BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79475_g1_i1 len=1006 path=[1062:0-1005]

Length=1006
                                                                      Score     E

emb|CDP13382.1|  unnamed protein product                                134   2e-34   
gb|AFK33528.1|  unknown                                                 130   2e-32   
ref|XP_002299329.2|  hypothetical protein POPTR_0001s13460g             130   3e-32   Populus trichocarpa [western balsam poplar]
gb|ADU56197.1|  SAUR family protein                                     129   4e-32   
gb|KDP26852.1|  hypothetical protein JCGZ_18010                         129   5e-32   
ref|XP_008340250.1|  PREDICTED: indole-3-acetic acid-induced prot...    127   1e-31   
ref|XP_011071313.1|  PREDICTED: uncharacterized protein LOC105156793    127   1e-31   
ref|XP_008222216.1|  PREDICTED: uncharacterized protein LOC103322112    127   1e-31   
ref|XP_002514869.1|  hypothetical protein RCOM_1078910                  127   1e-31   Ricinus communis
ref|XP_002303770.1|  hypothetical protein POPTR_0003s16580g             126   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_004491682.1|  PREDICTED: uncharacterized protein LOC101512600    126   3e-31   
ref|XP_007043889.1|  SAUR family protein                                125   4e-31   
ref|XP_010249111.1|  PREDICTED: uncharacterized protein LOC104591786    125   7e-31   
ref|XP_007227681.1|  hypothetical protein PRUPE_ppa026219mg             124   2e-30   
gb|AFK48563.1|  unknown                                                 123   3e-30   
ref|XP_011020815.1|  PREDICTED: uncharacterized protein LOC105123051    122   6e-30   
ref|XP_009349477.1|  PREDICTED: indole-3-acetic acid-induced prot...    122   1e-29   
ref|XP_011036123.1|  PREDICTED: uncharacterized protein LOC105133729    123   2e-29   
ref|XP_006436889.1|  hypothetical protein CICLE_v10033363mg             122   2e-29   
ref|XP_009770405.1|  PREDICTED: auxin-induced protein 10A5-like         120   4e-29   
ref|XP_003552755.1|  PREDICTED: uncharacterized protein LOC100777217    120   5e-29   
ref|XP_009336447.1|  PREDICTED: indole-3-acetic acid-induced prot...    119   8e-29   
ref|XP_010090676.1|  hypothetical protein L484_017482                   120   1e-28   
ref|XP_010044854.1|  PREDICTED: uncharacterized protein LOC104433707    119   1e-28   
ref|XP_008389916.1|  PREDICTED: indole-3-acetic acid-induced prot...    118   2e-28   
ref|XP_006493246.1|  PREDICTED: uncharacterized protein LOC102627134    119   3e-28   
gb|AGR44724.1|  SAUR family protein                                     118   3e-28   
gb|KDO64450.1|  hypothetical protein CISIN_1g029186mg                   119   4e-28   
ref|XP_004310111.1|  PREDICTED: uncharacterized protein LOC101294039    118   4e-28   
ref|XP_009624882.1|  PREDICTED: auxin-induced protein 10A5-like         116   7e-28   
ref|XP_003631359.1|  PREDICTED: auxin-induced protein 6B-like           116   9e-28   
ref|XP_002264638.1|  PREDICTED: uncharacterized protein LOC100245472    116   1e-27   Vitis vinifera
emb|CAN66812.1|  hypothetical protein VITISV_011138                     115   3e-27   Vitis vinifera
ref|XP_010482375.1|  PREDICTED: uncharacterized protein LOC104761057    114   1e-26   
gb|KDP22580.1|  hypothetical protein JCGZ_26411                         113   2e-26   
ref|XP_002511134.1|  calmodulin binding protein, putative               113   3e-26   Ricinus communis
ref|XP_007038060.1|  Calmodulin binding protein, putative               113   3e-26   
gb|KHN24973.1|  Indole-3-acetic acid-induced protein ARG7               112   4e-26   
gb|KDO83113.1|  hypothetical protein CISIN_1g030719mg                   112   6e-26   
ref|XP_010442311.1|  PREDICTED: uncharacterized protein LOC104725349    112   9e-26   
ref|XP_006586283.1|  PREDICTED: uncharacterized protein LOC100799988    110   2e-25   
ref|XP_011073103.1|  PREDICTED: uncharacterized protein LOC105158157    110   3e-25   
ref|XP_006844597.1|  hypothetical protein AMTR_s00016p00212020          109   4e-25   
ref|XP_006483047.1|  PREDICTED: uncharacterized protein LOC102613185    109   6e-25   
ref|XP_007210042.1|  hypothetical protein PRUPE_ppa017538mg             108   9e-25   
ref|XP_010446011.1|  PREDICTED: uncharacterized protein LOC104728772    108   1e-24   
ref|XP_006438814.1|  hypothetical protein CICLE_v10032901mg             108   1e-24   
ref|XP_010668453.1|  PREDICTED: uncharacterized protein LOC104885461    108   2e-24   
ref|XP_010025283.1|  PREDICTED: uncharacterized protein LOC104415655    107   3e-24   
ref|XP_006363778.1|  PREDICTED: indole-3-acetic acid-induced prot...    106   3e-24   
ref|XP_008459883.1|  PREDICTED: uncharacterized protein LOC103498869    106   6e-24   
ref|XP_011044095.1|  PREDICTED: uncharacterized protein LOC105139380    105   1e-23   
ref|XP_004298545.1|  PREDICTED: uncharacterized protein LOC101292997    106   1e-23   
ref|XP_004228430.1|  PREDICTED: auxin-induced protein X10A-like         105   1e-23   
ref|XP_007139103.1|  hypothetical protein PHAVU_008G001500g             105   2e-23   
ref|XP_009600107.1|  PREDICTED: uncharacterized protein LOC104095647    105   3e-23   
ref|XP_002318753.2|  hypothetical protein POPTR_0012s10450g             104   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011042925.1|  PREDICTED: uncharacterized protein LOC105138521    104   4e-23   
ref|XP_008239631.1|  PREDICTED: uncharacterized protein LOC103338225    104   5e-23   
ref|XP_004140543.1|  PREDICTED: uncharacterized protein LOC101219164    103   9e-23   
ref|XP_002511133.1|  calmodulin binding protein, putative               101   4e-22   Ricinus communis
ref|XP_009375239.1|  PREDICTED: uncharacterized protein LOC103964074    101   4e-22   
gb|EYU43035.1|  hypothetical protein MIMGU_mgv1a025672mg                100   7e-22   
ref|XP_002462638.1|  hypothetical protein SORBIDRAFT_02g029390        99.4    7e-22   Sorghum bicolor [broomcorn]
ref|XP_002462640.1|  hypothetical protein SORBIDRAFT_02g029410        99.4    9e-22   Sorghum bicolor [broomcorn]
ref|XP_009770249.1|  PREDICTED: uncharacterized protein LOC104220973    100   1e-21   
ref|XP_004298546.1|  PREDICTED: uncharacterized protein LOC101293297  99.8    1e-21   
ref|NP_001150755.1|  calmodulin binding protein                       98.6    2e-21   Zea mays [maize]
gb|ACG40236.1|  calmodulin binding protein                            98.6    2e-21   Zea mays [maize]
ref|XP_009383406.1|  PREDICTED: uncharacterized protein LOC103971172  98.6    2e-21   
gb|EYU43034.1|  hypothetical protein MIMGU_mgv1a014941mg              99.4    3e-21   
ref|XP_006347628.1|  PREDICTED: uncharacterized protein LOC102598616  98.6    3e-21   
ref|XP_011083566.1|  PREDICTED: uncharacterized protein LOC105166046    100   3e-21   
ref|XP_010926791.1|  PREDICTED: auxin-induced protein X15-like        97.8    3e-21   
ref|XP_008446293.1|  PREDICTED: uncharacterized protein LOC103489067  98.2    5e-21   
ref|XP_010929727.1|  PREDICTED: indole-3-acetic acid-induced prot...  97.8    5e-21   
gb|AFK42411.1|  unknown                                               96.7    1e-20   
ref|XP_008791133.1|  PREDICTED: auxin-induced protein X15-like        95.9    1e-20   
ref|XP_010093925.1|  hypothetical protein L484_008816                 97.1    2e-20   
emb|CDY71491.1|  BnaCnng73150D                                        95.9    4e-20   
ref|XP_008346665.1|  PREDICTED: uncharacterized protein LOC103409638  95.1    5e-20   
ref|XP_010939481.1|  PREDICTED: uncharacterized protein LOC105058300  97.1    7e-20   
ref|XP_004298547.1|  PREDICTED: uncharacterized protein LOC101293586  93.6    2e-19   
ref|XP_004235361.1|  PREDICTED: uncharacterized protein LOC101246229  93.2    2e-19   
ref|XP_009337547.1|  PREDICTED: uncharacterized protein LOC103929995  93.2    3e-19   
gb|KEH20995.1|  SAUR-like auxin-responsive family protein             92.4    3e-19   
ref|XP_010523232.1|  PREDICTED: uncharacterized protein LOC104801612  92.8    3e-19   
ref|XP_004241451.1|  PREDICTED: uncharacterized protein LOC101265243  92.8    4e-19   
tpg|DAA40496.1|  TPA: calmodulin binding protein                      92.4    4e-19   
gb|KGN64431.1|  hypothetical protein Csa_1G051690                     92.4    6e-19   
ref|XP_008804094.1|  PREDICTED: auxin-induced protein X15-like        91.3    6e-19   
ref|NP_199889.1|  SAUR-like auxin-responsive protein                  92.4    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864075.1|  auxin-responsive family protein                  91.7    1e-18   
ref|XP_004145218.1|  PREDICTED: uncharacterized protein LOC101219975  90.9    1e-18   
ref|XP_010663898.1|  PREDICTED: auxin-induced protein X10A-like       90.5    2e-18   
ref|XP_008670314.1|  PREDICTED: uncharacterized protein LOC103647576  91.3    3e-18   
ref|NP_001149909.1|  calmodulin binding protein                       89.7    3e-18   Zea mays [maize]
ref|XP_010045491.1|  PREDICTED: uncharacterized protein LOC104434216  90.9    3e-18   
gb|KEH20999.1|  SAUR-like auxin-responsive family protein             89.7    4e-18   
ref|XP_004298548.1|  PREDICTED: uncharacterized protein LOC101293879  89.4    5e-18   
ref|XP_009134069.1|  PREDICTED: uncharacterized protein LOC103858456  89.4    5e-18   
gb|KHN32562.1|  Auxin-induced protein X15                             89.4    7e-18   
ref|XP_004952566.1|  PREDICTED: uncharacterized protein LOC101780971  89.0    7e-18   
ref|XP_010111738.1|  hypothetical protein L484_008396                 87.8    9e-18   
ref|XP_006281172.1|  hypothetical protein CARUB_v10027207mg           89.4    9e-18   
gb|KHN23965.1|  Indole-3-acetic acid-induced protein ARG7             88.2    1e-17   
ref|XP_009132695.1|  PREDICTED: uncharacterized protein LOC103857272  88.6    1e-17   
emb|CDY45819.1|  BnaC03g16420D                                        88.6    1e-17   
ref|XP_003523159.1|  PREDICTED: uncharacterized protein LOC100789525  88.2    2e-17   
ref|XP_003602784.1|  Auxin-induced protein 6B                         87.4    2e-17   
dbj|BAK03180.1|  predicted protein                                    87.8    3e-17   
gb|EYU23063.1|  hypothetical protein MIMGU_mgv1a015250mg              87.0    4e-17   
gb|EPS74604.1|  hypothetical protein M569_00152                       84.7    4e-17   
ref|XP_004957298.1|  PREDICTED: indole-3-acetic acid-induced prot...  86.3    4e-17   
ref|XP_009383865.1|  PREDICTED: auxin-induced protein X15-like        85.9    5e-17   
ref|XP_002280410.1|  PREDICTED: uncharacterized protein LOC100268140  86.7    5e-17   Vitis vinifera
emb|CAN64976.1|  hypothetical protein VITISV_027843                   86.7    5e-17   Vitis vinifera
ref|XP_006586323.1|  PREDICTED: uncharacterized protein LOC102667331  86.7    5e-17   
gb|KEH20997.1|  SAUR-like auxin-responsive family protein             85.1    5e-17   
ref|XP_009385439.1|  PREDICTED: indole-3-acetic acid-induced prot...  85.9    6e-17   
gb|KHN16861.1|  Indole-3-acetic acid-induced protein ARG7             86.3    7e-17   
ref|XP_007160002.1|  hypothetical protein PHAVU_002G284700g           85.1    2e-16   
ref|XP_010555564.1|  PREDICTED: uncharacterized protein LOC104825028  85.5    3e-16   
gb|EAY77041.1|  hypothetical protein OsI_04997                        84.7    3e-16   Oryza sativa Indica Group [Indian rice]
emb|CDY34024.1|  BnaC03g27910D                                        84.3    3e-16   
ref|XP_003572558.1|  PREDICTED: uncharacterized protein LOC100829717  84.3    4e-16   
ref|XP_010045485.1|  PREDICTED: uncharacterized protein LOC104434209  82.8    5e-16   
ref|NP_001172716.1|  Os01g0924966                                     84.3    5e-16   
gb|EAZ09691.1|  hypothetical protein OsI_31974                        82.8    8e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_004503773.1|  PREDICTED: uncharacterized protein LOC101489648  83.2    9e-16   
ref|XP_002459008.1|  hypothetical protein SORBIDRAFT_03g044380        83.2    9e-16   Sorghum bicolor [broomcorn]
ref|XP_006647269.1|  PREDICTED: auxin-induced protein 15A-like        81.6    2e-15   
ref|XP_009408359.1|  PREDICTED: indole-3-acetic acid-induced prot...  81.3    2e-15   
ref|XP_009393614.1|  PREDICTED: auxin-induced protein 15A             80.5    3e-15   
ref|XP_004977952.1|  PREDICTED: uncharacterized protein LOC101773448  83.2    4e-15   
emb|CDM85822.1|  unnamed protein product                              80.9    6e-15   
ref|XP_007136076.1|  hypothetical protein PHAVU_009G015600g           79.7    8e-15   
ref|XP_002459007.1|  hypothetical protein SORBIDRAFT_03g044370        80.1    9e-15   Sorghum bicolor [broomcorn]
ref|XP_003550112.1|  PREDICTED: uncharacterized protein LOC100779842  80.5    1e-14   
ref|XP_004971120.1|  PREDICTED: uncharacterized protein LOC101781779  79.7    1e-14   
gb|KDP33420.1|  hypothetical protein JCGZ_06991                       79.7    2e-14   
ref|XP_010232765.1|  PREDICTED: uncharacterized protein LOC100825908  80.1    2e-14   
ref|XP_004144827.1|  PREDICTED: indole-3-acetic acid-induced prot...  79.3    2e-14   
ref|XP_007161535.1|  hypothetical protein PHAVU_001G077500g           79.7    2e-14   
ref|XP_010271410.1|  PREDICTED: indole-3-acetic acid-induced prot...  79.3    2e-14   
ref|XP_010539863.1|  PREDICTED: indole-3-acetic acid-induced prot...  79.0    3e-14   
ref|XP_010061488.1|  PREDICTED: uncharacterized protein LOC104449147  78.6    3e-14   
ref|XP_010246411.1|  PREDICTED: indole-3-acetic acid-induced prot...  79.0    3e-14   
ref|XP_004501724.1|  PREDICTED: uncharacterized protein LOC101509958  78.2    3e-14   
gb|EMT25620.1|  hypothetical protein F775_26776                       78.6    3e-14   
ref|XP_003544655.2|  PREDICTED: uncharacterized protein LOC100799598  79.0    3e-14   
emb|CDM85823.1|  unnamed protein product                              80.1    4e-14   
ref|XP_003523572.1|  PREDICTED: indole-3-acetic acid-induced prot...  77.8    4e-14   
ref|XP_002513015.1|  Indole-3-acetic acid-induced protein ARG7, p...  77.8    5e-14   Ricinus communis
gb|EYU21194.1|  hypothetical protein MIMGU_mgv1a024031mg              78.6    6e-14   
ref|XP_004307934.1|  PREDICTED: auxin-induced protein 10A5-like       77.0    7e-14   
emb|CDX75459.1|  BnaA01g02430D                                        77.0    1e-13   
ref|XP_009367954.1|  PREDICTED: uncharacterized protein LOC103957507  77.4    1e-13   
emb|CCH47223.1|  similar to auxin-induced protein 6B                  77.4    1e-13   
ref|XP_010034089.1|  PREDICTED: uncharacterized protein LOC104423276  77.4    1e-13   
ref|XP_008645719.1|  PREDICTED: uncharacterized protein LOC103627198  77.0    2e-13   
ref|XP_008448020.1|  PREDICTED: indole-3-acetic acid-induced prot...  76.6    2e-13   
gb|KDP27624.1|  hypothetical protein JCGZ_19629                       76.3    2e-13   
