL + P NDDHPSHDV++GQ FVKEVYE LRSSPQWNE LF+I YDEHGGF+DHVP
Sbjct  256   QRYIDLPLEPANDDHPSHDVYQGQMFVKEVYETLRSSPQWNETLFIITYDEHGGFFDHVP  315

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPVTGVP+PDG++GP+P+ F F+RLGVRVP IM+SPWIE+G V+H P G PF  SE+EHS
Sbjct  316   TPVTGVPSPDGIVGPEPFLFGFNRLGVRVPTIMISPWIEKGTVVHSPKGSPFQTSEFEHS  375

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAG+FE ++ TRT PR DCPE L  PVK+R   A E A
Sbjct  376   SIPATVKKLFNLSSPFLTKRDEWAGSFEFIVQTRTEPRTDCPEQLPTPVKIRETPANEKA  435

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
             NLTE+Q+E++Q+AAV+ GD++    YP  + ++M+V +   Y   A  +F      A++ 
Sbjct  436   NLTEFQQELMQLAAVMKGDNIFTS-YPEAIGKDMNVKEGRQYMREAVRRFFEAGRLAKRM  494

Query  1498  GIHGDYSV  1521
             G+  D  V
Sbjct  495   GVSEDQIV  502



>ref|XP_004139131.1| PREDICTED: phospholipase C 3-like [Cucumis sativus]
Length=518

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 365/488 (75%), Gaps = 15/488 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PI T+VVLV ENRSFDHMLGWMK LNP+INGV G ESN L T+    +  +    F ++S
Sbjct  23    PITTIVVLVMENRSFDHMLGWMKKLNPQINGVDGSESNLLSTT----DPNSKRFFFQDQS  78

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S +++     P M GFA  A    N + MSG VMNGF
Sbjct  79    HYVDPDPGHSFQAIREQIFG---SDNTSANP--PPMNGFAQQAFSMDNTSAMSGDVMNGF  133

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
             +P+ V VYK LV EFAV DRWFASVPASTQPNRL+VHSATS GATSN    L +G+PQ+T
Sbjct  134   LPDKVAVYKTLVSEFAVFDRWFASVPASTQPNRLYVHSATSAGATSNIPALLAKGYPQRT  193

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  P+TLFYRNLRKLKY+  FH + ++FK   K+GKLPNYVVVE
Sbjct  194   IFENLDDAGMSFGIYYQNIPATLFYRNLRKLKYVNKFHDYGLNFKKDAKQGKLPNYVVVE  253

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY DL + P NDDHPSHDV++GQ F+KEVYE LRSSPQWNE LF+I YDEHGGF+DHVP
Sbjct  254   QRYIDLPLEPANDDHPSHDVYQGQMFIKEVYETLRSSPQWNETLFIITYDEHGGFFDHVP  313

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPVTGVP+PDG++GP+P+ F F+RLGVRVP IM+SPWIE+G V+H P G PF  SE+EHS
Sbjct  314   TPVTGVPSPDGIVGPEPFLFGFNRLGVRVPTIMISPWIEKGTVVHSPKGSPFQTSEFEHS  373

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAG+FE ++ TRT PR DCPE L  PVK+R   A E A
Sbjct  374   SIPATVKKLFNLSSPFLTKRDEWAGSFEFIVQTRTEPRTDCPEQLPTPVKIRETPANEKA  433

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
             NLTE+Q+E++Q+AAV+ GD++    YP  + ++M+V +   Y   A  +F      A++ 
Sbjct  434   NLTEFQQELMQLAAVMKGDNIFTS-YPEAIGKDMNVKEGRQYMREAVRRFFEAGRLAKRM  492

Query  1498  GIHGDYSV  1521
             G+  D  V
Sbjct  493   GVSEDQIV  500



>gb|KGN66548.1| hypothetical protein Csa_1G629050 [Cucumis sativus]
Length=519

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 365/488 (75%), Gaps = 15/488 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PI T+VVLV ENRSFDHMLGWMK LNP+INGV G ESN L T+    +  +    F ++S
Sbjct  24    PITTIVVLVMENRSFDHMLGWMKKLNPQINGVDGSESNLLSTT----DPNSKRFFFQDQS  79

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S +++     P M GFA  A    N + MSG VMNGF
Sbjct  80    HYVDPDPGHSFQAIREQIFG---SDNTSANP--PPMNGFAQQAFSMDNTSAMSGDVMNGF  134

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
             +P+ V VYK LV EFAV DRWFASVPASTQPNRL+VHSATS GATSN    L +G+PQ+T
Sbjct  135   LPDKVAVYKTLVSEFAVFDRWFASVPASTQPNRLYVHSATSAGATSNIPALLAKGYPQRT  194

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  P+TLFYRNLRKLKY+  FH + ++FK   K+GKLPNYVVVE
Sbjct  195   IFENLDDAGMSFGIYYQNIPATLFYRNLRKLKYVNKFHDYGLNFKKDAKQGKLPNYVVVE  254

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY DL + P NDDHPSHDV++GQ F+KEVYE LRSSPQWNE LF+I YDEHGGF+DHVP
Sbjct  255   QRYIDLPLEPANDDHPSHDVYQGQMFIKEVYETLRSSPQWNETLFIITYDEHGGFFDHVP  314

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPVTGVP+PDG++GP+P+ F F+RLGVRVP IM+SPWIE+G V+H P G PF  SE+EHS
Sbjct  315   TPVTGVPSPDGIVGPEPFLFGFNRLGVRVPTIMISPWIEKGTVVHSPKGSPFQTSEFEHS  374

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAG+FE ++ TRT PR DCPE L  PVK+R   A E A
Sbjct  375   SIPATVKKLFNLSSPFLTKRDEWAGSFEFIVQTRTEPRTDCPEQLPTPVKIRETPANEKA  434

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
             NLTE+Q+E++Q+AAV+ GD++    YP  + ++M+V +   Y   A  +F      A++ 
Sbjct  435   NLTEFQQELMQLAAVMKGDNIFTS-YPEAIGKDMNVKEGRQYMREAVRRFFEAGRLAKRM  493

Query  1498  GIHGDYSV  1521
             G+  D  V
Sbjct  494   GVSEDQIV  501



>emb|CDY48054.1| BnaA09g23040D [Brassica napus]
 emb|CDX77056.1| BnaC04g38510D [Brassica napus]
Length=519

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/471 (63%), Positives = 357/471 (76%), Gaps = 15/471 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGWMK LNPEINGV G ESNP+     A + ++  + FG  S
Sbjct  31    PIKTIVVLVMENRSFDHMLGWMKKLNPEINGVDGSESNPV----SASDPSSKKIQFGLGS  86

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S D++  K  P M GF   A  E     MS +VMNGF
Sbjct  87    HYVDPDPGHSFQAIREQIFG---SNDTS--KDPPPMNGFVQQAYSEDPTGNMSASVMNGF  141

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYK LV EFAV DRWFASVP+STQPNR+FVHS TS GATSND K L  G+PQ+T
Sbjct  142   EPDKVPVYKTLVSEFAVFDRWFASVPSSTQPNRMFVHSGTSGGATSNDPKSLALGYPQRT  201

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++DEA  SFGIY+Q  P+ LFYRNLRKLKYI  FH + + FK H K+GKLP Y V+E
Sbjct  202   IFENLDEADISFGIYFQNIPAVLFYRNLRKLKYIPKFHSYALSFKDHAKKGKLPGYAVIE  261

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K  P NDDHPSHDV++GQKF+KEVYE LR+SPQWNE L LI YDEHGG++DHVP
Sbjct  262   QRYMDTKFEPANDDHPSHDVYQGQKFIKEVYETLRASPQWNETLLLITYDEHGGYFDHVP  321

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++GP+P+ F+F+RLG+RVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  322   TPVRNVPSPDGIVGPEPFLFEFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  381

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAGTFE ++  R  PR DCPETL EPVK+R  EA E+A
Sbjct  382   SIPATVKKLFNLSTPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVKIRMTEANENA  441

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
              L+E+Q+E+VQ+AAVL GD +    YP ++ + M+V +   Y   A  +FL
Sbjct  442   KLSEFQQELVQLAAVLKGDDVLTT-YPKEIGKGMTVIQGKMYMEDAVKRFL  491



>ref|XP_009339440.1| PREDICTED: non-specific phospholipase C2-like [Pyrus x bretschneideri]
Length=522

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/483 (62%), Positives = 359/483 (74%), Gaps = 16/483 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGWMK +NPEINGV G E+NPL T+    +  +    F N+S
Sbjct  28    PIKTIVVIVMENRSFDHMLGWMKKINPEINGVDGSEANPLSTT----DPNSKRFFFNNES  83

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER--NQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S +++     P M GFA  A    N   +S  VMNGF
Sbjct  84    HYVDPDPGHSFQAIREQIFG---SDNTSADP--PPMNGFAQQAYSMDNTTALSQDVMNGF  138

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAV DRWFASVP+STQPNRL+VHS TS GATSN    L +G+PQ+T
Sbjct  139   NPDMVAVYKTLVSEFAVFDRWFASVPSSTQPNRLYVHSGTSAGATSNIPALLAKGYPQRT  198

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  PSTLFYRNLRKLKYI  FH +D  FK+H KEGKLP Y V+E
Sbjct  199   IFENLDDAGISFGIYYQNIPSTLFYRNLRKLKYIGKFHLYDT-FKSHAKEGKLPGYTVIE  257

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD+K  P NDDHPSHDV+ GQ FVKEVYE LR+SP+WN  L +I YDEHGGFYDHVP
Sbjct  258   QRYFDVKSAPANDDHPSHDVYHGQMFVKEVYEILRASPRWNNTLMIITYDEHGGFYDHVP  317

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP+P+ FQF+RLGVRVP IMVSPWIE+G V+HGP+G P P SE++HS
Sbjct  318   TPVRGVPSPDGIVGPEPFLFQFNRLGVRVPTIMVSPWIEKGTVVHGPNGSPSPTSEFDHS  377

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKKIFNL   FLT+RD WAGTFE V+ TRT PR DCPE L  PV +R  E KEDA
Sbjct  378   SIPATVKKIFNLTAPFLTKRDEWAGTFEGVVQTRTEPRTDCPEQLPTPVAIRKGEPKEDA  437

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+EM+Q+AAVL GD++    YP K  + M+V     Y+  A  +F      A++ 
Sbjct  438   KLSEFQQEMMQLAAVLKGDNIFTS-YPEKTGKEMTVKDGKKYADDAVKRFFEAGLYAKRM  496

Query  1498  GIH  1506
             G++
Sbjct  497   GVN  499



>gb|KHG07474.1| Phospholipase C 3 [Gossypium arboreum]
Length=518

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/507 (59%), Positives = 371/507 (73%), Gaps = 19/507 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGWMK +NPEINGV G E NPL T+    +  +  + F N++
Sbjct  23    PIKTIVVLVMENRSFDHMLGWMKKINPEINGVDGTEWNPLSTT----DPNSKKLFFQNQA  78

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN--QAGMSGAVMNGF  426
             Q+VDPDPGHS Q I EQIFG   S D++     P M GFA  A        MS  VMNGF
Sbjct  79    QFVDPDPGHSFQAIREQIFG---SNDTSTNP--PPMNGFAQQAYSMDPSTTMSQNVMNGF  133

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE VPVYK LV EFAV DRWFASVP+STQPNRL+VHSATS GATSN    L++G+PQ+T
Sbjct  134   DPEMVPVYKSLVSEFAVFDRWFASVPSSTQPNRLYVHSATSAGATSNIPALLVKGYPQRT  193

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D AG S+GIYYQ  P+TLFY+NLRKLKY+  F  + + FK H +EGKLP YVVVE
Sbjct  194   IFENLDAAGISWGIYYQNIPATLFYKNLRKLKYLFRFRPYGVTFKKHAQEGKLPGYVVVE  253

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K+ P NDDHPSHDV++GQ FVKEVYE LR+SPQWN+ L +I YDEHGGFYDHV 
Sbjct  254   QRYMDTKLEPANDDHPSHDVYQGQMFVKEVYETLRASPQWNQTLLIITYDEHGGFYDHVA  313

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPVTGVP+PDG++GP+P+ F FDRLGVRVP IMVS WI++G V+HG +G PFP SE+EHS
Sbjct  314   TPVTGVPSPDGIVGPEPFFFHFDRLGVRVPTIMVSSWIDKGTVVHGANGRPFPTSEFEHS  373

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVK +FNL   FLT+RD WA TFE+++ TR+ PR DCPETL  P ++R  EA E+A
Sbjct  374   SIPATVKLLFNLTSPFLTKRDEWAATFESILRTRSDPRTDCPETLPTPARIRRGEANEEA  433

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+E+VQ+AAVL GD++    YP ++ + MSV +  +Y   A  +F      A++ 
Sbjct  434   KLSEFQQELVQLAAVLKGDYILTS-YPERIGKEMSVKEGKEYMEDAVKRFFEAGHFAKKM  492

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKS  1578
             G+ G++ V    +  PS  T   KP S
Sbjct  493   GVDGEHIV----QMKPSLTTRSTKPSS  515



>ref|XP_008450341.1| PREDICTED: non-specific phospholipase C2 [Cucumis melo]
Length=519

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/508 (60%), Positives = 370/508 (73%), Gaps = 18/508 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PI T+VVLV ENRSFDHMLGWMK LNP+INGV G ESN L T+    NST     F ++S
Sbjct  24    PINTIVVLVMENRSFDHMLGWMKKLNPQINGVNGSESNLLSTTD--PNSTR--FFFQDQS  79

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S +++     P M GFA  A    N + MS  VMNGF
Sbjct  80    HYVDPDPGHSFQAIREQIFG---SDNTSANP--PPMNGFAQQAFSMDNTSAMSRDVMNGF  134

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
             +P+ V VYK LV EFAV DRWFASVP+STQPNRL+VHSATS GATSN    L +G+PQ+T
Sbjct  135   LPDKVAVYKTLVSEFAVFDRWFASVPSSTQPNRLYVHSATSAGATSNIPALLAKGYPQRT  194

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  P+TLFYRNLRKLKY+  FH++ ++FK    +GKLPNYVVVE
Sbjct  195   IFENLDDAGMSFGIYYQNIPATLFYRNLRKLKYVNKFHEYGLNFKKDAAQGKLPNYVVVE  254

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY DL + P NDDHPSHDV++GQ F+KEVYE LRSSPQWNE LF+I YDEHGGFYDHVP
Sbjct  255   QRYVDLPLEPANDDHPSHDVYQGQMFIKEVYETLRSSPQWNETLFIITYDEHGGFYDHVP  314

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPVTGVP+PDG++GP+P+ F FDRLGVRVP IM+SPWIE+G V+H P G PF  SE+EHS
Sbjct  315   TPVTGVPSPDGIVGPEPFLFGFDRLGVRVPTIMISPWIEKGTVVHSPEGSPFQTSEFEHS  374

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAG+FE ++ TRT PR DCPE L  P K+R  +A E+A
Sbjct  375   SIPATVKKLFNLSSPFLTKRDEWAGSFEFIVQTRTEPRTDCPEQLPTPEKIRETQANENA  434

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              LTE+Q+E++Q+AAV+ GD +    YP  + ++M+V +   Y   A  +F      A+  
Sbjct  435   KLTEFQQELMQLAAVMNGDDIFTS-YPEAIGKDMNVKEGRLYMREAVRRFFEAGHLAKTM  493

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKSF  1581
             G+  D  V     +P     + +KPK  
Sbjct  494   GVSEDQIV---QMRPSLATRSSQKPKQL  518



>ref|XP_011024970.1| PREDICTED: non-specific phospholipase C2 [Populus euphratica]
Length=555

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/506 (60%), Positives = 366/506 (72%), Gaps = 18/506 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIK+VVVLV ENRSFDHMLGWMK +NPEINGV G + NPL       +  +    F N++
Sbjct  61    PIKSVVVLVMENRSFDHMLGWMKKINPEINGVDGTQWNPL----NITDPNSQKFFFNNQA  116

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQ--AGMSGAVMNGF  426
             QYVDPDPGHS Q I EQIFG   S+D++  K  P M GFA  A        MS  VMNGF
Sbjct  117   QYVDPDPGHSFQAIREQIFG---SEDTS--KNPPPMNGFAQQAFSMDPTTNMSRDVMNGF  171

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ + VYK LV EFAV DRWFASVP+STQPNRLFVHS TS GATSN    L +G+PQ+T
Sbjct  172   EPDMLAVYKALVSEFAVFDRWFASVPSSTQPNRLFVHSGTSAGATSNIPAMLAKGYPQRT  231

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG S+GIYYQ  P+TLFYRNLRK+KY   FH +D  FK H  +GKLP YVV+E
Sbjct  232   IFENLDDAGISWGIYYQNIPATLFYRNLRKVKYTARFHPYDSAFKKHAGKGKLPGYVVIE  291

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY DLK  P NDDHPSHDV++GQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHV 
Sbjct  292   QRYTDLKTAPANDDHPSHDVYQGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVA  351

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP P+ F+FDRLGVRVP+IMVSPWIE+G V+HGP+G PFP SEYEHS
Sbjct  352   TPVIGVPSPDGIVGPAPFFFKFDRLGVRVPSIMVSPWIEKGTVVHGPNGSPFPTSEYEHS  411

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SIPATVKK+FN+N FLT+RD WAGTFE ++ TRT PR DCPE L  P ++R +E  EDA 
Sbjct  412   SIPATVKKLFNMNTFLTKRDEWAGTFEGIVQTRTEPRTDCPEQLPIPTRIRKSEPNEDAK  471

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LTE+Q+E++Q+AAVL G+     Y   K+ + M+V +  DY   A  +FL    +A + G
Sbjct  472   LTEFQQELLQLAAVLKGEDTLTSYL-EKIGKEMTVKQGNDYMEDAVKRFLEAGLHATRMG  530

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKS  1578
             +  +  V    +  PS  T   KP +
Sbjct  531   VDEEQIV----QMRPSLTTRTSKPTT  552



>ref|XP_010926985.1| PREDICTED: non-specific phospholipase C2-like [Elaeis guineensis]
Length=528

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/479 (61%), Positives = 356/479 (74%), Gaps = 13/479 (3%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVVLV ENRSFDHMLGWMK LNPEI+GV G E NP+     A +  +  V FG+ + 
Sbjct  37    IKTVVVLVMENRSFDHMLGWMKQLNPEIDGVTGSEWNPV----SASDPASPRVYFGDGAH  92

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVPE  435
             +VDPDPGHS Q I EQIFG   S D++       M GF  NA      M+ +VMNGF PE
Sbjct  93    FVDPDPGHSFQAIREQIFG---SNDTSAAPAP--MNGFVQNARSMSENMTESVMNGFRPE  147

Query  436   AVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIFE  615
              V VYK LV EFAV DRWFASVP STQPNRLFVHSATS GATSN+   L++G+PQ+TIFE
Sbjct  148   MVAVYKTLVEEFAVFDRWFASVPTSTQPNRLFVHSATSGGATSNNVSLLVKGYPQRTIFE  207

Query  616   SMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQRY  795
             ++D+AG SFGIYYQ  P+TLFYRNLRKLKY+  FH +D+ FK H  +G LPNY V+EQRY
Sbjct  208   NIDDAGLSFGIYYQNIPATLFYRNLRKLKYLFKFHSYDLTFKHHASKGSLPNYAVIEQRY  267

Query  796   FDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTPV  975
             FD K+ P  DDHPSHDV++GQ F+KEVYE LR+SPQWNE L +I YDEHGGF+DHVPTPV
Sbjct  268   FDSKLKPATDDHPSHDVYQGQMFIKEVYETLRASPQWNETLLVITYDEHGGFFDHVPTPV  327

Query  976   TGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSIP  1152
              GVP+PDG++GP P+ F FDRLGVRVP IMVSPWIE+G V+HGP+G P P SEYEHSSIP
Sbjct  328   RGVPSPDGIVGPDPFYFTFDRLGVRVPTIMVSPWIEKGTVIHGPNGVPSPTSEYEHSSIP  387

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFE-TVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             ATVKKIF+L + +LT RDAWAGTFE  V++RT PR DCP  L  P K+R+ EA EDA L+
Sbjct  388   ATVKKIFDLPSSYLTARDAWAGTFEGIVLSRTEPRTDCPVQLPTPSKIRNGEANEDAKLS  447

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             E+Q+E++Q+A+VL GD +    +  K+++ M+V +   Y   A  +F      A++ G+
Sbjct  448   EFQQELMQLASVLNGDQLLTS-FEEKILKQMNVREGIAYMENAVKRFFEAGMTAKKMGV  505



>ref|XP_010249047.1| PREDICTED: non-specific phospholipase C6-like [Nelumbo nucifera]
Length=527

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/501 (60%), Positives = 355/501 (71%), Gaps = 19/501 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKS-LNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHMLGWMK  +NP INGV G E NP+ T     +S    + F + 
Sbjct  42    PIKTIVVLVLENRSFDHMLGWMKKYVNPSINGVTGNECNPVSTKSPQSHS----ICFTDD  97

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +Q+VDPDPGHS QD+ EQ+FG+          L P+M GF   A    + +SG VM GF 
Sbjct  98    AQFVDPDPGHSFQDVQEQVFGS---------SLIPSMSGFVQQAMAMLSNLSGTVMKGFK  148

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE+VPVY  LVREFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  149   PESVPVYASLVREFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVPKQLARGYPQKTI  208

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  P+TLFYRNLRKLKYI  FHQFD  FK H +EGKLPN  V+E 
Sbjct  209   FDSLHENGLDFGIYFQNIPTTLFYRNLRKLKYIFKFHQFDFKFKKHAREGKLPNLTVIEP  268

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQK VKEVYE LRSSPQWNE L +I YDEHGGF+DHV T
Sbjct  269   RYFDLKGLPANDDHPSHDVASGQKLVKEVYETLRSSPQWNETLLVITYDEHGGFFDHVKT  328

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+  P+GP P+SE+EHSSI
Sbjct  329   PYVNVPNPDGNTGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVISAPNGPTPDSEFEHSSI  388

Query  1150  PATVKKIFNLN-QFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KKIFNLN  FLT RDAWAGTFE V+   T+PR DCPE L E   LR  EAKED  L
Sbjct  389   PATIKKIFNLNSNFLTHRDAWAGTFEHVLGGLTSPRTDCPEVLPEVAPLRKTEAKEDGKL  448

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E+VQ+AAVL GDH+    +P  +   MSV +A DY   A  +F+   + A + G 
Sbjct  449   SEFQSEIVQLAAVLNGDHLLSS-FPEGMTNKMSVKEAHDYVKGAVLRFIRASKEAIKLG-  506

Query  1504  HGDYSVVALSKQPPSPNTTPR  1566
               D S +   +   +  TT R
Sbjct  507   -ADESAIVDMRSSLTTRTTLR  526



>ref|XP_009337051.1| PREDICTED: non-specific phospholipase C2-like [Pyrus x bretschneideri]
Length=523

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/483 (62%), Positives = 358/483 (74%), Gaps = 16/483 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGWMK +NPEINGV G E+NPL T+    +  +    F N+S
Sbjct  29    PIKTIVVIVMENRSFDHMLGWMKKINPEINGVDGSEANPLSTT----DPNSKRFFFNNES  84

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER--NQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S +++     P M GFA  A    N   +S  VMNGF
Sbjct  85    HYVDPDPGHSFQAIREQIFG---SDNTSADP--PPMNGFAQQAYSMDNTTALSQDVMNGF  139

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAV DRWFASVP+STQPNRL+VHS TS GATSN    L +G+PQ+T
Sbjct  140   NPDMVAVYKTLVSEFAVFDRWFASVPSSTQPNRLYVHSGTSAGATSNIPALLAKGYPQRT  199

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  PSTLFYRNLRKLKYI  FH +D  FK+H KEGKLP Y V+E
Sbjct  200   IFENLDDAGISFGIYYQNIPSTLFYRNLRKLKYIGKFHLYDT-FKSHAKEGKLPGYTVIE  258

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD+K  P NDDHPSHDV+ GQ FVKEVYE LR+SP WN  L +I YDEHGGFYDHVP
Sbjct  259   QRYFDVKSAPANDDHPSHDVYHGQMFVKEVYETLRASPLWNNTLMIITYDEHGGFYDHVP  318

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP+P+ FQF+RLGVRVP IMVSPWIE+G V+HGP+G P P SE++HS
Sbjct  319   TPVRGVPSPDGIVGPEPFLFQFNRLGVRVPTIMVSPWIEKGTVVHGPNGSPSPTSEFDHS  378

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKKIFNL   FLT+RD WAGTFE ++ TRT PR DCPE L  PV +R  E KEDA
Sbjct  379   SIPATVKKIFNLTAPFLTKRDEWAGTFEGIVQTRTEPRTDCPEQLPTPVAIRKGEPKEDA  438

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+EM+Q+AAVL GD++    YP K  + M+V     Y+  A  +F      A++ 
Sbjct  439   KLSEFQQEMMQLAAVLKGDNIFTS-YPEKTGKEMTVKDGKKYADDAVKRFFEAGLYAKRM  497

Query  1498  GIH  1506
             G++
Sbjct  498   GVN  500



>ref|XP_009140862.1| PREDICTED: non-specific phospholipase C2 [Brassica rapa]
Length=527

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/445 (65%), Positives = 344/445 (77%), Gaps = 14/445 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGWMK LNPEINGV G ESNP+     A + ++  + FG+ S
Sbjct  58    PIKTIVVLVMENRSFDHMLGWMKKLNPEINGVDGSESNPV----SASDPSSKKIQFGSGS  113

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S D++  K  P M GF   A  E     MS +VMNGF
Sbjct  114   HYVDPDPGHSFQAIREQIFG---SNDTS--KDPPPMNGFVQQAYSEDPTGNMSASVMNGF  168

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYK LV EFAV DRWFASVP+STQPNR+FVHS TS GATSND K L  G+PQ+T
Sbjct  169   EPDKVPVYKTLVSEFAVFDRWFASVPSSTQPNRMFVHSGTSGGATSNDPKSLALGYPQRT  228

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++DEA  SFGIY+Q  P+ LFYRNLRKLKYI  FH + + FK H K+GKLP Y V+E
Sbjct  229   IFENLDEADISFGIYFQNIPAVLFYRNLRKLKYIPKFHSYSLSFKDHAKKGKLPGYAVIE  288

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D    P NDDHPSHDV++GQKF+KEVYE LR+SPQWNE L LI YDEHGG++DHVP
Sbjct  289   QRYMDTTFEPANDDHPSHDVYQGQKFIKEVYETLRASPQWNETLLLITYDEHGGYFDHVP  348

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++GP+P+ F+F+RLG+RVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  349   TPVRNVPSPDGIVGPEPFLFEFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  408

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAGTFE ++  R  PR DCPETL EPVK+R  EA E+A
Sbjct  409   SIPATVKKLFNLSTPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVKIRMTEANENA  468

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDY  1392
              L+E+Q+E+VQ+AAVL GD +   Y
Sbjct  469   KLSEFQQELVQLAAVLKGDDVLTAY  493



>gb|KDP43231.1| hypothetical protein JCGZ_22783 [Jatropha curcas]
Length=523

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/505 (60%), Positives = 364/505 (72%), Gaps = 20/505 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGWMK LNPEINGV G+E NPL TS    +  ++ + F  ++
Sbjct  29    PIKTIVVLVMENRSFDHMLGWMKKLNPEINGVDGREWNPLNTS----DVNSEKIYFKEEA  84

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN--QAGMSGAVMNGF  426
             ++VDPDPGHS Q I EQIFG      S   K  P M GFA  A        MS  VMNGF
Sbjct  85    EFVDPDPGHSFQAIREQIFG------SNDTKKPPLMNGFAQQALSMDPSTNMSKDVMNGF  138

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAV DRWFASVPASTQPNRL+VHS TS GATSN    LI+G+PQ+T
Sbjct  139   DPDMVAVYKTLVSEFAVFDRWFASVPASTQPNRLYVHSGTSAGATSNIPALLIKGYPQRT  198

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG S+GIYYQ  P+TLFYRNLRK+KYI NFH +D  FK H ++GKLP Y VVE
Sbjct  199   IFENLDDAGISWGIYYQNIPATLFYRNLRKIKYIGNFHSYDSTFKKHAQQGKLPGYAVVE  258

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K+ P NDDHPSHDV++GQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHV 
Sbjct  259   QRYMDTKLKPANDDHPSHDVYQGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVA  318

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV+GVP+PDG++GP+P+ F+FDRLGVRVP I+VSPWIE+  V+HG +G PFP SEYEHS
Sbjct  319   TPVSGVPSPDGIVGPEPFLFKFDRLGVRVPTIVVSPWIEKATVVHGSNGSPFPTSEYEHS  378

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WA TFE++I  RT PR DCP  L  P K+R  +A E+A
Sbjct  379   SIPATVKKLFNLSSPFLTKRDEWAATFESIIQKRTEPRTDCPVQLPTPSKIRKGDANENA  438

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+E++Q+AAVL GDH+    YP  + + M+V +   Y   A  +F      A++ 
Sbjct  439   KLSEFQQELMQLAAVLKGDHILTS-YPQNIGKQMTVKEGNAYMEDAVKRFFEAGLYAKKM  497

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKP  1572
             G+     V    K  PS  T   KP
Sbjct  498   GVDEQQIV----KMRPSLTTRSSKP  518



>ref|XP_006470553.1| PREDICTED: non-specific phospholipase C2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470554.1| PREDICTED: non-specific phospholipase C2-like isoform X2 [Citrus 
sinensis]
Length=522

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/482 (62%), Positives = 360/482 (75%), Gaps = 15/482 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHM+GWMK LNPEINGV G E NPL T+    +  +    F N++
Sbjct  27    PIKTIVVLVMENRSFDHMIGWMKKLNPEINGVDGSEWNPLSTT----DPKSQRFFFKNQA  82

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN--QAGMSGAVMNGF  426
             Q+VDPDPGHS Q I EQIFG   S D++     P M GFA  A        MS  VMNGF
Sbjct  83    QFVDPDPGHSFQAIREQIFG---SNDTSSD--HPPMNGFAQQAFSMDPSLNMSHNVMNGF  137

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAV DRWFASVP+STQPNRL+VHS TS GATSN   KL +G+PQ+T
Sbjct  138   EPDMVAVYKTLVSEFAVFDRWFASVPSSTQPNRLYVHSGTSAGATSNIPAKLAKGYPQRT  197

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  P+TLFYRNLRK+KY   FH +   FK   ++GKLP YVVVE
Sbjct  198   IFENLDDAGISFGIYYQNIPATLFYRNLRKIKYWGKFHPYGTSFKKDARDGKLPGYVVVE  257

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K  PGNDDHPSHDV++GQ FVKEVYE LR+SPQWNE LF+I YDEHGGFYDHVP
Sbjct  258   QRYTDTKSEPGNDDHPSHDVYQGQMFVKEVYETLRASPQWNETLFVITYDEHGGFYDHVP  317

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP+P+ F+FDRLGVRVP I VSPWIE+G V+HGP+G PF  SE+EHS
Sbjct  318   TPVRGVPSPDGIVGPEPFLFKFDRLGVRVPTIAVSPWIEKGTVVHGPNGSPFATSEFEHS  377

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RDAWAGTFE ++ TRTTPR DCPE L  P+K+R  EA E+A
Sbjct  378   SIPATVKKLFNLSAPFLTKRDAWAGTFEGIVQTRTTPRTDCPEQLPTPMKIRQGEANENA  437

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+E++Q+AAVL GDH+    +P  + ++ +V +  +Y   A  +F      A + 
Sbjct  438   KLSEFQQELMQLAAVLKGDHVLTS-FPDDIGKDTTVKEGKEYMEDAVKRFFDAGLQALKM  496

Query  1498  GI  1503
             G+
Sbjct  497   GV  498



>ref|XP_006854823.1| hypothetical protein AMTR_s00063p00190060 [Amborella trichopoda]
 gb|ERN16290.1| hypothetical protein AMTR_s00063p00190060 [Amborella trichopoda]
Length=563

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/482 (62%), Positives = 358/482 (74%), Gaps = 15/482 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLG+MK LNPEINGV G ESNP+ T+    +     V F   S
Sbjct  69    PIKTVVVLVMENRSFDHMLGYMKRLNPEINGVTGTESNPISTTDPGSSR----VTFKLGS  124

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S D++ +     M GFA  A    N     G VM+GF
Sbjct  125   PYVDPDPGHSFQAIREQIFG---SNDTSARPAP--MNGFAQQAFSMSNSTDFVGNVMSGF  179

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P  + VY+ LV EFAV DRWFASVPASTQPNRL+VHSATS+GATSN    L++G+PQKT
Sbjct  180   DPSQIAVYQSLVTEFAVFDRWFASVPASTQPNRLYVHSATSNGATSNMASLLVKGYPQKT  239

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+++ G SFGIY+Q  P+TLFYRNLRKLKYI  FH +D+ FK   K GKLPNYVVVE
Sbjct  240   IFESLEDEGLSFGIYFQNIPATLFYRNLRKLKYITKFHPYDLSFKGDAKAGKLPNYVVVE  299

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K+ P NDDHPSHDV++GQ FVKEVYE LRSSPQWN+ LF+I YDEHGGF+DHVP
Sbjct  300   QRYIDTKLTPANDDHPSHDVYQGQMFVKEVYETLRSSPQWNQTLFIITYDEHGGFFDHVP  359

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PD ++GP P+ F+FDRLGVRVP I+ SPWI +G V+HGP+G PFP+SE+EHS
Sbjct  360   TPVDGVPSPDDIVGPDPFFFRFDRLGVRVPTIIASPWINKGTVVHGPNGVPFPSSEFEHS  419

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RDAWAGTFE+++  R TPR DCP  L  P K+R  EA EDA
Sbjct  420   SIPATVKKLFNLSSPFLTKRDAWAGTFESIVQGRVTPRTDCPVQLPTPSKIRMGEANEDA  479

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+E+VQ+AAVL GD++    +P K+ E MSV +  +Y   +  +F      A + 
Sbjct  480   KLSEFQQELVQLAAVLNGDNLLTS-FPDKIGEKMSVREGQNYMEDSLKRFFEASFAAIEL  538

Query  1498  GI  1503
             G+
Sbjct  539   GV  540



>ref|XP_009411752.1| PREDICTED: non-specific phospholipase C2 [Musa acuminata subsp. 
malaccensis]
Length=535

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/479 (61%), Positives = 355/479 (74%), Gaps = 12/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK LNP INGV G E NP+     A ++ +D V F + +
Sbjct  41    PIKTVVVMVMENRSFDHMLGWMKRLNPAINGVDGSEWNPV----SASDAASDRVYFRDGA  96

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VDPDPGHS Q I EQIFG   S D++       M GF   A      M+ +VMNGF P
Sbjct  97    HFVDPDPGHSFQAIREQIFG---SNDTSADPA--PMNGFVQQARSMSDNMTESVMNGFPP  151

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E V VY+ LV EFAV DRWFASVP+STQPNRLFVHS TSHGATSN   KL  G+PQ+TIF
Sbjct  152   EMVAVYRALVGEFAVFDRWFASVPSSTQPNRLFVHSGTSHGATSNVASKLAIGYPQRTIF  211

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             E++D+A  SFGIYYQ  P+TLFYRNLRKLKYI  FH ++  FK H  +G LPNYVV+EQR
Sbjct  212   ENIDDADLSFGIYYQNVPATLFYRNLRKLKYISKFHSYEQKFKKHAGDGSLPNYVVIEQR  271

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K  P  DDHPSHDV++GQ FVKEVYE +RSSPQWNE LF+I YDEHGGF+DHVPTP
Sbjct  272   YMDKKDKPATDDHPSHDVYQGQLFVKEVYETIRSSPQWNETLFIITYDEHGGFFDHVPTP  331

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             V GVP+PDG++GP+P+ F FDRLGVRVP IMVSPWIE+G V+HGP+G P P SEYEHSSI
Sbjct  332   VKGVPSPDGIVGPEPFFFTFDRLGVRVPTIMVSPWIEKGTVVHGPNGIPTPTSEYEHSSI  391

Query  1150  PATVKKIFNLNQFLTERDAWAGTFE-TVITRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             PATVKKIF+L  +LT+RD WAGTFE  V++RT PR DCP  L  PV++R  EA E+A L+
Sbjct  392   PATVKKIFDLPSYLTKRDEWAGTFEGIVLSRTEPRTDCPVELPSPVRIRQTEANEEAPLS  451

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             E+Q+E++Q+A+VL GDH+   +   K+++ M+V +   Y+  A  +F      A++ G+
Sbjct  452   EFQQELMQLASVLNGDHLLTSFQ-EKVLKRMNVKEGIAYAESAVKRFFEAGLTAKKMGV  509



>ref|XP_002314000.2| phosphoesterase family protein [Populus trichocarpa]
 gb|EEE87955.2| phosphoesterase family protein [Populus trichocarpa]
Length=524

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/507 (60%), Positives = 370/507 (73%), Gaps = 19/507 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK +NPEINGV G + NPL  S    + ++       ++
Sbjct  30    PIKTVVVVVMENRSFDHMLGWMKKINPEINGVDGTQWNPLNIS----DPSSQKFFTNTQA  85

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAG--MSGAVMNGF  426
             QYVDPDPGHS Q I EQIFG   S+D++  K  P M GFA  A    A   +S  VMNGF
Sbjct  86    QYVDPDPGHSFQAIREQIFG---SEDTS--KNPPPMNGFAQQAFSMDASINLSRDVMNGF  140

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EF+V DRWFASVP+STQPNRLFVHSATS GATSN    L++G+PQ+T
Sbjct  141   EPDMVAVYKTLVSEFSVFDRWFASVPSSTQPNRLFVHSATSAGATSNIPALLVKGYPQRT  200

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG S+GIYYQ  P+TLFY NLRKLK+I  FH + + FK H K+GKLP Y V+E
Sbjct  201   IFENLDDAGISWGIYYQNIPATLFYSNLRKLKHITKFHPYGMSFKKHAKQGKLPGYAVLE  260

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D+KI P NDDHPSHDV++GQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHV 
Sbjct  261   QRYMDIKISPANDDHPSHDVYQGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVA  320

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV+GVP+PDG++GP+P+ F+FDRLGVRVP I+VSPWIE+G V+HGP+G PF  SEYEHS
Sbjct  321   TPVSGVPSPDGIVGPEPFLFKFDRLGVRVPTIVVSPWIEKGTVVHGPNGSPFSTSEYEHS  380

Query  1144  SIPATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FN+ + FLT RD WAGTFE ++ TRT PR DCP  L  P ++R +E  EDA
Sbjct  381   SIPATVKKLFNMPSPFLTRRDEWAGTFEGILQTRTEPRTDCPVQLPTPTQVRKSEPNEDA  440

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              LTE+Q+E++Q+AAVL GDH+    YP K+ + M+V +  DY   A  +F      A+  
Sbjct  441   KLTEFQQELLQLAAVLKGDHILTS-YPDKIGKEMTVKQGNDYMEDALKRFFEAGLYAKSM  499

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKS  1578
             G+  +  V    +  PS  T P KP S
Sbjct  500   GVDEEQIV----QMRPSLTTRPSKPTS  522



>ref|XP_002459116.1| hypothetical protein SORBIDRAFT_03g046200 [Sorghum bicolor]
 gb|EES04236.1| hypothetical protein SORBIDRAFT_03g046200 [Sorghum bicolor]
Length=523

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/503 (58%), Positives = 366/503 (73%), Gaps = 18/503 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNPEI+GV G+E NP  TS    + ++  V FG+ +
Sbjct  36    PIKTVVVLVMENRSFDHMLGWMKRLNPEIDGVTGREWNPANTS----DPSSGRVYFGDGA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAG-MSGAVMNGFV  429
              YVDPDPGHS Q+I +QIFG   S D++G      M GF   A     G M+ AVM+GF 
Sbjct  92    AYVDPDPGHSFQEIRQQIFG---SDDASGPA---RMDGFVQQAASIGGGNMTDAVMHGFA  145

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P++V VY+ELV +FAVCDRWFASVP+STQPNRLFVHS TS GATSN+   L EG+PQ+TI
Sbjct  146   PDSVAVYRELVSQFAVCDRWFASVPSSTQPNRLFVHSGTSGGATSNNPTLLAEGYPQRTI  205

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+++ +AG SFG+Y+Q  P+ LFYRNLRKLKY+ +FH     F  H + G LPNY V+EQ
Sbjct  206   FDNLHDAGLSFGVYFQDVPAVLFYRNLRKLKYLLDFHPLRPSFADHARRGVLPNYAVIEQ  265

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
              Y D K+ P NDDHPSHDV++GQ  VK VYE LR+SPQWN+ L +I YDEHGGF+DHVPT
Sbjct  266   HYLDSKLDPANDDHPSHDVYQGQMLVKYVYETLRASPQWNQTLLVITYDEHGGFFDHVPT  325

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVP+PDG++GP PYNF FDRLGVRVPAI+VSPWI++G V+H P+GP P S+YEHSSI
Sbjct  326   PVAGVPSPDGIVGPPPYNFTFDRLGVRVPAILVSPWIDKGTVVHAPTGPTPTSQYEHSSI  385

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIFNL Q FLT+RDAWAGTFE V+  RT PR DCPE L  P ++R  EA E+A L
Sbjct  386   PATVKKIFNLPQGFLTKRDAWAGTFEGVVQKRTEPRTDCPEQLPTPTRIRQTEADEEAKL  445

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E++Q+A+VL GDH        ++ + M+V +  DY   A  ++     +AR+ G+
Sbjct  446   SEFQQEIIQLASVLNGDHQLASLQ-DRIRDEMNVREGIDYMKAAVKRYFEAGASARRMGV  504

Query  1504  HGDYSVVALSKQPPSPNTTPRKP  1572
              G+  V    K  PS  T  ++P
Sbjct  505   DGEQIV----KMRPSLTTRIQRP  523



>ref|XP_011009118.1| PREDICTED: non-specific phospholipase C2-like isoform X1 [Populus 
euphratica]
Length=525

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/504 (60%), Positives = 367/504 (73%), Gaps = 19/504 (4%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVV+V ENRSFDHMLGWMK +NPEINGV G + NPL  S    + ++      N++Q
Sbjct  32    IKTVVVVVMENRSFDHMLGWMKKINPEINGVDGTQWNPLNIS----DPSSQKFFTNNQAQ  87

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGFV  429
             YVDPDPGHS Q I EQIFG   S+D++  K  P M GFA  A        +S  VMNGF 
Sbjct  88    YVDPDPGHSFQAIREQIFG---SEDTS--KNPPPMNGFAQQAFSMDTSTNLSRDVMNGFE  142

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P+ V VYK LV EF+V DRWFASVP+STQPNRLFVHS TS GATSN    L++G+PQ+TI
Sbjct  143   PDMVAVYKTLVSEFSVFDRWFASVPSSTQPNRLFVHSGTSAGATSNIPALLVKGYPQRTI  202

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FE++D+AG S+GIYYQ  P+TLFYRNLRKLKYI  FH + + FK H K+GKLP Y V+EQ
Sbjct  203   FENLDDAGISWGIYYQNIPATLFYRNLRKLKYITKFHPYGMSFKKHAKQGKLPGYAVLEQ  262

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RY D+KI P NDDHPSHDV++GQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  263   RYMDIKISPANDDHPSHDVYQGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVAT  322

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSS  1146
             PV+GVP+PD ++GP+P+ F+FDRLGVRVP I+VSPWIE+G V+HGP+G PF  SEYEHSS
Sbjct  323   PVSGVPSPDDIVGPEPFLFKFDRLGVRVPTIVVSPWIEKGTVVHGPNGSPFSTSEYEHSS  382

Query  1147  IPATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             IPATVKK+FN+ + +LT RD WAGTFE ++ TRT PR DCPE L  P ++R +E  EDA 
Sbjct  383   IPATVKKLFNMPSPYLTRRDEWAGTFEGILQTRTEPRTDCPEQLPTPTQVRKSEPNEDAK  442

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LTE+Q+E++Q+AAVL GDH+    YP K+   M+V +  DY   A  +F      A+  G
Sbjct  443   LTEFQQELLQLAAVLKGDHILTS-YPDKIGREMTVKQGNDYMEDALKRFFEAGLYAKSMG  501

Query  1501  IHGDYSVVALSKQPPSPNTTPRKP  1572
             +  +  V    +  PS  T P KP
Sbjct  502   VDEEQIV----QMRPSLTTRPSKP  521



>gb|ABK24597.1| unknown [Picea sitchensis]
Length=535

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/513 (57%), Positives = 375/513 (73%), Gaps = 20/513 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGW+K+ N EI+GV GKESNPL T+    +  + ++ F + S
Sbjct  39    PIKTIVVLVMENRSFDHMLGWLKAWNDEIDGVTGKESNPLSTT----DDNSPIINFADGS  94

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             +YVDPDPGHS Q I EQIFG   S+D++ +     M GFA  AE    GMS  VM GF P
Sbjct  95    EYVDPDPGHSYQAIREQIFG---SEDTSARP--APMNGFAQQAENMSEGMSTHVMRGFRP  149

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             EA+PVY  L  EFA+ D+WFASVP STQPNR +VHSATSHG+ SN  + L++GFPQ TIF
Sbjct  150   EALPVYATLATEFALFDKWFASVPTSTQPNRFYVHSATSHGSCSNVRRDLMKGFPQNTIF  209

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E+G SFGIYYQ  P+TLF+++LR+LK++  FH +   FK H K G LPNYVV+EQR
Sbjct  210   DSLEESGLSFGIYYQNIPATLFFKSLRRLKHVFKFHDYAASFKLHAKLGTLPNYVVIEQR  269

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ +LP NDDHPSHDV EGQKFVKEVYE LR+SPQWNEM+FLI YDEHGGF+DHVPTP
Sbjct  270   YFDVDLLPANDDHPSHDVAEGQKFVKEVYETLRASPQWNEMMFLITYDEHGGFFDHVPTP  329

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V  VPNPDG+IGP+PY F FDRLGVRVP I++SPWI++G V+H P+GP P+S +EHSS+P
Sbjct  330   VAHVPNPDGIIGPEPYYFNFDRLGVRVPTILISPWIDKGTVIHEPNGPTPHSHFEHSSVP  389

Query  1153  ATVKKIFNLN-QFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL   FLT RDAWAGTFE+ +  R TPR DCPETL +P+K LR     ED  +
Sbjct  390   ATVKKVFNLKADFLTRRDAWAGTFESYLHIRDTPRTDCPETLPDPIKSLRPTLTNEDKEI  449

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+V +AA L GD M ++Y   +L ++M+V +A  Y   A  +FL   + A + G 
Sbjct  450   SEFQEELVILAAQLIGDDMLKNY--SELGKHMTVKQANGYVEDAVARFLEAGKLALKAGA  507

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSC  1602
             + + +++ +      P  T RK   F + F+  
Sbjct  508   N-ESAIIQM-----RPALTSRKAGPFTSAFVQS  534



>ref|XP_008782022.1| PREDICTED: non-specific phospholipase C2-like [Phoenix dactylifera]
Length=484

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/493 (59%), Positives = 359/493 (73%), Gaps = 16/493 (3%)
 Frame = +1

Query  103   ENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQYVDPDPGHS  282
             ENRSFDHMLGWMK LNPEINGV G E NP+ TS  A       V F + + +VDPDPGHS
Sbjct  2     ENRSFDHMLGWMKRLNPEINGVTGSEWNPISTSDPASPR----VFFDDGAHFVDPDPGHS  57

Query  283   IQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVPEAVPVYKELV  462
              Q I EQIFG   S D++     P M GF   A    A M+ +VMNGF PE V VYK LV
Sbjct  58    FQAIREQIFG---SNDTSAAP--PPMNGFVQQARSMSANMTESVMNGFRPEMVSVYKALV  112

Query  463   REFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIFESMDEAGYSF  642
              EFAV DRWFASVP+STQPNRL+VHSATSHGATSN    L +G+PQ+TIFE++ +AG SF
Sbjct  113   EEFAVFDRWFASVPSSTQPNRLYVHSATSHGATSNIASMLAKGYPQRTIFENIYDAGLSF  172

Query  643   GIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQRYFDLKILPGN  822
             GIYYQ  P+TLFYRNLRKLKY+ +FH +D+ FK    +G LPNY V+EQRY D K  P N
Sbjct  173   GIYYQNIPATLFYRNLRKLKYLTHFHSYDLKFKDQASKGSLPNYAVIEQRYLDSKSKPAN  232

Query  823   DDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTPVTGVPNPDGL  1002
             DDHPSHDV++GQ FVKEVYE LRSSPQWN+ L +I YDEHGGF+DHVPTPV GVP+PDG+
Sbjct  233   DDHPSHDVYQGQMFVKEVYETLRSSPQWNQTLLIITYDEHGGFFDHVPTPVRGVPSPDGI  292

Query  1003  IGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSIPATVKKIFNL  1179
             +GP P++F FDRLGVRVP +MVSPWI++G V+HGPSG P P SEYEHSSIPATVKKIF+L
Sbjct  293   VGPDPFDFTFDRLGVRVPTVMVSPWIDKGTVIHGPSGVPSPTSEYEHSSIPATVKKIFDL  352

Query  1180  -NQFLTERDAWAGTFE-TVITRTTPRKDCPETLAEPVKLRSAEAKEDANLTEYQKEMVQM  1353
              + +LT+RDAWAGTFE  V++RT PR DCP  L  PVK+RS EA EDA L+E+Q E++Q+
Sbjct  353   PSPYLTKRDAWAGTFEGIVLSRTEPRTDCPAQLPTPVKIRSGEANEDAKLSEFQGELMQL  412

Query  1354  AAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGDYSVV---  1524
             A+VL GDH+    +  K+++ M+V +   Y   A  +F     +A++ G+  +  V    
Sbjct  413   ASVLNGDHLLTS-FEEKILKQMNVREGIAYMENAVRRFFEAGMSAKKMGVDQEQIVKMRP  471

Query  1525  ALSKQPPSPNTTP  1563
             +L+ +  SP   P
Sbjct  472   SLTTRSSSPTAQP  484



>ref|XP_010269437.1| PREDICTED: non-specific phospholipase C2-like [Nelumbo nucifera]
Length=505

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/480 (61%), Positives = 361/480 (75%), Gaps = 15/480 (3%)
 Frame = +1

Query  79    KTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQY  258
             KT+VVLV ENRSFDHMLGWMK +NP+INGV G ESN L T+    +  +    F ++S Y
Sbjct  12    KTLVVLVMENRSFDHMLGWMKRINPQINGVDGTESNLLSTT----DPNSPRFFFKDQSHY  67

Query  259   VDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFA--ANAERNQAGMSGAVMNGFVP  432
             VDPDPGHS Q I EQIFG   S D++   + P M GFA  A A  N   MS +VMNGF P
Sbjct  68    VDPDPGHSFQAIREQIFG---SNDTSA--VPPPMNGFAQQAFAMTNSTNMSESVMNGFNP  122

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             + V VYK LV EFAV DRWFA+VP+STQPNRLFVHSATS GATSN+   LI+G+PQ+TIF
Sbjct  123   DMVAVYKSLVTEFAVFDRWFAAVPSSTQPNRLFVHSATSGGATSNNPSLLIKGYPQRTIF  182

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             E++ +AG SFGIY+Q  P+TLFYRNLRKLKY+  FH +D+ FK+H K GKLPNYVV+EQR
Sbjct  183   ENIHDAGLSFGIYFQNIPATLFYRNLRKLKYLTKFHPYDLFFKSHAKAGKLPNYVVIEQR  242

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K+ P NDDHPSHDV++GQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHVPTP
Sbjct  243   YIDTKLWPANDDHPSHDVYQGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVPTP  302

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             VTGVP+PDG++GP+P+ F+FDRLGVRVP IMVSPWIE+G V+HGP+G PF  SE+EHSSI
Sbjct  303   VTGVPSPDGIVGPEPFLFRFDRLGVRVPTIMVSPWIEKGTVVHGPNGFPFSTSEFEHSSI  362

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKK+FNL + FLT RD WAGTFE ++ TRT PR DCPE L  PVK+R     ++A  
Sbjct  363   PATVKKLFNLPSPFLTRRDEWAGTFEGIVQTRTEPRTDCPEQLPTPVKIRQGGPNKNATP  422

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E++Q+AAVL G+H+   Y  H + + M+V +   Y   A   F     +A+  G+
Sbjct  423   SEFQQELLQLAAVLKGEHILPTYLEH-IGKQMTVKEGKKYMDDAVKSFFEAGFSAKGMGV  481



>ref|XP_002276163.1| PREDICTED: non-specific phospholipase C2 [Vitis vinifera]
Length=516

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/503 (59%), Positives = 366/503 (73%), Gaps = 20/503 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGWMK +NP+INGV G E NP+  S    + T+ +V F N S
Sbjct  31    PIKTIVVLVMENRSFDHMLGWMKQINPQINGVDGSEYNPISPS----DPTSPLVFFTNTS  86

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVD DP HS Q I EQIFG+    D+A     P M GFA  A    A     VM+GF P
Sbjct  87    HYVDADPPHSFQAIREQIFGS----DNASAD-HPPMNGFAQQATTTSAA-PQTVMSGFDP  140

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
               V VYK LV EFAV DRWFASVPASTQPNRLFVHSATS GAT N    L +G+PQ+TIF
Sbjct  141   SMVAVYKTLVSEFAVFDRWFASVPASTQPNRLFVHSATSAGATGNIPTMLAKGYPQRTIF  200

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +++D AG  FGIYYQ  P+TLFY++LRKLKY+  FH + + F+ H +EGKLP Y V+EQR
Sbjct  201   DNLDAAGVPFGIYYQNIPATLFYQSLRKLKYLDKFHFYGLSFERHAREGKLPGYTVIEQR  260

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K+ PGNDDHPSHDV+EGQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHVPTP
Sbjct  261   YMDTKVEPGNDDHPSHDVYEGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVPTP  320

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             V GVP+PDG+ GP+P+ F FDRLGVRVP IMVSPWI++G V+HGP+G PFP SEYEHSSI
Sbjct  321   VRGVPSPDGIAGPEPFLFGFDRLGVRVPTIMVSPWIDKGTVVHGPNGSPFPTSEYEHSSI  380

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIFNL+  FLT+RD WAGTFE ++ TRT PR DCPE L +P+++R  EA E A L
Sbjct  381   PATVKKIFNLSSPFLTKRDEWAGTFEGIVQTRTQPRTDCPEQLPKPMRMRKGEANESAKL  440

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E++Q+AAVL GD++    YP K+ + M+V +   Y   A  +FL    +A++ G+
Sbjct  441   SEFQEELLQLAAVLKGDNILTS-YPEKIGKQMNVKQGKKYMEDAVKQFLEAGLSAKRMGV  499

Query  1504  HGDYSVVALSKQPPSPNTTPRKP  1572
             + +  +V +      P+ T R P
Sbjct  500   NEE-QIVKM-----RPSLTTRSP  516



>emb|CBI24244.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/503 (59%), Positives = 366/503 (73%), Gaps = 20/503 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGWMK +NP+INGV G E NP+  S    + T+ +V F N S
Sbjct  22    PIKTIVVLVMENRSFDHMLGWMKQINPQINGVDGSEYNPISPS----DPTSPLVFFTNTS  77

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVD DP HS Q I EQIFG+    D+A     P M GFA  A    A     VM+GF P
Sbjct  78    HYVDADPPHSFQAIREQIFGS----DNASAD-HPPMNGFAQQATTTSAA-PQTVMSGFDP  131

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
               V VYK LV EFAV DRWFASVPASTQPNRLFVHSATS GAT N    L +G+PQ+TIF
Sbjct  132   SMVAVYKTLVSEFAVFDRWFASVPASTQPNRLFVHSATSAGATGNIPTMLAKGYPQRTIF  191

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +++D AG  FGIYYQ  P+TLFY++LRKLKY+  FH + + F+ H +EGKLP Y V+EQR
Sbjct  192   DNLDAAGVPFGIYYQNIPATLFYQSLRKLKYLDKFHFYGLSFERHAREGKLPGYTVIEQR  251

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K+ PGNDDHPSHDV+EGQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHVPTP
Sbjct  252   YMDTKVEPGNDDHPSHDVYEGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVPTP  311

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             V GVP+PDG+ GP+P+ F FDRLGVRVP IMVSPWI++G V+HGP+G PFP SEYEHSSI
Sbjct  312   VRGVPSPDGIAGPEPFLFGFDRLGVRVPTIMVSPWIDKGTVVHGPNGSPFPTSEYEHSSI  371

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIFNL+  FLT+RD WAGTFE ++ TRT PR DCPE L +P+++R  EA E A L
Sbjct  372   PATVKKIFNLSSPFLTKRDEWAGTFEGIVQTRTQPRTDCPEQLPKPMRMRKGEANESAKL  431

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E++Q+AAVL GD++    YP K+ + M+V +   Y   A  +FL    +A++ G+
Sbjct  432   SEFQEELLQLAAVLKGDNILTS-YPEKIGKQMNVKQGKKYMEDAVKQFLEAGLSAKRMGV  490

Query  1504  HGDYSVVALSKQPPSPNTTPRKP  1572
             + +  +V +      P+ T R P
Sbjct  491   NEE-QIVKM-----RPSLTTRSP  507



>gb|KDO54822.1| hypothetical protein CISIN_1g009936mg [Citrus sinensis]
Length=522

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/507 (59%), Positives = 367/507 (72%), Gaps = 21/507 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHM+GWMK LNPEINGV G E NPL T+    +  +    F N++
Sbjct  27    PIKTIVVLVMENRSFDHMIGWMKKLNPEINGVDGSEWNPLSTT----DPKSQRFFFKNQA  82

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN--QAGMSGAVMNGF  426
             Q+VDPDPGHS Q I EQIFG   S D++     P M GFA  A        MS  VMNGF
Sbjct  83    QFVDPDPGHSFQAIREQIFG---SNDTSSD--HPPMNGFAQQAFSMDPSLNMSHNVMNGF  137

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAV DRWFASVP+STQPNRL+VHS TS GATSN   KL +G+PQ+T
Sbjct  138   EPDMVAVYKTLVSEFAVFDRWFASVPSSTQPNRLYVHSGTSAGATSNIPAKLAKGYPQRT  197

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  P+TLFYRNLRK+KY   FH +   FK   ++GKLP YVVVE
Sbjct  198   IFENLDDAGISFGIYYQNIPATLFYRNLRKIKYWGKFHPYGTSFKKDARDGKLPGYVVVE  257

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K  PGNDDHPSHDV++GQ  VKEVYE LR+SPQWNE LF+I YDEHGGFYDHV 
Sbjct  258   QRYTDTKSEPGNDDHPSHDVYQGQVLVKEVYETLRASPQWNETLFVITYDEHGGFYDHVT  317

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP+P+ F+FDRLGVRVP I +SPWIE+G V+HGP+G PF  SE+EHS
Sbjct  318   TPVRGVPSPDGIVGPEPFLFKFDRLGVRVPTIAISPWIEKGTVVHGPNGSPFATSEFEHS  377

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RDAWAGTFE ++ TRT PR DCPE L  P K+R  EA E+A
Sbjct  378   SIPATVKKLFNLSAPFLTKRDAWAGTFEGIVQTRTAPRTDCPEQLPTPTKIRQGEANENA  437

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+E++Q+AAVL GDH+    +P  + ++M+V +  +Y   A  +F      A + 
Sbjct  438   KLSEFQQELMQLAAVLKGDHVLTS-FPDNIGKDMTVKEGKEYMEDAVKRFFDAGLQALKM  496

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKS  1578
             G+  D   +   K    P+ T R P++
Sbjct  497   GV--DVEQIVQMK----PSLTTRSPRT  517



>ref|XP_002298470.1| phosphoesterase family protein [Populus trichocarpa]
 gb|EEE83275.1| phosphoesterase family protein [Populus trichocarpa]
Length=527

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/506 (59%), Positives = 363/506 (72%), Gaps = 18/506 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIK+VVVLV ENRSFDHMLGWMK +NPEINGV G + NPL       +  +    F N++
Sbjct  33    PIKSVVVLVMENRSFDHMLGWMKKINPEINGVDGTQWNPL----NITDPNSPKFFFNNQA  88

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
             QYVDPDPGHS Q I EQIFG   S+D++  K  P M GFA  A        MS  VMNGF
Sbjct  89    QYVDPDPGHSFQAIREQIFG---SEDTS--KNPPPMNGFAQQAFSMDPSTNMSRDVMNGF  143

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ + VY+ LV EFAV DRWFASVP+STQPNRLFVHS TS GATSN    L +G+PQ+T
Sbjct  144   EPDMLAVYRALVSEFAVFDRWFASVPSSTQPNRLFVHSGTSAGATSNIPAMLAKGYPQRT  203

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG S+GIYYQ  P+TLFYRNLRK+KY   FH +D  FK    +GKLP YVV+E
Sbjct  204   IFENLDDAGISWGIYYQNIPATLFYRNLRKVKYTSRFHPYDSSFKKDAGKGKLPGYVVIE  263

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY DLK  P NDDHPSHDV+ GQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHV 
Sbjct  264   QRYTDLKTAPANDDHPSHDVYRGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVA  323

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP P+ F+FDRLGVRVP+IMVSPWIE+G V+HGP+G PFP SEYEHS
Sbjct  324   TPVIGVPSPDGIVGPAPFFFKFDRLGVRVPSIMVSPWIEKGTVVHGPNGSPFPTSEYEHS  383

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SIPATVKK+FN+  FLT+RD WAGTFE ++ TRT PR DCPE L  P ++R +E  EDA 
Sbjct  384   SIPATVKKLFNMTTFLTKRDEWAGTFEGIVQTRTEPRTDCPEQLPIPTRIRKSEPNEDAK  443

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             LTE+Q+E++Q+AAVL G+     Y   K+ + M+V +  DY   A  +FL    +A + G
Sbjct  444   LTEFQQELLQLAAVLKGEDTLTSYL-EKIGKEMTVKQGNDYMEDAVKRFLEAGLHATRMG  502

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKS  1578
             +  +  V    +  PS  T   KP +
Sbjct  503   VDEEQIV----QMRPSLTTRTSKPTT  524



>ref|XP_006446285.1| hypothetical protein CICLE_v10014860mg [Citrus clementina]
 gb|ESR59525.1| hypothetical protein CICLE_v10014860mg [Citrus clementina]
Length=533

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/507 (59%), Positives = 367/507 (72%), Gaps = 21/507 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHM+GWMK LNPEINGV G E NPL T+    +  +    F N++
Sbjct  38    PIKTIVVLVMENRSFDHMIGWMKKLNPEINGVDGSEWNPLSTT----DPKSQRFFFKNQA  93

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN--QAGMSGAVMNGF  426
             Q+VDPDPGHS Q I EQIFG   S D++     P M GFA  A        MS  VMNGF
Sbjct  94    QFVDPDPGHSFQAIREQIFG---SNDTSSD--HPPMNGFAQQAFSMDPSLNMSHNVMNGF  148

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAV DRWFASVP+STQPNRL+VHS TS GATSN   KL +G+PQ+T
Sbjct  149   EPDMVAVYKTLVSEFAVFDRWFASVPSSTQPNRLYVHSGTSVGATSNIPAKLAKGYPQRT  208

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SFGIYYQ  P+TLFYRNLRK+KY   FH +   FK   ++GKLP YVVVE
Sbjct  209   IFENLDDAGISFGIYYQNIPATLFYRNLRKIKYWGKFHPYGTSFKKDARDGKLPGYVVVE  268

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K  PGNDDHPSHDV++GQ  VKEVYE LR+SPQWNE LF+I YDEHGGFYDHV 
Sbjct  269   QRYTDTKSEPGNDDHPSHDVYQGQVLVKEVYETLRASPQWNETLFVITYDEHGGFYDHVT  328

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP+P+ F+FDRLGVRVP I +SPWIE+G V+HGP+G PF  SE+EHS
Sbjct  329   TPVRGVPSPDGIVGPEPFLFKFDRLGVRVPTIAISPWIEKGTVVHGPNGSPFATSEFEHS  388

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RDAWAGTFE ++ TRT PR DCPE L  P K+R  EA E+A
Sbjct  389   SIPATVKKLFNLSAPFLTKRDAWAGTFEGIVQTRTAPRTDCPEQLPTPTKIRQGEANENA  448

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q+E++Q+AAVL GDH+    +P  + ++M+V +  +Y   A  +F      A + 
Sbjct  449   KLSEFQQELMQLAAVLKGDHVLTS-FPDNIGKDMTVKEGKEYMEDAVKRFFDAGLQALKM  507

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKS  1578
             G+  D   +   K    P+ T R P++
Sbjct  508   GV--DVEQIVQMK----PSLTTRSPRT  528



>ref|XP_010473071.1| PREDICTED: non-specific phospholipase C2 [Camelina sativa]
Length=518

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/505 (59%), Positives = 366/505 (72%), Gaps = 21/505 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGWMK LNPEINGV G ESNP+     A + ++  + FG+ S
Sbjct  30    PIKTIVVVVMENRSFDHMLGWMKKLNPEINGVDGSESNPV----SASDPSSKKIKFGSGS  85

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQ+FG   S D+      P M GF   A  E     MS +VMNGF
Sbjct  86    HYVDPDPGHSFQAIREQVFG---SNDTTMDP--PPMNGFVQQAYSEDPSGNMSASVMNGF  140

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYK LV EFAV DRWFASVP+STQPNR+FVHSATS GATSND   L +G+PQ+T
Sbjct  141   EPDKVPVYKSLVSEFAVFDRWFASVPSSTQPNRMFVHSATSAGATSNDPLSLAKGYPQRT  200

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+++D+   SFGIYYQ  P+ LFYR LRKLKY+  FH + + FK H K+GKLP Y V+E
Sbjct  201   IFDNLDDEDISFGIYYQNIPAVLFYRGLRKLKYVSKFHSYGLSFKDHAKKGKLPAYTVIE  260

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D    P +DDHPSHDV++GQKF+KEVYE LR+SPQWNE L +I YDEHGG++DHVP
Sbjct  261   QRYMDTISEPASDDHPSHDVYQGQKFIKEVYETLRASPQWNESLLIITYDEHGGYFDHVP  320

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++G +P+ FQF+RLG+RVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  321   TPVRKVPSPDGIVGQEPFLFQFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  380

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL++ FLT+RD WAGTFE ++  R  PR DCPETL EPV++R  EA E A
Sbjct  381   SIPATVKKLFNLSKPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVRIRMGEANEKA  440

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              LTE+Q+E+VQ+AAVL GD+M    +P ++ + M+V +   Y   A  +FL    +A   
Sbjct  441   LLTEFQQELVQLAAVLKGDNMLTT-FPKEISKGMTVIEGKRYMEDAVKRFLEAGRSALAM  499

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKP  1572
             G + +  V         P+ T RKP
Sbjct  500   GANQEELVHM------KPSLTKRKP  518



>ref|XP_010673757.1| PREDICTED: non-specific phospholipase C2 [Beta vulgaris subsp. 
vulgaris]
Length=532

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/514 (59%), Positives = 368/514 (72%), Gaps = 21/514 (4%)
 Frame = +1

Query  46    SEISDGSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTN  225
             S +  GS  PIKTVV+LV ENRSFDHMLGWMK LNPEINGV G ESNP+  S       +
Sbjct  27    SLLIHGSPNPIKTVVILVMENRSFDHMLGWMKKLNPEINGVNGSESNPVSLS----KPDS  82

Query  226   DVVLFGNKSQYV-DPDPGHSIQDIYEQIFGAPWSQDSAGKKLEP-TMQGFAANAERNQAG  399
              ++ + + + YV DPDPGHS Q I EQIFG+    D  G   EP +M GFA  A      
Sbjct  83    PLIFYNDTAHYVVDPDPGHSFQAIREQIFGS----DQTGS--EPASMNGFAQQAYAINGS  136

Query  400   MSGA--VMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDT  573
             M  A  VMNG+ PE VPVY+ LV+ FAV DRWFASVP+STQPNRLFVHSATS GATSN  
Sbjct  137   MEMARHVMNGYKPELVPVYQALVQNFAVFDRWFASVPSSTQPNRLFVHSATSAGATSNIP  196

Query  574   KKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCK  753
               L +G+PQ+TIF+++D  G SFGIYYQ  P+TLFYRNLRKLKYI  F  + I FK H +
Sbjct  197   ALLAKGYPQRTIFDNLDSEGKSFGIYYQNIPATLFYRNLRKLKYITKFLPYGIFFKRHAR  256

Query  754   EGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIY  933
             EGKLP+YVVVEQRY D K  P NDDHPSHDV++GQ FVKEVYE LR+SPQWNE LFLI Y
Sbjct  257   EGKLPSYVVVEQRYTDTKADPANDDHPSHDVYQGQLFVKEVYETLRASPQWNETLFLITY  316

Query  934   DEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG  1113
             DEHGGFYDHVPTPV GVP+PDG++GP+P+ F+FDRLGVRVP I +SPWIE+G V+H   G
Sbjct  317   DEHGGFYDHVPTPVNGVPSPDGIVGPEPFLFKFDRLGVRVPTIAISPWIEKGTVVHKAQG  376

Query  1114  PFPNSEYEHSSIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK  1287
             P+P SEYEHSSI ATVKK+FN++  FLT RDAWAGTFE ++ TRT PR DCP  L  PV+
Sbjct  377   PYPTSEYEHSSIAATVKKLFNMSSPFLTNRDAWAGTFEAIVETRTEPRTDCPVQLPTPVQ  436

Query  1288  LRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKF  1467
             +R  EA E+  L+E+Q+E++ +AAVL GD++    YP K+ + ++V +  +Y   A  +F
Sbjct  437   IRKGEADENRLLSEFQQELMHLAAVLKGDNILSS-YPEKIAKGLTVKQGKEYMEEAVKRF  495

Query  1468  LGDCENARQRGIHGDYSVVALSKQPPSPNTTPRK  1569
                   A++ G+H +  V    K  PS  + P K
Sbjct  496   FEAGRLAKELGVHEEQIV----KMRPSLTSRPTK  525



>ref|XP_010031720.1| PREDICTED: non-specific phospholipase C2-like [Eucalyptus grandis]
 gb|KCW51087.1| hypothetical protein EUGRSUZ_J00692 [Eucalyptus grandis]
Length=529

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/505 (60%), Positives = 360/505 (71%), Gaps = 19/505 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNP I+GV G ESNPL TS    +  +    F ++S
Sbjct  39    PIKTVVVLVMENRSFDHMLGWMKRLNPAIDGVDGSESNPLSTS----DPKSTRFHFDDRS  94

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN--QAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S D++     P MQGFA  A        MS +VM+GF
Sbjct  95    HYVDPDPGHSFQAIREQIFG---SNDTSADP--PPMQGFAQQAYSMDPSMNMSRSVMSGF  149

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAV DRWFASVP+STQPNRL+VHS TS GATSN    L  G+PQ+T
Sbjct  150   HPDMVAVYKALVSEFAVFDRWFASVPSSTQPNRLYVHSGTSGGATSNIPALLALGYPQRT  209

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE++D+AG SF IYYQ  P+TLFYRNLRKLKY+  F  +   F    ++G LPNY V+E
Sbjct  210   IFENLDDAGLSFRIYYQNIPATLFYRNLRKLKYVPKFRSYSASFAADARQGNLPNYAVIE  269

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K  P  DDHPSHDV++GQ FVKEVYE LR+SPQWN+ L LI YDEHGGF+DHVP
Sbjct  270   QRYMDTKEEPATDDHPSHDVYQGQMFVKEVYETLRASPQWNQTLLLITYDEHGGFFDHVP  329

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP+P+NF F+RLGVRVP I  SPWIE+G V+HGP+G PFP SEYEHS
Sbjct  330   TPVRGVPSPDGIVGPEPFNFTFNRLGVRVPTIAASPWIEKGTVVHGPNGSPFPTSEYEHS  389

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RDAWAGTFE ++ TRT PR DCPE L  PVK+R  EA EDA
Sbjct  390   SIPATVKKLFNLSAPFLTKRDAWAGTFEGIVQTRTEPRTDCPEKLPTPVKIRKGEANEDA  449

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
               +E+Q+E++Q+AAVL GDH+    YP +  + M+V +  +Y   A   F      A++ 
Sbjct  450   KPSEFQQELLQLAAVLKGDHIFTS-YPERFGKEMTVKEGKEYMEDAVKSFFEASLYAKKM  508

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKP  1572
             G+  +  V    K  PS  T P KP
Sbjct  509   GVDREQIV----KMRPSLTTRPSKP  529



>ref|XP_010557451.1| PREDICTED: non-specific phospholipase C2 [Tarenaya hassleriana]
Length=519

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/482 (61%), Positives = 354/482 (73%), Gaps = 17/482 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNPEINGV G E N         +  +  + FG+ S
Sbjct  24    PIKTVVVLVMENRSFDHMLGWMKKLNPEINGVDGSEWN----RESVADPNSKQIFFGSGS  79

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQ--AGMSGAVMNGF  426
              YVDPDPGHS Q I EQ+FG      S   K  P M+GFA  A        MS +VMNGF
Sbjct  80    HYVDPDPGHSFQAIREQVFG------SDDTKAPPEMKGFAQQALSMDPTGSMSASVMNGF  133

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
             +P+ VPV++ LV EFA+ DRWFAS+P STQPNR++VH+ATS GATSN   KL +G+PQ+T
Sbjct  134   LPDKVPVFQSLVSEFALFDRWFASIPTSTQPNRMYVHAATSSGATSNLGWKLAKGYPQRT  193

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE+++E G SFGIY+Q  PSTL Y+ LRKLKY+  F  +   FK H +EGKLPNY VVE
Sbjct  194   IFENLEEDGLSFGIYFQNIPSTLIYQKLRKLKYVFKFKPYG-SFKDHAREGKLPNYAVVE  252

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFDL + P NDDHPSHDV+ GQ  VKEVYE LR+SPQWNE L LI YDEHGGF+DHVP
Sbjct  253   QRYFDLALAPANDDHPSHDVYNGQMLVKEVYETLRASPQWNETLLLITYDEHGGFFDHVP  312

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PD ++GP+P+ F+FDRLGVRVP I VSPWIE+G V+HGP+G P P SEYEHS
Sbjct  313   TPVNGVPSPDDIVGPEPFFFRFDRLGVRVPTIAVSPWIEKGTVVHGPNGLPTPTSEYEHS  372

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKKIFNL+  FLT+RDAWAGTFE +++ RT PR DCPE L EPV++R  EAKEDA
Sbjct  373   SIPATVKKIFNLSSPFLTKRDAWAGTFEHILSVRTEPRTDCPEKLPEPVRIRKGEAKEDA  432

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              LTE+Q+E++Q+AAVL GDH+    +P +  +NM+V +   Y   A  +F      A + 
Sbjct  433   KLTEFQRELIQLAAVLKGDHVLST-FPEETGKNMTVREGKMYMDEAVKRFFEAGRLALRM  491

Query  1498  GI  1503
             G+
Sbjct  492   GV  493



>ref|XP_006293962.1| hypothetical protein CARUB_v10022952mg, partial [Capsella rubella]
 gb|EOA26860.1| hypothetical protein CARUB_v10022952mg, partial [Capsella rubella]
Length=539

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 353/471 (75%), Gaps = 15/471 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGWMK LNP+INGV G ESNP+  S  +    N    FG+ S
Sbjct  51    PIKTIVVVVMENRSFDHMLGWMKKLNPDINGVDGSESNPVSASDPSSKKIN----FGSGS  106

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQ+FG   S D+      P M GF   A  E     MS +VMNGF
Sbjct  107   HYVDPDPGHSFQAIREQVFG---SNDTTMDP--PPMNGFVQQAYSEDPSGNMSASVMNGF  161

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VP+YK LV EFAV DRWFASVP+STQPNR+FVHS TS GATSN+  +L +G+PQ+T
Sbjct  162   EPDKVPIYKSLVSEFAVFDRWFASVPSSTQPNRMFVHSGTSAGATSNNPVELAKGYPQRT  221

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+++D+   SFGIYYQ  P+ LFYR+LRKLKY+ NFH + + FK H ++GKLP Y V+E
Sbjct  222   IFDNLDDEDISFGIYYQNIPAVLFYRSLRKLKYVFNFHSYGLSFKDHAEKGKLPAYTVIE  281

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D    P +DDHPSHDV++GQKF+KEVYE LR+SPQWNE L LI YDEHGG++DHVP
Sbjct  282   QRYMDTISEPASDDHPSHDVYQGQKFIKEVYETLRASPQWNETLLLITYDEHGGYFDHVP  341

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  +P+PDG++GP+P+ FQF+RLG+RVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  342   TPVRNIPSPDGIVGPEPFLFQFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  401

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL   FLT+RD WAGTFE ++  R  PR DCPETL EPVK+R  EA E A
Sbjct  402   SIPATVKKLFNLTSPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVKIRMGEANEKA  461

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
              LTE+Q+E+VQ+AAVL GD+M    +P ++ + M+V +   Y   A  +FL
Sbjct  462   LLTEFQQELVQLAAVLKGDNMLTT-FPREISKGMTVIEGKRYMEDAMKRFL  511



>ref|XP_006408611.1| hypothetical protein EUTSA_v10001963mg [Eutrema salsugineum]
 gb|ESQ50064.1| hypothetical protein EUTSA_v10001963mg [Eutrema salsugineum]
Length=519

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/471 (61%), Positives = 354/471 (75%), Gaps = 15/471 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGWMK LNPEINGV G ESNP+  S    + ++  + FG+ S
Sbjct  31    PIKTIVVLVMENRSFDHMLGWMKKLNPEINGVDGSESNPVSVS----DPSSKKIQFGSGS  86

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S D++     P M GF   A  E     M+ +VMNGF
Sbjct  87    HYVDPDPGHSFQAIREQIFG---SNDTSMDP--PPMNGFVQQAYSEDPTGNMAASVMNGF  141

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYK LV EFAV DRWFASVP+STQPNR+FVHS TS GATSN+   L +G+PQ+T
Sbjct  142   EPDKVPVYKSLVSEFAVFDRWFASVPSSTQPNRMFVHSGTSGGATSNNPMLLAKGYPQRT  201