ref|XP_009122007.1|  PREDICTED: uncharacterized protein LOC103846762  76.3    2e-13   
emb|CDX97071.1|  BnaC09g45540D                                        75.9    3e-13   
ref|XP_009396221.1|  PREDICTED: indole-3-acetic acid-induced prot...  75.9    3e-13   
ref|NP_178034.1|  SAUR-like auxin-responsive protein                  75.5    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004303802.1|  PREDICTED: uncharacterized protein LOC101309563  76.6    3e-13   
ref|XP_003576721.1|  PREDICTED: indole-3-acetic acid-induced prot...  75.9    3e-13   
ref|XP_007023649.1|  SAUR-like auxin-responsive protein family, p...  76.3    3e-13   
ref|XP_007017754.1|  SAUR-like auxin-responsive protein family        75.9    3e-13   
gb|EMT16843.1|  hypothetical protein F775_31032                       75.5    3e-13   
ref|XP_008387015.1|  PREDICTED: indole-3-acetic acid-induced prot...  75.1    4e-13   
ref|XP_009391841.1|  PREDICTED: auxin-induced protein 6B              76.3    4e-13   
ref|XP_002513310.1|  Indole-3-acetic acid-induced protein ARG7, p...  75.9    4e-13   Ricinus communis
ref|XP_011037237.1|  PREDICTED: auxin-induced protein 10A5            75.5    4e-13   
emb|CDY51099.1|  BnaCnng20020D                                        75.5    4e-13   
ref|XP_002305471.1|  hypothetical protein POPTR_0004s17130g           75.5    4e-13   Populus trichocarpa [western balsam poplar]
gb|KHN39378.1|  Auxin-induced protein 15A                             75.1    5e-13   
ref|XP_010940987.1|  PREDICTED: auxin-induced protein 6B              75.5    5e-13   
dbj|BAK04310.1|  predicted protein                                    74.7    5e-13   
ref|XP_010417533.1|  PREDICTED: auxin-induced protein 15A-like        74.7    5e-13   
ref|XP_008378142.1|  PREDICTED: uncharacterized protein LOC103441218  75.5    6e-13   
ref|NP_001046940.1|  Os02g0512000                                     75.5    6e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86017.1|  hypothetical protein OsI_07378                        75.5    6e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_009109163.1|  PREDICTED: uncharacterized protein LOC103834796  75.1    6e-13   
ref|NP_001045869.2|  Os02g0143400                                     74.7    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003631581.1|  PREDICTED: auxin-induced protein 6B-like         74.7    7e-13   
ref|XP_003588611.1|  Auxin-induced protein 6B                         75.5    7e-13   
ref|XP_006382198.1|  auxin-responsive family protein                  75.1    7e-13   
ref|XP_010474488.1|  PREDICTED: auxin-induced protein 15A-like        74.3    8e-13   
gb|EMT16846.1|  hypothetical protein F775_03778                       74.3    8e-13   
ref|XP_004309365.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.9    9e-13   
ref|XP_008783079.1|  PREDICTED: auxin-induced protein 6B-like         74.7    9e-13   
gb|EMT16842.1|  hypothetical protein F775_18859                       74.3    9e-13   
ref|XP_010259870.1|  PREDICTED: uncharacterized protein LOC104599158  75.1    9e-13   
gb|EMS53831.1|  hypothetical protein TRIUR3_00762                     75.1    9e-13   
gb|EMT16845.1|  hypothetical protein F775_03777                       74.7    9e-13   
ref|XP_004147834.1|  PREDICTED: auxin-induced protein 6B-like         74.7    9e-13   
ref|XP_010263287.1|  PREDICTED: uncharacterized protein LOC104601591  75.1    1e-12   
ref|XP_008243661.1|  PREDICTED: auxin-induced protein X10A            73.9    1e-12   
ref|XP_006414980.1|  hypothetical protein EUTSA_v10026472mg           74.3    1e-12   
ref|XP_009418176.1|  PREDICTED: auxin-induced protein 15A-like        73.6    1e-12   
gb|EAY84447.1|  hypothetical protein OsI_05820                        73.9    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_008466498.1|  PREDICTED: auxin-induced protein 6B              74.3    1e-12   
ref|XP_010095665.1|  hypothetical protein L484_012237                 74.3    1e-12   
ref|XP_010431642.1|  PREDICTED: auxin-induced protein 15A-like        73.9    1e-12   
gb|AGQ56868.1|  SAUR family protein 39                                74.3    1e-12   
dbj|BAD13235.1|  auxin-induced protein-like                           74.3    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006850943.1|  hypothetical protein AMTR_s00025p00192620        74.3    1e-12   
ref|XP_006416459.1|  hypothetical protein EUTSA_v10009868mg           74.3    1e-12   
ref|XP_009375726.1|  PREDICTED: uncharacterized protein LOC103964518  74.7    1e-12   
ref|XP_011047078.1|  PREDICTED: auxin-induced protein 10A5-like       73.9    1e-12   
ref|XP_007203531.1|  hypothetical protein PRUPE_ppa026695mg           73.6    1e-12   
ref|XP_004498552.1|  PREDICTED: uncharacterized protein LOC101505346  74.7    1e-12   
ref|XP_009337658.1|  PREDICTED: uncharacterized protein LOC103930093  73.9    1e-12   
ref|XP_004303544.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.6    1e-12   
gb|EMS53829.1|  hypothetical protein TRIUR3_00760                     73.6    2e-12   
gb|EMT06448.1|  hypothetical protein F775_14394                       73.2    2e-12   
ref|XP_002446314.1|  hypothetical protein SORBIDRAFT_06g014230        74.3    2e-12   Sorghum bicolor [broomcorn]
ref|XP_008804009.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.9    2e-12   
ref|XP_008466269.1|  PREDICTED: uncharacterized protein LOC103503729  74.3    2e-12   
ref|XP_004242870.1|  PREDICTED: uncharacterized protein LOC101250316  73.9    2e-12   
ref|XP_006450104.1|  hypothetical protein CICLE_v10010302mg           74.3    2e-12   
ref|XP_010913783.1|  PREDICTED: auxin-induced protein 6B-like         73.6    2e-12   
gb|KDP36945.1|  hypothetical protein JCGZ_08236                       73.6    2e-12   
ref|XP_002313749.1|  hypothetical protein POPTR_0009s12880g           73.6    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009630044.1|  PREDICTED: uncharacterized protein LOC104120067  73.9    2e-12   
ref|XP_010498406.1|  PREDICTED: uncharacterized protein LOC104776100  73.6    2e-12   
ref|XP_006435148.1|  hypothetical protein CICLE_v10003150mg           73.6    2e-12   
ref|XP_008361160.1|  PREDICTED: uncharacterized protein LOC103424846  73.9    2e-12   
gb|ADE76442.1|  unknown                                               73.9    2e-12   
emb|CDX68733.1|  BnaC01g07200D                                        74.3    2e-12   
ref|XP_002510511.1|  Auxin-induced protein 6B, putative               73.6    2e-12   Ricinus communis
ref|XP_010928766.1|  PREDICTED: auxin-induced protein 6B-like         73.2    3e-12   
gb|KGN60020.1|  hypothetical protein Csa_3G866530                     74.3    3e-12   
ref|XP_007041996.1|  F10A5.20, putative                               73.6    3e-12   
ref|XP_007160682.1|  hypothetical protein PHAVU_001G008100g           73.2    3e-12   
ref|XP_008358422.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.2    3e-12   
ref|XP_009347330.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.2    3e-12   
ref|XP_004517301.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.2    3e-12   
ref|XP_008781914.1|  PREDICTED: auxin-induced protein 6B-like         73.2    3e-12   
ref|XP_010462797.1|  PREDICTED: uncharacterized protein LOC104743408  73.2    3e-12   
ref|XP_009379214.1|  PREDICTED: uncharacterized protein LOC103967662  73.9    3e-12   
ref|XP_010648451.1|  PREDICTED: uncharacterized protein LOC100250771  73.2    3e-12   
emb|CDY62584.1|  BnaA08g31240D                                        72.8    3e-12   
ref|XP_008219982.1|  PREDICTED: uncharacterized protein LOC103320129  73.6    4e-12   
ref|XP_009378468.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.8    4e-12   
ref|XP_008342622.1|  PREDICTED: uncharacterized protein LOC103405398  73.6    4e-12   
ref|XP_011006641.1|  PREDICTED: uncharacterized protein LOC105112603  73.2    4e-12   
emb|CAN63902.1|  hypothetical protein VITISV_031686                   72.8    4e-12   Vitis vinifera
ref|XP_004963509.1|  PREDICTED: uncharacterized protein LOC101784697  73.2    4e-12   
ref|XP_009334986.1|  PREDICTED: uncharacterized protein LOC103927766  73.6    4e-12   
ref|XP_009347904.1|  PREDICTED: uncharacterized protein LOC103939528  73.2    4e-12   
ref|XP_003529710.1|  PREDICTED: uncharacterized protein LOC100818996  72.4    4e-12   
ref|XP_006473631.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.8    5e-12   
ref|XP_006390290.1|  hypothetical protein EUTSA_v10019286mg           72.4    5e-12   
ref|XP_008460570.1|  PREDICTED: uncharacterized protein LOC103499...  72.8    5e-12   
dbj|BAJ34271.1|  unnamed protein product                              72.4    5e-12   
ref|XP_010520521.1|  PREDICTED: uncharacterized protein LOC104799608  72.8    6e-12   
gb|EMT03631.1|  hypothetical protein F775_19990                       72.0    6e-12   
ref|XP_008228004.1|  PREDICTED: uncharacterized protein LOC103327442  73.2    6e-12   
ref|XP_006483628.1|  PREDICTED: uncharacterized protein LOC102619609  72.8    6e-12   
gb|AAR20762.1|  At4g34750                                             72.4    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138004.1|  PREDICTED: uncharacterized protein LOC103862042  73.6    6e-12   
ref|XP_002989902.1|  hypothetical protein SELMODRAFT_49701            70.1    6e-12   
ref|XP_008387955.1|  PREDICTED: auxin-induced protein 10A5-like       72.4    6e-12   
gb|ABR17095.1|  unknown                                               72.0    6e-12   Picea sitchensis
ref|XP_008437649.1|  PREDICTED: auxin-induced protein X15             71.6    6e-12   
ref|XP_010526282.1|  PREDICTED: uncharacterized protein LOC104803884  72.8    6e-12   
ref|XP_002968653.1|  hypothetical protein SELMODRAFT_69737            70.1    7e-12   
emb|CDY13423.1|  BnaA03g51410D                                        72.8    7e-12   
ref|XP_008460569.1|  PREDICTED: uncharacterized protein LOC103499...  72.8    7e-12   
gb|AFK44148.1|  unknown                                               72.4    7e-12   
emb|CDX83744.1|  BnaC08g19010D                                        72.0    7e-12   
ref|XP_003527716.1|  PREDICTED: auxin-induced protein 6B-like         71.6    7e-12   
emb|CDY29393.1|  BnaA06g14030D                                        72.0    7e-12   
ref|XP_010050904.1|  PREDICTED: uncharacterized protein LOC104439552  72.8    8e-12   
ref|XP_009125262.1|  PREDICTED: uncharacterized protein LOC103850290  72.0    8e-12   
emb|CDX72302.1|  BnaC07g43240D                                        73.2    8e-12   
ref|XP_006399598.1|  hypothetical protein EUTSA_v10015745mg           72.0    8e-12   
gb|KGN57847.1|  hypothetical protein Csa_3G346940                     72.0    8e-12   
ref|XP_007216865.1|  hypothetical protein PRUPE_ppa021387mg           72.8    8e-12   
ref|XP_007201825.1|  hypothetical protein PRUPE_ppa012885mg           72.0    8e-12   
ref|XP_004142814.1|  PREDICTED: uncharacterized protein LOC101207913  72.4    9e-12   
gb|KHN38103.1|  Auxin-induced protein X15                             72.0    9e-12   
ref|XP_003530361.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.0    9e-12   
ref|XP_010548082.1|  PREDICTED: uncharacterized protein LOC104819631  72.0    9e-12   
ref|XP_009341743.1|  PREDICTED: uncharacterized protein LOC103933780  72.0    9e-12   
emb|CAN68562.1|  hypothetical protein VITISV_033102                   72.0    9e-12   
emb|CDP13586.1|  unnamed protein product                              71.6    9e-12   
gb|AEW08460.1|  hypothetical protein 2_10399_01                       71.2    9e-12   
ref|XP_009415076.1|  PREDICTED: auxin-induced protein 6B-like         71.6    9e-12   
ref|XP_006286600.1|  hypothetical protein CARUB_v10002201mg           71.6    9e-12   
ref|XP_009149476.1|  PREDICTED: uncharacterized protein LOC103872789  71.6    1e-11   
ref|XP_002265932.1|  PREDICTED: auxin-induced protein 6B-like         72.0    1e-11   
ref|XP_009379568.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.6    1e-11   
gb|EYU38833.1|  hypothetical protein MIMGU_mgv1a021651mg              71.6    1e-11   
ref|XP_006596565.1|  PREDICTED: auxin-induced protein 6B-like         71.6    1e-11   
ref|XP_004291305.1|  PREDICTED: uncharacterized protein LOC101314623  72.0    1e-11   
ref|XP_009335244.1|  PREDICTED: auxin-induced protein 10A5-like       71.6    1e-11   
ref|XP_006412188.1|  hypothetical protein EUTSA_v10026506mg           71.6    1e-11   
emb|CDY68586.1|  BnaCnng59650D                                        71.6    1e-11   
ref|XP_006436403.1|  hypothetical protein CICLE_v10033759mg           72.4    1e-11   
gb|AFK44459.1|  unknown                                               72.0    1e-11   
ref|XP_003607090.1|  Auxin-induced protein 6B                         71.2    1e-11   
gb|EMS53830.1|  hypothetical protein TRIUR3_00761                     71.2    1e-11   
ref|XP_006361587.1|  PREDICTED: uncharacterized protein LOC102596161  72.0    1e-11   
gb|KDO84796.1|  hypothetical protein CISIN_1g043725mg                 71.6    1e-11   
ref|XP_004136303.1|  PREDICTED: auxin-induced protein 6B-like         72.0    1e-11   
ref|XP_006601344.1|  PREDICTED: auxin-induced protein 6B-like         71.6    1e-11   
gb|EMS53827.1|  hypothetical protein TRIUR3_00758                     71.2    1e-11   
ref|NP_195201.1|  SAUR-like auxin-responsive family protein           71.6    1e-11   
gb|AFK48909.1|  unknown                                               71.2    1e-11   
ref|XP_009336969.1|  PREDICTED: auxin-induced protein 6B-like         70.9    1e-11   
ref|NP_001148938.1|  SAUR20 - auxin-responsive SAUR family member     71.6    1e-11   
emb|CDX79712.1|  BnaC03g20480D                                        70.9    1e-11   
emb|CDY36449.1|  BnaC03g67690D                                        72.0    1e-11   
gb|AFK41725.1|  unknown                                               72.0    1e-11   
ref|XP_002880581.1|  hypothetical protein ARALYDRAFT_481295           72.0    1e-11   
ref|NP_001168736.1|  uncharacterized protein LOC100382528             71.6    1e-11   
ref|XP_010917979.1|  PREDICTED: auxin-induced protein 10A5-like       71.2    1e-11   
ref|XP_009405045.1|  PREDICTED: auxin-induced protein 6B-like         71.2    1e-11   
gb|EYU40411.1|  hypothetical protein MIMGU_mgv1a015936mg              71.2    1e-11   
ref|XP_009386173.1|  PREDICTED: auxin-induced protein 6B-like         70.5    2e-11   
ref|XP_008380405.1|  PREDICTED: uncharacterized protein LOC103443353  72.0    2e-11   
ref|XP_009790302.1|  PREDICTED: uncharacterized protein LOC104237780  71.6    2e-11   
ref|XP_009397518.1|  PREDICTED: indole-3-acetic acid-induced prot...  70.9    2e-11   
ref|XP_009614199.1|  PREDICTED: auxin-induced protein X15-like        70.9    2e-11   