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+++D+   SFGIYYQ  P+ LFYRNLRKLKYI  FH + + FK H K+GKLP+Y V+E
Sbjct  202   IFDNLDQDDISFGIYYQNVPAVLFYRNLRKLKYIPKFHSYALSFKDHAKKGKLPSYAVIE  261

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D    P  DDHPSHDV++GQKF+KEVYE LR+SPQWNE L +I YDEHGG++DHVP
Sbjct  262   QRYMDTIFEPATDDHPSHDVYQGQKFIKEVYETLRASPQWNETLLMITYDEHGGYFDHVP  321

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++G +P+ FQF+RLG+RVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  322   TPVRNVPSPDGIVGQEPFLFQFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  381

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAGTFE ++  R  PR DCPETL EPVK+R  EA E+A
Sbjct  382   SIPATVKKLFNLSTPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVKIRMTEANENA  441

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
              L+E+Q+E+VQ+AAVL GD +    YP ++ + M+V +   Y   A  +FL
Sbjct  442   KLSEFQQELVQLAAVLKGDDVLTT-YPKEIGKGMTVIQGKRYMEDAVKRFL  491



>ref|XP_010417832.1| PREDICTED: non-specific phospholipase C2-like [Camelina sativa]
Length=518

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/481 (60%), Positives = 357/481 (74%), Gaps = 15/481 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGWMK LNPEINGV G ESNP+     A + ++  + FG+ S
Sbjct  30    PIKTIVVVVMENRSFDHMLGWMKKLNPEINGVDGSESNPV----SASDPSSKKIKFGSGS  85

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQ+FG   S D+      P M GF   A  E     MS +VMNGF
Sbjct  86    HYVDPDPGHSFQAIREQVFG---SNDTTMDP--PPMNGFVQQAYSEDPSGNMSSSVMNGF  140

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYK LV EFAV DRWFASVP+STQPNR+FVHSATS GATSND   L +G+PQ+T
Sbjct  141   EPDKVPVYKSLVSEFAVFDRWFASVPSSTQPNRMFVHSATSAGATSNDPLSLAKGYPQRT  200

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+++D+   SFGIYYQ  P+ LFYR LRKLKY+  FH + + FK H ++GKLP Y V+E
Sbjct  201   IFDNLDDEDISFGIYYQNIPAVLFYRRLRKLKYVFKFHSYGLSFKDHAEKGKLPAYTVIE  260

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D K  P +DDHPSHDV++GQKF+KEVYE LR+SPQWNE L +I YDEHGG++DHV 
Sbjct  261   QRYMDTKSEPASDDHPSHDVYQGQKFIKEVYEILRASPQWNESLLIITYDEHGGYFDHVS  320

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++G +P+ FQF+RLG+RVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  321   TPVRNVPSPDGIVGQEPFLFQFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  380

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAGTFE ++  R  PR DCPETL EPV++R  EA E A
Sbjct  381   SIPATVKKLFNLSTPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVRIRMGEANEKA  440

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              LTE+Q+E+VQ+AAVL GD+M    +P ++ + M+V +   Y   A  +FLG   +A   
Sbjct  441   LLTEFQQELVQLAAVLKGDNMLTT-FPKEISKGMTVIEGKRYMEDAVKRFLGAGRSALAM  499

Query  1498  G  1500
             G
Sbjct  500   G  500



>ref|XP_002880842.1| phosphoesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57101.1| phosphoesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 354/471 (75%), Gaps = 15/471 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGWMK LNPEINGV G ESNP+     A + ++  + FG+ S
Sbjct  26    PIKTIVVVVMENRSFDHMLGWMKKLNPEINGVDGSESNPV----SASDPSSKKIKFGSGS  81

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQ+FG   S D++     P M GF   A  E     MS +VMNGF
Sbjct  82    HYVDPDPGHSFQAIREQVFG---SNDTSMDP--PPMNGFVQQAYSEDPSGNMSASVMNGF  136

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYK LV EFAV DRWFASVP+STQPNR+FVHS TS GATSN+   L +G+PQ+T
Sbjct  137   EPDKVPVYKSLVSEFAVFDRWFASVPSSTQPNRMFVHSGTSAGATSNNPISLAKGYPQRT  196

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+++D+  +SFGIYYQ  P+ LFY++LRKLKY+  FH +   FK H K GKLP Y V+E
Sbjct  197   IFDNLDDEEFSFGIYYQNIPAVLFYQSLRKLKYVLKFHSYGNSFKDHAKNGKLPAYTVIE  256

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D  + P +DDHPSHDV++GQKF+KEVYE LR+SPQWNE L +I YDEHGG++DHVP
Sbjct  257   QRYMDTLLEPASDDHPSHDVYQGQKFIKEVYETLRASPQWNETLLIITYDEHGGYFDHVP  316

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++GP P+ FQF+RLG+RVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  317   TPVRNVPSPDGIVGPDPFLFQFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  376

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAGTFE ++  R  PR DCPETL EPVK+R  EA E A
Sbjct  377   SIPATVKKLFNLSSPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVKIRMGEANEKA  436

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
              LTE+Q+E+VQ+AAVL GD+M    +P ++ + M+V +   Y   A  +FL
Sbjct  437   LLTEFQQELVQLAAVLKGDNMLTT-FPKEISKGMTVIEGKRYMEDAMKRFL  486



>ref|NP_180255.1| non-specific phospholipase C2 [Arabidopsis thaliana]
 sp|O81020.1|NPC2_ARATH RecName: Full=Non-specific phospholipase C2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC32238.1| putative phospholipase C [Arabidopsis thaliana]
 dbj|BAC22507.1| phosphatidylglycerol specific phospholipase C [Arabidopsis thaliana]
 gb|AEC07902.1| non-specific phospholipase C2 [Arabidopsis thaliana]
Length=514

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/481 (60%), Positives = 357/481 (74%), Gaps = 15/481 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGWMK LNPEINGV G ESNP+  S    + ++  + FG+ S
Sbjct  26    PIKTIVVVVMENRSFDHMLGWMKKLNPEINGVDGSESNPVSVS----DPSSRKIKFGSGS  81

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQ+FG   S D++     P M GF   A  E     MS +VMNGF
Sbjct  82    HYVDPDPGHSFQAIREQVFG---SNDTSMDP--PPMNGFVQQAYSEDPSGNMSASVMNGF  136

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYK LV EFAV DRWFASVP+STQPNR+FVHS TS GATSN+   L +G+PQ+T
Sbjct  137   EPDKVPVYKSLVSEFAVFDRWFASVPSSTQPNRMFVHSGTSAGATSNNPISLAKGYPQRT  196

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+++D+  +SFGIYYQ  P+ LFY++LRKLKY+  FH +   FK H K+GKLP Y V+E
Sbjct  197   IFDNLDDEEFSFGIYYQNIPAVLFYQSLRKLKYVFKFHSYGNSFKDHAKQGKLPAYTVIE  256

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D  + P +DDHPSHDV++GQKF+KEVYE LR+SPQWNE L +I YDEHGG++DHVP
Sbjct  257   QRYMDTLLEPASDDHPSHDVYQGQKFIKEVYETLRASPQWNETLLIITYDEHGGYFDHVP  316

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++GP P+ FQF+RLG+RVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  317   TPVRNVPSPDGIVGPDPFLFQFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  376

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAGTFE ++  R  PR DCPETL EPVK+R  EA E A
Sbjct  377   SIPATVKKLFNLSSPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVKIRMGEANEKA  436

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              LTE+Q+E+VQ+AAVL GD+M    +P ++ + M+V +   Y   A  +FL     A   
Sbjct  437   LLTEFQQELVQLAAVLKGDNMLTT-FPKEISKGMTVIEGKRYMEDAMKRFLEAGRMALSM  495

Query  1498  G  1500
             G
Sbjct  496   G  496



>dbj|BAJ87922.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04785.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/490 (59%), Positives = 360/490 (73%), Gaps = 14/490 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK LNP I+GV G E NP   +  +  S+   V FG+ +
Sbjct  35    PIKTVVVVVMENRSFDHMLGWMKRLNPTIDGVTGAEWNP---ANASDPSSGRRVYFGDGA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAG-MSGAVMNGFV  429
             Q+VDPDPGHS Q+I +QIFG   S D++G    P M GF   A     G M+ AVMNGF 
Sbjct  92    QFVDPDPGHSYQEIRQQIFG---SDDASGP---PRMNGFVQQAASIGGGNMTDAVMNGFA  145

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P++V VY+ELV +FAVCDRWFASVP+STQPNRLFVHS TS GATSN+ + L  G+PQ+TI
Sbjct  146   PDSVAVYRELVSQFAVCDRWFASVPSSTQPNRLFVHSGTSGGATSNNPELLARGYPQRTI  205

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+++ +AG SFG+Y+Q  P+ LFYRNLRKLKYI NFH F   F+ H + G LPNY V+EQ
Sbjct  206   FDNVHDAGLSFGVYFQDVPAVLFYRNLRKLKYILNFHPFHNAFRDHARRGSLPNYAVIEQ  265

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
              Y D K  P NDDHPSHDV++GQ FVKE+YE LR+SPQWNE L ++ YDEHGGF+DHVPT
Sbjct  266   HYMDSKDHPANDDHPSHDVYQGQMFVKEIYETLRASPQWNETLMVLTYDEHGGFFDHVPT  325

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSS  1146
             PV GVP+PD ++GP PYNF F+RLGVRVPAI++SPWIE+G V+HGP+G P   S++EHSS
Sbjct  326   PVDGVPSPDDIVGPPPYNFTFNRLGVRVPAILISPWIEKGTVVHGPNGNPTSTSQFEHSS  385

Query  1147  IPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             IPATVKK+FNL Q FLT+RDAWAGTFE V+ TRT PR DCPE L  P ++R  EA E+A 
Sbjct  386   IPATVKKLFNLPQDFLTKRDAWAGTFEGVVQTRTEPRTDCPEQLPMPTRIRQTEANEEAK  445

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+ +Q+E+VQ+AAVL GDH        ++ E M+V +   Y   A  +F     +A++ G
Sbjct  446   LSSFQQEIVQLAAVLNGDHQLSSLQ-ERIRERMNVREGTSYMRSAVRRFFEAGMSAKRMG  504

Query  1501  IHGDYSVVAL  1530
             +  D  +V +
Sbjct  505   LADDEQIVKM  514



>ref|XP_008227281.1| PREDICTED: LOW QUALITY PROTEIN: non-specific phospholipase C2 
[Prunus mume]
Length=505

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/505 (60%), Positives = 362/505 (72%), Gaps = 32/505 (6%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGWMK +NPEINGV G E+NPL T+    +  +    F N+S
Sbjct  25    PIKTIVVIVMENRSFDHMLGWMKRINPEINGVDGSEANPLSTT----DPNSKRFFFKNES  80

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA--ERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S +++     P M GFA  A    N   MS  VMNGF
Sbjct  81    HYVDPDPGHSFQAIREQIFG---SDNTSADP--PPMNGFAQQAFSMDNTTNMSQDVMNGF  135

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V VYK LV EFAVCDRWFASVP+STQPNRL+VHS TS GATSN    L +G+PQ+T
Sbjct  136   NPDMVAVYKTLVSEFAVCDRWFASVPSSTQPNRLYVHSGTSAGATSNIPALLAKGYPQRT  195

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFES+D+AG SFGIYYQ  P+TLFYRNLRKLKYI  FH +D  FK+H K+GKLP Y VVE
Sbjct  196   IFESVDDAGISFGIYYQNIPATLFYRNLRKLKYISKFHMYDT-FKSHAKQGKLPGYTVVE  254

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD+KI P NDDHPSHDVF+GQ FVKEVYE LR+SPQWN+ L +I YDEHGGFYDHV 
Sbjct  255   QRYFDVKIAPANDDHPSHDVFQGQMFVKEVYETLRASPQWNDTLLIITYDEHGGFYDHVA  314

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV GVP+PDG++GP+P+ FQFDRLGVRVP IMVSPWIE+  VLHGP+G PFP SE+EHS
Sbjct  315   TPVHGVPSPDGIVGPEPFLFQFDRLGVRVPTIMVSPWIEKSTVLHGPNGSPFPTSEFEHS  374

Query  1144  SIPATVKKIFNLNQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             SIPATV+KIFNL+  LT+RD WAGTFE ++ TRT PR DCPE L  PVK+R++E KEDA 
Sbjct  375   SIPATVRKIFNLSAPLTKRDEWAGTFEGIVQTRTEPRTDCPEQLPTPVKIRTSEPKEDAK  434

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
                           L GD++    YP K  + M+V    +Y+  A  +F      A++ G
Sbjct  435   -------------XLKGDNIFTS-YPKKTGKEMTVKDGKEYADDAVKRFFEAGLYAKRMG  480

Query  1501  IHGDYSVV---ALSKQP-PSPNTTP  1563
             +  +  V    +L+ +P P  N TP
Sbjct  481   VSEEQIVQMRPSLTTRPSPIVNQTP  505



>ref|XP_002969128.1| hypothetical protein SELMODRAFT_90880 [Selaginella moellendorffii]
 gb|EFJ30244.1| hypothetical protein SELMODRAFT_90880 [Selaginella moellendorffii]
Length=519

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/487 (60%), Positives = 357/487 (73%), Gaps = 14/487 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGW+K LNPEI+G+ G ESNPL T+  A       +   + +
Sbjct  34    PIKTVVVLVMENRSFDHMLGWLKKLNPEIDGLQGNESNPLSTTDPASRK----IFVADTA  89

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             ++VDPDPGHS Q I EQ+FG   S D++   + P M GFA  AE    G S  VM GF P
Sbjct  90    EFVDPDPGHSFQAITEQVFG---SNDTSA--IPPPMNGFAQQAESMVEGFSETVMKGFRP  144

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E VPVY  L  EFAV DRWFAS P STQPNRL+VHSATS+G  SN  K L++GFPQKTI+
Sbjct  145   ELVPVYTALAMEFAVFDRWFASTPTSTQPNRLYVHSATSYGEISNVKKDLVKGFPQKTIY  204

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+ LF++NLRKLKY+  +H +   FK H + G LPN  V+EQR
Sbjct  205   DSLDEDGLSFGIYYQNIPACLFFKNLRKLKYLTKYHSYRAAFKLHARLGMLPNVAVIEQR  264

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFDL + P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHGGFYDHVPTP
Sbjct  265   YFDLDLTPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEVLFVITYDEHGGFYDHVPTP  324

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
               GVPNPDG++GP+P  F FDRLGVRVP IMVSPWIE+G V+H P+GP P S++EHSS+ 
Sbjct  325   NVGVPNPDGVLGPEPGFFDFDRLGVRVPTIMVSPWIEKGTVVHEPNGPTPTSQFEHSSLA  384

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETL-AEPVKLRSAEAKEDANL  1323
             AT+KK+F+L + FLT+RDAWAGTFE+V++ R++PR DCPETL   P  LR     EDA L
Sbjct  385   ATIKKLFDLKSDFLTKRDAWAGTFESVVSGRSSPRTDCPETLPTPPWSLRHRAVDEDAKL  444

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             TE+Q+E+VQ+A+ L GDH + + YP+   + MSV +A+DY   A  KFL +   A + G 
Sbjct  445   TEFQEELVQLASQLNGDH-RLNGYPN-FGKGMSVRQASDYVESAVRKFLDEGRLALKSGG  502

Query  1504  HGDYSVV  1524
               D + V
Sbjct  503   QADDTTV  509



>ref|XP_008220698.1| PREDICTED: non-specific phospholipase C1 [Prunus mume]
Length=535

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/480 (62%), Positives = 356/480 (74%), Gaps = 16/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGW+KS  PEI+G+ G ESNPL  S    NS    V   + +
Sbjct  38    PIKTVVVLVMENRSFDHMLGWLKSTRPEIDGLTGNESNPLSVSD--PNSLR--VPVSSDA  93

Query  253   QYVDPDPGHSIQDIYEQIFGAPWS-QDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
              ++D DPGHSIQ I EQIFG+  S +D A       M GFA  AE    GMS  VM+GF 
Sbjct  94    FFIDSDPGHSIQAIREQIFGSNRSFEDPA------PMNGFAQQAESMAEGMSSKVMSGFK  147

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +PVY EL  EFAV DRWFASVPASTQPNR +VHSATSHGA+SN  K LI GFPQKTI
Sbjct  148   PEVLPVYTELANEFAVFDRWFASVPASTQPNRFYVHSATSHGASSNVRKDLIHGFPQKTI  207

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+DE    FGIYYQ  P+TLF+R+LRKLK++  FH + + FK H K GKLPNY V+EQ
Sbjct  208   FDSLDENALDFGIYYQNIPATLFFRSLRKLKHVTKFHSYALKFKLHAKRGKLPNYAVIEQ  267

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+K LP NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVPT
Sbjct  268   RYFDVKELPANDDHPSHDVARGQRFVKEVYETLRASPQWKEMALLITYDEHGGFYDHVPT  327

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV+GVP+PDG++GP P+ F+FDRLGVRVP I+VSPWIE+G V+H P+GP P+S +EHSSI
Sbjct  328   PVSGVPSPDGIVGPDPFYFRFDRLGVRVPTILVSPWIEKGTVIHEPTGPTPDSHFEHSSI  387

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDAN  1320
             PATVKK+FNL + FLT+RDAWAGTFE     R+TPR DCPETL E  + LR    +ED +
Sbjct  388   PATVKKLFNLKSNFLTKRDAWAGTFENYFYLRSTPRDDCPETLPEVTMSLRPGGPQEDVS  447

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E++Q+A+ L GDH+  + YP+ + E+M VA+A  Y+  A  +FL     A + G
Sbjct  448   LSEFQVELIQLASQLNGDHVL-NTYPY-IGESMRVAEANRYAEDAVKRFLEAGRAALKAG  505



>ref|XP_004971305.1| PREDICTED: uncharacterized protein LOC101755304 [Setaria italica]
Length=525

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/502 (57%), Positives = 366/502 (73%), Gaps = 17/502 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK LNPEI+GV G E NP  T+          V FG  +
Sbjct  39    PIKTVVVVVMENRSFDHMLGWMKRLNPEIDGVTGAEWNPANTTDPGAGR----VYFGEGA  94

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             QYVDPDPGHS Q+I +QIFG   S D++G      M GF   A      M+ AVM+GF P
Sbjct  95    QYVDPDPGHSFQEIRQQIFG---SDDASGPA---RMDGFVQQARSLGGNMTDAVMHGFAP  148

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             ++V VY+ELV +FAVCDRWFASVP+STQPNRLFVHS TS GATSN+ + L +G+PQ+TIF
Sbjct  149   DSVAVYRELVAQFAVCDRWFASVPSSTQPNRLFVHSGTSGGATSNNPQLLAKGYPQRTIF  208

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +++ +AG SFG+Y+Q  P+ LFYRNLRKLKY+ +FH F   F+ H + G LPNY V+EQ 
Sbjct  209   DNIHDAGLSFGVYFQDVPAVLFYRNLRKLKYLLDFHPFHPTFRDHARRGSLPNYAVIEQH  268

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K+ P NDDHPSHDV++GQ FVKE+YE LR+SPQWN+ L ++ YDEHGGF+DHVPTP
Sbjct  269   YLDSKLDPANDDHPSHDVYQGQMFVKEIYETLRASPQWNQTLMVLTYDEHGGFFDHVPTP  328

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVP+PDG++GP PYNF FDRLGVRVPAI++SPWIE+G V+HGP+GP   S+YEHSSIP
Sbjct  329   VNGVPSPDGIVGPPPYNFTFDRLGVRVPAILISPWIEKGTVVHGPNGPTQTSQYEHSSIP  388

Query  1153  ATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANLT  1326
             ATVKK+F+L Q FLT+RDAWAGTFE+V+ TRT PR DCPE L  P ++R  EA E+A L+
Sbjct  389   ATVKKLFDLPQDFLTKRDAWAGTFESVVQTRTEPRTDCPEQLPMPTRIRQTEANEEAKLS  448

Query  1327  EYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIH  1506
             E+Q+E++Q+A+VL GDH +      ++ + M+V +   Y   A  ++     +A++ G+ 
Sbjct  449   EFQQEIIQLASVLNGDH-ELTSLQDRIRDKMNVREGIAYMRGAVKRYFEAGMSAKRMGVD  507

Query  1507  GDYSVVALSKQPPSPNTTPRKP  1572
              +  V    K  PS  T   +P
Sbjct  508   DEQIV----KMRPSLTTRIERP  525



>emb|CDM86599.1| unnamed protein product [Triticum aestivum]
Length=530

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/490 (58%), Positives = 361/490 (74%), Gaps = 14/490 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK LNP I+GV G E NP   +  +  S    V FG+ +
Sbjct  34    PIKTVVVVVMENRSFDHMLGWMKRLNPAIDGVTGAEWNP---ANASDPSAGPRVYFGDGA  90

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAG-MSGAVMNGFV  429
             Q+VDPDPGHS Q+I +Q+FG   S D++G    P M GF   A     G M+ AVMNGF 
Sbjct  91    QFVDPDPGHSYQEIRQQVFG---SDDASGP---PLMNGFVQQARSIGGGNMTEAVMNGFA  144

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P++V VY+ELV +FAVCDRWFASVP+STQPNRLFVHS TS GATSN+ + L +G+PQ+TI
Sbjct  145   PDSVAVYRELVAQFAVCDRWFASVPSSTQPNRLFVHSGTSGGATSNNPELLAKGYPQRTI  204

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+++ +AG SFG+Y+Q  P+ LFYRNLRKLKYI NFH F   F+ H   G LPNY V+EQ
Sbjct  205   FDNVHDAGLSFGVYFQDVPAVLFYRNLRKLKYILNFHPFHNTFRDHAIRGSLPNYAVIEQ  264

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
              Y D K  P NDDHPSHDV++GQ FVKE+YE LR+SPQWNE L ++ YDEHGGF+DHVPT
Sbjct  265   HYMDSKDHPANDDHPSHDVYQGQMFVKEIYETLRASPQWNETLMVLTYDEHGGFFDHVPT  324

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSS  1146
             PV GVP+PD ++GP PY+F F+RLGVRVPAI++SPWIE+G V+HGP+G P P S++EHSS
Sbjct  325   PVDGVPSPDDIVGPPPYSFTFNRLGVRVPAILISPWIEKGTVMHGPNGSPTPTSQFEHSS  384

Query  1147  IPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             IPATVKK+FNL Q FLT+RDAWAGTFE V+ TRT PR DCPE L  P ++R  EA E+A 
Sbjct  385   IPATVKKLFNLPQDFLTKRDAWAGTFEGVVQTRTEPRTDCPEQLPTPTRIRQTEANEEAK  444

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+ +Q+E+VQ+AAVL GDH        ++ E M+V +   Y   +  +F     +A++ G
Sbjct  445   LSSFQQEIVQLAAVLNGDHQLSSLQ-ERIRERMNVREGTSYMRSSVRRFFEAGMSAKRMG  503

Query  1501  IHGDYSVVAL  1530
             + G+  +V +
Sbjct  504   LAGEEQIVKM  513



>dbj|BAJ98752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/401 (69%), Positives = 322/401 (80%), Gaps = 10/401 (2%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQ  255
             IKTVVV+VQENRSFDHMLGWMKSLNP+I+GV G E+N +  +    +  +  V F + S+
Sbjct  39    IKTVVVVVQENRSFDHMLGWMKSLNPDIDGVTGAETNRVVVA----DPRSKAVPFRDGSE  94

Query  256   YVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-----MQGFAANAERNQAGMSGAVMN  420
             +VDPDPGHSIQ IYEQ++G P+    A     P      M GFA  AE+ + GM+  VM+
Sbjct  95    FVDPDPGHSIQAIYEQVYGTPFVDAQATPITPPAVPAPPMTGFAQQAEKEKPGMAETVMS  154

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
             GF P+AVPVY+EL  EFAVCDRWFAS PASTQPNRLFVHSATSHG  SN+TK L+ G PQ
Sbjct  155   GFRPDAVPVYRELALEFAVCDRWFASNPASTQPNRLFVHSATSHGLVSNNTKALVAGLPQ  214

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
              TIF+S+ +AG+SFG+YYQYPPS LFYRNLR+LKY+ NF+ FD+ F+ HC+EG+LPNYVV
Sbjct  215   TTIFDSLHDAGHSFGVYYQYPPSVLFYRNLRQLKYVGNFYPFDLEFRRHCREGRLPNYVV  274

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             VEQRYFDLKILPGNDDHPSHDV EGQ+FVKEVYEALRS PQW E L ++ YDEHGGFYDH
Sbjct  275   VEQRYFDLKILPGNDDHPSHDVCEGQRFVKEVYEALRSGPQWEETLLVVTYDEHGGFYDH  334

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEH  1140
             VPTPV GVP+PDG++   P+ F FDRLGVRVPA  VSPWIE G V+H PSGP+P SE+EH
Sbjct  335   VPTPV-GVPSPDGIVSDAPFFFNFDRLGVRVPAFFVSPWIEPGTVVHRPSGPYPTSEFEH  393

Query  1141  SSIPATVKKIFNLNQFLTERDAWAGTFETVITRTTPRKDCP  1263
             SSIPATVKKIFNL  FLT+RDAWAGTF+ V+TR TPR DCP
Sbjct  394   SSIPATVKKIFNLGCFLTKRDAWAGTFDVVLTRDTPRTDCP  434



>ref|NP_001146430.1| hypothetical protein precursor [Zea mays]
 gb|ACL53955.1| unknown [Zea mays]
 tpg|DAA55773.1| TPA: hypothetical protein ZEAMMB73_227077 [Zea mays]
Length=515

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/503 (58%), Positives = 356/503 (71%), Gaps = 16/503 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNPEI+GV G+E NP      A +     V F + +
Sbjct  26    PIKTVVVLVMENRSFDHMLGWMKRLNPEIDGVTGREWNP----ANASDPAAGRVYFRDGA  81

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAG-MSGAVMNGFV  429
              YVDPDPGHS Q+I +Q+FG   S D A     P M GFA  A     G MS AVM GF 
Sbjct  82    AYVDPDPGHSFQEIRQQVFG---SDDDAADN-PPRMDGFAQQARSIGGGAMSDAVMRGFN  137

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P  V VY+ELV +FAVCDRWFASVP+STQPNRLFVHS TS GATSN+   L EG+PQ+TI
Sbjct  138   PADVAVYRELVSQFAVCDRWFASVPSSTQPNRLFVHSGTSGGATSNNPTLLAEGYPQRTI  197

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+++ +AG SFG+Y+Q  P+ LFYRNLRKLKY+ +FH     F  H + G LPNY V+EQ
Sbjct  198   FDNLHDAGLSFGVYFQDVPAVLFYRNLRKLKYLLDFHPLRPSFADHARRGTLPNYAVIEQ  257

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
              Y D K+ P NDDHPSHDV++GQ  VK VYE LR+SPQWN+ L +I YDEHGGF+DHVPT
Sbjct  258   HYLDSKLDPANDDHPSHDVYQGQMLVKYVYETLRASPQWNQTLLVITYDEHGGFFDHVPT  317

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVP+PDG++GP PYNF FDRLGVRVPAI+VSPWI+RG V+HGP GP P S+YEHSSI
Sbjct  318   PVAGVPSPDGIVGPPPYNFTFDRLGVRVPAILVSPWIDRGTVVHGPHGPTPTSQYEHSSI  377

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIF L Q FLT RDAWAGTFE V+  RT PR DCPE L  P ++R  EA E+A L
Sbjct  378   PATVKKIFGLPQDFLTRRDAWAGTFEGVVQGRTEPRTDCPEQLPTPTRIRQTEADEEAKL  437

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E++Q+A+VL GD+        ++  +M+V +  DY   A  ++      AR+ G+
Sbjct  438   SEFQQEIIQLASVLNGDYHLATLQ-DRIKNDMNVREGIDYMKAAVKRYFQAGAFARRMGV  496

Query  1504  HGDYSVVALSKQPPSPNTTPRKP  1572
              GD  V    K  PS  T  ++P
Sbjct  497   DGDQIV----KMRPSLTTRIQRP  515



>ref|XP_008803348.1| PREDICTED: LOW QUALITY PROTEIN: non-specific phospholipase C2-like 
[Phoenix dactylifera]
Length=528

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/479 (60%), Positives = 351/479 (73%), Gaps = 13/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGWMK LNPEI+GV G E N +     A +  +  V FG+ +
Sbjct  36    PIKTVVVLVMENRSFDHMLGWMKRLNPEIDGVTGSEWNTV----SASDPASPRVYFGDGA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VDPDPGHS Q I EQIFG   S D++       M GF  NA      M+ +VMNGF P
Sbjct  92    HFVDPDPGHSFQAIREQIFG---SNDTSAAPA--PMNGFVQNARSMSENMTESVMNGFRP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E V VYK LV EFAV DRWFASVPASTQPNRLFVHSATSHGAT N+   L++G+PQ+TIF
Sbjct  147   EMVAVYKTLVEEFAVFDRWFASVPASTQPNRLFVHSATSHGATGNNASLLVKGYPQRTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             E+MD+AG SFGIYYQ  P+ LFY NLRKLKY+  FH +D  FK H  +G LPNY V+EQR
Sbjct  207   ENMDDAGLSFGIYYQNIPAILFYSNLRKLKYLFKFHSYDHTFKRHAAKGSLPNYAVIEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K  P  DDHPSHDV++GQ F+KEVYE LR+SPQWNE L +I YDEHGGF+DHVPTP
Sbjct  267   YLDSKSKPATDDHPSHDVYQGQMFIKEVYETLRASPQWNETLLIITYDEHGGFFDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             + GVP+PDG++GP P+ F FDRLGVRVP IMVSPWI++G V+HGP+G P P SEYEHSSI
Sbjct  327   IAGVPSPDGIVGPPPFFFAFDRLGVRVPTIMVSPWIDKGTVIHGPNGVPSPTSEYEHSSI  386

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKKIF+L + +LT+RDAWAGTFE ++ +RT PR DCP  L  P K+R+ EA E A L
Sbjct  387   PATVKKIFDLPSPYLTQRDAWAGTFEGIMQSRTEPRADCPVQLPTPSKIRNGEANEGAKL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q+E++Q+A+VL GDH+    +  K+ + M+V +   Y   A  +F      A++ G
Sbjct  447   SEFQQELMQLASVLNGDHLLAG-FDEKISKQMNVREGIAYMENAVKRFFEAGMTAKKMG  504



>ref|XP_003565100.1| PREDICTED: non-specific phospholipase C2 [Brachypodium distachyon]
Length=541

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/494 (58%), Positives = 362/494 (73%), Gaps = 15/494 (3%)
 Frame = +1

Query  61    GSIFPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLF  240
             G   PIKTVVV+V ENRSFDHMLGWMKSLNP I+GV G E NP      A + ++  V F
Sbjct  42    GPTSPIKTVVVVVMENRSFDHMLGWMKSLNPAIDGVTGAEWNP----ANASDPSSPRVYF  97

Query  241   GNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAG-MSGAVM  417
              + +QYVDPDPGHS Q+I +Q+FG   S D++G      M GF   A     G M+ AVM
Sbjct  98    RDGAQYVDPDPGHSYQEIRQQVFG---SDDASGPA---KMNGFVQQATSIGGGNMTDAVM  151

Query  418   NGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFP  597
             +G+ P+AV VYKELV +FAVCDRWFASVP+STQPNRLFVHS TS GATSN+ + L EG+P
Sbjct  152   HGYKPDAVAVYKELVSQFAVCDRWFASVPSSTQPNRLFVHSGTSGGATSNNPELLAEGYP  211

Query  598   QKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYV  777
             Q+TIF+++ +AG SFG+Y+Q  P+ LFYRNLRK+KY+  FH F   F+ H + G LPNY 
Sbjct  212   QRTIFDNIYDAGLSFGVYFQDVPAVLFYRNLRKIKYLLKFHPFHNTFRDHAQSGNLPNYA  271

Query  778   VVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYD  957
             VVEQ Y D K  P NDDHPSHDV++GQ F+KE+YE LR+SPQWNE L +I YDEHGGF+D
Sbjct  272   VVEQHYMDSKSHPANDDHPSHDVYQGQMFIKEIYETLRASPQWNETLMVITYDEHGGFFD  331

Query  958   HVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEY  1134
             HVPTPV  VP+PDG++GP PYNF+F+RLGVRVP I +SPWIE+G V+HGP+G P PNS+Y
Sbjct  332   HVPTPVDNVPSPDGIVGPPPYNFEFNRLGVRVPTIFISPWIEKGTVVHGPNGSPTPNSQY  391

Query  1135  EHSSIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAK  1308
             EHSSIPATVKK+FNL Q FLT RDAWAGTFE+V+ TRT PR DCPETL  P ++R  +A 
Sbjct  392   EHSSIPATVKKLFNLPQDFLTRRDAWAGTFESVVKTRTEPRTDCPETLPMPTRIRQTDAN  451

Query  1309  EDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENA  1488
             E+A L+ +Q+E+VQ+AAVL GDH        ++ + M+V +   Y   A  +F     +A
Sbjct  452   EEAKLSSFQQEIVQLAAVLNGDHQLTSLQ-ERIRDRMNVREGTAYMRRAVRRFFEAGLSA  510

Query  1489  RQRGIHGDYSVVAL  1530
             ++ G+  D  +V +
Sbjct  511   KRMGVANDEQIVKM  524



>ref|XP_002973936.1| hypothetical protein SELMODRAFT_267716 [Selaginella moellendorffii]
 gb|EFJ24891.1| hypothetical protein SELMODRAFT_267716 [Selaginella moellendorffii]
Length=512

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/483 (60%), Positives = 354/483 (73%), Gaps = 14/483 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDHMLGW+K LNPEI+G+ G ESNPL T+  A       +   + +
Sbjct  27    PIKTVVVLVMENRSFDHMLGWLKKLNPEIDGLQGNESNPLSTTDPASRK----IFVADTA  82

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             ++VDPDPGHS Q I EQ+FG   S D++   + P M GFA  AE    G S  VM GF P
Sbjct  83    EFVDPDPGHSFQAITEQVFG---SNDTSA--IPPPMNGFAQQAESMVEGFSETVMKGFRP  137

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E VPVY  L  EFAV DRWFAS P STQPNRL+VHSATS+G  SN  K L++GFPQKTI+
Sbjct  138   ELVPVYTALAMEFAVFDRWFASTPTSTQPNRLYVHSATSYGEISNVKKDLVKGFPQKTIY  197

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+ LF++NLRKLKY+  +H +   FK H + G LPN  V+EQR
Sbjct  198   DSLDEDGLSFGIYYQNIPACLFFKNLRKLKYLTKYHSYRAAFKLHARLGMLPNVAVIEQR  257

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFDL + P NDDHPSHDV EGQK VKEVYEALRSSPQWNE+LF+I YDEHGGFYDHVPTP
Sbjct  258   YFDLDLTPANDDHPSHDVSEGQKLVKEVYEALRSSPQWNEVLFVITYDEHGGFYDHVPTP  317

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
               GVPNPDG++GP+P  F FDRLGVRVP IMVSPWIE+G V+H P+GP P S++EHSS+ 
Sbjct  318   NVGVPNPDGVLGPEPGFFDFDRLGVRVPTIMVSPWIEKGTVVHEPNGPTPTSQFEHSSLA  377

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETL-AEPVKLRSAEAKEDANL  1323
             AT+KK+F+L + FLT+RDAWAGTFE+V++ R++PR DCPETL   P  LR     EDA L
Sbjct  378   ATIKKLFDLKSDFLTKRDAWAGTFESVVSGRSSPRTDCPETLPTPPWSLRHRAVDEDAKL  437

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             TE+Q+E+VQ+A+ L GDH + + YP+   + MSV +A +Y   A  KFL +   A + G 
Sbjct  438   TEFQEELVQLASQLNGDH-RLNGYPN-FGKGMSVRQANNYVESAVRKFLDEGRLALKSGG  495

Query  1504  HGD  1512
               D
Sbjct  496   QAD  498



>ref|XP_009348348.1| PREDICTED: non-specific phospholipase C2-like [Pyrus x bretschneideri]
Length=534

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/498 (60%), Positives = 355/498 (71%), Gaps = 31/498 (6%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIK +VVLV ENRSFDHMLGWMK +NPEINGV G ESNPL T+    +  +    F N+S
Sbjct  25    PIKNIVVLVMENRSFDHMLGWMKKINPEINGVDGSESNPLSTT----DPNSKRFFFKNES  80

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAER--NQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S +++     P M GFA  A    N   MS  VMNGF
Sbjct  81    HYVDPDPGHSFQAIREQIFG---SDNTSADP--PPMNGFAQQAYSMDNTTAMSQDVMNGF  135

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ V +YK LV EFAV DRWFAS+P STQPNRL+VHS TS GATSN    L +G+PQ+T
Sbjct  136   NPDMVAIYKTLVSEFAVFDRWFASLPTSTQPNRLYVHSGTSAGATSNIPALLAKGYPQRT  195

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+++D+AG SFGIYYQ  PSTLFYRNLRKLKYI  FH++   FK H  EGKLP Y V+E
Sbjct  196   IFQNLDDAGISFGIYYQNIPSTLFYRNLRKLKYIFKFHRYKT-FKRHANEGKLPGYTVIE  254

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD+K  P NDDHPSHDV+ GQ FVKEVYE LR+SPQWN+ LF+I YDEHGGFYDHV 
Sbjct  255   QRYFDIKSAPANDDHPSHDVYHGQMFVKEVYETLRASPQWNDTLFIITYDEHGGFYDHVS  314

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++GP+P+ FQFDRLGVRVP IMVSPWIE+G V+HGP+G PFP SE+EHS
Sbjct  315   TPVREVPSPDGIVGPEPFFFQFDRLGVRVPTIMVSPWIEKGTVVHGPNGSPFPTSEFEHS  374

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKKIFNL   FLT+RD WAGTFE ++ TRT PR DCPE L  PV +R +E  EDA
Sbjct  375   SIPATVKKIFNLTAPFLTKRDEWAGTFEGIVQTRTEPRTDCPEQLPTPVAIRKSEPNEDA  434

Query  1318  NLTEYQ---------------KEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHL  1452
              LTE+Q               +EM+Q+AAVL GD++    YP K  + M+V     Y+  
Sbjct  435   KLTEFQQXXXXXXXXXXXXXXQEMIQLAAVLKGDNIFTS-YPKKTGKAMTVKDGKKYADD  493

Query  1453  AFNKFLGDCENARQRGIH  1506
             A   F      A++ G++
Sbjct  494   AVKGFFEAGLYAKRMGVN  511



>ref|NP_001045435.1| Os01g0955000 [Oryza sativa Japonica Group]
 dbj|BAB90779.1| putative phosphatidylglycerol specific phospholipase C [Oryza 
sativa Japonica Group]
 dbj|BAF07349.1| Os01g0955000 [Oryza sativa Japonica Group]
 gb|EAZ14872.1| hypothetical protein OsJ_04801 [Oryza sativa Japonica Group]
 dbj|BAG94996.1| unnamed protein product [Oryza sativa Japonica Group]
Length=520

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/480 (60%), Positives = 354/480 (74%), Gaps = 14/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK LNPEI+GV G E NP      A + ++  V FG  +
Sbjct  29    PIKTVVVVVMENRSFDHMLGWMKRLNPEIDGVTGGEWNPT----NASDPSSGRVYFGEGA  84