emb|CBI37971.3|  unnamed protein product                              70.5    2e-11   
ref|NP_001130827.1|  SAUR56-auxin-responsive SAUR family member       70.5    2e-11   
ref|XP_002306917.1|  auxin-responsive family protein                  70.9    2e-11   
ref|XP_008457620.1|  PREDICTED: uncharacterized protein LOC103497270  72.0    2e-11   
ref|XP_003602327.1|  Auxin-induced protein 10A5                       70.9    2e-11   
emb|CDY28255.1|  BnaA01g05940D                                        71.6    2e-11   
ref|XP_003603566.1|  Auxin-induced protein 6B                         71.2    2e-11   
ref|XP_009127095.1|  PREDICTED: uncharacterized protein LOC103851967  71.6    2e-11   
gb|AFK49594.1|  unknown                                               71.2    2e-11   
gb|EMS53828.1|  hypothetical protein TRIUR3_00759                     70.5    2e-11   
ref|XP_002887769.1|  auxin-responsive family protein                  70.5    2e-11   
ref|XP_004160397.1|  PREDICTED: auxin-induced protein X15-like        70.5    2e-11   
ref|XP_002876644.1|  auxin-responsive family protein                  70.9    2e-11   
ref|XP_011046563.1|  PREDICTED: uncharacterized protein LOC105141139  71.2    2e-11   
ref|NP_001053812.1|  Os04g0608300                                     71.2    2e-11   
ref|XP_008377159.1|  PREDICTED: uncharacterized protein LOC103440265  70.9    2e-11   
gb|ACG34454.1|  SAUR56 - auxin-responsive SAUR family member          70.5    2e-11   
gb|AFK37533.1|  unknown                                               70.1    2e-11   
ref|XP_010431593.1|  PREDICTED: auxin-induced protein 10A5-like       70.5    2e-11   
ref|XP_010921547.1|  PREDICTED: auxin-induced protein 15A-like        70.1    2e-11   
ref|XP_002277332.1|  PREDICTED: auxin-induced protein 6B-like         70.9    2e-11   
gb|KFK38176.1|  hypothetical protein AALP_AA3G079300                  70.9    2e-11   
gb|AAM62891.1|  unknown                                               70.9    2e-11   
emb|CBI18450.3|  unnamed protein product                              70.5    3e-11   
ref|XP_009395454.1|  PREDICTED: uncharacterized protein LOC103980710  70.9    3e-11   
gb|KHN25456.1|  Auxin-induced protein 6B                              69.3    3e-11   
ref|XP_006412606.1|  hypothetical protein EUTSA_v10027570mg           71.2    3e-11   
ref|XP_002513381.1|  Indole-3-acetic acid-induced protein ARG7, p...  70.5    3e-11   
emb|CDY20311.1|  BnaC04g36450D                                        70.9    3e-11   
ref|XP_009106211.1|  PREDICTED: uncharacterized protein LOC103832008  70.5    3e-11   
gb|EMT06447.1|  hypothetical protein F775_28320                       70.1    3e-11   
ref|XP_008380439.1|  PREDICTED: auxin-induced protein 15A-like        69.7    3e-11   
ref|NP_001054156.1|  Os04g0662400                                     70.5    3e-11   
ref|XP_003632936.1|  PREDICTED: uncharacterized protein LOC100855086  70.9    3e-11   
ref|XP_010541681.1|  PREDICTED: uncharacterized protein LOC104815072  70.5    3e-11   
emb|CBI18456.3|  unnamed protein product                              70.1    3e-11   
ref|XP_008663699.1|  PREDICTED: indole-3-acetic acid-induced prot...  70.5    3e-11   
ref|XP_008223816.1|  PREDICTED: auxin-induced protein 6B-like         70.5    3e-11   
ref|XP_011045120.1|  PREDICTED: auxin-induced protein 6B-like         70.5    3e-11   
ref|NP_189898.1|  SAUR-like auxin-responsive protein                  70.5    3e-11   
gb|ABK28585.1|  unknown                                               70.5    3e-11   
ref|XP_009391239.1|  PREDICTED: uncharacterized protein LOC103977449  70.9    3e-11   
gb|KDO46694.1|  hypothetical protein CISIN_1g040086mg                 70.1    3e-11   
ref|XP_002266916.1|  PREDICTED: uncharacterized protein LOC100242742  70.9    3e-11   
emb|CAN62212.1|  hypothetical protein VITISV_011167                   70.9    3e-11   
gb|EMT19210.1|  hypothetical protein F775_43039                       69.7    3e-11   
ref|XP_002316430.1|  auxin-responsive family protein                  70.9    3e-11   
ref|XP_002270432.1|  PREDICTED: auxin-induced protein 6B-like         70.1    4e-11   
ref|XP_002889033.1|  auxin-responsive family protein                  70.1    4e-11   
ref|XP_007226850.1|  hypothetical protein PRUPE_ppa017180mg           70.5    4e-11   
ref|XP_009598038.1|  PREDICTED: uncharacterized protein LOC104093914  70.1    4e-11   
ref|XP_010112436.1|  hypothetical protein L484_013820                 70.5    4e-11   
ref|XP_008791678.1|  PREDICTED: auxin-induced protein 6B-like iso...  69.3    4e-11   
ref|XP_008391870.1|  PREDICTED: indole-3-acetic acid-induced prot...  69.7    4e-11   
ref|XP_003540937.1|  PREDICTED: indole-3-acetic acid-induced prot...  69.7    4e-11   
ref|XP_006468108.1|  PREDICTED: uncharacterized protein LOC102612713  70.9    4e-11   
ref|XP_009366726.1|  PREDICTED: indole-3-acetic acid-induced prot...  69.7    4e-11   
ref|XP_003551054.1|  PREDICTED: uncharacterized protein LOC100795275  70.1    4e-11   
ref|XP_009123263.1|  PREDICTED: uncharacterized protein LOC103848025  70.1    4e-11   
ref|XP_002275644.1|  PREDICTED: uncharacterized protein LOC100266455  70.1    4e-11   
ref|XP_008377160.1|  PREDICTED: uncharacterized protein LOC103440266  70.1    4e-11   
ref|XP_010493190.1|  PREDICTED: uncharacterized protein LOC104770457  70.1    4e-11   
ref|XP_004501217.1|  PREDICTED: uncharacterized protein LOC101489202  70.5    5e-11   
ref|XP_007012552.1|  SAUR-like auxin-responsive protein family        70.1    5e-11   
emb|CBI27760.3|  unnamed protein product                              70.1    5e-11   
gb|KHG20809.1|  Auxin-induced 15A                                     70.1    5e-11   
ref|NP_196660.1|  SAUR-like auxin-responsive protein                  69.7    5e-11   
emb|CAN63903.1|  hypothetical protein VITISV_031687                   70.1    5e-11   
ref|XP_011018209.1|  PREDICTED: auxin-induced protein 6B-like         69.7    5e-11   
ref|XP_007011526.1|  SAUR family protein                              70.1    5e-11   
ref|XP_009797904.1|  PREDICTED: auxin-induced protein 6B-like         69.7    5e-11   
ref|XP_008791677.1|  PREDICTED: histidine-rich glycoprotein-like ...  69.7    5e-11   
ref|XP_006419133.1|  hypothetical protein EUTSA_v10002695mg           69.7    5e-11   
ref|XP_002266327.1|  PREDICTED: uncharacterized protein LOC100265117  70.1    5e-11   
ref|XP_006652791.1|  PREDICTED: uncharacterized protein LOC102718261  70.1    6e-11   
ref|XP_008366667.1|  PREDICTED: indole-3-acetic acid-induced prot...  69.3    6e-11   
ref|NP_180016.1|  SAUR-like auxin-responsive protein                  70.1    6e-11   
ref|XP_010417194.1|  PREDICTED: uncharacterized protein LOC104702959  70.1    6e-11   
ref|XP_006288810.1|  hypothetical protein CARUB_v10002144mg           69.7    6e-11   
gb|EAY95922.1|  hypothetical protein OsI_17789                        69.7    6e-11   
ref|XP_004147056.1|  PREDICTED: auxin-induced protein X10A-like       69.7    6e-11   
emb|CAN60527.1|  hypothetical protein VITISV_000524                   70.5    6e-11   
ref|XP_010093746.1|  hypothetical protein L484_019148                 69.3    6e-11   
ref|XP_010927192.1|  PREDICTED: auxin-induced protein 6B-like         69.3    6e-11   
ref|XP_010050905.1|  PREDICTED: uncharacterized protein LOC104439553  69.7    6e-11   
ref|XP_010472448.1|  PREDICTED: uncharacterized protein LOC104752081  70.1    6e-11   
gb|EMS53832.1|  hypothetical protein TRIUR3_00763                     72.4    6e-11   
ref|XP_002875598.1|  hypothetical protein ARALYDRAFT_484787           69.7    6e-11   
ref|XP_011028981.1|  PREDICTED: indole-3-acetic acid-induced prot...  69.3    7e-11   
ref|XP_002308089.1|  hypothetical protein POPTR_0006s06990g           69.3    7e-11   
ref|XP_007135867.1|  hypothetical protein PHAVU_010G164600g           69.3    7e-11   
ref|XP_009133110.1|  PREDICTED: indole-3-acetic acid-induced prot...  68.9    7e-11   
ref|XP_009140550.1|  PREDICTED: uncharacterized protein LOC103864549  69.7    7e-11   
emb|CDY46148.1|  BnaA04g14360D                                        69.7    7e-11   
gb|KHN11778.1|  Auxin-induced protein 6B                              67.8    7e-11   
ref|XP_004499236.1|  PREDICTED: auxin-induced protein 6B-like         69.3    8e-11   
ref|XP_007136493.1|  hypothetical protein PHAVU_009G049900g           68.9    8e-11   
ref|XP_009141624.1|  PREDICTED: auxin-induced protein 15A-like        68.6    8e-11   
ref|XP_010239379.1|  PREDICTED: uncharacterized protein LOC100841069  69.7    8e-11   
ref|XP_008462190.1|  PREDICTED: uncharacterized protein LOC103500611  69.3    8e-11   
gb|EYU19681.1|  hypothetical protein MIMGU_mgv1a016283mg              68.9    8e-11   
ref|XP_010245477.1|  PREDICTED: auxin-induced protein 15A-like        68.6    8e-11   
ref|XP_006430165.1|  hypothetical protein CICLE_v10013674mg           68.6    8e-11   
emb|CDY16564.1|  BnaC09g37090D                                        69.3    8e-11   
ref|XP_010438052.1|  PREDICTED: uncharacterized protein LOC104721706  69.7    8e-11   
emb|CDX91329.1|  BnaC04g08210D                                        68.6    9e-11   
ref|XP_010908835.1|  PREDICTED: auxin-induced protein 10A5-like       69.7    9e-11   
ref|XP_007027790.1|  SAUR family protein                              68.6    9e-11   
ref|XP_009772845.1|  PREDICTED: auxin-induced protein X15-like        68.6    9e-11   
gb|KHN47616.1|  Indole-3-acetic acid-induced protein ARG7             69.3    9e-11   
ref|XP_007137148.1|  hypothetical protein PHAVU_009G103800g           69.3    9e-11   
ref|XP_006400646.1|  hypothetical protein EUTSA_v10014872mg           69.3    9e-11   
emb|CDX69085.1|  BnaC01g03680D                                        68.9    1e-10   
ref|XP_004960183.1|  PREDICTED: auxin-induced protein X10A-like       68.9    1e-10   
ref|XP_008791346.1|  PREDICTED: uncharacterized protein LOC103708279  70.1    1e-10   
ref|XP_009760450.1|  PREDICTED: uncharacterized protein LOC104212795  69.3    1e-10   
ref|NP_001175932.1|  Os09g0507900                                     72.8    1e-10   
ref|XP_006586657.1|  PREDICTED: uncharacterized protein LOC100527...  69.3    1e-10   
ref|XP_003534357.1|  PREDICTED: auxin-induced protein 10A5-like       68.6    1e-10   
ref|XP_010530800.1|  PREDICTED: uncharacterized protein LOC104807287  68.9    1e-10   
ref|XP_001781743.1|  predicted protein                                67.0    1e-10   
emb|CDP07418.1|  unnamed protein product                              68.9    1e-10   
ref|XP_010233800.1|  PREDICTED: auxin-induced protein 15A-like        68.6    1e-10   
ref|XP_010933741.1|  PREDICTED: auxin-induced protein 15A-like        68.6    1e-10   
ref|XP_004956905.1|  PREDICTED: uncharacterized protein LOC101782...  68.9    1e-10   
emb|CDY18466.1|  BnaA04g21210D                                        68.2    1e-10   
emb|CDX92434.1|  BnaA10g14730D                                        68.9    1e-10   
ref|XP_008242284.1|  PREDICTED: uncharacterized protein LOC103340...  69.3    1e-10   
gb|KFK29713.1|  hypothetical protein AALP_AA7G169300                  69.3    1e-10   
gb|AFG56379.1|  hypothetical protein 0_8672_01                        68.6    1e-10   
ref|XP_002871957.1|  hypothetical protein ARALYDRAFT_488986           68.9    1e-10   
ref|XP_010425808.1|  PREDICTED: uncharacterized protein LOC104710848  68.9    1e-10   
ref|XP_008242287.1|  PREDICTED: uncharacterized protein LOC103340...  69.3    1e-10   
ref|XP_010514710.1|  PREDICTED: uncharacterized protein LOC104790628  68.9    1e-10   
ref|XP_002318465.1|  hypothetical protein POPTR_0012s03050g           68.2    1e-10   
ref|XP_002869128.1|  hypothetical protein ARALYDRAFT_491180           68.6    1e-10   
gb|KDO41698.1|  hypothetical protein CISIN_1g045914mg                 68.9    1e-10   
ref|XP_009120769.1|  PREDICTED: uncharacterized protein LOC103845643  68.9    1e-10   
gb|KHN23320.1|  Auxin-induced protein X15                             68.2    1e-10   
ref|XP_010060852.1|  PREDICTED: auxin-induced protein X15-like        68.2    1e-10   
ref|XP_006487288.1|  PREDICTED: auxin-induced protein 6B-like         68.6    1e-10   
ref|XP_004508030.1|  PREDICTED: uncharacterized protein LOC101493355  68.6    2e-10   
ref|XP_006404974.1|  hypothetical protein EUTSA_v10000345mg           68.9    2e-10   
ref|XP_006450049.1|  hypothetical protein CICLE_v10013946mg           68.9    2e-10   
gb|KGN61862.1|  hypothetical protein Csa_2G257100                     69.7    2e-10   
ref|XP_010503025.1|  PREDICTED: uncharacterized protein LOC104780223  68.6    2e-10   
gb|AEW07678.1|  hypothetical protein 0_8672_01                        68.6    2e-10   
ref|XP_004507568.1|  PREDICTED: uncharacterized protein LOC101489126  68.6    2e-10   
ref|XP_010669485.1|  PREDICTED: uncharacterized protein DDB_G0283357  69.7    2e-10   
ref|XP_009346677.1|  PREDICTED: auxin-induced protein 6B-like         68.6    2e-10   
ref|NP_001235246.1|  uncharacterized protein LOC100526867             68.2    2e-10   
ref|XP_002324658.1|  hypothetical protein POPTR_0018s13230g           68.6    2e-10   
ref|XP_007206720.1|  hypothetical protein PRUPE_ppa024564mg           67.8    2e-10   
ref|XP_004956904.1|  PREDICTED: uncharacterized protein LOC101782...  68.9    2e-10   
gb|KHN09100.1|  Indole-3-acetic acid-induced protein ARG7             67.4    2e-10   
ref|XP_006302946.1|  hypothetical protein CARUB_v10021085mg           68.6    2e-10   
gb|AFG56382.1|  hypothetical protein 0_8672_01                        68.2    2e-10   
ref|XP_008779201.1|  PREDICTED: auxin-induced protein X15-like        67.4    2e-10   
ref|NP_001238039.1|  uncharacterized protein LOC100527570             68.6    2e-10   
ref|XP_002871447.1|  auxin-responsive family protein                  68.2    2e-10   
ref|XP_006410882.1|  hypothetical protein EUTSA_v10017913mg           67.8    2e-10   
ref|XP_002301987.1|  auxin-responsive family protein                  68.2    2e-10   
ref|XP_002977020.1|  hypothetical protein SELMODRAFT_38714            66.2    2e-10   
emb|CDX73182.1|  BnaC06g36300D                                        68.2    2e-10   
ref|XP_011083510.1|  PREDICTED: auxin-induced protein 6B-like         68.2    2e-10   
ref|XP_009126477.1|  PREDICTED: indole-3-acetic acid-induced prot...  68.6    2e-10   
ref|XP_002448702.1|  hypothetical protein SORBIDRAFT_06g031780        68.2    2e-10   
gb|AAN65371.1|  auxin-regulated protein                               68.2    2e-10   
ref|XP_010428584.1|  PREDICTED: uncharacterized protein LOC104713210  68.2    2e-10   
gb|KEH40216.1|  SAUR-like auxin-responsive family protein             68.2    2e-10   
ref|XP_010645952.1|  PREDICTED: uncharacterized protein LOC104877995  68.9    2e-10   