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             +YVDPDPGHS Q+I +QIFG   S D++G      M GF   A      M+ AVMNGF P
Sbjct  85    EYVDPDPGHSFQEIRQQIFG---SDDASGPA---RMDGFVQQARSLGDNMTAAVMNGFSP  138

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             ++V VY+ELV EFAV DRWFASVP+STQPNRLFVHSATS GATSN+ + L +G+PQ+TIF
Sbjct  139   DSVAVYRELVGEFAVFDRWFASVPSSTQPNRLFVHSATSGGATSNNPELLAKGYPQRTIF  198

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +++ +AG SFG+YYQ  P+ LFYRNLRKLKY+  FH F   F+ H   G LPNY VVEQ 
Sbjct  199   DNVHDAGLSFGVYYQDVPAVLFYRNLRKLKYLTKFHPFHGAFRDHAARGSLPNYAVVEQH  258

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K  P NDDHPSHDVF+GQ  VKEVYE LR+SPQWN+ L ++ YDEHGGFYDHVPTP
Sbjct  259   YMDSKSHPANDDHPSHDVFQGQMLVKEVYETLRASPQWNQTLMVVTYDEHGGFYDHVPTP  318

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             VTGVP+PDG++GP PYNF FDRLGVRVPAI++SPWI +G V+HGP+G P   SEYEHSSI
Sbjct  319   VTGVPSPDGIVGPPPYNFAFDRLGVRVPAIVISPWINKGTVVHGPNGSPTATSEYEHSSI  378

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKK+F+L Q FLT+RDAWAGTFE+V+  RT PR DCPE L  P+++R  EA E+A L
Sbjct  379   PATVKKLFDLPQDFLTKRDAWAGTFESVVQGRTEPRTDCPEQLPMPMRIRLTEANEEAKL  438

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+A+VL GDH         + + M+V +   Y   A  +F     +A++ G+
Sbjct  439   SEFQQELVQLASVLNGDHQLSSLQ-DTIRDRMNVREGIAYMRGAVKRFFETGMSAKRMGV  497



>ref|XP_007205028.1| hypothetical protein PRUPE_ppa004016mg [Prunus persica]
 gb|EMJ06227.1| hypothetical protein PRUPE_ppa004016mg [Prunus persica]
Length=535

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/480 (61%), Positives = 356/480 (74%), Gaps = 16/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDH+LGW+KS  PEI+G+ G ESNPL  S    +  +  V   + +
Sbjct  38    PIKTVVVLVMENRSFDHILGWLKSTRPEIDGLTGNESNPLSVS----DPNSPRVPVSSDA  93

Query  253   QYVDPDPGHSIQDIYEQIFGAPWS-QDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
              ++D DPGHSIQ I EQIFG+  S +D A       M GFA  AE    GMS  VM+GF 
Sbjct  94    FFIDSDPGHSIQAIREQIFGSNRSFEDPA------PMNGFAQQAESMAEGMSSKVMSGFK  147

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +PVY EL  EFAV DRWFASVPASTQPNR +VHSATSHGA+SN  K LI GFPQKTI
Sbjct  148   PEVLPVYTELANEFAVFDRWFASVPASTQPNRFYVHSATSHGASSNVRKDLIHGFPQKTI  207

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+DE    FGIYYQ  P+TLF+R+LRKLK++  FH + + FK H K GKLPNY V+EQ
Sbjct  208   FDSLDENALDFGIYYQNIPATLFFRSLRKLKHVTKFHSYALKFKLHAKRGKLPNYAVIEQ  267

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+K LP NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVPT
Sbjct  268   RYFDVKELPANDDHPSHDVARGQRFVKEVYETLRASPQWKEMALLITYDEHGGFYDHVPT  327

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV+GVP+PDG++GP P+ F+FDRLGVRVP I+VSPWIE+G V+H P+GP P+S +EHSSI
Sbjct  328   PVSGVPSPDGIVGPDPFYFRFDRLGVRVPTILVSPWIEKGTVIHEPTGPTPDSHFEHSSI  387

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDAN  1320
             PATVKK+FNL + FLT+RDAWAGTFE     R+TPR DCPETL E  + LR    +ED +
Sbjct  388   PATVKKLFNLKSNFLTKRDAWAGTFENYFYLRSTPRDDCPETLPEVTMSLRPGGPREDVS  447

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E++Q+A+ L GD++  + YP+ + E+M VA+A  Y+  A  +FL     A + G
Sbjct  448   LSEFQVELIQLASQLNGDYVL-NTYPY-IGESMRVAEANRYAEDAVKRFLEAGRAALKAG  505



>gb|EAY77273.1| hypothetical protein OsI_05247 [Oryza sativa Indica Group]
Length=520

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/480 (60%), Positives = 354/480 (74%), Gaps = 14/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK LNPEI+GV G E NP      A + ++  V FG  +
Sbjct  29    PIKTVVVVVMENRSFDHMLGWMKRLNPEIDGVTGGEWNPT----NASDPSSGRVYFGEGA  84

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             +YVDPDPGHS Q+I +QIFG   S D++G      M GF   A      M+ AVMNGF P
Sbjct  85    EYVDPDPGHSFQEIRQQIFG---SDDASGPA---RMDGFVQQARSLGDNMTAAVMNGFSP  138

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             ++V VY+ELV EFAV DRWFASVP+STQPNRLFVHSATS GATSN+ + L +G+PQ+TIF
Sbjct  139   DSVAVYRELVGEFAVFDRWFASVPSSTQPNRLFVHSATSGGATSNNPELLAKGYPQRTIF  198

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +++ +AG SFG+YYQ  P+ LFYRNLRKLKY+  FH F   F+ H   G LPNY VVEQ 
Sbjct  199   DNVHDAGLSFGVYYQDVPAVLFYRNLRKLKYLTKFHPFHGAFRDHAARGSLPNYAVVEQH  258

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K  P NDDHPSHDVF+GQ  VKEVYE LR+SPQWN+ L ++ YDEHGGFYDHVPTP
Sbjct  259   YMDSKSHPANDDHPSHDVFQGQMLVKEVYETLRASPQWNQTLMVVTYDEHGGFYDHVPTP  318

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             VTGVP+PDG++GP PYNF FDRLGVRVPAI++SPWI +G V+HGP+G P   SEYEHSSI
Sbjct  319   VTGVPSPDGIVGPPPYNFAFDRLGVRVPAIVISPWINKGTVVHGPNGSPTATSEYEHSSI  378

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKK+F+L Q FLT+RDAWAGTFE+V+  RT PR DCPE L  P+++R  EA E+A L
Sbjct  379   PATVKKLFDLPQDFLTKRDAWAGTFESVVQGRTEPRTDCPEQLPMPMRIRLTEANEEAKL  438

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+A+VL GDH         + + M+V +   Y   A  +F     +A++ G+
Sbjct  439   SEFQQELVQLASVLNGDHQLSSLQ-DTIRDRMNVREGIAYMRGAVKRFFEAGMSAKRMGV  497



>ref|XP_010037407.1| PREDICTED: non-specific phospholipase C6 [Eucalyptus grandis]
 gb|KCW49113.1| hypothetical protein EUGRSUZ_K02713 [Eucalyptus grandis]
Length=519

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/480 (60%), Positives = 353/480 (74%), Gaps = 19/480 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTN-DVVLFGN  246
             PIKT+VVLV ENRSFDHMLGWMK S+NP INGV G+E NP+ T     N T+  ++ F +
Sbjct  34    PIKTIVVLVLENRSFDHMLGWMKRSINPNINGVTGRECNPVST-----NKTDPGMICFTD  88

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
              +++VDPDPGHS + + +Q+FG+            PTM GF   A      +S  VM GF
Sbjct  89    DAEFVDPDPGHSFEAVQQQVFGS---------GTVPTMTGFVEQALTMSQDLSETVMKGF  139

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE+VPVY  L  EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K L +GFPQKT
Sbjct  140   RPESVPVYATLASEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKLLAKGFPQKT  199

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+ E G +FGIYYQ  P+TLFYRNLRKLKYI  FHQ+D+ FK   ++GKLP+  V+E
Sbjct  200   IFDSLHENGMNFGIYYQNVPNTLFYRNLRKLKYILKFHQYDLKFKKDARDGKLPSLTVIE  259

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
              RYFDLK +PGNDDHPSHDV  GQK VKEVYE LR SPQWNE L +I YDEHGGFYDHV 
Sbjct  260   PRYFDLKGMPGNDDHPSHDVANGQKLVKEVYETLRGSPQWNETLLIITYDEHGGFYDHVE  319

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP   VPNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSS
Sbjct  320   TPYVNVPNPDGNTGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVISGPKGPAPNSEFEHSS  379

Query  1147  IPATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             IPAT+KKIFNL + FLT RDAWAGTFE V+   T+PR DCPETL   + LRS+EAKED  
Sbjct  380   IPATIKKIFNLTSNFLTHRDAWAGTFEEVVGELTSPRTDCPETLPHAMPLRSSEAKEDGA  439

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E+VQ+AAVL GDH     +P ++ + M+V +A++Y + A ++F+   + A + G
Sbjct  440   LSEFQSEVVQLAAVLNGDHFLSS-FPDEMGKKMNVKQASEYVNGAISRFIRASKEAIKLG  498



>ref|XP_010487249.1| PREDICTED: non-specific phospholipase C1-like [Camelina sativa]
Length=530

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/500 (57%), Positives = 361/500 (72%), Gaps = 17/500 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  P+I+G+ G+ESNPL  S    +  ++ +   N +
Sbjct  34    PIKTIVVVVMENRSFDHILGWLKSTRPDIDGLTGQESNPLNVS----DPNSEKIFVSNDA  89

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +PTM GFA  +E  + GM+  VM+GF P
Sbjct  90    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPTMNGFAQQSESMEPGMAKNVMSGFKP  143

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF V DRWFASVP STQPNR +VHSATSHG +SN  K L++GFPQKTIF
Sbjct  144   EVLPVYSELANEFGVFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLVKGFPQKTIF  203

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+T F+++LR++K++  FH + + FK H K GKLPNY VVEQR
Sbjct  204   DSLDENGLSFGIYYQNIPATFFFKSLRRIKHLVKFHSYALKFKLHAKLGKLPNYSVVEQR  263

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  264   YFDVDLFPANDDHPSHDVALGQRFVKEVYETLRSSPQWEEMALLITYDEHGGFYDHVPTP  323

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+G V+H P GP PNS+YEHSSIP
Sbjct  324   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFLISPWIEKGTVIHEPDGPTPNSQYEHSSIP  383

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE L E  + LR   A+ED+ L
Sbjct  384   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRIRDSPRQDCPEKLPEVTQLLRPQGAREDSKL  443

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V++   Y+  A  KFL     A + G 
Sbjct  444   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVSEGNKYAEDAVEKFLEAGMAALEAG-  500

Query  1504  HGDYSVVALSKQPPSPNTTP  1563
               D + +   +   +  T+P
Sbjct  501   -ADENTIVTMRPSLTTRTSP  519



>gb|KFK32464.1| hypothetical protein AALP_AA6G245200 [Arabis alpina]
Length=518

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/471 (61%), Positives = 351/471 (75%), Gaps = 15/471 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK LNPEINGV G ESNP+  S    + ++  + FG  S
Sbjct  30    PIKTVVVVVMENRSFDHMLGWMKKLNPEINGVDGSESNPVSVS----DPSSKKIQFGWGS  85

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFA--ANAERNQAGMSGAVMNGF  426
              YVDPDPGHS Q I EQIFG   S D+      P M GFA  A +      MS +VMNGF
Sbjct  86    HYVDPDPGHSFQAIREQIFG---SNDTTMDP--PPMNGFAQVAYSMDPTGDMSASVMNGF  140

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+ VPVYK LV EFAV DRWFASVP+STQPNR+FVHS TS GAT ND   L +G+PQ+T
Sbjct  141   QPDKVPVYKSLVSEFAVFDRWFASVPSSTQPNRMFVHSGTSGGATGNDPMSLAKGYPQRT  200

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IFE+++E   SFGIY+Q  P+ LFYRNLRKLKY+  FH + + FK H K+GKLP Y V+E
Sbjct  201   IFENLEENDISFGIYFQNIPAVLFYRNLRKLKYVTKFHSYGLSFKDHAKKGKLPAYTVIE  260

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRY D    P  DDHPSHDV++GQKF+KEVYE LR+SPQWNE+L +I YDEHGG++DHV 
Sbjct  261   QRYMDTVFEPATDDHPSHDVYQGQKFIKEVYETLRASPQWNEILLMITYDEHGGYFDHVA  320

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHS  1143
             TPV  VP+PDG++GP+P+ F+F+RLGVRVP I VSPWIE+G V+HGP+G PFP+SEYEHS
Sbjct  321   TPVRNVPSPDGIVGPEPFLFEFNRLGVRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHS  380

Query  1144  SIPATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNL+  FLT+RD WAGTFE ++  R  PR DCPETL EPVK+R  EA E+A
Sbjct  381   SIPATVKKLFNLSTPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVKIRMGEANENA  440

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
              L+E+Q+E+VQ+AAVL GD      +P+++   M+V +   Y   A  +FL
Sbjct  441   RLSEFQQELVQLAAVLKGDD-SLTTFPNEIGARMTVIEGKMYMEDAVKRFL  490



>ref|XP_001777798.1| predicted protein [Physcomitrella patens]
 gb|EDQ57336.1| predicted protein [Physcomitrella patens]
Length=529

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/479 (61%), Positives = 354/479 (74%), Gaps = 14/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIK VVV+V ENRSFDHMLGW+K+LNPEI+G+ GKE NP  TS    N  +++V   N +
Sbjct  35    PIKVVVVMVMENRSFDHMLGWLKTLNPEIDGLTGKECNPKNTS----NPDSELVCVSNIA  90

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             ++VDPDPGHS Q I EQIFG   ++ SA   + P M GFA  AE    G S  VM+GF P
Sbjct  91    EFVDPDPGHSFQAIREQIFGK--NETSA---IPPPMNGFAQQAESMAKGFSKTVMSGFRP  145

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E VP YK L  E+AV DRWFAS P STQPNR +VHSATS+GA SN  ++LIEGFPQKTIF
Sbjct  146   EVVPAYKALAAEYAVFDRWFASAPTSTQPNRFYVHSATSYGAMSNVREELIEGFPQKTIF  205

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             ES+  AG++ GIYYQ  P+TLF+RNLRKLK++  FH + + F+ H + G LPNYVVVEQR
Sbjct  206   ESIVNAGHTVGIYYQNLPATLFFRNLRKLKFVNKFHDYTLKFRNHARRGVLPNYVVVEQR  265

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD K+LP NDDHPSHDV EGQ FVKEVYE LR+SPQWNEMLF+I YDEHGGFYDHVPTP
Sbjct  266   YFDTKVLPANDDHPSHDVSEGQGFVKEVYEILRASPQWNEMLFIITYDEHGGFYDHVPTP  325

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             VT VPNPDGLIGP P  F F RLGVRVP +M+SPWI +G V+HGP GP  +S+YEHSSIP
Sbjct  326   VTNVPNPDGLIGPPPEYFNFRRLGVRVPTLMISPWINKGVVVHGPHGPTADSQYEHSSIP  385

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETL-AEPVKLRSAEAKEDANL  1323
             ATV+KIFNL + FLT RD WAGTFE V   R +PR DCP+ + + P  LR +   E A L
Sbjct  386   ATVRKIFNLPDDFLTARDEWAGTFEHVFAQRKSPRIDCPKQIPSPPWSLRHSPPNESAPL  445

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             TE+Q+E++Q+A+ L GDH   + YPH L + M+V +A +Y+  A  KF+   + A + G
Sbjct  446   TEFQEELIQLASQLNGDHQHPE-YPH-LGKRMNVGQAYEYATKAVAKFIETGKAALKAG  502



>emb|CDY06689.1| BnaA10g04680D [Brassica napus]
Length=529

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/509 (57%), Positives = 360/509 (71%), Gaps = 21/509 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+K   PEI+G+ GKESNPL     A +  +  +   N +
Sbjct  33    PIKTIVVVVMENRSFDHILGWLKPTRPEIDGLTGKESNPL----NASDPNSKKIYVSNDA  88

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +P M GFA  AE  + GM+  VM+GF P
Sbjct  89    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPKMNGFAQEAESMEPGMAKNVMSGFKP  142

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF + DRWFASVP STQPNR +VHSATSHG +SN  K LI GFPQKTIF
Sbjct  143   EVLPVYTELANEFGIFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLIRGFPQKTIF  202

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E G SFGIYYQ  P+T F+++LR+LK++  FH + + FK H K GKLPNY V+EQR
Sbjct  203   DSLEETGLSFGIYYQNIPATFFFKSLRRLKHLVKFHSYALKFKLHAKLGKLPNYSVIEQR  262

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  263   YFDIDLFPANDDHPSHDVAAGQRFVKEVYETLRSSPQWEEMALLITYDEHGGFYDHVPTP  322

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+G V+H P GP P S+YEHSSIP
Sbjct  323   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFIISPWIEKGTVIHEPDGPTPTSQYEHSSIP  382

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE LAE  + LR   AKED+ L
Sbjct  383   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRIRDSPRQDCPEKLAEVERSLRPWGAKEDSKL  442

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V +   Y+  A  KFL   + A + G 
Sbjct  443   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVREGNKYAEDAVQKFLEAGKAALEAG-  499

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATK  1590
               D + +   +    P+ T R   S  TK
Sbjct  500   -ADENTIVTMR----PSLTTRTSPSDGTK  523



>emb|CDY10260.1| BnaC05g05030D [Brassica napus]
Length=529

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/500 (57%), Positives = 358/500 (72%), Gaps = 17/500 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+K   PEI+G+ GKESNPL     A +  +  +   N +
Sbjct  33    PIKTIVVVVMENRSFDHILGWLKPTRPEIDGLTGKESNPL----NASDPNSKKIYVSNDA  88

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +P M GFA  AE  + GM+  VM+GF P
Sbjct  89    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPKMNGFAQEAESMEPGMAKNVMSGFKP  142

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF + DRWFASVP STQPNR +VHSATSHG +SN  K LI GFPQKTIF
Sbjct  143   EVLPVYTELANEFGIFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLIRGFPQKTIF  202

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E G SFGIYYQ  P+T F+++LR+LK++  FH + + FK H K GKLPNY V+EQR
Sbjct  203   DSLEETGLSFGIYYQNIPATFFFKSLRRLKHLVKFHSYALKFKLHAKLGKLPNYSVIEQR  262

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW+EM  +I YDEHGGFYDHVPTP
Sbjct  263   YFDIDLFPANDDHPSHDVAAGQRFVKEVYETLRSSPQWDEMALIITYDEHGGFYDHVPTP  322

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+G V+H P GP P S+YEHSSIP
Sbjct  323   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFIISPWIEKGTVIHEPDGPTPTSQYEHSSIP  382

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE LAE  + LR   AKED+ L
Sbjct  383   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRVRDSPRQDCPEKLAEVERSLRPWGAKEDSKL  442

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V +   Y+  A  KFL   + A + G 
Sbjct  443   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVREGNKYAEDAVQKFLEAGKAALEAG-  499

Query  1504  HGDYSVVALSKQPPSPNTTP  1563
               D + +   +   +  T+P
Sbjct  500   -ADENTIVTMRPSLTTRTSP  518



>ref|XP_010475476.1| PREDICTED: non-specific phospholipase C1-like [Camelina sativa]
Length=533

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/511 (56%), Positives = 366/511 (72%), Gaps = 18/511 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  P+I+G+ G+ESNPL  S    +  ++ +   N +
Sbjct  35    PIKTIVVVVMENRSFDHILGWLKSTRPDIDGLTGQESNPLNVS----DPNSEKIFVSNDA  90

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              ++D DPGHS Q I EQIFG   S D++G   +PTM GFA  +E  + GM+  VM+GF P
Sbjct  91    VFIDMDPGHSFQAIREQIFG---SNDTSG---DPTMNGFAQQSESMEPGMAKNVMSGFKP  144

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF V DRWFASVP STQPNR +VHSATSHG +SN  K L++GFPQKTIF
Sbjct  145   EVLPVYTELANEFGVFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLVKGFPQKTIF  204

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+T F+++LR++K++  FH + + FK H K GKLPNY VVEQR
Sbjct  205   DSLDENGLSFGIYYQNIPATFFFKSLRRIKHLVKFHSYALKFKLHAKLGKLPNYSVVEQR  264

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  265   YFDVDLFPANDDHPSHDVALGQRFVKEVYETLRSSPQWEEMALLITYDEHGGFYDHVPTP  324

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+G V+H P GP P+S+YEHSSIP
Sbjct  325   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFLISPWIEKGTVIHEPEGPTPHSQYEHSSIP  384

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE L E  + LR   A+ED+ L
Sbjct  385   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRIRESPRQDCPEKLPEVTQLLRPRGAREDSKL  444

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V++   Y+  A  KFL     A + G 
Sbjct  445   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVSEGNKYAEDAVEKFLEAGVAALEAG-  501

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATKFL  1596
               D + +   +   +  T+P  P   A K++
Sbjct  502   -ADENTIVTMRPSLTTRTSP-SPSEGANKYI  530



>ref|XP_010482768.1| PREDICTED: non-specific phospholipase C1-like [Camelina sativa]
Length=531

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/500 (57%), Positives = 361/500 (72%), Gaps = 17/500 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  P+I+G+ G+ESNPL  S    +  ++ +   N +
Sbjct  35    PIKTIVVVVMENRSFDHILGWLKSTRPDIDGLTGQESNPLNVS----DPNSEKIFVSNDA  90

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +PTM GFA  +E  + GM+  VM+GF P
Sbjct  91    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPTMNGFAQQSESMEPGMAKNVMSGFKP  144

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF V DRWFASVP STQPNR +VHSATSHG +SN  K L++GFPQKTIF
Sbjct  145   EVLPVYSELANEFGVFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLVKGFPQKTIF  204

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+T F+++LR++K++  FH + + FK H K GKLPNY VVEQR
Sbjct  205   DSLDENGLSFGIYYQNIPATFFFKSLRRIKHLVKFHSYALKFKLHAKLGKLPNYSVVEQR  264

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  265   YFDVDLFPANDDHPSHDVALGQRFVKEVYETLRSSPQWEEMALLITYDEHGGFYDHVPTP  324

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+G V+H P GP P+S+YEHSSIP
Sbjct  325   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFLISPWIEKGTVIHEPDGPTPHSQYEHSSIP  384

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE L E  + LR   A+ED+ L
Sbjct  385   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRIRDSPRQDCPEKLPEVTQLLRPRGAREDSKL  444

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V++   Y+  A  KFL     A + G 
Sbjct  445   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVSEGNKYAEDAVEKFLEAGVAALEAG-  501

Query  1504  HGDYSVVALSKQPPSPNTTP  1563
               D + +   +   +  T+P
Sbjct  502   -ADENTIVTMRPSLTTRTSP  520



>ref|XP_010521945.1| PREDICTED: non-specific phospholipase C1 [Tarenaya hassleriana]
Length=528

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/507 (57%), Positives = 364/507 (72%), Gaps = 19/507 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  PEI+G+ GKESNPL  S    +  +  +   N +
Sbjct  37    PIKTIVVVVMENRSFDHILGWLKSTRPEIDGLTGKESNPLNVS----DPNSPEIFVSNDA  92

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +P M GFA  AE   +GM+  VM GF P
Sbjct  93    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPKMNGFAQQAESMGSGMAKNVMGGFKP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +P+Y EL  EFAV DRWFASVP STQPNR +VHSATSHG +SN  K L+ GFPQKTIF
Sbjct  147   EVLPIYTELANEFAVFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLVLGFPQKTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E G SFGIYYQ  P+TLF+++LR+LK++  FH + + FK H K GKLPNY VVEQR
Sbjct  207   DSLEENGLSFGIYYQNIPATLFFKSLRRLKHLVKFHSYALKFKLHAKLGKLPNYSVVEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKE+Y+ LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  267   YFDVNLFPANDDHPSHDVAAGQRFVKEIYDTLRSSPQWKEMALLITYDEHGGFYDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG++GP P+ F FDRLGVRVP +++SPWIE+G V+H P GP P S++EHSSIP
Sbjct  327   VKGVPNPDGIVGPDPFYFGFDRLGVRVPTLLISPWIEKGTVIHEPDGPTPYSQFEHSSIP  386

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK--LRSAEAKEDAN  1320
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE L E VK  LR    KE++ 
Sbjct  387   ATVKKLFNLKSNFLTKRDAWAGTFEKYFYLRHSPREDCPEKLPE-VKGSLRPWGPKEESK  445

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E++Q+A+ L GDH+   Y    + +NM+VA+A  Y+  A +KFL   + A Q G
Sbjct  446   LSEFQMELIQLASQLVGDHLLNSY--PDIGKNMTVAQANRYAEEAVHKFLEAGKAALQAG  503

Query  1501  IHGDYSVVALSKQPPSPNTTPRKPKSF  1581
                D + +   +   +  T PR   SF
Sbjct  504   --ADENAIVTMRPSLTTQTGPRFTSSF  528



>ref|XP_009118978.1| PREDICTED: non-specific phospholipase C1 [Brassica rapa]
Length=529

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/509 (57%), Positives = 360/509 (71%), Gaps = 21/509 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+K   PEI+G+ GKESNPL  S    +  +  +   N +
Sbjct  33    PIKTIVVVVMENRSFDHILGWLKPTRPEIDGLTGKESNPLNVS----DPNSKKIYVSNDA  88

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +P M GFA  AE  + GM+  VM+GF P
Sbjct  89    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPKMNGFAQEAESMEPGMAKNVMSGFKP  142

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF + DRWFASVP STQPNR +VHSATSHG +SN  K LI GFPQKTIF
Sbjct  143   EVLPVYTELANEFGIFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLIRGFPQKTIF  202

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E G SFGIYYQ  P+T F+++LR+LK++  FH + + FK H K GKLPNY V+EQR
Sbjct  203   DSLEETGLSFGIYYQNIPATFFFKSLRRLKHLVKFHSYALKFKLHAKLGKLPNYSVIEQR  262

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  263   YFDIDLFPANDDHPSHDVAAGQRFVKEVYETLRSSPQWEEMALLITYDEHGGFYDHVPTP  322

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+G V+H P GP P S+YEHSSIP
Sbjct  323   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFIISPWIEKGTVIHEPDGPTPTSQYEHSSIP  382

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE LAE  + LR   AKED+ L
Sbjct  383   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRIRDSPRQDCPEKLAEVERSLRPWGAKEDSKL  442

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V +   Y+  A  KFL   + A + G 
Sbjct  443   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVREGNKYAEDAVQKFLEAGKAALEAG-  499

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATK  1590
               D + +   +    P+ T R   S  TK
Sbjct  500   -ADENTIVTMR----PSLTTRTSPSDGTK  523



>ref|XP_002511167.1| Phospholipase C 4 precursor, putative [Ricinus communis]
 gb|EEF51769.1| Phospholipase C 4 precursor, putative [Ricinus communis]
Length=517

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/479 (59%), Positives = 348/479 (73%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHM+GWMK ++NP INGV G E NP+ T    +N T   + F N 
Sbjct  32    PIKTIVVLVMENRSFDHMIGWMKKTVNPAINGVTGTECNPVST----KNPTRQSICFTND  87

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG             P+M GF   A      +S  VM GF 
Sbjct  88    AEFVDPDPGHSFEAVEQQVFG---------NGSIPSMSGFVEQALTMSPNLSETVMKGFR  138

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE+VPVY  LV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L +G+PQKTI
Sbjct  139   PESVPVYAALVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAQGYPQKTI  198

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G +FGIY+Q  P+TLFYRN+RKLKYI  FHQFD+ FK   + GKLP+  V+E 
Sbjct  199   FDSLHENGKNFGIYFQNIPTTLFYRNMRKLKYIFKFHQFDLKFKKDARNGKLPSLTVIEP  258

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQK VKEVYEALR SPQWNE L +I YDEHGGFYDHV T
Sbjct  259   RYFDLKGLPANDDHPSHDVANGQKLVKEVYEALRGSPQWNETLLVITYDEHGGFYDHVKT  318

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSSI
Sbjct  319   PFADVPNPDGNTGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVVSGPKGPAPNSEFEHSSI  378

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+   T+PR DCPETL +   LRS EAKED++L
Sbjct  379   PATIKKMFNLPSNFLTHRDAWAGTFEGVVGELTSPRTDCPETLPDVAPLRSTEAKEDSSL  438

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P  + + M+V +A  Y   A ++F+   + A   G
Sbjct  439   SEFQSEVVQLAAVLNGDHFLSS-FPDGMSKKMNVREAHQYVKGAVSRFIRASKEAITLG  496



>ref|XP_010457889.1| PREDICTED: non-specific phospholipase C1 [Camelina sativa]
Length=530

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/500 (57%), Positives = 360/500 (72%), Gaps = 17/500 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  P+I+G+ G+ESNPL  S    +  ++ +   N +
Sbjct  34    PIKTIVVVVMENRSFDHILGWLKSTRPDIDGLTGQESNPLNVS----DPNSEKIFVSNDA  89

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +PTM GFA  +E  + GM+  VM+GF P
Sbjct  90    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPTMNGFAQQSESMEPGMAKNVMSGFKP  143

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF V DRWFASVP STQPNR +VHSATSHG +SN  K L++GFPQKTIF
Sbjct  144   EVLPVYTELANEFGVFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLVKGFPQKTIF  203

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+T F+++LR++K++  FH + + FK H K GKLPNY VVEQR
Sbjct  204   DSLDENGLSFGIYYQNIPATFFFKSLRRIKHLVKFHSYALKFKLHAKLGKLPNYSVVEQR  263

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  264   YFDVNLFPANDDHPSHDVALGQRFVKEVYETLRSSPQWEEMALLITYDEHGGFYDHVPTP  323

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+  V+H P GP P+S+YEHSSIP
Sbjct  324   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFLISPWIEKATVIHEPDGPTPHSQYEHSSIP  383

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE L E  + LR   A+ED+ L
Sbjct  384   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRIRDSPRQDCPEKLPEVTQLLRPRGAREDSKL  443

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V++   Y+  A  KFL     A Q G 
Sbjct  444   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVSEGNKYAEDAVEKFLEAGMAALQAG-  500

Query  1504  HGDYSVVALSKQPPSPNTTP  1563
               D + +   +   +  T+P
Sbjct  501   -ADENTIVTMRPSLTTRTSP  519



>ref|XP_006645376.1| PREDICTED: non-specific phospholipase C2-like [Oryza brachyantha]
Length=527

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/480 (60%), Positives = 349/480 (73%), Gaps = 14/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK LNPEI+GV G E NP      A + ++  V FG  +
Sbjct  36    PIKTVVVVVMENRSFDHMLGWMKRLNPEIDGVTGTEWNPT----NASDPSSGRVYFGEGA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             +YVDPDPGHS Q+I +QIFG   S D++G      M GF   A      M+ AVMNGF P
Sbjct  92    EYVDPDPGHSFQEIRQQIFG---SDDASGPA---KMDGFVQQARSLGDNMTAAVMNGFSP  145

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             ++V VY+ELVREFAV DRWFASVP+STQPNRLFVHS TS GATSN+ + L +G+PQ+TIF
Sbjct  146   DSVSVYRELVREFAVFDRWFASVPSSTQPNRLFVHSGTSGGATSNNPELLAKGYPQRTIF  205

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +++ +AG SFG+YYQ  P+ LFYRNLRKLKY+  FH F   F+ H   G LPNY VVEQ 
Sbjct  206   DNVHDAGLSFGVYYQDVPAVLFYRNLRKLKYLTKFHPFHGAFRDHAARGALPNYAVVEQH  265

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K  P NDDHPSHDVF+GQ  VKEVYE LR+SPQWN  L LI YDEHGGF+DHV TP
Sbjct  266   YMDSKSHPANDDHPSHDVFQGQMLVKEVYETLRASPQWNHTLLLITYDEHGGFFDHVATP  325

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
             V GVP+PDG++GP PYNF FDRLGVRVP I +SPWI++G V+HGP+G P   SEYEHSSI
Sbjct  326   VKGVPSPDGIVGPPPYNFTFDRLGVRVPTIAISPWIDKGTVVHGPNGSPTSTSEYEHSSI  385

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKK+F+L Q FLT+RDAWAGTFE+V+ TRT PR DCPE L  P ++R  EA E+A L
Sbjct  386   PATVKKLFDLPQDFLTKRDAWAGTFESVVQTRTEPRTDCPEQLPMPTRIRLTEANEEAKL  445

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q+E+VQ+A+VL GDH         + + M+V +   Y   A   F     +A++ G+
Sbjct  446   SEFQQELVQLASVLNGDHQLSGLQ-DMIRDRMNVREGIAYMRGAVKSFFEAGMSAKRMGV  504



>ref|XP_006848189.1| hypothetical protein AMTR_s00029p00239010 [Amborella trichopoda]
 gb|ERN09770.1| hypothetical protein AMTR_s00029p00239010 [Amborella trichopoda]
Length=528

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/513 (56%), Positives = 362/513 (71%), Gaps = 21/513 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDHMLGW+KS  PEI+G+ G ESN L       +  +  ++  N +
Sbjct  34    PIKTIVVVVMENRSFDHMLGWLKSQLPEIDGLHGNESNRL----SVFDEKSPEIVVSNDA  89

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
             ++VDPDPGHS Q I EQIFG   S D+    LEPTM GF   A   + GM+  VM+GF P
Sbjct  90    EFVDPDPGHSFQAIREQIFG---SNDTT---LEPTMSGFVQQAATMEDGMAKTVMSGFRP  143

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY  L +EF V DRWF SVP STQPNR +VHSATSHGA+SN  K L+ GFPQKTIF
Sbjct  144   EVLPVYSTLAKEFTVFDRWFCSVPTSTQPNRFYVHSATSHGASSNVRKDLVHGFPQKTIF  203

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P TLFY +LRKLKY+  FHQ+ + FK H   G LPNYVV+EQ+
Sbjct  204   DSLDENGLSFGIYYQNIPPTLFYNSLRKLKYVTKFHQYSLSFKLHAMLGILPNYVVIEQK  263

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+   P NDDHPSHD+ EGQKFVKE+YE LR+SPQW EM+ LI YDEHGGFYDHVPTP
Sbjct  264   YFDVVGFPANDDHPSHDIAEGQKFVKEIYETLRASPQWKEMMLLITYDEHGGFYDHVPTP  323

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V  VPNPDG+IGP+P+ F+FDRLGVRVP +++SPWIE+G V+H P GP P S YEHSS+P
Sbjct  324   VKEVPNPDGIIGPEPFYFKFDRLGVRVPTLLISPWIEKGTVIHEPEGPTPYSHYEHSSVP  383

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAG+FE     R TPR+DCPE L E V+ LR  +  EDA L
Sbjct  384   ATVKKLFNLKSNFLTKRDAWAGSFEKYFYIRDTPREDCPEKLPEVVQSLRHKDPNEDAKL  443

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             TE+Q E++Q+A+ L GDH+   Y    + + M+V +A  Y+  A ++FL     A + G 
Sbjct  444   TEFQVELIQLASQLNGDHVLNSY--PDMGKTMTVGEANRYAEDAVSRFLEAGRAALKAGA  501

Query  1504  HGDYSVVALSKQPPSPNTTPRKPKSFATKFLSC  1602
             + + ++V +      P+ T R+   F +   S 
Sbjct  502   N-ETAIVTM-----RPSLTSRRAGGFTSYLQSA  528



>ref|XP_006417823.1| hypothetical protein EUTSA_v10007332mg [Eutrema salsugineum]
 gb|ESQ36176.1| hypothetical protein EUTSA_v10007332mg [Eutrema salsugineum]
Length=533

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/500 (57%), Positives = 359/500 (72%), Gaps = 17/500 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  PEI+G+ GKESNPL  S    +  +  +   + +
Sbjct  37    PIKTIVVVVMENRSFDHILGWLKSTRPEIDGLTGKESNPLNVS----DPNSQKIFVSDDA  92

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +P M GFA  +E  + GM+  VM+GF P
Sbjct  93    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPKMNGFAQQSESMEPGMAKNVMSGFKP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF + DRWFASVP STQPNR +VHSATSHG +SN  K LI GFPQKTIF
Sbjct  147   EVLPVYTELANEFGIFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLIRGFPQKTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E G SFGIYYQ  P+T F+++LR+LK++  FH + + FK H K GKLPNY VVEQR
Sbjct  207   DSLEENGLSFGIYYQNIPATFFFKSLRRLKHLVKFHSYALKFKLHAKLGKLPNYSVVEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  267   YFDIDLFPANDDHPSHDVAAGQRFVKEVYETLRSSPQWEEMALLITYDEHGGFYDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+G V+H P GP P+S++EHSSIP
Sbjct  327   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFIISPWIEKGTVVHEPDGPTPHSQFEHSSIP  386

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R + RKDCPE LAE  + LR   AKED+ L
Sbjct  387   ATVKKLFNLKSNFLTKRDAWAGTFEKYFHIRDSARKDCPEKLAEVERSLRPWGAKEDSKL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V++   Y+  A  KF+   + A + G 
Sbjct  447   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVSEGNKYAEDAVQKFIEAGKTALEAG-  503

Query  1504  HGDYSVVALSKQPPSPNTTP  1563
               D + +   +   +  T+P
Sbjct  504   -ADENTIVTMRPSLTTRTSP  522



>ref|XP_007137903.1| hypothetical protein PHAVU_009G165500g [Phaseolus vulgaris]
 gb|ESW09897.1| hypothetical protein PHAVU_009G165500g [Phaseolus vulgaris]
Length=515

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/479 (59%), Positives = 348/479 (73%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKS-LNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIK VVVLV ENRSFDHMLGWMK  +N  INGV G E NP+ T G  Q+S    + F + 
Sbjct  30    PIKNVVVLVMENRSFDHMLGWMKERINALINGVTGDECNPVSTKGSKQDS----ICFTDD  85

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS +D+ +Q+FG+       GK   P+M GF   A      +S  VM GF 
Sbjct  86    AEFVDPDPGHSFEDVLQQVFGS-------GKI--PSMNGFVEQALSVSQNLSETVMKGFK  136

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PEAVPVY  LV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  ++L +G+PQKTI
Sbjct  137   PEAVPVYAALVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKRQLAKGYPQKTI  196

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+SM E G  FGIY+Q  P+TLFYRNLRKLKY+  FHQFD+ FK   + GKLP   V+E 
Sbjct  197   FDSMHENGLDFGIYFQNIPTTLFYRNLRKLKYVFKFHQFDLKFKRDARNGKLPPLTVIEP  256

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQ  VKEVYEALR+SPQWNE LF+I YDEHGGF+DHV T
Sbjct  257   RYFDLKGLPANDDHPSHDVAHGQMLVKEVYEALRASPQWNETLFIITYDEHGGFFDHVKT  316

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   +PNPDG  GP PY F+FDRLGVRVP IM+SPWI++G V+ G  GP  NSE+EHSSI
Sbjct  317   PFVNIPNPDGNTGPAPYFFKFDRLGVRVPTIMISPWIKKGTVISGAKGPAENSEFEHSSI  376

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KKIFNL + FLT RDAWAGTFE V+   ++PR DCP TL +   LRS EAKEDA L
Sbjct  377   PATIKKIFNLSSNFLTHRDAWAGTFEQVVGELSSPRTDCPVTLPDVTPLRSTEAKEDAGL  436