>emb|CDP13382.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 101/167 (60%), Gaps = 21/167 (13%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSW--SHGLRIMERSEKRMGVGAAAPEGWL  523
            LI+K WERC+S GG+G   + H     +KSKSW  S      E   KR      APEG  
Sbjct  12   LILKAWERCRSFGGIGSSRSRHAA--KLKSKSWTGSAAASTREADPKRAKNPRVAPEGCF  69

Query  522  WVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
             V VG +KQRF+IKTE +NHPL + LLEEAESEYGY +DGPL  PC+VDHF++VL EM+ 
Sbjct  70   SVYVGAQKQRFVIKTECLNHPLLKMLLEEAESEYGYTNDGPLELPCDVDHFVKVLVEMD-  128

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPRQRPPLSTDDV  202
             D+  P C           SF+  + ++SYHLL  PR    L+ +DV
Sbjct  129  CDEIHPRC-----------SFS--KTYSSYHLLPSPRL---LALNDV  159



>gb|AFK33528.1| unknown [Lotus japonicus]
Length=171

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 91/157 (58%), Gaps = 26/157 (17%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI KTWERCKS+G            R+ +SKSW           +       APEG   V
Sbjct  30   LITKTWERCKSIG-------RGTTTRITRSKSWP---------SRGKSTTVVAPEGCFSV  73

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREM--ES  343
             VG++ QRF+IKTE+VNHPLF+ LLEEAESEYGY S GP++ PC VD F +VL EM  E+
Sbjct  74   YVGQQMQRFVIKTEYVNHPLFKMLLEEAESEYGYSSQGPIVLPCNVDVFYKVLMEMDEET  133

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            S  D P         GC  +F + R+ +SYHL +P R
Sbjct  134  STPDQP------QPHGC--AFVKQRSRSSYHLPSPSR  162



>ref|XP_002299329.2| hypothetical protein POPTR_0001s13460g [Populus trichocarpa]
 gb|EEE84134.2| hypothetical protein POPTR_0001s13460g [Populus trichocarpa]
Length=229

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 97/155 (63%), Gaps = 12/155 (8%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGA--AAPEGWL  523
            LIIKTWERCKS+G   K+ +   +    KSKS+ H    +E    R        APEG  
Sbjct  83   LIIKTWERCKSIGRGSKRTSRLVRSLTPKSKSYPHIKVSLEDDHDRKHSRQRRVAPEGCF  142

Query  522  WVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
             V VG +KQRF+IKTE+ NHPLF+ LLEEAESEYGY S+GPL  PC VD F +VL  +E 
Sbjct  143  SVYVGPQKQRFVIKTEYANHPLFKMLLEEAESEYGYSSEGPLTLPCNVDIFYRVLMAVED  202

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            ++ DD    KI+ G G    FA  +N+ SYHLL+P
Sbjct  203  TNIDD----KIHLGCG----FA--KNYGSYHLLSP  227



>gb|ADU56197.1| SAUR family protein [Jatropha curcas]
Length=182

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 95/166 (57%), Gaps = 21/166 (13%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIM-------ERSEKRMGVGA--  544
            LIIKTWERCKSLG   KK +   K    KSKSW     ++       ++  K     +  
Sbjct  13   LIIKTWERCKSLGRSSKKTSRIVKSLTAKSKSWPRVPPLIHDEGQEDDQDNKNKKCSSRK  72

Query  543  --AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
                PEG   VCVG +KQRF IKTE+ NHPLF+ LLEEAESEYGY  +GPL  PC VD F
Sbjct  73   RKVTPEGCFSVCVGPQKQRFFIKTEYANHPLFKILLEEAESEYGYNPEGPLALPCNVDIF  132

Query  369  LQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            ++VL  M  +D+++ T    N   GC  S    +N  SY LL+P R
Sbjct  133  VEVLSAM--ADNEETT----NRIHGCGFS----KNFNSYRLLSPSR  168



>gb|KDP26852.1| hypothetical protein JCGZ_18010 [Jatropha curcas]
Length=175

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 95/166 (57%), Gaps = 21/166 (13%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIM-------ERSEKRMGVGA--  544
            LIIKTWERCKSLG   KK +   K    KSKSW     ++       ++  K     +  
Sbjct  13   LIIKTWERCKSLGRSSKKTSRIVKSLTAKSKSWPRVPPLIHDEGQEDDQDNKNKKCSSRK  72

Query  543  --AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
                PEG   VCVG +KQRF IKTE+ NHPLF+ LLEEAESEYGY  +GPL  PC VD F
Sbjct  73   RKVTPEGCFSVCVGPQKQRFFIKTEYANHPLFKILLEEAESEYGYNPEGPLALPCNVDIF  132