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + MSV +A +Y   A ++F+   + A + G
Sbjct  437   SEFQSEVVQLAAVLNGDHFLSS-FPDEMSKKMSVKEAHEYVRGAVSRFIRASKEAIKLG  494



>gb|KFK43042.1| hypothetical protein AALP_AA1G070800 [Arabis alpina]
Length=529

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/479 (59%), Positives = 354/479 (74%), Gaps = 15/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  PEI+G+ G+ESNPL  S    +  ++ +   + +
Sbjct  33    PIKTIVVIVMENRSFDHILGWLKSTRPEIDGLTGQESNPLNVS----DPNSEKIFVSDDA  88

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +P M GFA  +E    GM+  VM+GF P
Sbjct  89    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPKMNGFAQQSESMDPGMAKNVMSGFKP  142

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF V DRWFASVP STQPNR +VHSATSHG +SN  K L++GFPQKTIF
Sbjct  143   EVLPVYTELANEFGVFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLVKGFPQKTIF  202

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+T F+++LR++K++  FH + + FK H K GKLPNY VVEQR
Sbjct  203   DSLDENGLSFGIYYQNIPATFFFKSLRRIKHLVKFHIYALKFKLHAKLGKLPNYSVVEQR  262

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE +RSSPQWNEM  LI YDEHGGFYDHVPTP
Sbjct  263   YFDIDLFPANDDHPSHDVAAGQRFVKEVYETVRSSPQWNEMALLITYDEHGGFYDHVPTP  322

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+G V+H P GP P+S++EHSSIP
Sbjct  323   VKGVPNPDGIIGPDPWYFGFDRLGVRVPTFIISPWIEKGTVIHEPDGPTPHSQFEHSSIP  382

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE LAE  + LR   AKED+ L
Sbjct  383   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRIRDSPRQDCPEKLAEVKRSLRPWGAKEDSKL  442

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V++   Y+  A  KF+   + A + G
Sbjct  443   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVSEGNKYAEDAVQKFIEAGKAALEAG  499



>ref|XP_004138043.1| PREDICTED: phospholipase C 3-like [Cucumis sativus]
 ref|XP_004173295.1| PREDICTED: phospholipase C 3-like [Cucumis sativus]
 gb|KGN63477.1| hypothetical protein Csa_1G001490 [Cucumis sativus]
Length=519

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/479 (58%), Positives = 349/479 (73%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKS-LNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDHM+GWMK  +NP+INGV G E NP+ T    +N   + + F + 
Sbjct  34    PIKTVVVLVMENRSFDHMIGWMKKYINPQINGVTGDECNPVST----KNPNPETICFTDD  89

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS +D+ +Q+FG+            P+M GF   A      +S  VM GF 
Sbjct  90    AEFVDPDPGHSFEDVLQQVFGS---------NSIPSMSGFVEQALSMSPNLSETVMKGFK  140

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PEAVP+Y  LVREFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  141   PEAVPIYGALVREFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAMGYPQKTI  200

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G +FGIY+Q  P+TLFYRNLRKLKYI  FHQ+D+ FK   + GKLP+  V+E 
Sbjct  201   FDSLHENGINFGIYFQNIPTTLFYRNLRKLKYIFKFHQYDLKFKKDARNGKLPSLTVIEP  260

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDL  +P NDDHPSHDV  GQK VKEVYE LR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  261   RYFDLVGMPANDDHPSHDVANGQKLVKEVYETLRASPQWNETLLIITYDEHGGFYDHVKT  320

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+  P GP PNSE+EHSSI
Sbjct  321   PFVNVPNPDGNTGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVISSPKGPTPNSEFEHSSI  380

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KKIFN+ + FLT RDAWAGTFE ++ + T+PR DCP TL E   LR  EA E++ L
Sbjct  381   PATIKKIFNIPSNFLTHRDAWAGTFEDIVDQLTSPRTDCPVTLPEVTPLRKTEANENSGL  440

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P+++ E M++ +A DY+  A ++F+   + A + G
Sbjct  441   SEFQSEVVQLAAVLNGDHFLSS-FPNEISEKMTIKEAHDYTRGAVSRFIRASKEAIKLG  498



>ref|NP_172203.2| non-specific phospholipase C1 [Arabidopsis thaliana]
 sp|Q8L7Y9.1|NPC1_ARATH RecName: Full=Non-specific phospholipase C1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM74513.1| At1g07230/F10K1_4 [Arabidopsis thaliana]
 dbj|BAC22506.1| phosphatidylglycerol specific phospholipase C [Arabidopsis thaliana]
 gb|AAW80856.1| At1g07230 [Arabidopsis thaliana]
 gb|AEE28095.1| non-specific phospholipase C1 [Arabidopsis thaliana]
Length=533

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/500 (57%), Positives = 358/500 (72%), Gaps = 17/500 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  PEI+G+ GKESNPL  S    +  +  +   + +
Sbjct  37    PIKTIVVVVMENRSFDHILGWLKSTRPEIDGLTGKESNPLNVS----DPNSKKIFVSDDA  92

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +P M GFA  +E  + GM+  VM+GF P
Sbjct  93    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPKMNGFAQQSESMEPGMAKNVMSGFKP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF V DRWFASVP STQPNR +VHSATSHG +SN  K L++GFPQKTIF
Sbjct  147   EVLPVYTELANEFGVFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLVKGFPQKTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+T F+++LR+LK++  FH + + FK   K GKLPNY VVEQR
Sbjct  207   DSLDENGLSFGIYYQNIPATFFFKSLRRLKHLVKFHSYALKFKLDAKLGKLPNYSVVEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  267   YFDIDLFPANDDHPSHDVAAGQRFVKEVYETLRSSPQWKEMALLITYDEHGGFYDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWIE+G V+H P GP P+S++EHSSIP
Sbjct  327   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFLISPWIEKGTVIHEPEGPTPHSQFEHSSIP  386

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE L E  + LR   AKED+ L
Sbjct  387   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRIRDSPRQDCPEKLPEVKLSLRPWGAKEDSKL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V++   Y+  A  KFL     A + G 
Sbjct  447   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVSEGNKYAEDAVQKFLEAGMAALEAG-  503

Query  1504  HGDYSVVALSKQPPSPNTTP  1563
               D + +   +   +  T+P
Sbjct  504   -ADENTIVTMRPSLTTRTSP  522



>ref|XP_008464423.1| PREDICTED: non-specific phospholipase C6 [Cucumis melo]
Length=519

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/479 (58%), Positives = 349/479 (73%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKS-LNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDHM+GWMK  +NP+INGV G E NP+ T    +N   + + F + 
Sbjct  34    PIKTVVVLVMENRSFDHMIGWMKKYVNPKINGVTGDECNPVST----KNPNPETICFTDD  89

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS +D+ +Q+FG+            P+M GF   A      +S  VM GF 
Sbjct  90    AEFVDPDPGHSFEDVLQQVFGS---------NSIPSMSGFVEQALSMSPNLSETVMKGFK  140

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PEAVP+Y  LVREFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  141   PEAVPIYGALVREFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAMGYPQKTI  200

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G +FGIY+Q  P+TLFYRNLRKLKYI  FHQ+D+ FK   + GKLP+  V+E 
Sbjct  201   FDSLHENGINFGIYFQNIPTTLFYRNLRKLKYIFKFHQYDLKFKKDARNGKLPSLTVIEP  260

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDL  +P NDDHPSHDV  GQK VKEVYE LR+SPQWNE L +I YDEHGGF+DHV T
Sbjct  261   RYFDLVGMPANDDHPSHDVANGQKLVKEVYETLRASPQWNETLLIITYDEHGGFFDHVKT  320

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+  P GP PNSE+EHSSI
Sbjct  321   PFVNVPNPDGNTGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVISSPKGPTPNSEFEHSSI  380

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KKIFN+ + FLT RDAWAGTFE ++ + T+PR DCP TL E   LR  EA E++ L
Sbjct  381   PATIKKIFNIPSNFLTHRDAWAGTFEDIVDQLTSPRTDCPVTLPEVTPLRKTEANENSGL  440

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P+++ E M+V +A DY+  A ++F+   + A + G
Sbjct  441   SEFQSEVVQLAAVLNGDHFLSS-FPNEISEKMTVKEAHDYTRGAVSRFIRASKEAIKLG  498



>ref|XP_011080409.1| PREDICTED: non-specific phospholipase C2 [Sesamum indicum]
Length=493

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 354/496 (71%), Gaps = 17/496 (3%)
 Frame = +1

Query  85    VVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQYVD  264
             VVVLV ENRSFDHMLGWMK LNPEINGV G ESN + T+    +  +  V FG++S +VD
Sbjct  12    VVVLVMENRSFDHMLGWMKKLNPEINGVDGSESNLINTT----DPKSTRVFFGSQSHFVD  67

Query  265   PDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVPEAVP  444
             PDPGHS Q I EQIFG   S D++     P M GFA  A+     M  +VMNGF P  V 
Sbjct  68    PDPGHSFQAIREQIFG---SNDTSANP--PPMNGFAQQAKSMDPNMPQSVMNGFDPSKVA  122

Query  445   VYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIFESMD  624
             VYK LV EFAV DRWFASVPASTQPNRL+VHSATSHGATSN    L +G+PQ+TIFE +D
Sbjct  123   VYKALVSEFAVFDRWFASVPASTQPNRLYVHSATSHGATSNVAALLAKGYPQRTIFEDLD  182

Query  625   EAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQRYFDL  804
             +AG SFGIY+Q  P+TLFYR+LRKLKYI  FH + + FK     GKLP YVVVEQRY D 
Sbjct  183   DAGISFGIYFQNIPATLFYRDLRKLKYIGKFHPYGVSFKKDATNGKLPGYVVVEQRYMDS  242

Query  805   KILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTPVTGV  984
             K  P NDDHPSHDV++GQ FVKEVYE LR SPQWNE L +I YDEHGGFYDHV TP  GV
Sbjct  243   KAEPANDDHPSHDVYQGQMFVKEVYETLRGSPQWNETLLVITYDEHGGFYDHVATPNHGV  302

Query  985   PNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSIPATV  1161
             P+PDG++GP P+ F+FDRLGVRVP I+VSPW+++  V+HGP+G P P SEYEHSSIPATV
Sbjct  303   PSPDGIVGPDPFFFKFDRLGVRVPTIVVSPWVQKATVVHGPNGSPSPTSEYEHSSIPATV  362

Query  1162  KKIFNLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANLTEYQ  1335
             +KIFNL+   LT+R+AWAGTF+ ++     PR DCPE L  PVK+R  +A EDA ++E+Q
Sbjct  363   RKIFNLSSPPLTKREAWAGTFDGILQILKQPRTDCPEKLPTPVKIRQGDANEDAKVSEFQ  422

Query  1336  KEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGDY  1515
             +E++Q+AAVL GD +    YP K+ +NMSV +  +Y   A   F      A++ G+    
Sbjct  423   QELIQLAAVLKGDDLLTS-YPGKIGKNMSVREGKEYMESAVKSFFEAGFAAKKMGVDEQQ  481

Query  1516  SVVALSKQPPSPNTTP  1563
              V    K  PS +T P
Sbjct  482   IV----KMRPSLSTRP  493



>gb|AAF82197.1|AC067971_5 Contains similarity to an unknown protein T8P19.120 gi|6523092 
from Arabidopsis thaliana BAC T8P19 gb|AL133315. ESTs gb|R84021, 
gb|AI992399, gb|H76814, gb|F15169, gb|AA585873, and gb|AA605516 
come from this gene [Arabidopsis thaliana]
Length=533

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/500 (57%), Positives = 357/500 (71%), Gaps = 17/500 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  PEI+G+ GKESNPL  S    +  +  +   + +
Sbjct  37    PIKTIVVVVMENRSFDHILGWLKSTRPEIDGLTGKESNPLNVS----DPNSKKIFVSDDA  92

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +P M GFA  +E  + GM+  VM+GF P
Sbjct  93    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPKMNGFAQQSESMEPGMAKNVMSGFKP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF V DRWFASVP STQPNR +VHSATSHG +SN  K L++GFPQKTIF
Sbjct  147   EVLPVYTELANEFGVFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLVKGFPQKTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+T F+++LR+LK++  FH + + FK   K GKLPNY VVEQR
Sbjct  207   DSLDENGLSFGIYYQNIPATFFFKSLRRLKHLVKFHSYALKFKLDAKLGKLPNYSVVEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  267   YFDIDLFPANDDHPSHDVAAGQRFVKEVYETLRSSPQWKEMALLITYDEHGGFYDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++S WIE+G V+H P GP P+S++EHSSIP
Sbjct  327   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFLISSWIEKGTVIHEPEGPTPHSQFEHSSIP  386

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE L E  + LR   AKED+ L
Sbjct  387   ATVKKLFNLKSHFLTKRDAWAGTFEKYFRIRDSPRQDCPEKLPEVKLSLRPWGAKEDSKL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V++   Y+  A  KFL     A + G 
Sbjct  447   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVSEGNKYAEDAVQKFLEAGMAALEAG-  503

Query  1504  HGDYSVVALSKQPPSPNTTP  1563
               D + +   +   +  T+P
Sbjct  504   -ADENTIVTMRPSLTTRTSP  522



>ref|XP_007037999.1| Non-specific phospholipase C6 [Theobroma cacao]
 gb|EOY22500.1| Non-specific phospholipase C6 [Theobroma cacao]
Length=521

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/479 (59%), Positives = 348/479 (73%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHM+GWMK S+NP +NGV G E NP+ T    +N   + + F + 
Sbjct  36    PIKTIVVLVMENRSFDHMVGWMKKSINPAVNGVTGDECNPVST----KNPNPESICFTDD  91

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+            P+M GF   A      +S  VM GF 
Sbjct  92    AEFVDPDPGHSFEAVEQQVFGSASI---------PSMSGFVEQALSMSQNLSETVMKGFR  142

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P+AVPVY  LV+EFA+ DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  143   PQAVPVYAALVKEFALFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAHGYPQKTI  202

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             FES+ E G  FGIY+Q  P+TLFYRNLRKLKY+  FHQFD+ FK   ++GKLP+  V+E 
Sbjct  203   FESLYENGKDFGIYFQNIPTTLFYRNLRKLKYVFKFHQFDLKFKKDARKGKLPSLTVIEP  262

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQK VKEVYE LR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  263   RYFDLKGLPANDDHPSHDVANGQKLVKEVYETLRASPQWNETLLVITYDEHGGFYDHVKT  322

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP P  F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSSI
Sbjct  323   PYVNVPNPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVISGPKGPTPNSEFEHSSI  382

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+   T+PR DCP TL +   LR+ EAKEDA L
Sbjct  383   PATIKKMFNLSSNFLTHRDAWAGTFEEVVAGLTSPRTDCPVTLPDVAPLRTTEAKEDAGL  442

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + MSV +A +Y   A ++F+   + A + G
Sbjct  443   SEFQSEVVQLAAVLNGDHFLSS-FPDEMGKKMSVKEAHEYVKGAVSRFIRASKEAIKLG  500



>ref|XP_011035177.1| PREDICTED: non-specific phospholipase C1-like [Populus euphratica]
Length=535

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/470 (60%), Positives = 348/470 (74%), Gaps = 16/470 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDH+LGW+KS  P+I+G++G ESN +     A +  +D V   + +
Sbjct  39    PIKTLVVLVMENRSFDHLLGWLKSTRPDIDGLSGSESNRI----SASDPNSDEVFVSDDA  94

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAERNQAGMSGAVMNGFV  429
              ++D DPGHS Q I EQIFG   S DS     +P  M GF   A+     MS  VM+GF 
Sbjct  95    VFIDSDPGHSFQAIREQIFG---SNDSFA---DPAPMNGFVQQAKSMGETMSKTVMSGFK  148

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P  +PVY EL  EFAV DRWFASVPASTQPNR +VHSATSHGA SN  K LI GFPQ+TI
Sbjct  149   PSLLPVYTELANEFAVFDRWFASVPASTQPNRFYVHSATSHGAMSNVRKDLIHGFPQRTI  208

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+D+ G SFGIYYQ  P+TLF+++LRKLK++  FH +++ FK H K GKLPNYVVVEQ
Sbjct  209   FDSLDDNGLSFGIYYQNIPATLFFKSLRKLKHLLKFHSYELKFKLHAKLGKLPNYVVVEQ  268

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+++ P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPT
Sbjct  269   RYFDVELFPANDDHPSHDVARGQRFVKEVYEILRSSPQWKEMALLITYDEHGGFYDHVPT  328

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVPNPDG+IGP PY FQFDRLG+RVP  ++SPW+++G V+H P GP P+S++EHSSI
Sbjct  329   PVRGVPNPDGIIGPDPYYFQFDRLGIRVPTFLISPWVDKGTVIHEPDGPRPDSQFEHSSI  388

Query  1150  PATVKKIFNLN-QFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDAN  1320
             PATVKK+FNLN  FLT RDAWAGTFE     R TPR DCPETL +    LR    KEDA+
Sbjct  389   PATVKKLFNLNSNFLTRRDAWAGTFENYFYLRDTPRDDCPETLPDVTTSLRPWGPKEDAS  448

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             L+E+Q EM+Q+A+ L GDH+  + YP  + ++M+V +A  Y+  A  +FL
Sbjct  449   LSEFQVEMIQLASQLNGDHVL-NAYP-DIGKSMTVGEANRYAEDAVRRFL  496



>ref|XP_009359424.1| PREDICTED: non-specific phospholipase C6-like [Pyrus x bretschneideri]
Length=529

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/480 (59%), Positives = 346/480 (72%), Gaps = 18/480 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVL+ ENRSFDHMLGWMK S+NP INGV GKE NP+ T       +   + F + 
Sbjct  42    PIKTVVVLIMENRSFDHMLGWMKKSVNPAINGVTGKECNPVSTKPAEPTKS---ICFSDD  98

Query  250   SQYVDPDPGHSIQDIYEQIFGA-PWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
             +++VDPDPGHS + + +Q+FG+ P           P+M GF   A      +S  VM GF
Sbjct  99    AEFVDPDPGHSFEAVEQQVFGSGPL----------PSMTGFVEQALSMSPNLSETVMKGF  148

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE+VPVY  LVREFAV DRWF+S+P  TQPNRLFV+SATSHG  S+  K+L  G+PQKT
Sbjct  149   RPESVPVYAALVREFAVFDRWFSSIPGPTQPNRLFVYSATSHGPPSHVKKQLASGYPQKT  208

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+ E G  FG+Y+Q  P+T+FYRN+RKLKY   FHQ+D+ FK   ++GKLPN  V+E
Sbjct  209   IFDSVHENGLDFGVYFQTTPTTMFYRNMRKLKYTFKFHQYDLKFKKDARKGKLPNLTVIE  268

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
              RYFDLK +P NDDHPSHDV  GQ+ VK+VYE LR+SPQWNE L +I YDEHGGF+DHV 
Sbjct  269   PRYFDLKGMPANDDHPSHDVANGQRLVKDVYETLRASPQWNETLLVITYDEHGGFFDHVQ  328

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP   VPNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSS
Sbjct  329   TPYVNVPNPDGNSGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVMSGPQGPTPNSEFEHSS  388

Query  1147  IPATVKKIFNLN-QFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             IPAT+KKIFNLN  FLT RDAWAGTFE V+ + ++PR DCP TL + V LR  EAKED N
Sbjct  389   IPATIKKIFNLNSNFLTHRDAWAGTFEQVVGQLSSPRTDCPVTLPDVVPLRKTEAKEDGN  448

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E+VQ+AAVL GDH     YP ++ + MSV +A +Y   A ++F+   + A   G
Sbjct  449   LSEFQGEVVQLAAVLNGDHFLSS-YPDEMSKKMSVREAHEYVQGAVSRFIRASKEAINLG  507



>ref|XP_010923059.1| PREDICTED: non-specific phospholipase C1 [Elaeis guineensis]
Length=543

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/471 (61%), Positives = 346/471 (73%), Gaps = 17/471 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWM--KSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGN  246
             PIKTVVVLV ENRSFDHMLGW+  KS  P+I+G+ G+ESN L     A +  +  +   +
Sbjct  43    PIKTVVVLVMENRSFDHMLGWLTTKSSRPDIDGLTGRESNRL----NASDPDSPEIFVSD  98

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAERNQAGMSGAVMNG  423
              + +VD DPGHS Q I EQIFG      SA    +P  M GFA  A     GM+  VM G
Sbjct  99    DAVFVDSDPGHSFQAIREQIFG------SADASADPAPMNGFAQQAHSMGLGMARTVMGG  152

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F P+AVPVY  L  EFAV DRWFASVPASTQPNR +VHSATSHGA SN  K LI GFPQK
Sbjct  153   FSPDAVPVYAALADEFAVFDRWFASVPASTQPNRFYVHSATSHGAMSNVRKDLIHGFPQK  212

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIF+S+DE G SFGIYYQ  P+TLF+++LRKLK++ +FH + + FK H   GKLPNYVVV
Sbjct  213   TIFDSLDEDGLSFGIYYQNIPATLFFKSLRKLKHLLSFHSYTLSFKLHALLGKLPNYVVV  272

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRYFD+ +LP NDDHPSHDV  GQ FVKEVYE LR+SPQW+E   +I YDEHGGFYDHV
Sbjct  273   EQRYFDIDLLPANDDHPSHDVGRGQSFVKEVYETLRASPQWDETALIITYDEHGGFYDHV  332

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTPV+GVPNPDG+IGP PY F+FDRLGVRVP I++SPWIE+G V+H P+GP  +S +EHS
Sbjct  333   PTPVSGVPNPDGIIGPDPYYFKFDRLGVRVPTILISPWIEKGTVIHEPNGPTTHSHFEHS  392

Query  1144  SIPATVKKIFNLN-QFLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNLN  FLT+RDAWAGTFE+  + R TPR DCPE L E   LR    +EDA
Sbjct  393   SIPATVKKLFNLNSNFLTKRDAWAGTFESHFSLRKTPRTDCPEKLPEVKTLRPFGPREDA  452

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
              L+E+Q E++Q+A+ L GDH+   Y   ++ + M+VA+A  Y+  A  +FL
Sbjct  453   TLSEFQMELIQLASQLNGDHVLNTY--PEIGKGMTVAQANRYAEDAVARFL  501



>ref|XP_002299814.1| phospholipase family protein [Populus trichocarpa]
 gb|EEE84619.1| phospholipase family protein [Populus trichocarpa]
Length=535

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/470 (60%), Positives = 348/470 (74%), Gaps = 16/470 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDH+LGW+KS  P+I+G++G ESN +     A +  +D V   + +
Sbjct  39    PIKTLVVLVMENRSFDHVLGWLKSTRPDIDGLSGSESNRI----SASDRNSDEVFVSDDA  94

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAERNQAGMSGAVMNGFV  429
              ++D DPGHS Q I EQIFG   S DS     +P  M GF   A+     MS  VM+GF 
Sbjct  95    VFIDSDPGHSFQAIREQIFG---SNDSFA---DPAPMNGFVQQAKSMGETMSKTVMSGFK  148

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P  +PVY EL  EFAV DRWFASVPASTQPNR +VHSATSHGA SN  K LI GFPQ+TI
Sbjct  149   PSLLPVYTELANEFAVFDRWFASVPASTQPNRFYVHSATSHGAMSNVRKDLIHGFPQRTI  208

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+D+ G SFGIYYQ  P+TLF+++LRKLK++  FH +++ FK H K GKLPNYVVVEQ
Sbjct  209   FDSLDDNGLSFGIYYQNIPATLFFKSLRKLKHLLKFHSYELKFKLHAKLGKLPNYVVVEQ  268

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+++ P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPT
Sbjct  269   RYFDVELFPANDDHPSHDVARGQRFVKEVYEILRSSPQWKEMALLITYDEHGGFYDHVPT  328

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVPNPDG+IGP PY FQFDRLG+RVP  ++SPWI++G V+H P GP P+S++EHSSI
Sbjct  329   PVRGVPNPDGIIGPDPYYFQFDRLGIRVPTFLISPWIDKGTVIHEPDGPRPDSQFEHSSI  388

Query  1150  PATVKKIFNLN-QFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDAN  1320
             PATVKK+FNLN  FLT RDAWAG+FE     R TPR DCPETL +    LR    KEDA+
Sbjct  389   PATVKKLFNLNSNFLTRRDAWAGSFENYFYLRDTPRDDCPETLPDVTTSLRPWGPKEDAS  448

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             L+E+Q EM+Q+A+ L GDH+  + YP  + ++M+V +A  Y+  A  +FL
Sbjct  449   LSEFQVEMIQLASQLNGDHVL-NAYP-DIGKSMTVGEANRYAEDAVRRFL  496



>ref|XP_009374252.1| PREDICTED: non-specific phospholipase C1-like [Pyrus x bretschneideri]
Length=532

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/481 (59%), Positives = 352/481 (73%), Gaps = 18/481 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTS--GGAQNSTNDVVLFGN  246
             PIKTVVV+V ENRSFDH+ GW+KS  P+I+G+ G ESNP+  S  G A+      V   N
Sbjct  36    PIKTVVVVVMENRSFDHIFGWLKSTRPDIDGLNGNESNPISVSQPGSAR------VRVSN  89

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
              + ++D DPGHS Q I EQIFG+  S ++        M GFA  AE    GM+  VM+GF
Sbjct  90    DAFFIDSDPGHSFQAIREQIFGSNESSENPAP-----MNGFAQQAESMGEGMARTVMSGF  144

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE +PVY  L  EFAV DRWFASVPASTQPNR +VHSATSHGA SN  K LI GFPQKT
Sbjct  145   KPEVLPVYTGLANEFAVFDRWFASVPASTQPNRFYVHSATSHGAMSNVRKDLIHGFPQKT  204

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+DE G  FGIYYQ  P+TLF+ +LRKLK++  FH + + FK H + GKLPNY V+E
Sbjct  205   IFDSLDENGLDFGIYYQNIPATLFFNSLRKLKHVMKFHSYALTFKLHARLGKLPNYAVIE  264

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD+K LP NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVP
Sbjct  265   QRYFDVKELPANDDHPSHDVARGQRFVKEVYETLRASPQWKEMALLITYDEHGGFYDHVP  324

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPV+GVP+PDG+ GP PY F+FDRLGVRVP I+VSPW+E+G V+H P+GP P+S++EHSS
Sbjct  325   TPVSGVPSPDGIEGPDPYYFRFDRLGVRVPTILVSPWVEKGTVIHEPTGPKPHSQFEHSS  384

Query  1147  IPATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETLAE-PVKLRSAEAKEDA  1317
             IPATVKK+FNL + FLT+RDAWAGTFE   T R+TPR DCPETL E    LR    +ED+
Sbjct  385   IPATVKKLFNLKSNFLTKRDAWAGTFENYFTLRSTPRDDCPETLPEVTTSLRPGGPREDS  444

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
             +L+E+Q E++Q+A+ L GDH+  + YP+ + E M+V +A  Y+  A  +FL     A + 
Sbjct  445   SLSEFQVELIQLASQLNGDHVL-NTYPN-IGETMTVREANIYAEDAVKRFLEAGRAALKA  502

Query  1498  G  1500
             G
Sbjct  503   G  503



>ref|XP_006307226.1| hypothetical protein CARUB_v10008826mg [Capsella rubella]
 gb|EOA40124.1| hypothetical protein CARUB_v10008826mg [Capsella rubella]
Length=530

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/479 (58%), Positives = 350/479 (73%), Gaps = 15/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  PEI+G+ G+ESNPL  S    +  +  V   + +
Sbjct  34    PIKTIVVVVMENRSFDHILGWLKSTRPEIDGLTGQESNPLNVS----DPNSKKVFVSDDA  89

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S D++G   +P M GFA  +E  + GM+  VM+GF P
Sbjct  90    VFVDMDPGHSFQAIREQIFG---SNDTSG---DPKMNGFAQQSESMEPGMAKNVMSGFKP  143

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EF V DRWFASVP STQPNR +VHSATSHG +SN  K L+ GFPQKTIF
Sbjct  144   EVLPVYTELANEFGVFDRWFASVPTSTQPNRFYVHSATSHGCSSNVKKDLVRGFPQKTIF  203

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G SFGIYYQ  P+T F+++LR++K++  FH + + FK H K GKLPNY VVEQR
Sbjct  204   DSLDENGLSFGIYYQNIPATFFFKSLRRIKHLVKFHSYALKFKLHAKLGKLPNYSVVEQR  263

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPTP
Sbjct  264   YFDIDLFPANDDHPSHDVAVGQRFVKEVYETLRSSPQWKEMALLITYDEHGGFYDHVPTP  323

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP P+ F FDRLGVRVP  ++SPWI++G V+H P GP P+S+YEHSSIP
Sbjct  324   VKGVPNPDGIIGPDPFYFGFDRLGVRVPTFLISPWIDKGTVIHEPDGPTPHSQYEHSSIP  383

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR+DCPE L E  + LR   A+E++ L
Sbjct  384   ATVKKLFNLKSHFLTKRDAWAGTFENYFRIRDSPRQDCPEKLPEVKQSLRPWGARENSKL  443

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E++Q+A+ L GDH+   Y    + +NM+V++   Y+  A  KFL     A + G
Sbjct  444   SEFQVELIQLASQLVGDHLLNSY--PDIGKNMTVSEGNKYAEDAVEKFLEAGMAALEAG  500



>ref|XP_004294247.1| PREDICTED: phospholipase C 3-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/479 (59%), Positives = 349/479 (73%), Gaps = 14/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDH+LGW+KS  PEI+G+ G+ESN L  S    + ++  V   + +
Sbjct  34    PIKTVVVLVMENRSFDHILGWLKSTRPEIDGLTGQESNRLSVS----DPSSPKVHVTSDA  89

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              ++D DPGHS Q I EQIFG+  S  +  +     M GFA  AE    GM+  VM+GF P
Sbjct  90    YFIDSDPGHSFQAIREQIFGSNRSSGAPAR-----MNGFAQQAESMSPGMAATVMSGFKP  144

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY  L   FAV DRWFASVPASTQPNR +VHSATSHGATSN  K LI GFPQ+TIF
Sbjct  145   EVLPVYTALANNFAVFDRWFASVPASTQPNRFYVHSATSHGATSNVRKDLIHGFPQRTIF  204

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE   SFGIYYQ  P++LF+++LRKLK++  FH + + FK H K G+LPNY V+EQR
Sbjct  205   DSLDENALSFGIYYQNIPASLFFKSLRKLKHVAKFHSYALKFKLHAKLGRLPNYAVIEQR  264

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+K +P NDDHPSHDV  GQ+FVKEVYE LR SPQW EM  LI YDEHGGFYDHVPTP
Sbjct  265   YFDVKEMPANDDHPSHDVARGQRFVKEVYETLRKSPQWKEMALLITYDEHGGFYDHVPTP  324

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
               GVP+PDG+ GP P+ F+FDRLGVRVP I+VSPW+E+G V+H P+GP P+S++EHSSIP
Sbjct  325   TEGVPSPDGITGPDPFYFRFDRLGVRVPTILVSPWVEKGTVIHEPTGPTPHSQFEHSSIP  384

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R TPR DCPETL E  K LR    +ED +L
Sbjct  385   ATVKKLFNLKSNFLTKRDAWAGTFENYFYIRDTPRDDCPETLPEVTKSLRPGGPREDVSL  444

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E++Q+A+ L GDH+  + YP+ + E M+V +A  Y+  A  +FL     A + G
Sbjct  445   SEFQVELIQLASQLNGDHVL-NTYPY-IGERMNVCEANSYAEDAVKRFLEAGRAALKAG  501



>ref|XP_008239487.1| PREDICTED: non-specific phospholipase C6 [Prunus mume]
Length=528

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/479 (58%), Positives = 349/479 (73%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHMLGWMK ++NP INGV GKE NP+ T    +N+    + F + 
Sbjct  43    PIKTIVVLVMENRSFDHMLGWMKKAINPAINGVTGKECNPVST----KNADPKSICFSDD  98

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+            P+M GF   A      +S  VM GF 
Sbjct  99    AEFVDPDPGHSFEAVEQQVFGS---------SSLPSMTGFVEQALSMSPNLSETVMKGFR  149

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE+VPVY  LVREFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  150   PESVPVYAALVREFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLASGYPQKTI  209

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E   +FG+Y+Q  P+T+FYRN+RKLKYI  FHQ+D+ FK   ++GKLP+  V+E 
Sbjct  210   FDSVHENDMNFGVYFQNIPTTMFYRNMRKLKYISKFHQYDLKFKKDARKGKLPSLTVIEP  269

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
              YFDL  +P NDDHPSHDV  GQK +KEVYE LR+SPQWNE L +I YDEHGGF+DHV T
Sbjct  270   AYFDLTGMPANDDHPSHDVANGQKLIKEVYETLRASPQWNETLLVITYDEHGGFFDHVKT  329

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSSI
Sbjct  330   PYVNVPNPDGNSGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVMSGPQGPTPNSEFEHSSI  389

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL+  FLT RDAWAGTFE V+ + T+PR DCPETL + V LRS EAKEDA L
Sbjct  390   PATIKKMFNLSSNFLTHRDAWAGTFEHVLGQLTSPRTDCPETLPDVVPLRSTEAKEDAGL  449

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+A VL GDH     +P ++ + MSV +A  Y   A ++F+   + A + G
Sbjct  450   SEFQGEVVQLAGVLNGDHFLSS-FPDEMSKKMSVKQAHGYVKGAVSRFIRASKEAIKLG  507



>gb|EYU46196.1| hypothetical protein MIMGU_mgv1a004566mg [Erythranthe guttata]
Length=520

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/486 (58%), Positives = 350/486 (72%), Gaps = 12/486 (2%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHMLGWMK LNPEINGV G E N + T+    +  +  V+FG+KS
Sbjct  34    PIKTVVVMVMENRSFDHMLGWMKKLNPEINGVDGSEYNRISTT----DPNSPRVVFGDKS  89

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VDPDPGHS Q I EQIFG+    +       P M GFA  A      M+ +VMNGF P
Sbjct  90    HFVDPDPGHSFQAIREQIFGS----NVTSSDRPPPMNGFAQQAFSMDPNMTQSVMNGFHP  145

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             + V VYK LV EFAV DRWFASVPASTQPNRL+VHS TSHGATSN    L +G+PQ+TIF
Sbjct  146   DKVAVYKSLVSEFAVFDRWFASVPASTQPNRLYVHSGTSHGATSNIAALLAKGYPQRTIF  205

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             E +D+AG SF IY+Q  P+T FYRNLRK+KY+  F  + + FK+  K+GKLP Y VVEQR
Sbjct  206   EDLDDAGVSFRIYFQNIPATFFYRNLRKVKYLLKFRPYALSFKSDAKKGKLPGYAVVEQR  265

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K+ P NDDHPSHDV++GQ FVKEVYE LR+SPQWNE L LI YDEHGGFYDHVPTP
Sbjct  266   YMDSKVEPANDDHPSHDVYQGQMFVKEVYETLRASPQWNETLLLITYDEHGGFYDHVPTP  325

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSI  1149
               GVP+PD ++GP P+ F+FDRLGVRVP I +SPWI++G V+HGP+G P P SEYEHSS+
Sbjct  326   NAGVPSPDDIVGPDPFFFKFDRLGVRVPTIAISPWIQKGTVVHGPNGSPTPTSEYEHSSV  385

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATV+KIFNL+   LT+R+AWAGTFE +  +   PR DCPE L  PV++R  EA E+A +
Sbjct  386   PATVRKIFNLSSPPLTKREAWAGTFEGIFGKLKQPRTDCPEQLPNPVRIRETEANEEAQV  445

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             TE+Q+E++Q+AAVL G+ +       K  ++M+V +  +Y   A   F      A++ GI
Sbjct  446   TEFQQELLQLAAVLKGEDVLTSNL-AKFGKDMTVREGKEYMESAVRSFFEAGLAAKKMGI  504

Query  1504  HGDYSV  1521
              G+  V
Sbjct  505   DGEQIV  510



>ref|XP_004981202.1| PREDICTED: uncharacterized protein LOC101779707 [Setaria italica]
Length=546

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/469 (60%), Positives = 349/469 (74%), Gaps = 14/469 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDH+LGW++   P+I+G+ G+ESN L     A + ++  +   +++
Sbjct  52    PIKTVVVVVMENRSFDHILGWLRRTRPDIDGLTGRESNHL----NASDPSSPEIFVTDEA  107

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVD DPGH  +DI EQIFG   S D++   + P M GFA NA     GM+  VM+GF P
Sbjct  108   GYVDSDPGHGFEDIREQIFG---SADTSA--VPPPMSGFAQNARGMGLGMAQNVMSGFKP  162

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             EA+PVY  L  EFAV DRWFASVP STQPNRLFVHSATSHG T N  K LI GFPQKTIF
Sbjct  163   EAIPVYASLADEFAVFDRWFASVPTSTQPNRLFVHSATSHGLTFNARKDLIHGFPQKTIF  222

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E G SFGIYYQ  P+TLFY++LR+LK++  FHQ+ + FK H K GKLPNY V+EQR
Sbjct  223   DSLEENGLSFGIYYQNIPATLFYQSLRRLKHLVKFHQYSLKFKLHAKWGKLPNYAVIEQR  282

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD ++ P NDDHPSHDV  GQ+FVKEVYE LR+SPQWNE   LI YDEHGGFYDHVPTP
Sbjct  283   YFDCELFPANDDHPSHDVARGQRFVKEVYETLRASPQWNETALLITYDEHGGFYDHVPTP  342

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVP PDG++GP PY F+F+RLGVRVP+ ++SPWIE+G V+H PSGP  +S+YEHSSIP
Sbjct  343   VVGVPQPDGIVGPDPYYFKFERLGVRVPSFLISPWIEKGTVIHEPSGPQESSQYEHSSIP  402

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R TPR DCPETL E  K LR    KED++L
Sbjct  403   ATVKKLFNLHSNFLTKRDAWAGTFENYFKIRKTPRTDCPETLPEVTKSLRPFGPKEDSSL  462

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             +E+Q E++Q+A+ L GDH+  + YP  +   M+V +A  Y+  A  +FL
Sbjct  463   SEFQVELIQLASQLNGDHVL-NTYP-DIGRTMTVGEANRYAEDAVARFL  509



>ref|XP_006436856.1| hypothetical protein CICLE_v10031232mg [Citrus clementina]
 ref|XP_006493213.1| PREDICTED: non-specific phospholipase C6-like [Citrus sinensis]
 gb|ESR50096.1| hypothetical protein CICLE_v10031232mg [Citrus clementina]
Length=523

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/479 (58%), Positives = 346/479 (72%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHMLGWMK ++NP INGV G E N + T    +   +  + F + 
Sbjct  38    PIKTIVVLVMENRSFDHMLGWMKKAINPRINGVTGNECNSVST----KTPKSQTICFTDD  93

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+          + P+M GF   A      +S  VM GF 
Sbjct  94    AEFVDPDPGHSFEAVEQQVFGS---------GVIPSMSGFVEQALSMSPNLSETVMKGFS  144

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
              EAVPVY  L+REFA+ DRWF+S+P  TQPNRLFV+SATSHG+TS+  K L +G+PQKTI
Sbjct  145   AEAVPVYAALIREFALYDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKLLAQGYPQKTI  204