Query  369  LQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            ++VL  M  +D+++ T    N   GC  S    +N  SY LL+P R
Sbjct  133  VEVLSAM--ADNEETT----NRIHGCGFS----KNFNSYRLLSPSR  168



>ref|XP_008340250.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
 ref|XP_008361853.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=153

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 94/156 (60%), Gaps = 13/156 (8%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWS-HGLRIMERSEKRMGVGAAAPEGWLW  520
            LI KTW+RCKS+G  G+  N H     + +KS S   + +    EKR      APEG   
Sbjct  3    LITKTWKRCKSIG-RGRPTNIHGMVPALTTKSKSCPNINLGIPEEKRATKRQVAPEGCFT  61

Query  519  VCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESS  340
            V VG +KQRF++KTEH NHPLF+ LLEEAESE+GY S GPL+ PC+V+ F +VL EM+  
Sbjct  62   VYVGSQKQRFVVKTEHANHPLFKMLLEEAESEFGYDSRGPLVLPCDVEIFYKVLMEMDDC  121

Query  339  DDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
             D     +K+  G G +  +       SYHLLTP R
Sbjct  122  GD-----QKVPQGCGLAKRYG------SYHLLTPSR  146



>ref|XP_011071313.1| PREDICTED: uncharacterized protein LOC105156793 [Sesamum indicum]
Length=169

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 91/156 (58%), Gaps = 8/156 (5%)
 Frame = -2

Query  696  LIIKTWERCKSL-GGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLW  520
            +I + WERC S  GG+G+K  +      MKSKSW  GL      E        APEG   
Sbjct  14   IISRAWERCISFSGGIGRKARNSSGKLKMKSKSWPRGLTDSVGVEIGKKWRRVAPEGCFS  73

Query  519  VCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESS  340
            + VG +KQRF+IKTE+VNHPLFR LLEEAESEYGY S+GPL+ PCEVD FL VL +M+  
Sbjct  74   IYVGPQKQRFVIKTEYVNHPLFRDLLEEAESEYGYSSEGPLLLPCEVDRFLGVLDQMDFE  133

Query  339  DDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            D+       I   +  +    R     +  L+TPPR
Sbjct  134  DN-------IRKHKSRNFVATRVIGAVTTSLITPPR  162



>ref|XP_008222216.1| PREDICTED: uncharacterized protein LOC103322112 [Prunus mume]
Length=165

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 97/161 (60%), Gaps = 18/161 (11%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRM-----MKSKSWSH-GLRIMERSEKRMGVGAAAP  535
            LI+KTWERCKS+G  G+ +       M     +KS+S  H  L + ER EKR      AP
Sbjct  10   LIVKTWERCKSIG-RGRNMTTTTATTMVPALTIKSRSCPHINLGVPEREEKRTSRRQVAP  68

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG +KQRF++KTE+ NHPLF+ LLEEAESE+GY S GPL+ PC V+ F +VL 
Sbjct  69   EGCFSVYVGPQKQRFVVKTEYANHPLFKMLLEEAESEFGYDSQGPLVLPCNVEVFYKVLM  128

Query  354  EMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            EM     DD    K+  G G +      + + SYHLL+P R
Sbjct  129  EM-----DDCGNPKVPQGCGLA------KRYGSYHLLSPSR  158



>ref|XP_002514869.1| hypothetical protein RCOM_1078910 [Ricinus communis]
 gb|EEF47423.1| hypothetical protein RCOM_1078910 [Ricinus communis]
Length=174

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 94/164 (57%), Gaps = 18/164 (11%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSH-------GLRIMERSEKRMGVGAAA  538
            LIIKTWERCKSLG   K+ +      + KSKS  H       G      S         A
Sbjct  13   LIIKTWERCKSLGRGSKRTSRLVGSLITKSKSLPHLHIHPSIGDDDQRSSSSSSRKRRVA  72

Query  537  PEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVL  358
            PEG   V VG EKQRF+IKTE+ NHPLF+ LLEEAESEYGY  +GPL  PC VD F +VL
Sbjct  73   PEGCFSVYVGPEKQRFVIKTEYANHPLFKVLLEEAESEYGYNPEGPLALPCNVDIFCKVL  132

Query  357  REMESSDDDDPTCEKINNGR--GCSSSFARNRNHTSYHLLTPPR  232
              M+SSDD     E I+  R  GC  S    +N+ SY LL+P R
Sbjct  133  VAMDSSDD-----EAIHPHRRQGCGFS----KNYGSYRLLSPSR  167



>ref|XP_002303770.1| hypothetical protein POPTR_0003s16580g [Populus trichocarpa]
 gb|EEE78749.1| hypothetical protein POPTR_0003s16580g [Populus trichocarpa]
Length=167

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 96/157 (61%), Gaps = 12/157 (8%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIME--RSEKRMGVGAAAPEGWL  523
            LIIKTWERC S G   K+ +   +    KSKS  H    +E    +K       APEG  
Sbjct  14   LIIKTWERCISFGRGSKRTSRLERSLTPKSKSCPHIKVSLEDDHDQKHSRKSRVAPEGCF  73

Query  522  WVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
             V VG +KQRF+IKTE+ NHPLF+ LLEEAESEYGY  +GPL  PC VD F +VL  ME 
Sbjct  74   SVYVGPQKQRFVIKTEYANHPLFKILLEEAESEYGYNPEGPLTLPCNVDIFYKVLMAMED  133

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            +  D+    KI+  RGC  SFA  +N+ SYHLL+P R
Sbjct  134  TGIDN----KIH--RGC--SFA--KNYGSYHLLSPSR  160



>ref|XP_004491682.1| PREDICTED: uncharacterized protein LOC101512600 [Cicer arietinum]
Length=172

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 99/160 (62%), Gaps = 17/160 (11%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKF----RMMKSKSWSHGLRIMERSEKRMGVGAAAPEG  529
            +I KTWERCKS+G  G K  +           +SKSW    R  E+ EK++G     P+G
Sbjct  18   MITKTWERCKSIGRGGYKSKYSSSTINPTATRRSKSWPI-RRGDEKGEKKLG-SVVVPQG  75

Query  528  WLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREM  349
            +  V VG + Q+F+IKTE+ NHPLF+ LLEEAE+EYGY S GPL  PC VD F +VL EM
Sbjct  76   YFCVYVGPQMQKFVIKTEYCNHPLFKILLEEAETEYGYSSQGPLALPCNVDVFYKVLMEM  135

Query  348  ESSDDDDPTCEKINNGRGCSSSFARN-RNHTSYHLLTPPR  232
            +S        E +N+ +GC  +F  N R+ +SYHLL+P R
Sbjct  136  DS--------EVMNSRQGC--AFRGNYRSRSSYHLLSPSR  165



>ref|XP_007043889.1| SAUR family protein [Theobroma cacao]
 gb|EOX99720.1| SAUR family protein [Theobroma cacao]
Length=154

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 92/155 (59%), Gaps = 21/155 (14%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI+KTWERCKS+G          +    KSKSW   +    + EKR      APEG   V
Sbjct  14   LIVKTWERCKSIG--------RARALSKKSKSWPS-MDASLKEEKRTRKNRVAPEGCFSV  64

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG  +QRF+IKTE+ NHPLF+ LLEEAESEYG+ S+GPL+ PC VD F +VL  M+  D
Sbjct  65   YVGPRRQRFVIKTEYANHPLFKILLEEAESEYGFNSEGPLVLPCNVDLFCKVLLAMDDGD  124

Query  336  DDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            +      KI  G     SFA  + + SY LL+PPR
Sbjct  125  N------KIRQG----CSFA--KGYGSYRLLSPPR  147



>ref|XP_010249111.1| PREDICTED: uncharacterized protein LOC104591786 [Nelumbo nucifera]
Length=161

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 106/171 (62%), Gaps = 20/171 (12%)
 Frame = -2

Query  738  DVGRREgkaggkkALIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSE--  565
            +VGR+E    G   LI+KTWERC+S+G  GKK +      + KSKSW    R  + S+  
Sbjct  2    EVGRKEKSKKG---LIVKTWERCRSIGVGGKKSSGITP--IAKSKSWP---RTPDSSDDG  53

Query  564  KRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPC  385
            KR      APEG   V VG +KQRF+IKTE+VNHPLF+ LL+EAE EYGY S GPL  PC
Sbjct  54   KRGVNRRVAPEGCFSVYVGPQKQRFVIKTEYVNHPLFKMLLDEAEMEYGYNSAGPLALPC  113

Query  384  EVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            +VD F +VL EM S +++      I + +GC+ +    + + SY LL+P R
Sbjct  114  DVDLFYKVLLEMGSDENE------IIHQQGCNFT----KGYNSYRLLSPSR  154



>ref|XP_007227681.1| hypothetical protein PRUPE_ppa026219mg [Prunus persica]
 gb|EMJ28880.1| hypothetical protein PRUPE_ppa026219mg [Prunus persica]
Length=160

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 94/159 (59%), Gaps = 15/159 (9%)
 Frame = -2

Query  696  LIIKTWERCKSLG---GLGKKLNHHCKFRMMKSKSWSH-GLRIMERSEKRMGVGAAAPEG  529
            LI+KTWERCKS+G    +            +KS+S  H  L + +R EKR      APEG
Sbjct  10   LIVKTWERCKSIGRGRNMTTTTTTMVPSLTIKSRSCPHINLGVPKREEKRASRRQVAPEG  69

Query  528  WLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREM  349
               V VG +KQ+F++KTE+ NHPLF+ LLEEAESE+GY S GPL+ PC V+ F +VL EM
Sbjct  70   CFSVYVGPQKQKFVVKTEYANHPLFKMLLEEAESEFGYDSQGPLVLPCNVEVFYKVLMEM  129

Query  348  ESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
                 DD    K+  G G +      + + SYHLL+P R
Sbjct  130  -----DDCGNPKVPQGCGLA------KRYGSYHLLSPSR  157



>gb|AFK48563.1| unknown [Medicago truncatula]
 gb|KEH21449.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=162

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 94/157 (60%), Gaps = 21/157 (13%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFR--MMKSKSWSHGLRIMERSEKRMGVGAAAPEGWL  523
            LI KTWERCKS+GG  K  ++         +SKSW    R  E   K++     APEG  
Sbjct  18   LITKTWERCKSIGGGHKSKSYSSSVTPTTRRSKSWPGLPRGEENRRKKV-----APEGCF  72

Query  522  WVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
             V VG + QRF+IKTE+ NHPLF+ LLEEAESEYGY   GPL  PC VD F +VL EM  
Sbjct  73   SVYVGPQMQRFVIKTEYANHPLFKMLLEEAESEYGYSCQGPLALPCNVDVFYKVLMEM--  130

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
             D++ P        +GC  +F R+R  +SYHLL+P R
Sbjct  131  -DNEAPL-------QGC--TFGRSR--SSYHLLSPSR  155



>ref|XP_011020815.1| PREDICTED: uncharacterized protein LOC105123051 [Populus euphratica]
Length=167

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 95/157 (61%), Gaps = 12/157 (8%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIME--RSEKRMGVGAAAPEGWL  523
            LIIKTWERC S G   K+ +   +    +SKS  H    +E    +K       APEG  
Sbjct  14   LIIKTWERCISFGRGSKRTSRLERSLTPESKSCPHIKVSLEDDHDQKHSRKSRVAPEGCF  73

Query  522  WVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
             V VG +KQRF+IKTE+ NHPLF+ LLEEAESEYGY  +GPL  PC VD F +VL  ME 
Sbjct  74   SVYVGPQKQRFVIKTEYANHPLFKILLEEAESEYGYNPEGPLTLPCNVDIFYKVLMAMED  133

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            +  D+    KI+  RGC   FA  +N+ SYHLL+P R
Sbjct  134  TGIDN----KIH--RGC--RFA--KNYGSYHLLSPSR  160



>ref|XP_009349477.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=153

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 92/156 (59%), Gaps = 13/156 (8%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWS-HGLRIMERSEKRMGVGAAAPEGWLW  520
            LI +TW+RCKS+G  G+  N H     + +KS S   + +    EKR      APEG   
Sbjct  3    LITETWKRCKSIG-RGRPTNIHGMVPALTTKSKSCPNINLGIPEEKRASKRQVAPEGCFT  61

Query  519  VCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESS  340
            V VG +KQRF++KTEH NHPLF+ LLEEAESE+GY S GPL+ PC V+ F +VL EM+  
Sbjct  62   VYVGSQKQRFVVKTEHANHPLFKMLLEEAESEFGYDSRGPLVLPCNVEIFYKVLMEMDDC  121

Query  339  DDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
             D     +K+  G G +  +       SYH LTP R
Sbjct  122  GD-----QKVPQGCGLAKRYG------SYHHLTPSR  146



>ref|XP_011036123.1| PREDICTED: uncharacterized protein LOC105133729 [Populus euphratica]
 ref|XP_011036124.1| PREDICTED: uncharacterized protein LOC105133729 [Populus euphratica]
Length=229

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGA--AAPEGWL  523
            LIIKTWERCKS+G   K+           S S+ H    +E    R        APEG  
Sbjct  83   LIIKTWERCKSIGRGSKRTPRLVGSLTPNSNSYPHINVSLEDDNDRKHSRQRRIAPEGCF  142

Query  522  WVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
             V VG +KQRF+IK E+ NHPLF+ LLEE ESEYGY S+GPL  PC+VD F +VL  +E 
Sbjct  143  SVYVGPQKQRFVIKAEYANHPLFKMLLEEVESEYGYTSEGPLTLPCDVDIFYKVLMAVED  202

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            ++ DD    KI+ G G    FA  +N+ SYHLL+P R
Sbjct  203  ANIDD----KIHLGCG----FA--KNYGSYHLLSPSR  229



>ref|XP_006436889.1| hypothetical protein CICLE_v10033363mg [Citrus clementina]
 gb|ESR50129.1| hypothetical protein CICLE_v10033363mg [Citrus clementina]
Length=199

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 101/185 (55%), Gaps = 34/185 (18%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNH------------HCKFRMMKSKSWSHGLRIMERSEKRMG  553
            LI+KTWERCKSLG      +              C   M+KSKSWS      ER+     
Sbjct  12   LILKTWERCKSLGSSSSSGSGSGSGSSSNNKKPSCVMMMIKSKSWSSS---PERNNNYNN  68

Query  552  VGA-AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVD  376
             G   APEG   V VG ++QRF+IKTE  NHPLF+ LLE+AESEYGY + GP++ PC+VD
Sbjct  69   KGCQVAPEGCFSVYVGPQRQRFVIKTEFANHPLFKILLEDAESEYGYENQGPIMLPCDVD  128

Query  375  HFLQVLREMESSDDDDPTCEKINNGRGCS-----SSFARNRNHT------------SYHL  247
             F +VL E+ES+ D+D   +  N G  CS     SS AR  NH             +Y L
Sbjct  129  LFFKVLAELESTGDEDDDHDIANKG-CCSPLVLCSSPARRPNHRISSKDYDAGAGGAYRL  187

Query  246  LTPPR  232
            L+P R
Sbjct  188  LSPSR  192



>ref|XP_009770405.1| PREDICTED: auxin-induced protein 10A5-like [Nicotiana sylvestris]
Length=148

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 92/155 (59%), Gaps = 29/155 (19%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI KTWERCKS G      N H                  +++ KR+ V   A EG   +
Sbjct  13   LIPKTWERCKSFGRKNSSENRHA--------------LTTKKTRKRVRV---ATEGCFSI  55

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG +KQRF+I+TE+VNHP+F+ LLEEAESE+GY S GPL+ PC+VD FL+VL EM+S +
Sbjct  56   YVGPQKQRFVIRTEYVNHPIFKMLLEEAESEFGYNSKGPLVLPCDVDIFLKVLMEMDSDE  115

Query  336  DDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
               P        RGC  SFA  R ++SYH LTP R
Sbjct  116  IGHPR-------RGC--SFA--RTYSSYH-LTPTR  138



>ref|XP_003552755.1| PREDICTED: uncharacterized protein LOC100777217 [Glycine max]
 gb|KHN12589.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=172

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 93/166 (56%), Gaps = 20/166 (12%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHH---CKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGW  526
            LI KTWERCKS+G   K+ + +        M+SKSW +  R  E   K       APEG 
Sbjct  22   LITKTWERCKSIGRSRKEASSNSLNTNTNTMRSKSWPNRNRA-ENKNKNKNSTIVAPEGC  80

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              V VG + QRF+IKTE+ NHPLF+ LLEEAESEYGY S GPL  PC VD F +VL EM+
Sbjct  81   FSVYVGPQMQRFVIKTEYANHPLFKMLLEEAESEYGYNSQGPLALPCHVDVFYKVLMEMD  140

Query  345  SSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPRQRPPLSTD  208
             SD+   +C  +             R+ ++Y LL   R  P LS +
Sbjct  141  -SDETHGSCACV------------KRSPSAYQLL---RTSPMLSIN  170



>ref|XP_009336447.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=153

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 95/157 (61%), Gaps = 15/157 (10%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMM--KSKSWSHGLRIMERSEKRMGVGAAAPEGWL  523
            LI KTW+RCKS+G  G+  N H     +  KSKS  H +++    EKR      APEG  
Sbjct  3    LITKTWKRCKSIG-RGRPTNLHGMVPALTTKSKSCPH-IKLGMLEEKRASKRQVAPEGCF  60

Query  522  WVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
             V VG +KQRF++KTEH NHPLF+ LLEEAESE+GY S GPL+ PC V+ F +VL EM  
Sbjct  61   TVYVGPQKQRFVVKTEHANHPLFKMLLEEAESEFGYDSRGPLVLPCNVEIFYKVLVEM--  118

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
               DD   +K+  G G +      + + SY +L+P R
Sbjct  119  ---DDCGEQKVPRGWGLA------KRYGSYSVLSPSR  146



>ref|XP_010090676.1| hypothetical protein L484_017482 [Morus notabilis]
 gb|EXB40340.1| hypothetical protein L484_017482 [Morus notabilis]
Length=179

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 100/167 (60%), Gaps = 23/167 (14%)
 Frame = -2

Query  696  LIIKTWERCKSLG-GL------GKKLNHHCKFRMMKSKSW-----SHGLRIMERSEKRMG  553
            LI KTW+RCKS+G GL      G+ + H       KSKSW     +      E+ E+   
Sbjct  17   LINKTWQRCKSIGRGLKSTSPAGRSIGHGMT---KKSKSWPRMINAAATHEEEKRERESK  73

Query  552  VGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDH  373
             G  APEG   V VG ++QRF++KT+++NHPLF+ LLEEAESE+GY + GPL+ PC VD 
Sbjct  74   KGRVAPEGCFSVYVGPQRQRFVVKTQYLNHPLFKMLLEEAESEFGYDTQGPLMLPCNVDI  133

Query  372  FLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            F +VL EM   D+DD   +KI+ G  C       + H SYHLL+P R
Sbjct  134  FYKVLMEM---DNDDGGADKIHPGY-CGFP----KRHGSYHLLSPSR  172



>ref|XP_010044854.1| PREDICTED: uncharacterized protein LOC104433707 [Eucalyptus grandis]
 gb|KCW86967.1| hypothetical protein EUGRSUZ_B03532 [Eucalyptus grandis]
Length=177

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 92/163 (56%), Gaps = 12/163 (7%)
 Frame = -2

Query  696  LIIKTWERCKSLG-GLGKKLNHHCKFRMM-KSKSWSHGLRIMERSEKRMGVGA----AAP  535
            LI KTWERCKS+G G G K       R+  K+KSW+        +    G        AP
Sbjct  12   LITKTWERCKSIGRGGGNKAAASSPGRLTRKTKSWNGSSAGAAAAAAMEGGRGGRRRVAP  71

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG  KQ+F+IKTE+ NHPLF+ LL+EAE+EYGY S GP+  PC+V  F +VL 
Sbjct  72   EGCFSVYVGPGKQKFVIKTEYANHPLFKALLDEAEAEYGYSSGGPIELPCDVAVFCRVLM  131

Query  354  EMESSDDDDPTCEKINNGR--GCSSSFARNRNHTSYHLLTPPR  232
            EM+S+DDD      +   R  GC      N+ +  Y LL+P R
Sbjct  132  EMDSADDDGGRVGGLGAKRRVGCGV----NQGYGGYRLLSPSR  170



>ref|XP_008389916.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
 ref|XP_008350962.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=153

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 94/157 (60%), Gaps = 15/157 (10%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMM--KSKSWSHGLRIMERSEKRMGVGAAAPEGWL  523
            LI KTW+RCKS+G  G+  N H     +  KSKS  H +++    EKR      APEG  
Sbjct  3    LITKTWKRCKSIG-RGRPTNLHGMVPALTTKSKSCPH-IKLGMLEEKRASKRQVAPEGCF  60

Query  522  WVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
             V VG +KQRF++KTEH NHPLF+ LLEEAESE+GY S GPL+ PC V+ F +VL EM  
Sbjct  61   TVYVGPQKQRFVVKTEHANHPLFKMLLEEAESEFGYDSRGPLVLPCNVEIFHKVLVEM--  118

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
               DD   +K+  G G +  +       SY +L+P R
Sbjct  119  ---DDCGEQKVPRGWGLAKRYG------SYSVLSPSR  146



>ref|XP_006493246.1| PREDICTED: uncharacterized protein LOC102627134 [Citrus sinensis]
Length=197

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 101/183 (55%), Gaps = 32/183 (17%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNH----------HCKFRMMKSKSWSHGLRIMERSEKRMGVG  547
            LI+KTWERCKSLG      +            C   M+KSKSWS      ER+      G
Sbjct  12   LILKTWERCKSLGSSSSSGSGSGSSSNNKKPSCVMMMIKSKSWSSS---PERNNNYNNKG  68

Query  546  A-AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
               APEG   V VG ++QRF+IKTE  NHPLF+ LLE+AESEYGY + GP++ PC+VD F
Sbjct  69   CQVAPEGCFSVYVGPQRQRFVIKTEFANHPLFKILLEDAESEYGYENQGPIMLPCDVDLF  128

Query  369  LQVLREMESSDDDDPTCEKINNGRGCS-----SSFARNRNHT------------SYHLLT  241
             +VL E+ES+ D+D   +  N G  CS     SS AR  NH             +Y LL+
Sbjct  129  FKVLAELESTGDEDDDHDIANKG-CCSPLVLCSSPARRPNHRISSKDYDAGAGGAYRLLS  187

Query  240  PPR  232
            P R
Sbjct  188  PSR  190



>gb|AGR44724.1| SAUR family protein [Morus alba]
Length=182

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 100/167 (60%), Gaps = 23/167 (14%)
 Frame = -2

Query  696  LIIKTWERCKSLG-GL------GKKLNHHCKFRMMKSKSW-----SHGLRIMERSEKRMG  553
            LI KTW+RCKS+G GL      G+ + H       KSKSW     +      E+ E+   
Sbjct  20   LINKTWQRCKSIGRGLRSTSPAGRSIGHGMT---KKSKSWPRMINAAATHEEEKRERESK  76

Query  552  VGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDH  373
             G  APEG   V VG ++QRF++KT+++NHPLF+ LLEEAESE+GY + GPL+ PC VD 
Sbjct  77   KGRVAPEGCFSVYVGPQRQRFVVKTQYLNHPLFKMLLEEAESEFGYDTQGPLMLPCNVDI  136

Query  372  FLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            F +VL EM   D+DD   +KI+ G      FA+     SYHLL+P R
Sbjct  137  FYRVLMEM---DNDDGGADKIHPG---YCGFAKRPG--SYHLLSPSR  175



>gb|KDO64450.1| hypothetical protein CISIN_1g029186mg [Citrus sinensis]
Length=197

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 101/183 (55%), Gaps = 32/183 (17%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNH----------HCKFRMMKSKSWSHGLRIMERSEKRMGVG  547
            LI+KTWERCKSLG      +            C   M+KSKSWS      ER+      G
Sbjct  12   LILKTWERCKSLGSSSSSGSGSGSSSNNKKPSCVMMMIKSKSWSSS---PERNNNYNNKG  68

Query  546  A-AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
               APEG   V VG ++QRF+IKTE  NHPLF+ LLE+AESEYGY + GP++ PC+VD F
Sbjct  69   CQVAPEGCFSVYVGPQRQRFVIKTEFANHPLFKILLEDAESEYGYENQGPIMLPCDVDLF  128

Query  369  LQVLREMESSDDDDPTCEKINNGRGCS-----SSFARNRNHT------------SYHLLT  241
             +VL E+ES+ D+D   +  N G  CS     SS AR  NH             +Y LL+
Sbjct  129  FKVLAELESTGDEDDDHDIANKG-CCSPLVLCSSPARRPNHRISSKDYGAGAGGAYRLLS  187

Query  240  PPR  232
            P R
Sbjct  188  PSR  190



>ref|XP_004310111.1| PREDICTED: uncharacterized protein LOC101294039 [Fragaria vesca 
subsp. vesca]
Length=171

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 94/164 (57%), Gaps = 17/164 (10%)
 Frame = -2

Query  696  LIIKTWERCKSLG------GLGKKLNHHCKFRMMK-SKSWSHGLRIMERSEKRMGVGA--  544
            LI KTWERCKS+G        G   +      + K SKS  H +  M   +         
Sbjct  9    LITKTWERCKSIGRKSSITSTGTATSSPAVPALTKKSKSCPHIVLSMTDDDDDRRRHRRQ  68

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
             APEG   V VG EKQRF++KTE+ NHPLF+ LLEEAESE+GY S GPL+ PC+V  F +
Sbjct  69   VAPEGCFSVYVGSEKQRFVVKTEYANHPLFKLLLEEAESEFGYHSKGPLVLPCDVQVFYK  128

Query  363  VLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            VL EME    D    +K++  RGC   FA  + + SYHLL+P R
Sbjct  129  VLLEMEDCGGDG--VDKVS--RGC--GFA--KRYGSYHLLSPSR  164



>ref|XP_009624882.1| PREDICTED: auxin-induced protein 10A5-like [Nicotiana tomentosiformis]
Length=148

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 93/156 (60%), Gaps = 30/156 (19%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI KTWERCKS G      N H                  +++ KR  V   A EG   V
Sbjct  13   LIPKTWERCKSFGRKNSSENRHA--------------LTTKKTRKRARV---ATEGCFSV  55

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG++KQRF+I+TE+VNHP+F+ LLEEAESE+GY S GPL+ PC++D FL+VL EM+S  
Sbjct  56   YVGQQKQRFVIRTEYVNHPIFKMLLEEAESEFGYNSKGPLVLPCDIDIFLKVLMEMDSD-  114

Query  336  DDDPTCEKINNGR-GCSSSFARNRNHTSYHLLTPPR  232
                  E I + R GC  SFA  R ++SYH LTP R
Sbjct  115  ------EIIGHHRHGC--SFA--RTYSSYH-LTPTR  139



>ref|XP_003631359.1| PREDICTED: auxin-induced protein 6B-like [Vitis vinifera]
Length=153

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 93/159 (58%), Gaps = 23/159 (14%)
 Frame = -2