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  PSTLFYRNLRKLKYI  FHQ+D+ FK   ++G LP+  V+E 
Sbjct  205   FDSLHENGIDFGIYFQTIPSTLFYRNLRKLKYIFKFHQYDLKFKRDARKGNLPSLTVIEP  264

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK  PGNDDHPSHDV  GQK VKEVYE LR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  265   RYFDLKGFPGNDDHPSHDVANGQKLVKEVYETLRASPQWNETLLVITYDEHGGFYDHVET  324

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP P  F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSSI
Sbjct  325   PYVNVPNPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVMSGPKGPTPNSEFEHSSI  384

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+ + T+PR DCPETL +   LR  EAKED  L
Sbjct  385   PATIKKMFNLSSNFLTHRDAWAGTFEEVVGQLTSPRTDCPETLPDVAPLRKTEAKEDGGL  444

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + M+V +A +Y+  A ++F+   + A + G
Sbjct  445   SEFQSEVVQLAAVLNGDHFLSS-FPDEMGKKMTVKEAHEYAKGAVSRFIRASKEAVKLG  502



>ref|XP_010685575.1| PREDICTED: non-specific phospholipase C1 [Beta vulgaris subsp. 
vulgaris]
Length=528

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/506 (58%), Positives = 358/506 (71%), Gaps = 27/506 (5%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTS---GGAQNSTNDVVLFG  243
             PIKT+V+LV ENRSFDH+LGW+KS  PEING+ GKE N L +S       + TND V   
Sbjct  38    PIKTLVILVMENRSFDHILGWLKSTRPEINGLTGKEFNRLNSSEPNSPKLHVTNDAV---  94

Query  244   NKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNG  423
                 ++D DPGHSIQ I EQIFG+    + A       M GFA  A      M   VM+G
Sbjct  95    ----FIDSDPGHSIQAITEQIFGSSVVSNPA------LMCGFAQQANSMSKHMPKNVMSG  144

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F PE VPVY EL  EFAV DRWFASVPASTQPNR +VHSATSHGA+SN  + LI GFPQK
Sbjct  145   FKPELVPVYTELANEFAVLDRWFASVPASTQPNRFYVHSATSHGASSNVRRDLIHGFPQK  204

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIF+S+DE G SFGIYYQ  P+TLF+++LRKLK++  FH + + FK H K GKLPNYVV+
Sbjct  205   TIFDSLDENGLSFGIYYQNIPATLFFKSLRKLKHVIKFHSYYLKFKLHAKLGKLPNYVVI  264

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRYFD  + P NDDHPSHDV EGQ+FVKEVYE LR+SPQW EM  LI YDEHGGF+DHV
Sbjct  265   EQRYFDKNLFPANDDHPSHDVAEGQRFVKEVYETLRASPQWKEMALLITYDEHGGFFDHV  324

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTPV+GVPNPDG+IGP P+ F+FDRLGVRVP +++SPWI+RG V+  P GP P SE+EHS
Sbjct  325   PTPVSGVPNPDGIIGPDPFYFRFDRLGVRVPTLLISPWIDRGTVIGKPDGPTPTSEFEHS  384

Query  1144  SIPATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKED  1314
             SIPATVK++FNL + FLT RDAWAG+FE     R +PR+DCPE L E  V LR    +ED
Sbjct  385   SIPATVKRLFNLKSNFLTRRDAWAGSFEKYFYLRDSPREDCPEKLPEVKVSLRPFGPRED  444

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
             A L+E+Q E++Q+A+ L GDH+   Y    + +NM+V +A  Y+  A N+FL   + A +
Sbjct  445   AKLSEFQIELIQLASQLNGDHVLNTY--PDIGKNMTVNEANQYAEDAVNRFLEAGKAAIE  502

Query  1495  RGIHGDYSVVALSKQPPSPNTTPRKP  1572
              G   D ++V +      P+ T R P
Sbjct  503   AGA-DDSAIVTM-----RPSLTSRIP  522



>ref|XP_002278413.1| PREDICTED: non-specific phospholipase C1 isoform X1 [Vitis vinifera]
Length=532

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/490 (59%), Positives = 357/490 (73%), Gaps = 17/490 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDH+LGW+KS  PEI+G+ GKESN +     A +  +  +   + +
Sbjct  36    PIKTLVVLVMENRSFDHVLGWLKSARPEIDGLTGKESNRV----NASDPDSPEIWVSDDA  91

Query  253   QYVDPDPGHSIQDIYEQIFG-APWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
              +VD DPGHS Q I EQ+FG   W Q+ A       M GFA  A+    G+S  VM+GF 
Sbjct  92    LFVDSDPGHSFQAIREQVFGTGDWFQNPA------PMSGFAQQAKNMSEGLSKTVMSGFK  145

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P  +PVY  L  EFAV DRWFA+VPASTQPNR +VHSATSHGATSN  K LI GFPQ+TI
Sbjct  146   PAVLPVYTALANEFAVFDRWFAAVPASTQPNRFYVHSATSHGATSNVRKDLIHGFPQRTI  205

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+DE   SFGIYYQ  P+TLF+++LRKL+++  FH + + FK H K GKLPNYVV+EQ
Sbjct  206   FDSLDENDLSFGIYYQNIPATLFFKSLRKLRHVTRFHDYALKFKLHAKRGKLPNYVVIEQ  265

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+K  P NDDHPSHDV  GQKFVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPT
Sbjct  266   RYFDVKEFPANDDHPSHDVAIGQKFVKEVYEILRSSPQWKEMALLITYDEHGGFYDHVPT  325

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV+GVPNPDG+IGP P+ F+FDRLGVRVP I+VSPWIE+G V+H P+GP P+S++EHSSI
Sbjct  326   PVSGVPNPDGIIGPDPFYFRFDRLGVRVPTILVSPWIEKGTVIHEPTGPTPHSQFEHSSI  385

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVK-LRSAEAKEDAN  1320
             PATVKK+FNL + FLT+RDAWAGTFE     R TPR DCPETL E    LR    KED +
Sbjct  386   PATVKKLFNLKSNFLTKRDAWAGTFENYFYFRDTPRDDCPETLPEVTTPLRPRGPKEDLS  445

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E++Q+A+ L GD++  + YP+ + ++M+V +A  Y+  A  +FL +   A  R 
Sbjct  446   LSEFQVELIQLASQLNGDYVL-NTYPY-IGKSMTVGEANRYAEDAVRRFL-EAGKAALRA  502

Query  1501  IHGDYSVVAL  1530
                D ++V +
Sbjct  503   GANDSAIVTM  512



>ref|XP_003523153.1| PREDICTED: non-specific phospholipase C6-like [Glycine max]
 gb|KHN23977.1| Phospholipase C 3 [Glycine soja]
Length=515

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/479 (58%), Positives = 349/479 (73%), Gaps = 15/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDHMLGWMK S+N  INGV G E NP+ T    ++   D + F + 
Sbjct  28    PIKTVVVLVMENRSFDHMLGWMKESINTLINGVTGDECNPVST----KSPRKDSICFTDD  83

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS +D+ +Q+FG+       G    P+M GF   A      +S  VM GF 
Sbjct  84    AEFVDPDPGHSFEDVLQQVFGS-------GSGSIPSMNGFVEQALSMSPNLSETVMKGFK  136

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P++VP+Y  LV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  ++L +G+PQKTI
Sbjct  137   PDSVPIYAALVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHIKRQLAKGYPQKTI  196

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  P+TLFYRNLRKLKYI  FHQ+D+ FK   ++GKLP   V+E 
Sbjct  197   FDSLHENGLDFGIYFQNIPTTLFYRNLRKLKYIWKFHQYDLKFKRDARDGKLPPLTVIEP  256

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK +P NDDHPSHDV  GQ  VKEVYEALR+SPQWNE LF+I YDEHGGF+DHV T
Sbjct  257   RYFDLKGIPANDDHPSHDVAHGQMLVKEVYEALRASPQWNETLFIITYDEHGGFFDHVKT  316

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   +PNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+ G  GP  NSE+EHSSI
Sbjct  317   PFVNIPNPDGNTGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVISGAKGPAENSEFEHSSI  376

Query  1150  PATVKKIFNLN-QFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL+  FLT RDAWAGTFE V+   ++PR DCP TL +   LRS EAKE+A L
Sbjct  377   PATIKKMFNLSANFLTHRDAWAGTFEHVVGDLSSPRTDCPVTLPDVTPLRSTEAKENAGL  436

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + MSV +A +Y   A ++F+   + A + G
Sbjct  437   SEFQSEVVQLAAVLNGDHFLSS-FPDEMSKKMSVKEAHEYVRGAVSRFIRASKEAIKLG  494



>ref|XP_008802791.1| PREDICTED: non-specific phospholipase C1 [Phoenix dactylifera]
 ref|XP_008802792.1| PREDICTED: non-specific phospholipase C1 [Phoenix dactylifera]
Length=540

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/471 (60%), Positives = 346/471 (73%), Gaps = 17/471 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWM--KSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGN  246
             PIKTVVVLV ENRSFDHMLGW   KS  P+I+G+ G+ESN L     A +  +  +   +
Sbjct  43    PIKTVVVLVMENRSFDHMLGWFTNKSSRPDIDGLTGRESNRL----NASDPNSPEIFVSD  98

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAERNQAGMSGAVMNG  423
              + +VD DPGHS Q I EQIFG      SA    +P  M GFA  A     GM+  VM+G
Sbjct  99    DAVFVDSDPGHSFQAIREQIFG------SADASADPAPMDGFAQQAHSMGLGMARTVMSG  152

Query  424   FVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQK  603
             F P+AVPVY  L  EFAV DRWFASVPASTQPNR +VHSATSHGA SN  K LI GFPQK
Sbjct  153   FEPDAVPVYGALASEFAVFDRWFASVPASTQPNRFYVHSATSHGAMSNVRKDLIHGFPQK  212

Query  604   TIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVV  783
             TIF+S+DE G SFGIYYQ  P+TLF+++LRKLK++ +FH + + FK H   GKLPNYVV+
Sbjct  213   TIFDSLDEDGLSFGIYYQNIPATLFFKSLRKLKHLLSFHSYTLSFKLHALLGKLPNYVVI  272

Query  784   EQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHV  963
             EQRYFD+++ P NDDHPSHDV  GQ FVKEVYE LR+SPQW E   +I YDEHGGFYDHV
Sbjct  273   EQRYFDIELFPANDDHPSHDVARGQSFVKEVYETLRASPQWTETALIITYDEHGGFYDHV  332

Query  964   PTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHS  1143
             PTPV+GVPNPDG+IGP PY F+FDRLGVRVP I+VSPWIE+G V+H P+GP  +S++EHS
Sbjct  333   PTPVSGVPNPDGIIGPDPYYFKFDRLGVRVPTILVSPWIEKGTVIHEPNGPTAHSQFEHS  392

Query  1144  SIPATVKKIFNLN-QFLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDA  1317
             SIPATVKK+FNLN  FLT+RDAWAGTFE+  + R TPR DCPE L E  +LR    +ED+
Sbjct  393   SIPATVKKLFNLNSNFLTKRDAWAGTFESQFSLRKTPRTDCPEKLPEVKRLRPFGPREDS  452

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
              L+E+Q E++Q+A+ L GDH+   Y    + + M+VA+A  Y+  A  +FL
Sbjct  453   TLSEFQMELMQLASQLNGDHVLNTY--PDIGKGMTVAQANIYAEDAVARFL  501



>gb|KDO47309.1| hypothetical protein CISIN_1g009875mg [Citrus sinensis]
Length=523

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/479 (58%), Positives = 345/479 (72%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHMLGWMK ++NP INGV G E N + T    +   +  + F + 
Sbjct  38    PIKTIVVLVMENRSFDHMLGWMKKAINPRINGVTGNECNSVST----KTPKSQTICFTDD  93

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+          + P+M GF   A      +S  VM GF 
Sbjct  94    AEFVDPDPGHSFEAVEQQVFGS---------GVIPSMSGFVEQALSMSPNLSETVMKGFS  144

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
              EAVPVY  L+REFA+ DRWF+S+P  TQPNRLFV+SATSHG+TS+  K L +G+PQKTI
Sbjct  145   AEAVPVYAALIREFALYDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKLLAQGYPQKTI  204

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  PSTLFYRNLRKLKYI  FHQ+D+ FK   ++G LP+  V+E 
Sbjct  205   FDSLHENGIDFGIYFQTIPSTLFYRNLRKLKYIFKFHQYDLKFKRDARKGNLPSLTVIEP  264

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK  P NDDHPSHDV  GQK VKEVYE LR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  265   RYFDLKGFPANDDHPSHDVANGQKLVKEVYETLRASPQWNETLLVITYDEHGGFYDHVET  324

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP P  F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSSI
Sbjct  325   PYVNVPNPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVMSGPKGPTPNSEFEHSSI  384

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+ + T+PR DCPETL +   LR  EAKED  L
Sbjct  385   PATIKKMFNLSSNFLTHRDAWAGTFEEVVGQLTSPRTDCPETLPDVAPLRKTEAKEDGGL  444

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + M+V +A +Y+  A ++F+   + A + G
Sbjct  445   SEFQSEVVQLAAVLNGDHFLSS-FPDEMGKKMTVKEAHEYAKGAVSRFIRASKEAVKLG  502



>ref|XP_008388521.1| PREDICTED: non-specific phospholipase C6-like [Malus domestica]
Length=529

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/480 (58%), Positives = 346/480 (72%), Gaps = 18/480 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDHMLGWMK S+NP INGV GKE NP+ T       +   + F + 
Sbjct  42    PIKTVVVLVMENRSFDHMLGWMKKSVNPAINGVTGKECNPVSTKPAEPTKS---ICFSDD  98

Query  250   SQYVDPDPGHSIQDIYEQIFGA-PWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
             +++VDPDP HS + + +Q+FG+ P           P+M GF   A      +S  VM GF
Sbjct  99    AEFVDPDPXHSFEAVEQQVFGSGPL----------PSMTGFVEQALSMSQNLSETVMKGF  148

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE+VPVY  LVREFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKT
Sbjct  149   RPESVPVYAALVREFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLASGYPQKT  208

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+   G  FG+Y+Q  P+T+FYRN+RKLKY   FHQ+D+ FK   ++GKLP+  V+E
Sbjct  209   IFDSVHXNGLDFGVYFQTTPTTMFYRNMRKLKYTLKFHQYDLKFKKDARKGKLPSLTVIE  268

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
              RYFDLK +P NDDHPSHDV  GQ+ VK+VYE LR+SPQWNE L +I YDEHGGF+DHV 
Sbjct  269   PRYFDLKGMPANDDHPSHDVANGQRLVKDVYETLRASPQWNETLLVITYDEHGGFFDHVQ  328

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP   VPNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSS
Sbjct  329   TPYVNVPNPDGNSGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVMSGPQGPTPNSEFEHSS  388

Query  1147  IPATVKKIFNLN-QFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             IPAT KKIFNLN  FLT RDAWAGTFE V+ + ++PR DCP TL + V LR  EAKED N
Sbjct  389   IPATXKKIFNLNSNFLTHRDAWAGTFEQVLGQLSSPRTDCPVTLPDVVPLRKTEAKEDGN  448

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E+VQ+AAVL GDH     YP ++ + MSV +A +Y   A ++F+   + A + G
Sbjct  449   LSEFQGEVVQLAAVLNGDHYLSS-YPDEMSKKMSVREAHEYVKGAVSRFIRASKEAIKLG  507



>ref|XP_011082394.1| PREDICTED: non-specific phospholipase C1 [Sesamum indicum]
Length=537

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/481 (60%), Positives = 348/481 (72%), Gaps = 17/481 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT VVLV ENRSFDH+LGW+K   P+I+G++G E N +     A +ST+  V   + +
Sbjct  40    PIKTFVVLVMENRSFDHILGWLKRTRPDIDGLSGGEFNRV----NASDSTSPAVSVSDDA  95

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAERNQA-GMSGAVMNGF  426
              +VD DPGHSIQ I EQIFG     D++   + P  M GF   AE     G+S  VM+GF
Sbjct  96    FFVDSDPGHSIQAIREQIFGC---NDTS---VNPAPMSGFVQQAESMGVDGLSKTVMSGF  149

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE +PVY EL  EFAV DRWFASVPASTQPNR +VHSATSHGA+SN  K LI GFPQKT
Sbjct  150   KPELLPVYAELANEFAVLDRWFASVPASTQPNRFYVHSATSHGASSNVRKDLIHGFPQKT  209

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+DE G SFGIYYQ  P+TLF+++LRKLK+I  FH + + FK H K G+LPNYVV+E
Sbjct  210   IFDSLDENGLSFGIYYQNIPATLFFKSLRKLKHITKFHDYKMKFKLHAKMGQLPNYVVIE  269

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD+ + P NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVP
Sbjct  270   QRYFDVDLFPANDDHPSHDVALGQRFVKEVYETLRASPQWEEMALLITYDEHGGFYDHVP  329

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPV+GVPNPDG+IGP PY F+FDRLGVRVP  ++SPWIE+G V+H PSGP P+S+YEHSS
Sbjct  330   TPVSGVPNPDGIIGPDPYYFKFDRLGVRVPTFLISPWIEKGTVIHEPSGPTPSSQYEHSS  389

Query  1147  IPATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDA  1317
             IPATVKK+FNL + FLT+RDAWAGTFE  +  R TPR DCPE L E    LR    KED 
Sbjct  390   IPATVKKLFNLQSNFLTKRDAWAGTFEKYLYLRDTPRDDCPEKLPEVRTTLRHTGPKEDV  449

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q E++Q+A+ L GDH+   Y    +  +M+V  A  Y+  A  +FL     A + 
Sbjct  450   KLSEFQIELIQLASQLNGDHILNTY--PDIGRSMTVGTANRYAEDAVKRFLEAGRAALKA  507

Query  1498  G  1500
             G
Sbjct  508   G  508



>ref|XP_009413800.1| PREDICTED: non-specific phospholipase C1-like [Musa acuminata 
subsp. malaccensis]
Length=549

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/470 (59%), Positives = 345/470 (73%), Gaps = 15/470 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSL--NPEINGVAGKESNPLPTSGGAQNSTNDVVLFGN  246
             PIKT+VVLV ENRSFDHMLGW++S     +I+G+ G+ESN +     A + ++  V   +
Sbjct  52    PIKTLVVLVMENRSFDHMLGWLRSKGGRTDIDGLTGRESNHVK----ASDPSSPEVFVSD  107

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
              + YVD DPGHS Q I EQIFG   S DS+   +   M GFA  AE    G++G VM GF
Sbjct  108   GAAYVDYDPGHSFQAIREQIFG---SDDSSA--VPAPMSGFAQQAESMGEGVAGTVMRGF  162

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PEAVPVY  L  EFAVCDRWFASVPASTQPNR +VHSATSHGATSN  + LI GFPQKT
Sbjct  163   APEAVPVYSALAEEFAVCDRWFASVPASTQPNRFYVHSATSHGATSNVRRDLIHGFPQKT  222

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+DE G SFG+YYQ  P+ LF+++LRKLK++  FH + + FK H K+G+LPNYVV+E
Sbjct  223   IFDSLDEDGLSFGVYYQNIPAVLFFKSLRKLKHLVKFHSYKLAFKLHAKQGRLPNYVVIE  282

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             Q YFD+K+ P NDDHPSHDV  GQ+ VKE+YE LR+SPQWNE   LI YDEHGGFYDHVP
Sbjct  283   QHYFDVKLSPANDDHPSHDVARGQRLVKEIYETLRASPQWNETALLITYDEHGGFYDHVP  342

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPVTGVPNPDG+IGP P+ F+FDRLGVRVP I++SPWIE+  V+H P GP PNS++EHSS
Sbjct  343   TPVTGVPNPDGIIGPDPFYFKFDRLGVRVPTILISPWIEKRTVIHEPKGPTPNSQFEHSS  402

Query  1147  IPATVKKIFNLN-QFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             +PATVK++FNLN  +LT+RDAWAGTFE+    R TPR DCPE L E   LR    +ED  
Sbjct  403   VPATVKRLFNLNSNYLTKRDAWAGTFESYFYLRKTPRTDCPEKLPEVKPLRPFGPREDKV  462

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             L+E+Q E++Q+A+ L GDH+   Y    + + M+V +A  Y+  A  + L
Sbjct  463   LSEFQVELIQLASQLNGDHVLNTY--PDIGKGMTVGQANKYAEDAVARLL  510



>ref|XP_010026404.1| PREDICTED: non-specific phospholipase C6-like [Eucalyptus grandis]
 gb|KCW83144.1| hypothetical protein EUGRSUZ_B00100 [Eucalyptus grandis]
Length=521

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/482 (58%), Positives = 349/482 (72%), Gaps = 17/482 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHMLGWMK ++NP INGV G E N + T+    NS    + F + 
Sbjct  36    PIKTIVVLVLENRSFDHMLGWMKKTINPMINGVTGDECNSVSTN----NSKPQSICFTDD  91

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VD DPGHS +D+ EQ+FG+       G+   P+M GF   A+     +S  VM GF 
Sbjct  92    AEFVDLDPGHSFEDVAEQVFGS-------GEI--PSMSGFVEQAQSVSQNLSEIVMKGFS  142

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE++P+Y  LV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  ++L  G+PQKTI
Sbjct  143   PESIPIYTALVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHIVRQLAAGYPQKTI  202

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  PSTLFYRNLRKLKYI N H +D  FK   + G+LP   V+E 
Sbjct  203   FDSLYEDGLDFGIYFQNIPSTLFYRNLRKLKYISNLHLYDFKFKRDARNGRLPRLTVIEP  262

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQK VKEVYE LR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  263   RYFDLKGLPANDDHPSHDVANGQKLVKEVYETLRASPQWNETLLIITYDEHGGFYDHVRT  322

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP P+ F+FDRLGVRVP IMVSPWI++G ++  P+GP PNSEYEHSSI
Sbjct  323   PYVDVPNPDGNTGPAPFFFKFDRLGVRVPTIMVSPWIKKGTLISSPAGPAPNSEYEHSSI  382

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITRT-TPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE +I    +PR DCPETL +   LRS+EA E++ L
Sbjct  383   PATIKKMFNLTSNFLTHRDAWAGTFEHIIGELQSPRTDCPETLPDVTPLRSSEANENSGL  442

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E+VQ+AAVL GDH    +   ++ +NMSV +A DY   A ++F+   + A + G 
Sbjct  443   SEFQSEIVQLAAVLNGDHFLTSFR-DEMSKNMSVKEAHDYVKGAVSRFIRASKEAVRMGA  501

Query  1504  HG  1509
             +G
Sbjct  502   NG  503



>ref|XP_008355188.1| PREDICTED: non-specific phospholipase C1-like [Malus domestica]
Length=532

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/481 (59%), Positives = 350/481 (73%), Gaps = 18/481 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTS--GGAQNSTNDVVLFGN  246
             PIKTVVV+V ENRSFDH+ GW+KS  P+I+G+ G ESNP+     G A+      V   N
Sbjct  36    PIKTVVVVVMENRSFDHIFGWLKSTRPDIDGLNGNESNPISVXLPGSAR------VRVSN  89

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
              + ++D DPGHS Q I EQI+G+  S ++        M GFA  A     GM+  VM+GF
Sbjct  90    DAFFIDSDPGHSFQAIREQIYGSNESSENPAP-----MNGFAQQAXSMGEGMARTVMSGF  144

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE +PVY  L  EFAV DRWFASVPASTQPNR +VHSATSHGA SN  K LI GFPQKT
Sbjct  145   KPEVLPVYTGLANEFAVFDRWFASVPASTQPNRFYVHSATSHGAMSNVRKDLIHGFPQKT  204

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+DE G  FGIYYQ  P+TLF+ +LRKLK++K FH + + FK H + GKLPNY V+E
Sbjct  205   IFDSLDENGLDFGIYYQNIPATLFFNSLRKLKHVKKFHSYALTFKRHARLGKLPNYAVIE  264

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD+K LP NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVP
Sbjct  265   QRYFDVKELPANDDHPSHDVARGQRFVKEVYETLRASPQWKEMALLITYDEHGGFYDHVP  324

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPV+GVP+PDG+ GP PY F+FDRLGVRVP I+VSPW+E+G V+H P+GP P+S++EHSS
Sbjct  325   TPVSGVPSPDGIEGPDPYYFRFDRLGVRVPTILVSPWVEKGTVIHEPTGPKPDSQFEHSS  384

Query  1147  IPATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETLAE-PVKLRSAEAKEDA  1317
             IPATVK +FNL + FLT+RDAWAGTFE   T R+TPR DCPETL E    LR    +ED+
Sbjct  385   IPATVKXLFNLKSNFLTKRDAWAGTFENYFTLRSTPRDDCPETLPEVTTSLRPGGPREDS  444

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
             +L+E+Q E++Q+A+ L GDH+  + YP+ + E M+V +A  Y+  A  +FL     A + 
Sbjct  445   SLSEFQVELIQLASQLNGDHVL-NTYPN-IGETMTVREANIYAEDAVKRFLEAGRAALKA  502

Query  1498  G  1500
             G
Sbjct  503   G  503



>ref|XP_010031723.1| PREDICTED: non-specific phospholipase C2-like [Eucalyptus grandis]
 gb|KCW51088.1| hypothetical protein EUGRSUZ_J00693 [Eucalyptus grandis]
Length=483

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/492 (59%), Positives = 353/492 (72%), Gaps = 19/492 (4%)
 Frame = +1

Query  103   ENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQYVDPDPGHS  282
             ENRSFDH LGWMK LNP INGV G ES PL T+    NST     F ++S YVDPDPGHS
Sbjct  2     ENRSFDHTLGWMKRLNPAINGVDGSESTPLSTAD--PNSTR--FYFDDRSHYVDPDPGHS  57

Query  283   IQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERN--QAGMSGAVMNGFVPEAVPVYKE  456
              Q I EQIFG   S +++     P M GFA  A        MS  VM+GF P+ V VYK 
Sbjct  58    FQAIREQIFG---SDNTSADP--PPMDGFAQQAYSMDPSMNMSRDVMSGFNPDMVAVYKA  112

Query  457   LVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIFESMDEAGY  636
             LV EFAV DRWFASVP+STQPNRL+VHS TS GATSN    LI+G+PQ+TIFE++ +AG 
Sbjct  113   LVSEFAVFDRWFASVPSSTQPNRLYVHSGTSAGATSNIPALLIKGYPQRTIFENLYDAGL  172

Query  637   SFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQRYFDLKILP  816
             SFGIY+Q  P+TLFYRNLRKLKY+  FH + + FK   + GKLPNY VVEQR+ D K+ P
Sbjct  173   SFGIYFQNIPATLFYRNLRKLKYLTKFHPYGLSFKNDARRGKLPNYTVVEQRFMDTKLAP  232

Query  817   GNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTPVTGVPNPD  996
              NDDHPSHDV++GQ FVKEVYE LR+SPQWN+ L LI YDEHGG++DHVPTPV GVP+PD
Sbjct  233   ANDDHPSHDVYQGQMFVKEVYETLRASPQWNQTLLLITYDEHGGYFDHVPTPVRGVPSPD  292

Query  997   GLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSG-PFPNSEYEHSSIPATVKKIF  1173
             G++GP+P+NF F+RLGVRVP I +SPWIE+G V+HGP+G P P SEYEHSSIPATVK++F
Sbjct  293   GIVGPEPFNFTFNRLGVRVPTIAISPWIEKGTVVHGPNGSPSPTSEYEHSSIPATVKRLF  352

Query  1174  NLNQ-FLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANLTEYQKEMV  1347
             NL+  FLT+RDAWAGTFE ++ TRT PR DCPE L  PVK+R  EAKEDA L+E+Q+E++
Sbjct  353   NLSAPFLTKRDAWAGTFEGIVQTRTQPRTDCPEKLPTPVKIRKGEAKEDAKLSEFQQELM  412

Query  1348  QMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGDYSVVA  1527
             Q+AAVL G+H+  +       + M+V +  +Y   A   F      A++ G+  +  V  
Sbjct  413   QLAAVLKGEHIFSNNL-ESFGKEMTVKEGKEYMEDAVKSFFEAGLYAKKMGVDEEQIV--  469

Query  1528  LSKQPPSPNTTP  1563
               K  PS  T P
Sbjct  470   --KMRPSLTTRP  479



>ref|XP_010086965.1| Phospholipase C 3 [Morus notabilis]
 gb|EXB25244.1| Phospholipase C 3 [Morus notabilis]
Length=526

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/479 (58%), Positives = 349/479 (73%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHMLGWMK S+NP INGV G+E NP+ T    +      + F + 
Sbjct  41    PIKTIVVLVMENRSFDHMLGWMKKSVNPNINGVTGEECNPVST----KTQKPGTICFTDD  96

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+            P+M GF   A      +S  VM GF 
Sbjct  97    AEFVDPDPGHSFEAVEQQVFGS---------ASVPSMTGFVEQALSMSPNLSETVMKGFR  147

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P +VPVY+ LVREFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L +G+PQKTI
Sbjct  148   PGSVPVYEALVREFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAQGYPQKTI  207

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  P+TLFYRNLRKLKYI  FHQ D+ FK   + GKLP+  V+E 
Sbjct  208   FDSVHENGLDFGIYFQNIPTTLFYRNLRKLKYIFKFHQLDLKFKKDARNGKLPSLTVIEP  267

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQK VKEVYE LR+SPQWNE L +I YDEHGGF+DHV T
Sbjct  268   RYFDLKGLPANDDHPSHDVANGQKLVKEVYETLRASPQWNETLLVITYDEHGGFFDHVKT  327

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VP+PDG  GP P  F+FDRLGVRVP IMVSPWI++G V+ GP GP P+S++EHSSI
Sbjct  328   PYVNVPSPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVVSGPKGPTPDSQFEHSSI  387

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V++  T+PR DCPETL +   LR+ EAKE++ L
Sbjct  388   PATIKKMFNLRSNFLTHRDAWAGTFENVVSELTSPRTDCPETLPDVTPLRTTEAKENSGL  447

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + MSV +A +Y+  A ++F+   + A + G
Sbjct  448   SEFQGEVVQLAAVLNGDHFLSS-FPDEMSKKMSVKEAHEYAKGAVSRFIRASKEAIKLG  505



>ref|XP_011044122.1| PREDICTED: non-specific phospholipase C6-like [Populus euphratica]
Length=517

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/479 (58%), Positives = 346/479 (72%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHM+GWMK S+NP INGV+GKE NPL T    +N     + F + 
Sbjct  32    PIKTIVVLVMENRSFDHMIGWMKKSINPAINGVSGKECNPLST----KNPGPQSICFSDD  87

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG             P+M GF   A      +S  VM GF 
Sbjct  88    AEFVDPDPGHSFEAVEQQVFG---------NSSIPSMTGFVDQALTISQNLSETVMKGFR  138

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PEAVPVY  LV+EFAV DRWF+S+P  TQPNRL V+SATSHG+TS+  K+L +G+PQKTI
Sbjct  139   PEAVPVYATLVKEFAVFDRWFSSIPGPTQPNRLVVYSATSHGSTSHVKKQLAKGYPQKTI  198

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G SFGIY+Q  P+TLFYRN+RKLKYI  FHQF++ FK   + GKLP+  V+E 
Sbjct  199   FDSLHENGKSFGIYFQNIPTTLFYRNMRKLKYIFKFHQFNLKFKKDARNGKLPSLTVIEP  258

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
              YFDLK +P NDDHPSHDV  GQKFVKEVYEALR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  259   SYFDLKGMPANDDHPSHDVANGQKFVKEVYEALRASPQWNETLLVITYDEHGGFYDHVKT  318

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   +P+PDG  GP P  F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSSI
Sbjct  319   PYVNIPSPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVISGPKGPAPNSEFEHSSI  378

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+   T+PR DCP TL +   LR  EAKED +L
Sbjct  379   PATIKKMFNLSSNFLTHRDAWAGTFEGVVGGLTSPRTDCPVTLPDVAPLRRTEAKEDGSL  438

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + M+V +A +Y   +  +F+   + A   G
Sbjct  439   SEFQSEVVQLAAVLNGDHFLSS-FPDEMSKKMNVKEAHEYVEGSVTRFIRASKEAINLG  496



>ref|XP_004500251.1| PREDICTED: phospholipase C 4-like [Cicer arietinum]
Length=527

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/469 (59%), Positives = 348/469 (74%), Gaps = 14/469 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  P+I+G+ G ESNP+  S    N ++  +   N +
Sbjct  38    PIKTLVVIVMENRSFDHVLGWLKSTRPDIDGLTGTESNPIELS----NPSSPKIPVSNDA  93

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              ++D DPGHS Q I EQIFG   S +++ KK  P M GFA  AE+ Q GMS  VM+GF P
Sbjct  94    VFIDFDPGHSFQAIREQIFG---SNETSKKK--PPMNGFAQQAEQIQKGMSKTVMSGFKP  148

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY +L  EF V D+WFASVPASTQPNR +VHSATSHGA SN  K LI GFPQ+TIF
Sbjct  149   ELLPVYTKLANEFTVFDKWFASVPASTQPNRFYVHSATSHGAMSNVRKNLIHGFPQRTIF  208

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+++   +FGIYYQ  P+TLF+++LRKLK    FH + + FK H  +GKLPNYVVVEQR
Sbjct  209   DSLNDNDVTFGIYYQNIPATLFFKSLRKLKNTMKFHSYGLKFKRHAMKGKLPNYVVVEQR  268

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+K+ P NDDHPSHDV  GQ+F+KEVYE LR SPQW EM  LI YDEHGGFYDHVPTP
Sbjct  269   YFDVKVSPANDDHPSHDVATGQRFIKEVYEILRKSPQWKEMAILITYDEHGGFYDHVPTP  328

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP PY F+FDRLGVRVP  ++SPWI++G V+H P GP P+S+YEHSSIP
Sbjct  329   VEGVPNPDGIIGPHPYYFRFDRLGVRVPTFLISPWIDKGTVIHEPDGPTPHSQYEHSSIP  388

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R TPR DCPETL E    LR    KED++L
Sbjct  389   ATVKKLFNLKSNFLTKRDAWAGTFEKYFYIRDTPRDDCPETLPEVKTNLRPFGPKEDSSL  448

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             +E+Q E++Q+A+ L GD++   Y    + ++M+V +A  Y+  A  +FL
Sbjct  449   SEFQMELIQLASQLNGDYVLNSY--PNIGKSMTVEEANRYAEDAVKRFL  495



>ref|XP_009347571.1| PREDICTED: non-specific phospholipase C1-like [Pyrus x bretschneideri]
Length=532

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/479 (59%), Positives = 349/479 (73%), Gaps = 14/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDHM GW+K+  P+I+G+ G ESNP+  S       +  V   + +
Sbjct  36    PIKTVVVVVMENRSFDHMFGWLKATRPDIDGLNGNESNPISVS----EPGSPRVRVSSDA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG+  S ++        M GFA  AE    GM+  VM+GF P
Sbjct  92    FFVDSDPGHSFQAIREQIFGSNESCENPAP-----MNGFAQQAESMGEGMARTVMSGFKP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EFAV DRWFASVPASTQPNR +VHSATSHGA SN  K LI GFPQKTIF
Sbjct  147   EVLPVYTELANEFAVFDRWFASVPASTQPNRFYVHSATSHGAMSNVRKDLIHGFPQKTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE    FGIYYQ  P+TLF+++LRKLK++  FH + + FK H + GKLPNY V+EQR
Sbjct  207   DSLDENDLDFGIYYQNIPATLFFKSLRKLKHVTKFHSYALTFKRHARLGKLPNYAVIEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+K LP NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVPTP
Sbjct  267   YFDVKELPANDDHPSHDVARGQRFVKEVYETLRASPQWKEMALLITYDEHGGFYDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V+ VP+PDG+ G +PY F+FDRLGVRVP I+VSPW+E+G V+H P+GP P+S++EHSSIP
Sbjct  327   VSDVPSPDGMEGNEPYYFRFDRLGVRVPTILVSPWVEKGAVIHEPTGPTPHSQFEHSSIP  386

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE   T R+TPR DCPETL E  K LR    +ED++L
Sbjct  387   ATVKKLFNLKSNFLTKRDAWAGTFENYFTLRSTPRHDCPETLPEVTKSLRPGGPREDSSL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E++Q+A+ L GDH+ + Y    + + M+V +A  Y+  A  +FL     A + G
Sbjct  447   SEFQVELIQLASQLNGDHVLKTY--PDIGKTMTVREANSYAEDAVKRFLEAGRAALKAG  503



>ref|XP_002318737.1| phosphoesterase family protein [Populus trichocarpa]
 gb|ABK94364.1| unknown [Populus trichocarpa]
 gb|EEE96957.1| phosphoesterase family protein [Populus trichocarpa]
Length=517

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/479 (58%), Positives = 345/479 (72%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHM+GWMK S+NP INGV+G E NP+ T    +N     + F + 
Sbjct  32    PIKTIVVLVMENRSFDHMIGWMKKSINPAINGVSGTECNPVST----KNPGPQSICFSDD  87

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG             P+M GF   A      +S  VM GF 
Sbjct  88    AEFVDPDPGHSFEAVKQQVFG---------NSSIPSMTGFVEQALTISQNLSETVMEGFR  138

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PEAVPVY  LV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  139   PEAVPVYATLVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLATGYPQKTI  198

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G SFGIY+Q  P+TLFYRN+RKLKYI  FHQF++ FK   + GKLP+  V+E 
Sbjct  199   FDSLHENGKSFGIYFQNIPTTLFYRNMRKLKYIFKFHQFNLKFKKDARNGKLPSLTVIEP  258

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
              YFDLK +P NDDHPSHDV  GQKFVKEVYEALR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  259   SYFDLKRMPANDDHPSHDVANGQKFVKEVYEALRASPQWNETLLVITYDEHGGFYDHVKT  318

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   +P+PDG  GP P  F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSSI
Sbjct  319   PYVNIPSPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVISGPKGPAPNSEFEHSSI  378

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+   T+PR DCP TL +   LR  EAKED +L
Sbjct  379   PATIKKMFNLSSNFLTHRDAWAGTFEGVVGGVTSPRTDCPVTLPDVAPLRRTEAKEDGSL  438

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + M+V +A +Y   +  +F+   + A   G
Sbjct  439   SEFQSEVVQLAAVLNGDHFLSS-FPDEMSKKMNVKEAHEYVEGSVTRFIRASKEAINLG  496



>gb|KEH34259.1| non-specific phospholipase C4 [Medicago truncatula]
Length=531

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/469 (59%), Positives = 342/469 (73%), Gaps = 14/469 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+K   PEI+G+ G ESNP+  S    N ++  +   N +
Sbjct  35    PIKTIVVIVMENRSFDHVLGWLKQTRPEIDGLTGTESNPIHVS----NPSSPKIPVSNDA  90

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              ++D DPGHS Q I EQIFG+  ++ +        M GFA  AE+ Q GMS  VM+GF P
Sbjct  91    VFIDSDPGHSFQAIREQIFGSNQTKSNPAP-----MNGFAQQAEKTQTGMSKTVMSGFKP  145

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY  L  EF V D+WFASVPASTQPNR +VHSATSHGA SN  K LI GFPQ+TIF
Sbjct  146   ELLPVYTALAEEFTVFDKWFASVPASTQPNRFYVHSATSHGAMSNVRKNLIHGFPQRTIF  205

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+++ G SFGIYYQ  P+TLF+++LRKLK    FH + + FK H  +GKLPNYVV+EQR
Sbjct  206   DSLNDNGVSFGIYYQNIPATLFFKSLRKLKNSVKFHSYGLKFKRHALKGKLPNYVVIEQR  265

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+K+ P NDDHPSHDV  GQ+FVKEVYE LR SPQW EM  LI YDEHGGFYDHVPTP
Sbjct  266   YFDVKVSPANDDHPSHDVAIGQRFVKEVYEVLRKSPQWKEMAILITYDEHGGFYDHVPTP  325

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVPNPDG+IGP PY F+FDRLGVRVP  ++SPWI+R  V+H P GP P S+YEHSSIP
Sbjct  326   VVGVPNPDGIIGPTPYYFRFDRLGVRVPTFLISPWIDRRTVIHEPDGPTPYSQYEHSSIP  385

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R TPR DCPETL E  V LR    KED +L
Sbjct  386   ATVKKLFNLKSNFLTKRDAWAGTFEKYFYIRDTPRDDCPETLPEVKVNLRPFGPKEDLSL  445

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             +E+Q E++Q+A+ L GD++   Y    + ++M+V +A  Y+  A  +FL
Sbjct  446   SEFQMELIQLASQLNGDYILNSY--PNIGKSMTVKEANRYAEDAVKRFL  492



>ref|XP_011032127.1| PREDICTED: non-specific phospholipase C1 [Populus euphratica]
Length=535

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/470 (60%), Positives = 347/470 (74%), Gaps = 16/470 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+V+LV ENRSFDH+LGW+KS  P+I+G+ G ESN +  S    N   D +   + +
Sbjct  39    PIKTLVILVMENRSFDHVLGWLKSTRPDIDGLTGSESNRISVS----NPNADEIFVSDDA  94

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAERNQAGMSGAVMNGFV  429
              ++D DPGHS Q I EQIFG   S DS     +P  M GFA  A+     MS  VM+GF 
Sbjct  95    LFIDSDPGHSFQAIREQIFG---SNDSLA---DPAPMSGFAQQAKSMSETMSKIVMSGFK  148

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P  VPVY EL  EFAV DRWFASVPASTQPNRL+VHSATSHGA SN  K LI GFPQKTI
Sbjct  149   PSRVPVYTELANEFAVFDRWFASVPASTQPNRLYVHSATSHGAMSNVRKDLIHGFPQKTI  208

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+DE G SFG+YYQ  P+TLF ++LRKLK+   FH +++ FK H K GKLPNYVVVEQ
Sbjct  209   FDSLDENGLSFGVYYQNIPATLFLKSLRKLKHAMKFHSYELKFKLHAKLGKLPNYVVVEQ  268

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+++ P NDDHPSHD+  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPT
Sbjct  269   RYFDVELFPANDDHPSHDMARGQRFVKEVYETLRSSPQWKEMALLITYDEHGGFYDHVPT  328

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVPNPDG++G  PY FQF+RLGVRVP +++SPWI++G V+H P+GP P+S++EHSSI
Sbjct  329   PVRGVPNPDGIVGRDPYYFQFNRLGVRVPTLLISPWIDKGTVIHEPAGPRPSSQFEHSSI  388

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKL-RSAEAKEDAN  1320
             PATVKK+FNL + FLT RDAWAG+FE     R TPR DCPETL E   L R    KEDA+
Sbjct  389   PATVKKLFNLKSNFLTRRDAWAGSFENYFYLRDTPRDDCPETLPEVTTLMRPWGPKEDAS  448

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             L+E+Q EM+Q+A+ L GD++  + YP  + ++M+V +A  Y+  A  +FL
Sbjct  449   LSEFQVEMIQLASQLNGDYVL-NAYP-DIGKSMTVGEANRYAEDAVRRFL  496



>ref|NP_190430.2| non-specific phospholipase C6 [Arabidopsis thaliana]
 sp|Q8H965.1|NPC6_ARATH RecName: Full=Non-specific phospholipase C6; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAC22511.1| phosphatidylglycerol specific phospholipase C [Arabidopsis thaliana]
 gb|AEE78437.1| non-specific phospholipase C6 [Arabidopsis thaliana]
Length=520

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/498 (57%), Positives = 355/498 (71%), Gaps = 21/498 (4%)
 Frame = +1

Query  25    IYAMGPSSEISDGS---IFPIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPL  192
             +Y +   + ++ GS     PIKTVVVLV ENRSFDH+LGWMK S+NP INGV G+E NP+
Sbjct  19    LYCLLTQTHVAQGSHQWQSPIKTVVVLVLENRSFDHLLGWMKNSVNPTINGVTGQECNPV  78

Query  193   PTSGGAQNSTNDVVLFGNKSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFA  372
             P      NST   + F + +++VDPDPGHS + + +Q+FG+       G    P+M GF 
Sbjct  79    P------NSTQ-TICFTSDAEFVDPDPGHSFEAVEQQVFGS-------GPGQIPSMMGFV  124

Query  373   ANAERNQAGMSGAVMNGFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSH  552
               A      +S  VM GF PEAVPVY ELV+EFAV DRWF+S+P  TQPNRLFV+SATSH
Sbjct  125   EQALSMPGNLSETVMKGFRPEAVPVYAELVKEFAVFDRWFSSIPGPTQPNRLFVYSATSH  184

Query  553   GATSNDTKKLIEGFPQKTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDI  732
             G+TS+  K+L +G+PQKTIF+S+      FGIY+Q  P+TLFYRNLR+LKYI N HQ+D+
Sbjct  185   GSTSHVKKQLAQGYPQKTIFDSLHSNDIDFGIYFQNIPTTLFYRNLRQLKYIFNLHQYDL  244

Query  733   HFKTHCKEGKLPNYVVVEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNE  912
              FK    +GKLP+  V+E RYFDLK LP NDDHPSHDV  GQK VKEVYEALRSSPQWNE
Sbjct  245   KFKKDAAKGKLPSLTVIEPRYFDLKGLPANDDHPSHDVANGQKLVKEVYEALRSSPQWNE  304

Query  913   MLFLIIYDEHGGFYDHVPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGK  1092
              L +I YDEHGGFYDHV TP  G+PNPDG  GP P  F+FDRLGVRVP IMVSPWI++G 
Sbjct  305   TLLVITYDEHGGFYDHVKTPYVGIPNPDGNTGPAPGFFKFDRLGVRVPTIMVSPWIQKGT  364

Query  1093  VLHGPSGPFPNSEYEHSSIPATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPE  1266
             V+    GP  +SEYEHSSIPAT+KK+FNL + FLT RDAWA TFE V++  TTPR DCP 
Sbjct  365   VVSEAKGPTESSEYEHSSIPATIKKLFNLSSNFLTHRDAWAATFEDVVSHLTTPRTDCPM  424

Query  1267  TLAEPVKLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYS  1446
             TL E   +R+ E KEDA L+E+Q E+VQ+AAVL GDH     +P ++ + M+V +A +Y 
Sbjct  425   TLPEVAPMRATEPKEDAALSEFQGEVVQLAAVLNGDHFLSS-FPEEIGKKMTVKQAHEYV  483

Query  1447  HLAFNKFLGDCENARQRG  1500
               A ++F+   + A + G
Sbjct  484   KGATSRFIRASKEAMKLG  501



>ref|XP_006488503.1| PREDICTED: non-specific phospholipase C1-like [Citrus sinensis]
Length=539

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/480 (58%), Positives = 354/480 (74%), Gaps = 15/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVL+ ENRSFDH+LGW+KS  P+I+G+ GKESN +  S    +  +  V   + +
Sbjct  42    PIKTVVVLIMENRSFDHILGWLKSTRPDIDGLTGKESNSVNIS----DPKSPKVFVSDDA  97

Query  253   QYVDPDPGHSIQDIYEQIFGA-PWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
              +VD DPGHS Q I EQIFG+   S +SA     P M GF   A      M+  VM+GF 
Sbjct  98    IFVDSDPGHSFQAIREQIFGSNVISPNSA-----PMMNGFVQQAMSMDPDMARTVMSGFK  152

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +P+Y EL  EFAV DRWFASVP+STQPNR +VHSATSHG  SN  K LI GFPQKTI
Sbjct  153   PEVIPIYTELANEFAVFDRWFASVPSSTQPNRFYVHSATSHGCQSNVKKDLIHGFPQKTI  212

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+DE G +FGIYYQ  P+TLF+++LRKLK++  FH + + FK H + GKLPNY V+EQ
Sbjct  213   FDSVDENGLTFGIYYQNIPATLFFKSLRKLKHLTKFHSYGLKFKRHARLGKLPNYAVIEQ  272

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+ + P NDDHPSHDV EGQ+FVKEVYE LRSSPQWNEM FLI YDEHGGF+DHVPT
Sbjct  273   RYFDVSLFPANDDHPSHDVAEGQRFVKEVYETLRSSPQWNEMAFLITYDEHGGFFDHVPT  332

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV+ VP+PDG+IGP P+ F+FDRLGVRVP +++SPWI++G V+HGP+GP P+SE+EHSSI
Sbjct  333   PVSHVPSPDGVIGPDPFFFRFDRLGVRVPTLLISPWIDKGTVIHGPNGPTPHSEFEHSSI  392

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDAN  1320
             PATVKK+FNL + FLT+RDAWAGTFE  +  R TPR DCP TL E  + LR    +ED  
Sbjct  393   PATVKKLFNLKSNFLTKRDAWAGTFEKFLQLRKTPRDDCPVTLPEVTRSLRPWGPREDKE  452

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E++Q+AA L GD++  + YP+ + +NM+  +A  Y+  A  +FL   + A + G
Sbjct  453   LSEFQVELIQLAAQLVGDYVL-NTYPN-MGKNMTAGEANRYAEDAVKRFLEAGKAAIRAG  510



>ref|XP_010043437.1| PREDICTED: non-specific phospholipase C1 [Eucalyptus grandis]
 gb|KCW85448.1| hypothetical protein EUGRSUZ_B02259 [Eucalyptus grandis]
Length=531

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/469 (60%), Positives = 345/469 (74%), Gaps = 15/469 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VV+V ENRSFDH+LGW+KS  P+I+G+ G+ESNPL  S     S    V   + +
Sbjct  37    PIKTLVVIVMENRSFDHVLGWLKSTRPDIDGLTGQESNPLNVSDPGSPS----VRVADDA  92

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG   S+DS+    +P M+GFA  AE  + G S  VM+GF P
Sbjct  93    VFVDWDPGHSFQAIREQIFG---SEDSSA---DPNMKGFAQQAEGMEEGKSKTVMSGFKP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
               +P Y  L  EFAV DRWFASVPASTQPNR +VHSATSHGATSN  K L+ GFPQKTIF
Sbjct  147   RLLPAYTALANEFAVIDRWFASVPASTQPNRFYVHSATSHGATSNVRKDLVHGFPQKTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E+G SFGIYYQ  P+T+F+ +LR+LK+I  FH + + FK   K GKLPNYVVVEQR
Sbjct  207   DSLEESGLSFGIYYQNIPATMFFSSLRRLKHITKFHSYSLKFKLDAKLGKLPNYVVVEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVPTP
Sbjct  267   YFDVNVFPANDDHPSHDVAIGQRFVKEVYETLRASPQWKEMALLITYDEHGGFYDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V+ VPNPDG++GP P+ F FDRLGVRVP ++VSPWI++G V+H P GP P+S++EHSSIP
Sbjct  327   VSHVPNPDGIVGPDPFYFHFDRLGVRVPTLLVSPWIDKGTVIHTPEGPTPHSQFEHSSIP  386

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPV-KLRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAG+FE     R TPR DCPETL E   +LR    KEDA L
Sbjct  387   ATVKKLFNLKSNFLTKRDAWAGSFERYFYLRNTPRDDCPETLPEVTSQLRPRGPKEDAKL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             +E+Q E++Q+A  L GD++   Y    L ++M+V +A  Y+  A   FL
Sbjct  447   SEFQVELIQLAQQLNGDYVLNTY--PDLGKSMTVGQANRYAENAVRSFL  493



>ref|XP_006425054.1| hypothetical protein CICLE_v10028112mg [Citrus clementina]
 gb|ESR38294.1| hypothetical protein CICLE_v10028112mg [Citrus clementina]
Length=563

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/480 (58%), Positives = 351/480 (73%), Gaps = 15/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVL+ ENRSFDH+LGW+KS  P+I+G+ GKESN +  S    +  +  V   + +
Sbjct  66    PIKTVVVLIMENRSFDHILGWLKSTRPDIDGLTGKESNSVNIS----DPKSPKVFVSDDA  121

Query  253   QYVDPDPGHSIQDIYEQIFGA-PWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
              +VD DPGHS Q I+EQIFG+   S +SA     P M GF   A      M+  VM+GF 
Sbjct  122   IFVDSDPGHSFQAIHEQIFGSNVISPNSA-----PMMNGFVQQAMSMDPDMARTVMSGFK  176

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +P+Y EL  EFAV DRWFASVP+STQPNR +VHSATSHG  SN  K LI GFPQKTI
Sbjct  177   PEVIPIYTELANEFAVFDRWFASVPSSTQPNRFYVHSATSHGCQSNVKKDLIHGFPQKTI  236

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+DE G +FGIYYQ  P+TLF+++LRKLK++  FH + + FK H + GKLPNY V+EQ
Sbjct  237   FDSVDENGLTFGIYYQNIPATLFFKSLRKLKHLTKFHSYGLKFKRHARLGKLPNYAVIEQ  296

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+ + P NDDHPSHDV  GQ+FVKEVYE LRSSPQWNEM FLI YDEHGGF+DHVPT
Sbjct  297   RYFDISLFPANDDHPSHDVAAGQRFVKEVYETLRSSPQWNEMAFLITYDEHGGFFDHVPT  356

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV+ VP+PDG+IGP P+ F+FDRLGVRVP +++SPWI++G V+HGP+GP P+SE+EHSSI
Sbjct  357   PVSHVPSPDGVIGPDPFFFRFDRLGVRVPTLLISPWIDKGTVIHGPNGPTPHSEFEHSSI  416

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDAN  1320
             PATVKK+FNL + FLT+RDAWAGTFE  +  R TPR DCP TL E  + LR    +ED  
Sbjct  417   PATVKKLFNLKSNFLTKRDAWAGTFEKFLQLRKTPRDDCPVTLPEVTRSLRPWGPREDKE  476

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E++Q+AA L GD++   Y    + +NM+  +A  Y+  A  +FL   + A + G
Sbjct  477   LSEFQVELIQLAAQLVGDYVLNTY--PDMGKNMTAGEANRYAEDAVKRFLEAGKAAIRAG  534



>ref|XP_010519508.1| PREDICTED: non-specific phospholipase C6 [Tarenaya hassleriana]
Length=530

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/479 (59%), Positives = 351/479 (73%), Gaps = 16/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDHMLGWMK S+NP INGV G+E NP+ T     N+T  ++ F N 
Sbjct  44    PIKTVVVLVMENRSFDHMLGWMKKSINPSINGVTGRECNPVSTKD--PNNTR-IICFTND  100

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + EQ+FG+       G+   P+M GF   A      +S  VM GF 
Sbjct  101   AEFVDPDPGHSFEAVEEQVFGS-------GRI--PSMMGFVEQALSMPGNLSETVMKGFR  151

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PEAVPVY ELV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K L +G+PQKTI
Sbjct  152   PEAVPVYAELVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKLLAQGYPQKTI  211

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  P+TLFYRNLRKLKYI   HQ+++ FK   ++GKLP+  V+E 
Sbjct  212   FDSVHENGIDFGIYFQNIPTTLFYRNLRKLKYIFKLHQYNLRFKKDAEKGKLPSLTVIEP  271

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK +PGNDDHP+HDV  GQK VKEVYE LRSSPQWNE   +I YDEHGGFYDHV T
Sbjct  272   RYFDLKGMPGNDDHPAHDVANGQKLVKEVYETLRSSPQWNETALIITYDEHGGFYDHVQT  331

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P  GVPNPDG  GP P  F+FDRLGVRVP I+VSPWI++G V+ GP+GP   SEYEHSSI
Sbjct  332   PFEGVPNPDGNTGPAPGFFKFDRLGVRVPTIVVSPWIQKGTVVSGPNGPTETSEYEHSSI  391

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKK+FNL + FLT RDAWAGTFE + +  ++PR DCP TL E   +RS EAKE+A L
Sbjct  392   PATVKKLFNLSSNFLTHRDAWAGTFEHIFSPLSSPRSDCPLTLPEVSPMRSTEAKEEAAL  451

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + M+V +A +Y   A ++F+   + A   G
Sbjct  452   SEFQGEVVQLAAVLNGDHFLSS-FPDEVGKKMTVREAHEYIRGATSRFIRASKEAISLG  509



>ref|XP_008464045.1| PREDICTED: non-specific phospholipase C1 [Cucumis melo]
Length=534

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/470 (60%), Positives = 344/470 (73%), Gaps = 15/470 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDH+LGW+KS+ PEI+G+ GKESN +  S    +  ++ +   N +
Sbjct  37    PIKTVVVLVMENRSFDHVLGWLKSVRPEIDGLTGKESNRISVS----DPNSEEIFVSNDA  92

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAE-RNQAGMSGAVMNGFV  429
              ++D DPGHS Q I EQIFG   S DS+G      M GFA  A   ++  M   VM+GF 
Sbjct  93    IFIDSDPGHSFQAIREQIFG---SNDSSGNP--APMNGFAQQAAAMDEIDMPKTVMSGFK  147

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE VPVY EL  +FA+ DRWFASVPASTQPNR +VHSATSHGA SN  K LI GFPQKTI
Sbjct  148   PERVPVYTELANQFAIFDRWFASVPASTQPNRFYVHSATSHGAMSNVRKDLIHGFPQKTI  207

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+DE G +FGIYYQ  P+TLF+++LRKLK++  FH + + FK H K G+LPNY V+EQ
Sbjct  208   FDSLDENGLTFGIYYQNIPATLFFKSLRKLKHVVKFHSYALKFKLHAKLGRLPNYAVIEQ  267

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+ + P NDDHPSHDV  GQKFVKEVYE LR+SPQW EM  LI YDEHGGFYDHVPT
Sbjct  268   RYFDVDLYPANDDHPSHDVARGQKFVKEVYEILRASPQWKEMALLITYDEHGGFYDHVPT  327

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PVTGVPNPDG+IGP PY F+FDRLGVRVP I+VSPW+E+G V+H P GP   S++EHSSI
Sbjct  328   PVTGVPNPDGIIGPDPYYFRFDRLGVRVPTILVSPWVEKGTVIHEPVGPTSTSQFEHSSI  387

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDAN  1320
             PATVKK+FNL + FLT+RDAWAGTF+  +  R  PR DCPETL +    LR    KE A 
Sbjct  388   PATVKKLFNLKSNFLTKRDAWAGTFDHYLKLRDHPRDDCPETLPKVTAPLRPWGPKEHAK  447

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             L+E+Q E++Q+A+ L GDH+   Y    + + M+V +A  Y+  A  +FL
Sbjct  448   LSEFQVELIQLASQLNGDHVLNSY--PNIGKYMTVGEANKYAEDAVKRFL  495



>ref|XP_009375203.1| PREDICTED: non-specific phospholipase C6-like [Pyrus x bretschneideri]
Length=529

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 346/479 (72%), Gaps = 16/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDH+LGWMK S+NP INGV GKE NP+ T       +   + F + 
Sbjct  42    PIKTIVVLVMENRSFDHILGWMKKSVNPAINGVTGKECNPVSTKPADPEKS---ICFSDD  98

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+            P+M GF   A      +S  VM GF 
Sbjct  99    AEFVDPDPGHSFEAVEQQVFGS---------GSLPSMTGFVEQALSMSPNLSETVMKGFR  149

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE+VPVY  LV EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  150   PESVPVYAALVSEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLASGYPQKTI  209

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FG+Y+Q  P+T+FYRN+RKLKYI  FHQ+D+ FK   ++GKLP+  V+E 
Sbjct  210   FDSVHENGLDFGVYFQNIPTTMFYRNMRKLKYIFKFHQYDLKFKKDARKGKLPSLTVIEP  269

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK +P NDDHPSHDV  GQ+ VK+VYE LR+SPQWNE L +I YDEHGGF+DHV T
Sbjct  270   RYFDLKGMPANDDHPSHDVANGQRLVKDVYETLRASPQWNETLLVITYDEHGGFFDHVKT  329

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP P  F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSSI
Sbjct  330   PYVNVPNPDGNSGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVMSGPQGPTPNSEFEHSSI  389

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+ + ++PR DCP TL + V LR  EAKED+NL
Sbjct  390   PATIKKMFNLSSNFLTHRDAWAGTFEQVVGQLSSPRTDCPVTLPDVVPLRKTEAKEDSNL  449

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+ AVL GDH     YP ++ + MSV +A  Y   A ++F+   + A + G
Sbjct  450   SEFQGEVVQLGAVLNGDHFLSS-YPDEMSKKMSVREAHGYVKGAVSRFIRASKEAIKLG  507



>ref|XP_004501711.1| PREDICTED: phospholipase C 3-like [Cicer arietinum]
Length=521

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 345/479 (72%), Gaps = 16/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIK VVVLV ENRSFDHMLGWMK ++NP I+GV G E NP+ T    ++   D + F + 
Sbjct  35    PIKNVVVLVMENRSFDHMLGWMKKAINPLIDGVNGDECNPVST----ESPRKDTICFSDD  90

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS +D+ +Q+FG+  S         P+M GF   A      +S  VM GF 
Sbjct  91    AEFVDPDPGHSFEDVLKQVFGSGGSI--------PSMNGFVEQALSMSQNLSETVMKGFK  142

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P++VPVY  LV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  ++L +G+PQKTI
Sbjct  143   PQSVPVYASLVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKRQLAKGYPQKTI  202

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+SM E G  FGIY+Q  P+TLFYRNLRKLKYI  FHQFD+ FK   + GKLP+  V+E 
Sbjct  203   FDSMHENGLDFGIYFQNIPTTLFYRNLRKLKYISKFHQFDLKFKKDARNGKLPHLTVIEP  262

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDL  LP NDDHPSHDV  GQ  VKEVYE+LR+SPQWN+ L +I YDEHGGF+DHV T
Sbjct  263   RYFDLTGLPANDDHPSHDVANGQMLVKEVYESLRASPQWNQTLLVITYDEHGGFFDHVKT  322

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   +PNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+  P GP  NSE+EHSSI
Sbjct  323   PFLNIPNPDGNTGPAPYFFKFDRLGVRVPTIMVSPWIKKGIVVRNPKGPSVNSEFEHSSI  382

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KKIFNL + FLT RDAWAGTFE V+   ++PR DCP TL +   +R  EAKE+  L
Sbjct  383   PATIKKIFNLSSNFLTHRDAWAGTFEHVVGELSSPRTDCPVTLPDVTPMRRTEAKENGGL  442

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + MSV +A DY   A ++F+   + A + G
Sbjct  443   SEFQSEVVQLAAVLNGDHFLSS-FPDEMSKRMSVKEAHDYVRGAVSRFIRASKEAIKLG  500



>ref|XP_002314107.2| phospholipase family protein [Populus trichocarpa]
 gb|EEE88062.2| phospholipase family protein [Populus trichocarpa]
Length=535

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/470 (60%), Positives = 346/470 (74%), Gaps = 16/470 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+V+LV ENRSFDH+LGW+KS  P+I+G+ G ESN +  S    +   D +   + +
Sbjct  39    PIKTLVILVMENRSFDHVLGWLKSTRPDIDGLTGSESNRISVS----DPNADEIFVSDDA  94

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAERNQAGMSGAVMNGFV  429
              ++D DPGHS Q I EQIFG   S DS     +P  M GFA  A+     MS  VM+GF 
Sbjct  95    VFIDSDPGHSFQAIREQIFG---SNDSLA---DPAPMSGFAQQAKSMSETMSKVVMSGFK  148

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             P  VPVY EL  EFAV DRWFASVPASTQPNRL+VHSATSHGA SN  K LI GFPQKTI
Sbjct  149   PSRVPVYTELANEFAVFDRWFASVPASTQPNRLYVHSATSHGAMSNVRKDLIHGFPQKTI  208

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+DE G SFG+YYQ  P+TLF ++LRKLK+   FH + + FK H K GKLPNYVVVEQ
Sbjct  209   FDSLDENGLSFGVYYQNIPATLFLKSLRKLKHAMKFHSYQLKFKLHAKLGKLPNYVVVEQ  268

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+++ P NDDHPSHD+  GQ+FVKEVYE LRSSPQW EM  LI YDEHGGFYDHVPT
Sbjct  269   RYFDVELFPANDDHPSHDMARGQRFVKEVYETLRSSPQWKEMALLITYDEHGGFYDHVPT  328

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV GVPNPDG++G  PY FQF+RLGVRVP +++SPWI++G V+H P+GP P+S++EHSSI
Sbjct  329   PVRGVPNPDGIVGRDPYYFQFNRLGVRVPTLLISPWIDKGTVIHEPAGPRPSSQFEHSSI  388

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVKL-RSAEAKEDAN  1320
             PATVKK+FNL + FLT RDAWAG+FE     R TPR DCPETL E   L R    KEDA+
Sbjct  389   PATVKKLFNLKSNFLTRRDAWAGSFENYFYLRDTPRDDCPETLPEVTTLMRPWGPKEDAS  448

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             L+E+Q EM+Q+A+ L GD++  + YP  + ++M+V +A  Y+  A  +FL
Sbjct  449   LSEFQVEMIQLASQLNGDYVL-NAYP-DIGKSMTVGEANRYAEDAVRRFL  496



>ref|XP_009419667.1| PREDICTED: non-specific phospholipase C1-like [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/470 (59%), Positives = 347/470 (74%), Gaps = 15/470 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSL--NPEINGVAGKESNPLPTSGGAQNSTNDVVLFGN  246
             PIKT+VVLV ENRSFDHMLGW+++    P+I+G+ G E N L     A + ++  V   +
Sbjct  53    PIKTLVVLVMENRSFDHMLGWLRTKGGRPDIDGLTGHEYNRL----NASDPSSPEVFVSD  108

Query  247   KSQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGF  426
              + YVD DPGHS Q I EQIFG   S+D+A   +   M GFA  AE    GM+  VM GF
Sbjct  109   GAAYVDSDPGHSFQAIREQIFG---SEDTAA--VPAPMSGFAQQAESMGEGMASTVMRGF  163

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P+AVPVY  L  EFAV DRWFASVPASTQPNR +VHSATSHGATSN  + L+ GFPQKT
Sbjct  164   APDAVPVYSALAEEFAVFDRWFASVPASTQPNRFYVHSATSHGATSNVRRDLVHGFPQKT  223

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+DE G SFG+YYQ  P+ LF+++LRKLK++  FH + + FK   K G+LPNYVV+E
Sbjct  224   IFDSLDEDGLSFGVYYQNIPAVLFFKSLRKLKHLVKFHSYKLAFKLDAKLGRLPNYVVIE  283

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             Q YFD+K+ P NDDHPSHD+  GQ+ VKEVYE LR+SPQWNE   LI YDEHGGFYDHVP
Sbjct  284   QHYFDVKLSPANDDHPSHDIARGQRLVKEVYETLRASPQWNETALLITYDEHGGFYDHVP  343

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPVTGVPNPDG+IGP P+ F+FDRLGVRVP I++SPWIE+  V+H P GP P+S++EHSS
Sbjct  344   TPVTGVPNPDGIIGPDPFYFKFDRLGVRVPTILISPWIEKRTVIHEPKGPTPHSQFEHSS  403

Query  1147  IPATVKKIFNLN-QFLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             IPATV+K+FNLN  FLT+RDAWAGTFE+ ++ R TPR DCPE L +   LR    +ED  
Sbjct  404   IPATVRKLFNLNSNFLTKRDAWAGTFESHLSIRKTPRTDCPEKLPKVKSLRPFGPREDKV  463

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             L+E+Q E++Q+A+ L GDH+  + YP+ + E M+V +A  Y+  A  +FL
Sbjct  464   LSEFQVELIQLASQLNGDHVL-NTYPY-IGEGMTVGQANRYAEDAVARFL  511



>ref|XP_010256564.1| PREDICTED: non-specific phospholipase C1 [Nelumbo nucifera]
Length=528

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/486 (58%), Positives = 353/486 (73%), Gaps = 15/486 (3%)
 Frame = +1

Query  82    TVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKSQYV  261
             T+V+LV ENRSFDH+LGW+KS  PEI+G+ GKESN +     A +  +  +   N + +V
Sbjct  38    TLVILVMENRSFDHVLGWLKSSRPEIDGLTGKESNRV----SAFDIDSQEIFVTNDALFV  93

Query  262   DPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVPEAV  441
             D DPGHS Q I EQIFG+    ++      P M GF   AE    GMS  VM+GF P  +
Sbjct  94    DSDPGHSFQAIREQIFGS----ENCSSNPAP-MNGFVQQAESMGEGMSKTVMSGFKPSLL  148

Query  442   PVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIFESM  621
             PVY  L  EFAV DRWFASVPASTQPNR +VHSATSHGATSN  K LI GFPQ+TIF+S+
Sbjct  149   PVYTTLANEFAVFDRWFASVPASTQPNRFYVHSATSHGATSNVRKDLIHGFPQRTIFDSL  208

Query  622   DEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQRYFD  801
             DE+  SFGIYYQ  P+TLF+++LRKLK++  FH + + FK H K GKLPNYVV+EQRYFD
Sbjct  209   DESDLSFGIYYQNIPATLFFKSLRKLKHVVKFHSYALKFKMHAKLGKLPNYVVIEQRYFD  268

Query  802   LKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTPVTG  981
             +++ P NDDHPSHDV  GQKFVKEVYE LR+SPQWNE   LI YDEHGGFYDHVPTPV G
Sbjct  269   VELAPANDDHPSHDVAIGQKFVKEVYETLRASPQWNETALLITYDEHGGFYDHVPTPVIG  328

Query  982   VPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIPATV  1161
             VPNPDG+IGP P+ F+FDRLGVRVP I++SPWIE+G V+H P+GP P S++EHSSIPATV
Sbjct  329   VPNPDGIIGPDPFYFRFDRLGVRVPTILISPWIEKGTVIHEPNGPTPYSQFEHSSIPATV  388

Query  1162  KKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANLTEY  1332
             KK+FNL + FLT+RDAWAG+FE     R TPR DCPETL E V  LR    KED  L+E+
Sbjct  389   KKLFNLKSNFLTKRDAWAGSFENYFHLRDTPRTDCPETLPEVVTPLRPRGPKEDMGLSEF  448

Query  1333  QKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGIHGD  1512
             Q E++Q+A+ L GDH+  + YP+ + ++M+V +A  Y+  A  +FL     A   G + D
Sbjct  449   QVELIQLASQLNGDHVL-NTYPY-IGKSMTVGQANQYAEDAVARFLEAGRAALMAGAN-D  505

Query  1513  YSVVAL  1530
              ++V +
Sbjct  506   SAIVTM  511



>ref|XP_002877621.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53880.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=521

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/479 (58%), Positives = 347/479 (72%), Gaps = 18/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDH+LGWMK S+NP INGV G+E NP+P      NST   + F + 
Sbjct  38    PIKTVVVLVLENRSFDHLLGWMKNSVNPTINGVTGQECNPVP------NSTQ-TICFTSD  90

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+       G    P+M GF   A      +S  VM GF 
Sbjct  91    AEFVDPDPGHSFEAVEQQVFGS-------GSGQIPSMMGFVEQALSMPGNLSETVMKGFR  143

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PEA+PVY ELV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L +G+PQKTI
Sbjct  144   PEAIPVYAELVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAQGYPQKTI  203

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+      FGIY+Q  P+TLFYRNLR+LKYI N HQ+D+ FK    +GKLP+  V+E 
Sbjct  204   FDSLHSNDIDFGIYFQNIPTTLFYRNLRQLKYIFNLHQYDLKFKKDAAKGKLPSLTVIEP  263

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQK VKEVYEALR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  264   RYFDLKGLPANDDHPSHDVANGQKLVKEVYEALRASPQWNETLLVITYDEHGGFYDHVKT  323

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P  G+PNPDG  GP P  F+FDRLGVRVP IMVSPWI++G V+    GP  +SEYEHSSI
Sbjct  324   PYVGIPNPDGNTGPAPGFFKFDRLGVRVPTIMVSPWIKKGTVVSEAKGPTESSEYEHSSI  383

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWA TFE V++  TTPR DCP TL E   +R+ E KEDA L
Sbjct  384   PATIKKLFNLSSNFLTHRDAWAATFEDVVSHLTTPRTDCPMTLPEVAPMRATEPKEDAAL  443

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + M+V +A +Y   A ++F+   + A + G
Sbjct  444   SEFQGEVVQLAAVLNGDHFLSS-FPDEVGKKMTVKQAHEYVKGATSRFIRASKEAMKLG  501



>ref|XP_011023988.1| PREDICTED: non-specific phospholipase C6-like isoform X1 [Populus 
euphratica]
Length=517

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/479 (58%), Positives = 346/479 (72%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHM+GWMK S+NP INGV+G E NP+ T      S    + F + 
Sbjct  32    PIKTIVVLVMENRSFDHMIGWMKKSINPAINGVSGTECNPVSTKNPGPQS----ICFSDD  87

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG     DS+     P+M GF   A      +S  VM GF 
Sbjct  88    AEFVDPDPGHSFEAVEQQVFG-----DSSF----PSMSGFVEQALSVSQNLSETVMKGFR  138

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE+VPVY  LVREFAV DRWF+S+P  TQPNRLFV+SATSHG TS+  K+L  G+PQKTI
Sbjct  139   PESVPVYATLVREFAVFDRWFSSIPGPTQPNRLFVYSATSHGPTSHGKKQLAIGYPQKTI  198

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  P+TLF+RN+RKLKYI  FH FD  FK   ++GKLP+  V+E 
Sbjct  199   FDSLHENGKDFGIYFQNIPTTLFFRNMRKLKYIFKFHLFDFKFKKDARDGKLPSLTVIEP  258

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQK VKEVYE LR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  259   RYFDLKGLPANDDHPSHDVANGQKLVKEVYETLRASPQWNETLLVITYDEHGGFYDHVET  318

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VP+PDG  GP P  F+FDRLGVRVP IMVSPWI++G V+  P+GP P+SE+EHSSI
Sbjct  319   PYVNVPSPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVISSPNGPAPSSEFEHSSI  378

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+   T+PR DCP T+ +   LR+AEA+ED++L
Sbjct  379   PATIKKMFNLSSNFLTHRDAWAGTFEGVVGELTSPRTDCPVTMPDVAPLRTAEAREDSSL  438

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + M+V +A DY   +  +F+   + A   G
Sbjct  439   SEFQSEVVQLAAVLNGDHFLSS-FPDEISKKMNVKEALDYVEGSVTRFIRASKEAINLG  496



>gb|KDO66868.1| hypothetical protein CISIN_1g009232mg [Citrus sinensis]
Length=539

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/480 (58%), Positives = 350/480 (73%), Gaps = 15/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVL+ ENRSFDH+LGW+KS  P+I+G+ GKESN +  S    +  +  V   + +
Sbjct  42    PIKTVVVLIMENRSFDHILGWLKSTRPDIDGLTGKESNSVNIS----DPKSPKVFVSDDA  97

Query  253   QYVDPDPGHSIQDIYEQIFGA-PWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
              +VD DPGHS Q I EQIFG+   S +SA     P M GF   A      M+  VM+GF 
Sbjct  98    IFVDSDPGHSFQAIREQIFGSNVISPNSA-----PMMNGFVQQAMSMDPDMARTVMSGFK  152

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE +P+Y EL  EFAV DRWFASVP+STQPNR +VHSATSHG  SN  K LI GFPQKTI
Sbjct  153   PEVIPIYTELANEFAVFDRWFASVPSSTQPNRFYVHSATSHGCQSNVKKDLIHGFPQKTI  212

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+DE G +FGIYYQ  P+TLF+++LRKLK++  FH + + FK H + GKLPNY V+EQ
Sbjct  213   FDSVDENGLTFGIYYQNIPATLFFKSLRKLKHLTKFHSYGLKFKRHARLGKLPNYAVIEQ  272

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFD+ + P NDDHPSHDV EGQ+FVKEVYE LRSSPQWNEM FLI YDEHGGF+DHVPT
Sbjct  273   RYFDVSLFPANDDHPSHDVAEGQRFVKEVYETLRSSPQWNEMAFLITYDEHGGFFDHVPT  332

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             PV+ VP+PDG+IGP P+ F+FDRLGVRVP +++SPWI++G V+HG +GP P+SE+EHSSI
Sbjct  333   PVSHVPSPDGVIGPDPFFFRFDRLGVRVPTLLISPWIDKGTVIHGSNGPTPHSEFEHSSI  392

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDAN  1320
             PATVKK+FNL + FLT+RDAWAGTFE  +  R TPR DCP TL E  + LR    +ED  
Sbjct  393   PATVKKLFNLKSNFLTKRDAWAGTFEKFLQLRKTPRDDCPVTLPEVTRSLRPWGPREDKE  452

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q E++Q+AA L GD++   Y    + +NM+  +A  Y+  A  +FL   + A + G
Sbjct  453   LSEFQVELIQLAAQLVGDYVLNTY--PDMGKNMTAGEANRYAEDAVKRFLEAGKAAIRAG  510



>ref|XP_002322267.1| phosphoesterase family protein [Populus trichocarpa]
 gb|EEF06394.1| phosphoesterase family protein [Populus trichocarpa]
Length=517

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 343/479 (72%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHM+GWMK S+NP INGV+G E NP+ T      S    + F + 
Sbjct  32    PIKTIVVLVMENRSFDHMIGWMKKSINPAINGVSGTECNPVSTKNPGPQS----ICFSDD  87

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS +D+ +Q+FG             P+M GF   A      +S  VM GF 
Sbjct  88    AEFVDPDPGHSFEDVEQQVFG---------NSSFPSMSGFVEQALSVSQNLSETVMKGFR  138

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE+VPVY  LVREFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  139   PESVPVYATLVREFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAIGYPQKTI  198

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  P+TLF+RN+RKLKYI  FH FD  FK   ++GKLP+  V+E 
Sbjct  199   FDSLHENGKDFGIYFQNIPTTLFFRNMRKLKYIFKFHLFDFKFKKDARDGKLPSLTVIEP  258

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQ  VKEVYE LR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  259   RYFDLKGLPANDDHPSHDVANGQNLVKEVYETLRASPQWNETLLVITYDEHGGFYDHVET  318

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VP+PDG  GP P  F+FDRLGVRVP IMVSPWI++G V+  P+GP P+SE+EHSSI
Sbjct  319   PYVNVPSPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVISSPNGPAPSSEFEHSSI  378

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+   T+PR DCP T+ +   LR+ EAKED++L
Sbjct  379   PATIKKMFNLSSNFLTHRDAWAGTFEGVVGELTSPRTDCPVTMPDVAPLRTTEAKEDSSL  438

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + M+V +A DY   +  +F+   + A   G
Sbjct  439   SEFQSEVVQLAAVLNGDHFLSS-FPDEISKKMNVKEALDYVEGSVTRFIRASKEAINLG  496