Query  696  LIIKTWERCKSL--GGLGKKLNHHCKFRMMKSKSWSHGLRIME----RSEKRMGVGAAAP  535
            LI KTW RCKS   G   + +    K    KSKSW              +KR+  G  AP
Sbjct  3    LIKKTWNRCKSFSHGRSSENIPRAPK----KSKSWPRITAAAAAASLEDDKRVKKGRVAP  58

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG EKQRF+IKTE+ NHPLF+ LLEEAE EYGY S+GPL  PC V+ F +VL 
Sbjct  59   EGCFSVYVGPEKQRFVIKTEYANHPLFKILLEEAELEYGYNSEGPLALPCNVEIFHKVLL  118

Query  354  EMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            EM+SSD       KI+  +GC+      R+H+SY LL+P
Sbjct  119  EMDSSD-------KIH--QGCTFP----RSHSSYRLLSP  144



>ref|XP_002264638.1| PREDICTED: uncharacterized protein LOC100245472 [Vitis vinifera]
 emb|CBI38161.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 91/156 (58%), Gaps = 21/156 (13%)
 Frame = -2

Query  696  LIIKTWERCKSLG-GLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLW  520
            L+ KTWE+ KS G G      HH     MKSKS       +E  +K    G  APEG   
Sbjct  12   LMKKTWEQFKSFGHGRILSRTHHSS---MKSKSRPGHTASLEGVKK----GRVAPEGCFS  64

Query  519  VCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESS  340
            V VG  KQRF++KTE+ NHPLFR LLEEAE EYGY + GPL+ PC+V+ FL+VL EM+SS
Sbjct  65   VYVGHGKQRFVVKTEYANHPLFRALLEEAELEYGYNNGGPLVLPCKVEIFLKVLLEMDSS  124

Query  339  DDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            D+    C           SFAR+   +SY LL P R
Sbjct  125  DEVHQGC-----------SFARSP--SSYRLLGPSR  147



>emb|CAN66812.1| hypothetical protein VITISV_011138 [Vitis vinifera]
Length=154

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 91/155 (59%), Gaps = 19/155 (12%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            L+ KTWE+ KS G   +++        MKSKS       +E  +K    G  APEG   V
Sbjct  12   LMKKTWEQFKSFGH--RRILSRTHHSSMKSKSRPGHTASLEGVKK----GRVAPEGCFSV  65

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG  KQRF++KTE+ NHPLFR LLEEAE EYGY + GPL+ PC+V+ FL+VL EM+SSD
Sbjct  66   YVGHGKQRFVVKTEYANHPLFRALLEEAELEYGYNNGGPLVLPCKVEIFLKVLLEMDSSD  125

Query  336  DDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            +    C           SFAR+   +SY LL P R
Sbjct  126  EVHQGC-----------SFARSP--SSYRLLGPSR  147



>ref|XP_010482375.1| PREDICTED: uncharacterized protein LOC104761057 [Camelina sativa]
Length=183

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 91/175 (52%), Gaps = 26/175 (15%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIME----RSEKRMGVGAAAPEGW  526
            ++KTW + KS G      N      + KSKSW+  + + +     S+ +M    +   G+
Sbjct  5    VVKTWRKMKSFG----HTNSSTTATVKKSKSWTGSISLEDANSNESKGKMRRKESPQHGF  60

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              VCVG  KQR ++KT+ VNHPLFR LLE+AE+EYGYR DGP++ PCEVD F +VL EM+
Sbjct  61   FTVCVGPTKQRVVVKTKLVNHPLFRNLLEDAENEYGYRGDGPIVLPCEVDFFFKVLAEMK  120

Query  345  SS---------------DDDDPTCEKINNGRGCSSSFARN---RNHTSYHLLTPP  235
            S+                   P C      R C      +   R ++SY LL PP
Sbjct  121  SNDGHGDDYNDDDDDDGSTSSPICGLGTPYRSCGGGGTDSIGIRRNSSYKLLRPP  175



>gb|KDP22580.1| hypothetical protein JCGZ_26411 [Jatropha curcas]
Length=175

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 78/126 (62%), Gaps = 5/126 (4%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSW----SHGLRIMERSEKRMG-VGAAAPE  532
            + +  WERCKSLG    K   +    +MKS+SW    +  L   +   KR       APE
Sbjct  12   IFVNAWERCKSLGSGSPKSARNICSTLMKSRSWHCTNTKSLSGEDNDNKRKNKYQQVAPE  71

Query  531  GWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLRE  352
            G   V VG EKQRF+IKTE  NHPLF+ LLE+AE EYG+ S+GP++ PC+VD F +VL E
Sbjct  72   GCFSVYVGPEKQRFVIKTEFANHPLFKSLLEDAEMEYGFNSEGPILLPCDVDLFYKVLAE  131

Query  351  MESSDD  334
            M+S ++
Sbjct  132  MDSVEE  137



>ref|XP_002511134.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF51736.1| calmodulin binding protein, putative [Ricinus communis]
Length=170

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 96/163 (59%), Gaps = 8/163 (5%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLG-KKLNHHCKFRMMKSKSW-SHGLRIMERSE----KRMGVGAAAP  535
            +I+K W RCKSLG  G +K   +    +  S+SW     R   R E    KR      AP
Sbjct  1    MILKAWARCKSLGSRGNRKCARNVCNSLTNSRSWHCTTTRSSSREEDSIKKRKKKVQVAP  60

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            +G   V VG+E+QRF++KTE  NHPLF+ LLE+AE EYG+ S+GPL+ PC+VD F +VL 
Sbjct  61   QGCFSVYVGQEQQRFVMKTEFANHPLFKVLLEDAELEYGFNSEGPLLLPCDVDLFCKVLA  120

Query  354  EMESSDDDDPTCEKINNGRG-CS-SSFARNRNHTSYHLLTPPR  232
            EM+S ++   T    ++    CS S +  N+   +Y LL+P +
Sbjct  121  EMDSGEEISTTPSWSSSLLVLCSPSCYTTNKRSGAYRLLSPSK  163



>ref|XP_007038060.1| Calmodulin binding protein, putative [Theobroma cacao]
 gb|EOY22561.1| Calmodulin binding protein, putative [Theobroma cacao]
Length=180

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 94/168 (56%), Gaps = 19/168 (11%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSW------SHGLRIMERSEKRMGVGAAAP  535
            ++ + WERC SLG  GKK +      + KSKSW      S  L   E  ++R      AP
Sbjct  12   VLFRAWERCWSLGTGGKKSSGTSCDALRKSKSWHSTTTRSSSLEEDEGKKRRQ----VAP  67

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG ++QRF++KTE  NHPLF+ LLE+AE EYG+ S+GPL+ PC+VD F +VL 
Sbjct  68   EGCFSVYVGPQRQRFVVKTEFANHPLFKMLLEDAELEYGFSSEGPLLLPCDVDLFYKVLA  127

Query  354  EMESSDDDDPT-------CEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            EM+   +  P            +  R  SSS   N+ + SY LLTP R
Sbjct  128  EMDGGKEISPVRGFAYSPLILCSPSRRQSSSI--NKGYGSYKLLTPSR  173



>gb|KHN24973.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=176

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 75/123 (61%), Gaps = 7/123 (6%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRM---MKSKSWSHGLRIMERSEKRMGVGAAAPEGW  526
            LI KTWERCKS+G  G+K+           M+SKSW    R    ++ +      APEG 
Sbjct  21   LITKTWERCKSIGR-GRKVTSSSTNTNTNTMRSKSWPRRDR---ENKNKNSTTIVAPEGC  76

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              V VG + QRF+IKTE+ NHPLF+ LLEEAESEYGY S GPL  PC VD F  VL EM 
Sbjct  77   FSVYVGPQMQRFVIKTEYANHPLFKMLLEEAESEYGYNSQGPLALPCHVDVFYMVLMEMG  136

Query  345  SSD  337
            S +
Sbjct  137  SDE  139



>gb|KDO83113.1| hypothetical protein CISIN_1g030719mg [Citrus sinensis]
Length=172

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 92/163 (56%), Gaps = 22/163 (13%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSH----------GLRIMERSEKRMGVG  547
            LI+KTWERCKS+G   K+     +   +KSKSW                 +RS+K     
Sbjct  13   LIVKTWERCKSIGRSSKRSAPALR---VKSKSWPRIDTRLEEEEEDEEEEKRSKKLKR--  67

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
              APEG   V VG +KQRF+IKTE+VNHPLF+ LLEEAESEYG++S+GPL+ PC VD F 
Sbjct  68   RVAPEGCFSVYVGPQKQRFVIKTEYVNHPLFKLLLEEAESEYGFQSEGPLVLPCRVDVFY  127

Query  366  QVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            +VL  ++  D D    +      GC   F +      Y LL+P
Sbjct  128  RVLLAVDDHDHDHNKEDNFIRRPGC--GFGKG-----YRLLSP  163



>ref|XP_010442311.1| PREDICTED: uncharacterized protein LOC104725349 [Camelina sativa]
Length=183

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 76/122 (62%), Gaps = 8/122 (7%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIME----RSEKRMGVGAAAPEGW  526
            ++KTW R KS G          K    KSKSW+  + + +     S+ +M    +   G+
Sbjct  5    VVKTWRRMKSFGHTSSSTTATVK----KSKSWTGSISLEDANSIESKGKMRRKESPQHGF  60

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              VCVG  KQR ++KT+ VNHPLFR LLE+AE+EYGYR DGP++ PCEVD F +VL EM+
Sbjct  61   FTVCVGPTKQRVVVKTKLVNHPLFRNLLEDAENEYGYRGDGPIVLPCEVDFFFKVLAEMK  120

Query  345  SS  340
            S+
Sbjct  121  SN  122



>ref|XP_006586283.1| PREDICTED: uncharacterized protein LOC100799988 [Glycine max]
Length=176

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 75/123 (61%), Gaps = 7/123 (6%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRM---MKSKSWSHGLRIMERSEKRMGVGAAAPEGW  526
            LI KTWERCKS+G  G+K+           M+SKSW    R    ++ +      APEG 
Sbjct  21   LITKTWERCKSIG-RGRKVTSSSTNTNTNTMRSKSWPRRDR---ENKNKNSTTIVAPEGC  76

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              V VG + QRF+IKTE+ +HPLF+ LLEEAESEYGY S GPL  PC VD F  VL EM 
Sbjct  77   FSVYVGPQMQRFVIKTEYASHPLFKMLLEEAESEYGYNSQGPLALPCHVDVFYMVLMEMG  136

Query  345  SSD  337
            S +
Sbjct  137  SDE  139



>ref|XP_011073103.1| PREDICTED: uncharacterized protein LOC105158157 [Sesamum indicum]
Length=170

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 70/113 (62%), Gaps = 10/113 (9%)
 Frame = -2

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
             AP G   VCVG EKQRF+IKTE  NHPLFR LLE+AE EYG+++DGP++ PCEVD F +
Sbjct  52   VAPTGCFSVCVGPEKQRFVIKTEFANHPLFRMLLEDAELEYGFQNDGPIVLPCEVDLFCK  111

Query  363  VLREMESSDDDDP---------TCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            VL EM+   D D          +C   N  R    S +  +  TSY LLTPP+
Sbjct  112  VLAEMDLGKDIDNYPPCGFAYGSCSPFNPARRLGKS-SMAKGCTSYGLLTPPQ  163



>ref|XP_006844597.1| hypothetical protein AMTR_s00016p00212020 [Amborella trichopoda]
 gb|ERN06272.1| hypothetical protein AMTR_s00016p00212020 [Amborella trichopoda]
Length=155

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 16/127 (13%)
 Frame = -2

Query  612  KSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEA  433
            KSKSW     + E++  + G    APEG   V VG EK+RF++KT+++NHPLFR LLEEA
Sbjct  41   KSKSWPRSRSLKEKTSVQKG--KVAPEGCFTVYVGSEKERFVLKTDYINHPLFRVLLEEA  98

Query  432  ESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSY  253
            E EYG+ SDGPL+ PCEVD+F QVL EM +        +KI+ G     +F +  N   Y
Sbjct  99   EMEYGFNSDGPLVLPCEVDYFNQVLIEMHN--------DKIHGG----CAFPKGLN--GY  144

Query  252  HLLTPPR  232
             LL+P R
Sbjct  145  QLLSPTR  151



>ref|XP_006483047.1| PREDICTED: uncharacterized protein LOC102613185 [Citrus sinensis]
Length=178

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 78/123 (63%), Gaps = 15/123 (12%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSH----------GLRIMERSEKRMGVG  547
            LI+KTWERCKS+G   K+     +   +KSKSW                 +RS+K     
Sbjct  13   LIVKTWERCKSIGRSSKRSAPALR---VKSKSWPRIDTRLEEEEEDEEEEKRSKKLKR--  67

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
              APEG   V VG +KQRF+IKTE+VNHPLF+ LLEEAESEYG++S+GPL+ PC VD F 
Sbjct  68   RVAPEGCFSVYVGPQKQRFVIKTEYVNHPLFKLLLEEAESEYGFQSEGPLVLPCRVDVFY  127

Query  366  QVL  358
            +VL
Sbjct  128  RVL  130



>ref|XP_007210042.1| hypothetical protein PRUPE_ppa017538mg [Prunus persica]
 gb|EMJ11241.1| hypothetical protein PRUPE_ppa017538mg [Prunus persica]
Length=175

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 93/167 (56%), Gaps = 22/167 (13%)
 Frame = -2

Query  696  LIIKTWERC---KSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGW  526
            LI K W RC   +     G KL+      + KSKSW       ++S+     G  AP G 
Sbjct  12   LIAKAWRRCSLQRESSNKGFKLSS-----LTKSKSWDCSFGNRKKSK-----GQVAPNGC  61