>ref|XP_011073084.1| PREDICTED: non-specific phospholipase C6 [Sesamum indicum]
Length=514

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/479 (58%), Positives = 341/479 (71%), Gaps = 14/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHMLGWMK S+NP INGV GKE N +   G ++    +++ F + 
Sbjct  26    PIKTIVVLVLENRSFDHMLGWMKKSVNPSINGVTGKECNSVSAKGDSK-IVAEMICFSDD  84

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             ++YVDPDPGHS +D+ +Q+FG+            P+M GF   A      +S  VM GF 
Sbjct  85    AEYVDPDPGHSFEDVEKQVFGS---------SSFPSMSGFVEQALTMSENLSQTVMKGFR  135

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE VP+Y  LV EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  ++L  G+PQ TI
Sbjct  136   PENVPIYAALVSEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKRQLATGYPQHTI  195

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FGIY+Q  P+TLFYRNLRKLKYI  FHQ+D+ FK   + GKLP+  V+E 
Sbjct  196   FDSLHENGLDFGIYFQNVPTTLFYRNLRKLKYIFKFHQYDLKFKKDARNGKLPSLTVIEP  255

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDL  LP NDDHPSHDV  GQK VKEVYE LR+SPQWNE L +I YDEHGGFYDHV T
Sbjct  256   RYFDLTGLPANDDHPSHDVANGQKLVKEVYETLRASPQWNETLLVITYDEHGGFYDHVQT  315

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+  P GP PNSEYEHSSI
Sbjct  316   PYVNVPNPDGNTGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVISRPKGPSPNSEYEHSSI  375

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWAGTFE V+ + T+PR DCPE L E V LR     E+  L
Sbjct  376   PATIKKMFNLSSHFLTHRDAWAGTFEHVVGQLTSPRTDCPEVLPEVVPLRKTGTDENRGL  435

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P +  + M+V +A +Y   A ++F+   + A + G
Sbjct  436   SEFQNEVVQLAAVLNGDHFLSS-FPGETGKKMNVKEAHEYVRGAVSRFIRASKEASKLG  493



>ref|NP_001170209.1| uncharacterized protein LOC100384160 precursor [Zea mays]
 gb|ACN35859.1| unknown [Zea mays]
 gb|ACN36240.1| unknown [Zea mays]
Length=542

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/469 (59%), Positives = 343/469 (73%), Gaps = 14/469 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDH+LGW++   P+I+G+ G+ESN L     A + ++  +   +++
Sbjct  48    PIKTVVVVVMENRSFDHILGWLRRTRPDIDGLTGRESNRL----NASDPSSPDIFVTDEA  103

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVD DPGH  +DI EQIFG   S D++   + P M GFA NA     GM   VM+GF P
Sbjct  104   GYVDSDPGHGFEDIREQIFG---SADTSA--VPPPMSGFAQNARGMGLGMPQNVMSGFKP  158

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             +AVPVY  L  EFAV DRWFASVP STQPNRLFVHSATSHG T N  K LI GFPQKTIF
Sbjct  159   DAVPVYASLADEFAVFDRWFASVPTSTQPNRLFVHSATSHGLTFNARKDLIHGFPQKTIF  218

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S++E G SFGIYYQ  P+TLFY++LR+LK++  FHQ+ + FK H K GKLPNY V+EQR
Sbjct  219   DSLEENGLSFGIYYQNIPATLFYQSLRRLKHLVKFHQYTLKFKLHAKLGKLPNYAVIEQR  278

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD ++ P NDDHPSHDV  GQ+FVKEVYE LR+SPQWNE   +I YDEHGGFYDHVPTP
Sbjct  279   YFDCEMFPANDDHPSHDVARGQRFVKEVYETLRASPQWNETALIITYDEHGGFYDHVPTP  338

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V GVP PDG++GP PY F+F+RLGVRVP  ++SPWI++G V+H P+GP   S+YEHSSIP
Sbjct  339   VVGVPQPDGIVGPDPYYFKFERLGVRVPTFLISPWIDKGTVIHKPNGPQDTSQYEHSSIP  398

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R TPR DCPE L E  K LR    KED++L
Sbjct  399   ATVKKLFNLHSNFLTKRDAWAGTFENYFKIRRTPRTDCPEKLPEVTKSLRPFGPKEDSSL  458

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFL  1470
             +E+Q E++Q+A+ L GDH+   Y    +   M+V +A  Y+  A  +FL
Sbjct  459   SEFQVELIQLASQLNGDHVLNTY--PDIGRTMTVGEANRYAEDAVARFL  505



>ref|XP_004143151.1| PREDICTED: phospholipase C 3-like [Cucumis sativus]
Length=534

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/516 (56%), Positives = 362/516 (70%), Gaps = 23/516 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIK+VVVLV ENRSFDH+LGW+KS+ PEI+G+ GKESN +  S    +  ++ V   N +
Sbjct  37    PIKSVVVLVMENRSFDHVLGWLKSVRPEIDGLTGKESNRVSVS----DPNSEEVFVSNDA  92

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPT-MQGFAANAE-RNQAGMSGAVMNGF  426
              ++D DPGHS Q I EQIFG   S DS+   + P  M GFA  A   ++  M   VM+GF
Sbjct  93    IFIDSDPGHSFQAIREQIFG---SNDSS---VNPAPMNGFAQQAAAMDEIDMPKTVMSGF  146

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE VPVY EL  +FAV DRWFASVPASTQPNR +VHSATSHGA SN  K LI GFPQKT
Sbjct  147   KPERVPVYTELANQFAVFDRWFASVPASTQPNRFYVHSATSHGAMSNVRKDLIHGFPQKT  206

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+DE G +FGIYYQ  P+TLF+++LRKLK+I  FH + + FK H K G+LPNY V+E
Sbjct  207   IFDSLDENGLTFGIYYQNIPATLFFKSLRKLKHIVKFHSYALKFKLHAKLGRLPNYAVIE  266

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
             QRYFD+ + P NDDHPSHDV  GQKFVKEVYE LR+SPQW EM  LI YDEHGGFYDHVP
Sbjct  267   QRYFDVDLYPANDDHPSHDVARGQKFVKEVYEILRASPQWKEMALLITYDEHGGFYDHVP  326

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TPVTGVPNPDG+IGP PY F+FDRLGVRVP I+VSPW+E+G V+H P GP   S++EHSS
Sbjct  327   TPVTGVPNPDGIIGPDPYYFRFDRLGVRVPTILVSPWVEKGTVIHEPVGPTSTSQFEHSS  386

Query  1147  IPATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAEPVK-LRSAEAKEDA  1317
             +PATVKK+FNL + FLT+RDAWAGTF+  +  R  PR DCPETL +    LR    KE A
Sbjct  387   VPATVKKLFNLKSNFLTKRDAWAGTFDHYLKLRDHPRDDCPETLPKVTAPLRPWGPKEHA  446

Query  1318  NLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQR  1497
              L+E+Q E++Q+A+ L GDH+   Y    + + M+V +A  Y+  A  +FL     A   
Sbjct  447   KLSEFQVELIQLASQLNGDHVLNSY--PNIGKYMTVGEANKYAEDAVKRFLEAGRVALMA  504

Query  1498  GIHGDYSVVALSKQPPSPNTTPRKPKSFATKFLSCI  1605
             G + + ++V +      P+ T R     +  FL C+
Sbjct  505   GAN-ESAIVTM-----RPSLTSRTTAVDSGPFLICL  534



>ref|XP_003526950.1| PREDICTED: non-specific phospholipase C6-like [Glycine max]
 gb|KHN32548.1| Non-hemolytic phospholipase C [Glycine soja]
Length=519

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/480 (58%), Positives = 350/480 (73%), Gaps = 14/480 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDHMLGWMK S+N  INGV G E NP+ T    ++   D + F + 
Sbjct  29    PIKTVVVLVMENRSFDHMLGWMKESINTLINGVTGDECNPVST----KSPRKDSICFTDD  84

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA-ERNQAGMSGAVMNGF  426
             +++VDPDPGHS +D+ +Q+FG+     S      P+M GF   A   +   +S  VM GF
Sbjct  85    AEFVDPDPGHSFEDVLQQVFGSSSGSGSI-----PSMNGFVEQALSMSSPNLSETVMKGF  139

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              P++VPVY  LV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  ++L +G+PQKT
Sbjct  140   KPDSVPVYAALVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHIKRQLAKGYPQKT  199

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+SM E G  FGIY+Q  P+TLFYRNLRKLKYI  FHQ+D+ FK   ++GKLP   V+E
Sbjct  200   IFDSMHENGLDFGIYFQNIPTTLFYRNLRKLKYIWKFHQYDLKFKRDARDGKLPPLTVIE  259

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
              RYFDLK +P NDDHPSHDV  GQ  VKEVYEALR+SPQWNE LF+I YDEHGGF+DHV 
Sbjct  260   PRYFDLKGIPANDDHPSHDVAHGQMLVKEVYEALRASPQWNETLFVITYDEHGGFFDHVK  319

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP   +PNPDG  GP PY F+FDRLGVRVP IMVSPWI++G V+ G  GP  NSE+EHSS
Sbjct  320   TPFVNIPNPDGNTGPAPYFFKFDRLGVRVPTIMVSPWIKKGTVISGAKGPAENSEFEHSS  379

Query  1147  IPATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDAN  1320
             IPAT+K IFNL + FLT RDAWAGTFE V+   ++PR DCP T+ +   LRS EAKE+A 
Sbjct  380   IPATIKMIFNLSSNFLTHRDAWAGTFEHVVGELSSPRTDCPVTMPDVTPLRSTEAKENAG  439

Query  1321  LTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             L+E+Q+E+VQ+AAVL GDH     +P ++ + MSV +A +Y   A ++F+   + A + G
Sbjct  440   LSEFQREVVQLAAVLNGDHFLSS-FPDEMSKKMSVKEAHEYVRGAVSRFIRASKEAIKLG  498



>ref|XP_008374231.1| PREDICTED: non-specific phospholipase C6-like [Malus domestica]
 ref|XP_008346676.1| PREDICTED: non-specific phospholipase C6-like [Malus domestica]
Length=529

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 344/479 (72%), Gaps = 16/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHMLGWMK S+NP INGV GKE NP+ T       +   + F + 
Sbjct  42    PIKTIVVLVMENRSFDHMLGWMKKSVNPAINGVTGKECNPVSTKPADPEKS---ICFSDD  98

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+            P+M GF   A      +S  VM GF 
Sbjct  99    AEFVDPDPGHSFEAVEQQVFGS---------GSLPSMTGFVEQALSMSPNLSETVMKGFR  149

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE+VP Y  LV EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  150   PESVPAYAALVSEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLASGYPQKTI  209

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E G  FG+Y+Q  P+T+FYRN+RKLKYI  FHQ+D+ FK   ++GKLP+  V+E 
Sbjct  210   FDSVHENGLDFGVYFQNIPTTMFYRNMRKLKYIFKFHQYDLKFKKDARKGKLPSLTVIEP  269

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
              YFDLK +P NDDHPSHDV  GQ+ VKEVYE LR+SPQWNE L +I YDEHGGF+DHV T
Sbjct  270   SYFDLKGMPANDDHPSHDVANGQRLVKEVYETLRASPQWNETLLVITYDEHGGFFDHVKT  329

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VPNPDG  GP P  F+FDRLGVRVP IMVSPWI++G V+ GP GP PNSE+EHSSI
Sbjct  330   PYVNVPNPDGNSGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVMSGPQGPTPNSEFEHSSI  389

Query  1150  PATVKKIFNLNQ-FLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL+  FLT RDAWAGTFE V+ + ++PR DCP TL + V LR  EAKED++L
Sbjct  390   PATIKKMFNLSSNFLTHRDAWAGTFEQVVGQLSSPRTDCPVTLPDVVPLRKTEAKEDSSL  449

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E VQ+AAVL GDH     YP ++ + MSV +A  Y   A ++F+   + A + G
Sbjct  450   SEFQGEAVQLAAVLNGDHFLSS-YPDEMSKKMSVREAHGYVKGAVSRFVRASKEAIKLG  507



>ref|XP_008349572.1| PREDICTED: non-specific phospholipase C1-like [Malus domestica]
Length=532

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/479 (58%), Positives = 345/479 (72%), Gaps = 14/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDH+ GW+KS  P+I+G+ G ESNP+  S       +  V   + +
Sbjct  36    PIKTVVVVVMENRSFDHIFGWLKSTRPDIDGLNGNESNPIXVS----EPGSPRVRVSSDA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG+  S ++        M GFA  AE    GM+  VM+GF P
Sbjct  92    FFVDSDPGHSFQAIREQIFGSNESSENPAP-----MNGFAQQAESMGEGMARTVMSGFKP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EFAV DRWFASVPASTQPNR ++HSATSHGA SN  K LI GFPQKTIF
Sbjct  147   EVLPVYTELANEFAVFDRWFASVPASTQPNRFYIHSATSHGAMSNVRKDLIHGFPQKTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE    FGIYYQ  P+TLF+++LRKLK++  F  + + FK H + GKLPNY V+EQR
Sbjct  207   DSLDENDLDFGIYYQNIPATLFFKSLRKLKHVTKFXSYALTFKRHAQLGKLPNYAVIEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+K LP NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVPTP
Sbjct  267   YFDVKELPANDDHPSHDVARGQRFVKEVYETLRASPQWKEMALLITYDEHGGFYDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V  VP+PDG++G +PY F+FDRLGVRVP I+VSPW+E G V+H P GP P+S++EHSSI 
Sbjct  327   VXDVPSPDGIVGNEPYYFRFDRLGVRVPTILVSPWVEXGTVIHEPXGPTPHSQFEHSSIA  386

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE   T R+TPR DCPETL E  K LR    +ED++L
Sbjct  387   ATVKKLFNLKSNFLTKRDAWAGTFENYFTLRSTPRDDCPETLPEVTKSLRPGGPREDSSL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E++Q+A+ L GDH+ + Y    + E M+V +A  Y+  A  +FL     A + G
Sbjct  447   SEFQVELIQLASQLNGDHVLKTY--PDIGETMTVREANSYAEDAVKRFLEAGRAALKAG  503



>ref|XP_008384816.1| PREDICTED: non-specific phospholipase C1-like [Malus domestica]
Length=532

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/479 (58%), Positives = 345/479 (72%), Gaps = 14/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVV+V ENRSFDH+ GW+KS  P+I+G+ G ESNP+  S       +  V   + +
Sbjct  36    PIKTVVVVVMENRSFDHIFGWLKSTRPDIDGLNGNESNPISVS----EPGSPRVRVSSDA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG+  S ++        M GFA  AE    GM+  VM+GF P
Sbjct  92    FFVDSDPGHSFQAIREQIFGSNESSENPAP-----MNGFAQQAESMGEGMARTVMSGFKP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
             E +PVY EL  EFAV DRWFASVPASTQPNR ++HSATSHGA SN  K LI GFPQKTIF
Sbjct  147   EVLPVYTELANEFAVFDRWFASVPASTQPNRFYIHSATSHGAMSNVRKDLIHGFPQKTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE    FGIYYQ  P+TLF+++LRKLK++  F  + + FK H + GKLPNY V+EQR
Sbjct  207   DSLDENDLDFGIYYQNIPATLFFKSLRKLKHVTKFXSYALTFKRHAQLGKLPNYAVIEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+K LP NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVPTP
Sbjct  267   YFDVKELPANDDHPSHDVARGQRFVKEVYETLRASPQWKEMALLITYDEHGGFYDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V  VP+PDG++G +PY F+FDRLGVRVP I+VSPW+E G V+H P GP P+S++EHSSI 
Sbjct  327   VLDVPSPDGIVGNEPYYFRFDRLGVRVPTILVSPWVEXGTVIHEPXGPTPHSQFEHSSIA  386

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVIT-RTTPRKDCPETLAEPVK-LRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE   T R+TPR DCPETL E  K LR    +ED++L
Sbjct  387   ATVKKLFNLKSNFLTKRDAWAGTFENYFTLRSTPRDDCPETLPEVTKSLRPGGPREDSSL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E++Q+A+ L GDH+ + Y    + E M+V +A  Y+  A  +FL     A + G
Sbjct  447   SEFQVELIQLASQLNGDHVLKTY--PDIGETMTVREANSYAEDAVKRFLEAGRAALKAG  503



>ref|XP_010104638.1| Phospholipase C 4 [Morus notabilis]
 gb|EXC01444.1| Phospholipase C 4 [Morus notabilis]
Length=532

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/489 (58%), Positives = 354/489 (72%), Gaps = 15/489 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKTVVVLV ENRSFDH+LGW+KS  PEI+G+ GKE N +  S    +  +  V   + +
Sbjct  36    PIKTVVVLVMENRSFDHVLGWLKSTRPEIDGLTGKEWNRINVS----DPKSPNVFVSDDA  91

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG+     + G +    M GFA  A     GM   VM+GF P
Sbjct  92    IFVDSDPGHSFQAIREQIFGS-----NHGSENPAPMNGFAQQAVSMGEGMPRTVMSGFKP  146

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
               VPVY EL  EFAV DRWFASVPASTQPNR +VHSATSHGATSN  K LI GFPQKTIF
Sbjct  147   GRVPVYTELANEFAVFDRWFASVPASTQPNRFYVHSATSHGATSNVRKDLIHGFPQKTIF  206

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE G  FGIYYQ  P+TLF+++LRKLK+   FH + + FK H + GKLPNYVV+EQR
Sbjct  207   DSLDENGLDFGIYYQNIPATLFFKSLRKLKHAIKFHNYALKFKLHARLGKLPNYVVLEQR  266

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+ + P NDDHPSHDV  GQ+FVK+VYE LR+SPQW EM  LI YDEHGGFYDHVPTP
Sbjct  267   YFDVDLFPANDDHPSHDVALGQRFVKDVYEILRASPQWKEMALLITYDEHGGFYDHVPTP  326

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             V+GVP+PDG++GP P+ F+FDRLGVRVP I+VSPW+++G V+H P GP P+S++EHSSIP
Sbjct  327   VSGVPSPDGIVGPDPFYFRFDRLGVRVPTILVSPWVDKGTVIHEPVGPTPHSQFEHSSIP  386

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R +PR DCPETL E  + LR    KEDA L
Sbjct  387   ATVKKLFNLKSNFLTKRDAWAGTFENYFKLRDSPRDDCPETLPEVKLSLRPWGPKEDARL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GD+M  + YP+ + + M+V +A  Y+  A  +FL     A + G 
Sbjct  447   SEFQVELIQLASQLNGDYML-NTYPN-IGKTMTVGEANKYAEDAVKRFLEAGRAALKAGA  504

Query  1504  HGDYSVVAL  1530
             + D ++V +
Sbjct  505   N-DTAIVTM  512



>emb|CAN76213.1| hypothetical protein VITISV_015975 [Vitis vinifera]
Length=547

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/533 (56%), Positives = 362/533 (68%), Gaps = 50/533 (9%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDHMLGWMK +NP+INGV G E NP+  S    + T+ +V F N S
Sbjct  32    PIKTIVVLVMENRSFDHMLGWMKQINPQINGVDGSEYNPISPS----DPTSPLVFFTNTS  87

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              YVD DP HS Q I EQIFG+    D+A     P M GFA  A    A     VM+GF P
Sbjct  88    HYVDADPPHSFQAIREQIFGS----DNASAD-HPPMNGFAQQATTTSAA-PQTVMSGFDP  141

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
               V VYK LV EFAV DRWFASVPASTQPNRLFVHSATS GAT N    L +G+PQ+TIF
Sbjct  142   SMVAVYKTLVSEFAVFDRWFASVPASTQPNRLFVHSATSAGATGNIPTMLAKGYPQRTIF  201

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +++D AG  FGIYYQ  P+TLFY++LRKLKY+  FH + + F+ H +EGKLP Y V+EQR
Sbjct  202   DNLDAAGVPFGIYYQNIPATLFYQSLRKLKYLDKFHFYGLSFERHAREGKLPGYTVIEQR  261

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             Y D K+ PGNDDHPSHDV+EGQ FVKEVYE LR+SPQWNE L +I YDEHGGFYDHVPTP
Sbjct  262   YMDTKVEPGNDDHPSHDVYEGQMFVKEVYETLRASPQWNETLLVITYDEHGGFYDHVPTP  321

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIM-VSPWIERG--------------------  1089
             V GVP+PDG+ GP+P+ F FDRLGVRVP I+ ++  + R                     
Sbjct  322   VRGVPSPDGIAGPEPFLFXFDRLGVRVPTIIGLTIGLTRALDQFRFNDFLKAEKKDGPLP  381

Query  1090  ---------KVLHGPSG-PFPNSEYEHSSIPATVKKIFNLNQ-FLTERDAWAGTFETVI-  1233
                      KV+HGP+G PFP SEYEHSSIPATVKKIFNL+  FLT+RD WAGTFE ++ 
Sbjct  382   KCHTKTIKRKVVHGPNGSPFPTSEYEHSSIPATVKKIFNLSSPFLTKRDEWAGTFEGIVQ  441

Query  1234  TRTTPRKDCPETLAEPVKLRSAEAKEDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVE  1413
             TRT PR DCPE L  PV++R  EA E A L+E+Q+E+VQ+AAVL GD++    YP K+ +
Sbjct  442   TRTQPRTDCPEQLPTPVRMRKGEANESAKLSEFQEELVQLAAVLKGDNILTS-YPEKIGK  500

Query  1414  NMSVAKAADYSHLAFNKFLGDCENARQRGIHGDYSVVALSKQPPSPNTTPRKP  1572
              M+V +   Y   A  +FL    +A++ G++ +  +V +      P+ T R P
Sbjct  501   QMNVKQGKKYMEDAVKQFLEAGLSAKRMGVNEE-QIVKM-----RPSLTTRSP  547



>ref|XP_004234306.1| PREDICTED: non-specific phospholipase C6 [Solanum lycopersicum]
Length=525

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/482 (59%), Positives = 347/482 (72%), Gaps = 18/482 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDH+LGWMK S+NP INGV GKE NPL T   AQ++    + F + 
Sbjct  35    PIKTVVVLVLENRSFDHLLGWMKKSVNPRINGVTGKECNPLSTK--AQHT--QTICFTDD  90

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA-ERNQAGMSGAVMNGF  426
             +QYVDPDPGHS +D+ +Q+FG+       G    P+M GF   A   +   +S AVM GF
Sbjct  91    AQYVDPDPGHSFEDVEQQVFGS-------GSGSIPSMSGFVEQALTMSDKNLSRAVMRGF  143

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE VP+Y+ LVREFAV DRWF S+P  TQPNRLF++SATSHG+TS+  K+L  G+PQKT
Sbjct  144   KPENVPIYETLVREFAVFDRWFCSIPGPTQPNRLFLYSATSHGSTSHVKKQLATGYPQKT  203

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+ E G  FGIYYQ  PSTLFYRNLR LKY+  FHQ+D+ FK   K G LPN  V+E
Sbjct  204   IFDSLHENGLDFGIYYQNIPSTLFYRNLRMLKYMFKFHQYDLKFKKDAKNGNLPNLTVIE  263

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
              RYF +   P NDDHPSHDV +GQK VKE+YE LR+SPQWNE LF+I YDEHGGFYDHV 
Sbjct  264   PRYFGIIGYPANDDHPSHDVADGQKLVKEIYETLRASPQWNETLFVITYDEHGGFYDHVK  323

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP   VPNPDG  GP P  F+FDRLGVRVP IMVSPWI++G V+  P GP PNSE+EHSS
Sbjct  324   TPYGDVPNPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVITKPKGPTPNSEFEHSS  383

Query  1147  IPATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETL--AEPVKLRSAEAKED  1314
             IPAT+KKIFNL + FLT RDAWAGTFE V+ + ++PR DCPE L  A P++  + EA E 
Sbjct  384   IPATIKKIFNLSSNFLTHRDAWAGTFEHVVAQLSSPRTDCPEVLPDASPLRSTTTEADET  443

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
               L+E+Q E+VQ+AAVL GDH     +PH++ + M+V +A  Y   A ++F+   + A +
Sbjct  444   RALSEFQSEVVQLAAVLNGDHFLSS-FPHEMGKKMNVKEAHSYVGGAVSRFISASKEAIK  502

Query  1495  RG  1500
              G
Sbjct  503   LG  504



>ref|XP_006351512.1| PREDICTED: uncharacterized protein LOC102598393 [Solanum tuberosum]
Length=525

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/482 (59%), Positives = 346/482 (72%), Gaps = 18/482 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDH+LGWMK S+NP INGV GKE NPL T   AQ++  + + F + 
Sbjct  35    PIKTVVVLVLENRSFDHLLGWMKKSVNPRINGVTGKECNPLSTK--AQDT--ETICFTDD  90

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANA-ERNQAGMSGAVMNGF  426
             +QYVDPDPGHS +D+ +Q+FG+       G    P+M GF   A   +   +S AVM GF
Sbjct  91    AQYVDPDPGHSFEDVEQQVFGS-------GSGSIPSMSGFVEQALTMSDKNLSRAVMRGF  143

Query  427   VPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKT  606
              PE VP+Y  LVREFAV DRWF S+P  TQPNRLF++SATSHG+TS+  K+L  G+PQKT
Sbjct  144   KPENVPIYATLVREFAVFDRWFCSIPGPTQPNRLFLYSATSHGSTSHVKKQLATGYPQKT  203

Query  607   IFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVE  786
             IF+S+ E G  FGIYYQ  PSTLFYRNLR LKY+  FHQ+D+ FK   K G LPN  V+E
Sbjct  204   IFDSLHENGLDFGIYYQNIPSTLFYRNLRMLKYMFKFHQYDLKFKKDAKNGNLPNLTVIE  263

Query  787   QRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVP  966
              RYF +   P NDDHPSHDV +GQK VKE+YE LR+SPQWNE LF+I YDEHGGFYDHV 
Sbjct  264   PRYFGIIGYPANDDHPSHDVADGQKLVKEIYETLRASPQWNETLFVITYDEHGGFYDHVK  323

Query  967   TPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSS  1146
             TP   VPNPDG  GP P  F+FDRLGVRVP IMVSPWI++G V+  P GP PNSE+EHSS
Sbjct  324   TPFGDVPNPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVITKPKGPTPNSEFEHSS  383

Query  1147  IPATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETL--AEPVKLRSAEAKED  1314
             IPAT+KKIFNL + FLT RDAWAGTFE V+ + ++PR DCPE L  A P++  + EA E 
Sbjct  384   IPATIKKIFNLTSNFLTHRDAWAGTFEHVVAQLSSPRTDCPEVLPDASPLRSTTTEADET  443

Query  1315  ANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQ  1494
               L+E+Q E+VQ+AAVL GDH     +PH++ + M+V +   Y   A ++F+   + A +
Sbjct  444   RALSEFQSEVVQLAAVLNGDHFLSS-FPHEMGKKMNVKEGHSYVGGAVSRFISASKEAIK  502

Query  1495  RG  1500
              G
Sbjct  503   LG  504



>ref|XP_002525632.1| hydrolase, acting on ester bonds, putative [Ricinus communis]
 gb|EEF36750.1| hydrolase, acting on ester bonds, putative [Ricinus communis]
Length=537

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/503 (56%), Positives = 357/503 (71%), Gaps = 19/503 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNKS  252
             PIKT+VVLV ENRSFDH+LGW+KS  P+I+G+ GKE N +  +    +  ++ V   + +
Sbjct  40    PIKTLVVLVMENRSFDHVLGWLKSTRPDIDGLTGKEHNRVSIA----DPNSEKVYVSDDA  95

Query  253   QYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFVP  432
              +VD DPGHS Q I EQIFG+    D   K  +P M GFA  AE      S  VM+GF P
Sbjct  96    VFVDWDPGHSFQAIREQIFGS----DEDSKANQPLMNGFAQQAESMSENKSRTVMSGFKP  151

Query  433   EAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTIF  612
               +PVY  L  EFAV DRWFASVPASTQPNR +VHSATSHGATSN  + LI GFPQKTIF
Sbjct  152   NRLPVYTALANEFAVFDRWFASVPASTQPNRFYVHSATSHGATSNVRRDLIHGFPQKTIF  211

Query  613   ESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQR  792
             +S+DE   +FGIYYQ  P+TLF+++LRKLK++  FH +++ F+ H + GKLPNY VVEQR
Sbjct  212   DSLDENDLTFGIYYQNIPATLFFKSLRKLKHLIKFHDYELKFRRHARLGKLPNYAVVEQR  271

Query  793   YFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPTP  972
             YFD+++ P NDDHPSHDV  GQ+FVKEVYE LR+SPQW EM  LI YDEHGGFYDHVPTP
Sbjct  272   YFDVELFPANDDHPSHDVAIGQRFVKEVYEILRASPQWKEMALLITYDEHGGFYDHVPTP  331

Query  973   VTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSIP  1152
             VTGVP+PDG++GP P+ F+FDRLGVRVP I+VSPWI++G V+H P GP P+S++EHSSIP
Sbjct  332   VTGVPSPDGIVGPDPFYFRFDRLGVRVPTILVSPWIDKGTVIHEPVGPTPHSQFEHSSIP  391

Query  1153  ATVKKIFNL-NQFLTERDAWAGTFETVI-TRTTPRKDCPETLAE-PVKLRSAEAKEDANL  1323
             ATVKK+FNL + FLT+RDAWAGTFE     R TPR DCPETL E  + LR     ED  L
Sbjct  392   ATVKKLFNLKSNFLTKRDAWAGTFEDYFHIRDTPRDDCPETLPEVQMSLRPRGPIEDMRL  451

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRGI  1503
             +E+Q E++Q+A+ L GDH+   Y    + ++M+V +A  Y+  A  +FL +   A  R  
Sbjct  452   SEFQVELIQLASQLNGDHVLNTY--PDIGKSMTVGEANRYAEDAVKRFL-EAGKAALRAG  508

Query  1504  HGDYSVVALSKQPPSPNTTPRKP  1572
               + ++V +      P+ T R P
Sbjct  509   ANESAIVTM-----RPSLTSRVP  526



>ref|XP_006290899.1| hypothetical protein CARUB_v10017011mg [Capsella rubella]
 gb|EOA23797.1| hypothetical protein CARUB_v10017011mg [Capsella rubella]
Length=524

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/479 (58%), Positives = 348/479 (73%), Gaps = 15/479 (3%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMK-SLNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKTVVVLV ENRSFDH+LGWMK S+NP INGV G+E NP+P      NST   + F + 
Sbjct  38    PIKTVVVLVLENRSFDHLLGWMKKSVNPTINGVTGQECNPVP------NSTQ-TICFTSD  90

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+  S    G    P+M GF   A      +S  VM GF 
Sbjct  91    AEFVDPDPGHSFEAVEQQVFGSALS----GSGQIPSMTGFVEQALSMPGNLSETVMKGFR  146

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE+VPVY ELV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L +G+PQKTI
Sbjct  147   PESVPVYAELVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAQGYPQKTI  206

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+      FGIY+Q  P+TLFYRNLR+LKYI N HQ+D+ FK    +GKLP+  V+E 
Sbjct  207   FDSLHSNDIDFGIYFQNIPTTLFYRNLRQLKYIFNLHQYDLAFKRDAAKGKLPSLTVIEP  266

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQK VKEVYE+LRSSPQWN+ L +I YDEHGGFYDHV T
Sbjct  267   RYFDLKGLPANDDHPSHDVANGQKLVKEVYESLRSSPQWNQTLLVITYDEHGGFYDHVKT  326

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P  G+PNPDG  GP P  F+FDRLGVRVP IMVSPWI++G V+    GP  +SEYEHSSI
Sbjct  327   PYVGIPNPDGNTGPAPGFFKFDRLGVRVPTIMVSPWIKKGTVVSEAKGPTESSEYEHSSI  386

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PAT+KK+FNL + FLT RDAWA TFE V++  T+PR DCP TL +   +R+ E KEDA L
Sbjct  387   PATIKKLFNLSSNFLTHRDAWAATFEDVVSHLTSPRTDCPMTLPDVAPIRTTEPKEDAAL  446

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+AAVL GDH     +P ++ + M+V +A +Y   A ++F+   + A + G
Sbjct  447   SEFQGEVVQLAAVLNGDHFLSS-FPDEVGKKMTVKQAHEYVKGATSRFIRASKEAMKLG  504



>gb|KHG10805.1| Phospholipase C 3 [Gossypium arboreum]
 gb|KHG29372.1| Phospholipase C 3 [Gossypium arboreum]
Length=522

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/479 (58%), Positives = 342/479 (71%), Gaps = 17/479 (4%)
 Frame = +1

Query  73    PIKTVVVLVQENRSFDHMLGWMKS-LNPEINGVAGKESNPLPTSGGAQNSTNDVVLFGNK  249
             PIKT+VVLV ENRSFDHMLGWMK  +NP INGV G E NP+ T    +N   + + F + 
Sbjct  36    PIKTIVVLVMENRSFDHMLGWMKQHVNPSINGVTGDECNPVST----KNPNPESICFTDD  91

Query  250   SQYVDPDPGHSIQDIYEQIFGAPWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMNGFV  429
             +++VDPDPGHS + + +Q+FG+            P+M GF   A      +S  VM GF 
Sbjct  92    AEFVDPDPGHSFEAVEQQVFGS---------STIPSMSGFVEQALSMSKNLSETVMKGFR  142

Query  430   PEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQKTI  609
             PE+VPVY  LV+EFAV DRWF+S+P  TQPNRLFV+SATSHG+TS+  K+L  G+PQKTI
Sbjct  143   PESVPVYAALVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGSTSHVKKQLAHGYPQKTI  202

Query  610   FESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVVVEQ  789
             F+S+ E    FG+Y+Q  P+TLFYRNLRKLKY+  FHQFD+ FK   ++GKLP+  V+E 
Sbjct  203   FDSLHENDKDFGVYFQNIPTTLFYRNLRKLKYVFKFHQFDLKFKKDARKGKLPSLTVIEP  262

Query  790   RYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDHVPT  969
             RYFDLK LP NDDHPSHDV  GQK VKEVYE LR+SPQWN+ L +I YDEHGGFYDHV T
Sbjct  263   RYFDLKGLPANDDHPSHDVANGQKLVKEVYEILRASPQWNQTLLVITYDEHGGFYDHVHT  322

Query  970   PVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEHSSI  1149
             P   VP+PDG  GP P  F+FDRLGVRVP IMVSPWI++G V+ GP GPFPNSE+EHSSI
Sbjct  323   PYINVPSPDGNTGPAPSFFKFDRLGVRVPTIMVSPWIKKGTVISGPKGPFPNSEFEHSSI  382

Query  1150  PATVKKIFNL-NQFLTERDAWAGTFETVITR-TTPRKDCPETLAEPVKLRSAEAKEDANL  1323
             PATVKK+FNL + FLT RDAWAGTFE V+   ++PR DCPE L E   LR+  A EDA L
Sbjct  383   PATVKKMFNLSSNFLTHRDAWAGTFERVVGELSSPRTDCPEKLPEAAPLRTTAANEDAGL  442

Query  1324  TEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENARQRG  1500
             +E+Q E+VQ+A+VL GDH     +  ++   MSV  A +Y   A ++F+   + A + G
Sbjct  443   SEFQSEVVQLASVLNGDHFLSG-FAEEMHTKMSVKGAHEYVKGAVSRFIRASKEAIKLG  500



>ref|XP_002974695.1| hypothetical protein SELMODRAFT_174501 [Selaginella moellendorffii]
 gb|EFJ24215.1| hypothetical protein SELMODRAFT_174501 [Selaginella moellendorffii]
Length=511

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/484 (60%), Positives = 346/484 (71%), Gaps = 28/484 (6%)
 Frame = +1

Query  76    IKTVVVLVQENRSFDHMLGWMKSLNPEINGVAGKESNPL----PTSGGAQNSTNDVVLFG  243
             IKT+VVLVQENRSFDHMLGW+K LNPEI+G+ GKESNP     P+SG         V   
Sbjct  27    IKTIVVLVQENRSFDHMLGWLKKLNPEIDGLTGKESNPTNLTDPSSG--------TVFVS  78

Query  244   NKSQYVDPDPGHSIQDIYEQIFG-APWSQDSAGKKLEPTMQGFAANAERNQAGMSGAVMN  420
             +K+++VDPDPGHS   I +Q+FG    SQ+ A       M GFA  AE  Q  +S  VM+
Sbjct  79    DKAEFVDPDPGHSFGAIRDQVFGFGSTSQNPA------PMNGFAQQAEIIQKNLSQRVMS  132

Query  421   GFVPEAVPVYKELVREFAVCDRWFASVPASTQPNRLFVHSATSHGATSNDTKKLIEGFPQ  600
              F PE VP Y  L  EFA+CD+WFASVPASTQPNRL+VHSATSHGA SN    L++GFPQ
Sbjct  133   SFRPELVPAYTALAMEFAICDKWFASVPASTQPNRLYVHSATSHGAVSNVRSDLVKGFPQ  192

Query  601   KTIFESMDEAGYSFGIYYQYPPSTLFYRNLRKLKYIKNFHQFDIHFKTHCKEGKLPNYVV  780
             KTIFES+D+   SFGIYYQ  P+TLFYR++  L Y+  FH + + FKTH K+GKLPNYVV
Sbjct  193   KTIFESIDQDKLSFGIYYQNIPATLFYRHV--LVYLGKFHNYGL-FKTHAKQGKLPNYVV  249

Query  781   VEQRYFDLKILPGNDDHPSHDVFEGQKFVKEVYEALRSSPQWNEMLFLIIYDEHGGFYDH  960
             VEQRY+D K  P NDDHPSHDV EGQKF+KEVYE LRSSPQWNE L +I YDEHGGF+DH
Sbjct  250   VEQRYYDTKATPANDDHPSHDVAEGQKFIKEVYETLRSSPQWNETLLVITYDEHGGFFDH  309

Query  961   VPTPVTGVPNPDGLIGPQPYNFQFDRLGVRVPAIMVSPWIERGKVLHGPSGPFPNSEYEH  1140
             V TP+  VPNPDGL G    +F FDRLGVRVPAI VSPWI++G V+H P+GP  +S+YEH
Sbjct  310   VSTPMDNVPNPDGLRGGDDDHFNFDRLGVRVPAIFVSPWIDKGTVIHRPNGPTKDSQYEH  369

Query  1141  SSIPATVKKIFNLNQ-FLTERDAWAGTFETVI--TRTTPRKDCPETL-AEPVKLRSAEAK  1308
             SSIPATVKKIFNL Q FLT+RDAWAGTFETV+  TRTTPR DCP TL + P  LR +   
Sbjct  370   SSIPATVKKIFNLTQPFLTKRDAWAGTFETVLSSTRTTPRTDCPVTLPSSPWSLRHSPPN  429

Query  1309  EDANLTEYQKEMVQMAAVLCGDHMKEDYYPHKLVENMSVAKAADYSHLAFNKFLGDCENA  1488
             E+  LTE+Q EMV +A+ L GD+ K  Y    L  +M+V  A+DY   A    +   + A
Sbjct  430   EEGRLTEFQVEMVGLASQLNGDYGKSGY--PNLGASMTVKYASDYVDRAVEGIMRAGKVA  487

Query  1489  RQRG  1500
              Q G
Sbjct  488   LQSG  491



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5156615493492