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              V VG ++QRF +KTE  NHPLF+ LLE+AE+EYGY  +GP++ PC+VD F++VL EME
Sbjct  62   FSVYVGPQRQRFAVKTEFANHPLFKMLLEDAETEYGYNWEGPILLPCDVDLFVKVLAEME  121

Query  345  SSDDD--DPTCEKINNGRGCSSSFARNRNHT-------SYHLLTPPR  232
             ++ D   P C  +N G     S AR+ + +       +Y LL+P R
Sbjct  122  CTEKDVGTPNCGFVNYGSLILRSPARHLSSSINNGYGGAYRLLSPSR  168



>ref|XP_010446011.1| PREDICTED: uncharacterized protein LOC104728772 [Camelina sativa]
Length=158

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 74/125 (59%), Gaps = 8/125 (6%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIME----RSEKRMGVGAAAPEGW  526
            ++KTW + KS G          K    KSKSW+  + + +     S+ +M    +   G 
Sbjct  5    VVKTWRKMKSFGHTSSSTTATVK----KSKSWTGSISLEDANSIESKGKMRRKESPQHGV  60

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              VCVG  KQR ++KT+ VNHPLFR LLE+AE+EYGYR DGP++ PCEVD F +VL EM 
Sbjct  61   FTVCVGPTKQRVVVKTKLVNHPLFRNLLEDAENEYGYRGDGPIVLPCEVDFFFKVLAEMN  120

Query  345  SSDDD  331
            +   D
Sbjct  121  AGKGD  125



>ref|XP_006438814.1| hypothetical protein CICLE_v10032901mg [Citrus clementina]
 gb|ESR52054.1| hypothetical protein CICLE_v10032901mg [Citrus clementina]
Length=174

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 93/163 (57%), Gaps = 20/163 (12%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSH----------GLRIMERSEKRMGVG  547
            LI+KTWERCKS+G   K+     +   +KSKSW                 +RS+K     
Sbjct  13   LIVKTWERCKSIGRSSKRSAPALR---VKSKSWPRIDTRLEEEEEDEEEEKRSKKLKR--  67

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
              APEG   V VG +KQRF+IKTE+VNHPLF+ LLEEAESEYG++S+GPL+ PC VD F 
Sbjct  68   RVAPEGCFSVYVGPQKQRFVIKTEYVNHPLFKLLLEEAESEYGFQSEGPLVLPCRVDVFY  127

Query  366  QVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            +VL  ++  D D    ++ N  R     F +      Y LL+P
Sbjct  128  RVLLAVDDHDHDHDHNKEDNFIRRPGCGFGKG-----YRLLSP  165



>ref|XP_010668453.1| PREDICTED: uncharacterized protein LOC104885461 [Beta vulgaris 
subsp. vulgaris]
Length=180

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 95/168 (57%), Gaps = 25/168 (15%)
 Frame = -2

Query  696  LIIKTWERCKSLG--------GLGKKLNHHCKFRMMKSKSWSH---GLRIMERSEKRMG-  553
            ++ KTWER  S G             L       M+KSKSWS       +  R EKR+G 
Sbjct  13   VLKKTWERYTSFGHGQIQKASPTSPPLIASSGRPMVKSKSWSTFCPSSPLSPRLEKRVGG  72

Query  552  -----VGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFP  388
                 +G+ +P+G L V VG ++QRF++K E+ NHPLF+ LLE+AE EYG+  DGPL+ P
Sbjct  73   SKNSRLGSLSPKGCLSVYVGPDRQRFVVKIEYTNHPLFKMLLEKAEMEYGFNVDGPLMLP  132

Query  387  CEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLL  244
            CEVD F+++L EME+        +  ++    SS    +R+ +SYHLL
Sbjct  133  CEVDVFIKILYEMEA--------KDDDDNNNNSSRCKFSRSRSSYHLL  172



>ref|XP_010025283.1| PREDICTED: uncharacterized protein LOC104415655 [Eucalyptus grandis]
Length=179

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 90/169 (53%), Gaps = 23/169 (14%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGK-----KLNHHCKFRMMKSKSWSHGL----RIMERSEKRM----  556
            LI KTWERCK+LG  GK     +L H       KSKSWS  L    + +     R+    
Sbjct  12   LIFKTWERCKTLGRAGKSSSKPRLTHGPSL-AKKSKSWSGPLPSLLKEVNAPPPRLHGSL  70

Query  555  -GVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEV  379
              + AA PEG   V VG EKQRF+++TE  NHPLF+ LLEEAESE+GY S GP+  PC V
Sbjct  71   KQLRAAVPEGCFSVYVGPEKQRFVVRTECANHPLFQMLLEEAESEFGYSSGGPIELPCNV  130

Query  378  DHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            D F +VL EM+   D            GC    A      +Y LL+P R
Sbjct  131  DLFYRVLTEMDCDGDG--DGNGGTRRLGCGYGIA------AYQLLSPAR  171



>ref|XP_006363778.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=141

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 86/153 (56%), Gaps = 29/153 (19%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            +I KTWERCKS G            R    ++  H L      + R  V   + +G   V
Sbjct  14   IIPKTWERCKSFG------------RKNSLENNQHALTTKRARKSRYRV---STQGCFSV  58

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG +KQRF IKTE+VNHPLF+ LL+EAESE+GY S GPL+ PC+VD FL +L E++S++
Sbjct  59   YVGSDKQRFAIKTEYVNHPLFKMLLDEAESEFGYNSKGPLVLPCDVDFFLNLLMELDSNE  118

Query  336  DDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
                      N  GC  +    R+++ YH LTP
Sbjct  119  A---------NHHGCGFT----RSYSYYH-LTP  137



>ref|XP_008459883.1| PREDICTED: uncharacterized protein LOC103498869 [Cucumis melo]
 ref|XP_008459884.1| PREDICTED: uncharacterized protein LOC103498869 [Cucumis melo]
 ref|XP_008459886.1| PREDICTED: uncharacterized protein LOC103498869 [Cucumis melo]
 ref|XP_008459887.1| PREDICTED: uncharacterized protein LOC103498869 [Cucumis melo]
Length=172

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 87/162 (54%), Gaps = 19/162 (12%)
 Frame = -2

Query  696  LIIKTWERCKSLG---GLGKKLNHHCKFRMMKSKS------WSHGLRIMERSEKRMGVGA  544
            LI+KTWERCKS+G   G         +F   K+KS      +S G    E+  +R     
Sbjct  13   LILKTWERCKSMGRGQGNSPSSTRIKRFLTRKTKSLPRLEVFSGGEDEDEKERRRCRKRR  72

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
             APEG   V VG E+QRF+IKTE  NHPLFR LLEEAE+EYGY    PL  PC+V+ F  
Sbjct  73   VAPEGCFTVYVGAERQRFVIKTECANHPLFRSLLEEAEAEYGYNCQAPLSLPCDVESFYS  132

Query  363  VLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            VL EM     DD T   +   RGC     +      Y+LL+P
Sbjct  133  VLMEM-----DDDTASDLR--RGCGYPTPK---RFGYNLLSP  164



>ref|XP_011044095.1| PREDICTED: uncharacterized protein LOC105139380 [Populus euphratica]
Length=181

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 94/173 (54%), Gaps = 27/173 (16%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSW---------SHGLRIMERSEKRMGVGA  544
            L ++ W R  SL    KK + +      KSKSW           G+    +S+K+  V  
Sbjct  13   LFMRAWYR--SLTAGRKKPSKNSLISFTKSKSWHCTRVPSDLEDGISANNKSKKKTQV--  68

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
             AP+G   V VG EKQRF +K E  NH LF+ LLE+AE EYG+ S+GP++ PC+VD F +
Sbjct  69   -APDGCFSVYVGAEKQRFAVKAEFANHQLFKMLLEDAELEYGHNSEGPIMLPCDVDFFYK  127

Query  363  VLREMESSDDDDPTCEKINNGRGCSS----SFARNRN-----HTSYHLLTPPR  232
            VL EMES + DD     +NN   CSS    S AR  N     + +Y +L+P R
Sbjct  128  VLAEMESEEVDD----IMNNPPSCSSLALCSPARRFNSRKDGYGAYRILSPSR  176



>ref|XP_004298545.1| PREDICTED: uncharacterized protein LOC101292997 [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 89/165 (54%), Gaps = 12/165 (7%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSW----SHGLRIMERSEKRMGVGAAAPEG  529
            LIIK W+RC +L              + +SKSW    ++     ++ + +      AP G
Sbjct  12   LIIKAWKRCSTLPRQSSSKASTAAASLTRSKSWSSSSTNNTGTWKQKKNKAKTCKVAPVG  71

Query  528  WLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREM  349
               V VG EKQRF+++ E VNHPLF+ LLE+A  EYGY+SDGP++ PC+VD F  VL +M
Sbjct  72   CFTVYVGPEKQRFVVRMEFVNHPLFKTLLEDAALEYGYKSDGPILLPCDVDLFCNVLAQM  131

Query  348  ESSDDDDPTCEKINNGRGCSSSFARNRNHT--------SYHLLTP  238
            ES D D+      +     S S AR RN+         SY +LTP
Sbjct  132  ESDDIDEDMVGVSSTCSPISFSPARRRNNCGSNRGYGGSYRMLTP  176



>ref|XP_004228430.1| PREDICTED: auxin-induced protein X10A-like [Solanum lycopersicum]
Length=149

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 80/153 (52%), Gaps = 29/153 (19%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            +I KTWERCKS G               +  S  +    +     R      + +G   V
Sbjct  14   IIPKTWERCKSFG---------------RKNSLENNQHALTTKRSRKSKHRVSTQGCFSV  58

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG  KQRF IK E+VNHPLF+ LL+EAESE+GY S GPL+ PC+VD FL +L E++S++
Sbjct  59   YVGSYKQRFAIKIEYVNHPLFKMLLDEAESEFGYNSKGPLVLPCDVDFFLNLLMELDSNE  118

Query  336  DDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
             +   C       G S S+       SYH LTP
Sbjct  119  ANHHGC-------GFSRSY-------SYHHLTP  137



>ref|XP_007139103.1| hypothetical protein PHAVU_008G001500g [Phaseolus vulgaris]
 gb|ESW11097.1| hypothetical protein PHAVU_008G001500g [Phaseolus vulgaris]
Length=164

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 90/167 (54%), Gaps = 14/167 (8%)
 Frame = -2

Query  744  MEDVGRREgkaggkkALIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSE  565
            M DV +++   G    LI KTWER K +G             M +SKSW  G +  +++ 
Sbjct  5    MGDVAKKKVVKG----LITKTWERWKWIGA-----GKSSMMMMRRSKSWP-GRKGGKKNN  54

Query  564  KRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPC  385
                V   AP+G   V VG E QRF IKTE+ NHPLF+ LLEEAESEYGY S GPL  PC
Sbjct  55   SSNSV-YVAPQGCFSVYVGPEMQRFFIKTEYANHPLFKMLLEEAESEYGYTSQGPLALPC  113

Query  384  EVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLL  244
             VD F +VL EME S   +   ++      C   +   R+ ++Y LL
Sbjct  114  NVDIFYKVLMEMEYSKKQEKEKDEEEEESRC---YCLKRSPSAYRLL  157



>ref|XP_009600107.1| PREDICTED: uncharacterized protein LOC104095647 [Nicotiana tomentosiformis]
Length=209

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 83/140 (59%), Gaps = 25/140 (18%)
 Frame = -2

Query  618  MMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLE  439
            + KSKSW HG     +S+        APEG  WV VG EK+RF+IKT++ NHP+F+ LLE
Sbjct  76   LSKSKSW-HGSTTNIKSK-------VAPEGCFWVYVGPEKERFVIKTKYANHPMFKMLLE  127

Query  438  EAESEYGYR-SDGPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRG-CSSSFARNR-  268
            +AE EYGY  S GP++ PC+VDHF +VL E+ SS          ++G G CS  F+  R 
Sbjct  128  DAEKEYGYNYSQGPILLPCDVDHFYKVLAEIGSSKQIQ------SSGCGSCSPLFSPGRR  181

Query  267  --------NHTSYHLLTPPR  232
                     + SY +LTPPR
Sbjct  182  LGNSQMAKGYGSYRVLTPPR  201



>ref|XP_002318753.2| hypothetical protein POPTR_0012s10450g [Populus trichocarpa]
 gb|EEE96973.2| hypothetical protein POPTR_0012s10450g [Populus trichocarpa]
Length=181

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 89/169 (53%), Gaps = 19/169 (11%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSW---------SHGLRIMERSEKRMGVGA  544
            L ++ W R  ++G   KK + +      KS SW           G+    +S+K+  V  
Sbjct  13   LFMRAWYRSLTVGR--KKPSKNSVISFTKSNSWHCTRKPSDQEDGISTNNKSKKKTQV--  68

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
             AP+G   V VG EKQRF +K E  NH LF+ LLE+AE EYG+ S+GP+  PC+VD F +
Sbjct  69   -APDGCFSVYVGAEKQRFAVKAEFANHQLFKMLLEDAELEYGHNSEGPISLPCDVDFFYK  127

Query  363  VLREMESSDDDD-----PTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            VL EMES + DD     P+C  +          +R   H +Y +L+P R
Sbjct  128  VLAEMESDEVDDIMINPPSCSSLALCSPARRFKSRKDGHGAYRILSPSR  176



>ref|XP_011042925.1| PREDICTED: uncharacterized protein LOC105138521 [Populus euphratica]
Length=181

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 92/173 (53%), Gaps = 27/173 (16%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSW---------SHGLRIMERSEKRMGVGA  544
            L ++ W R  + G      N    F   KSKSW           G+    +S+K+  V  
Sbjct  13   LFMRAWYRSLTAGRDKSSKNSLISF--TKSKSWHCTRVPSDQEDGISANNKSKKKTQV--  68

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
             AP+G   V VG EKQRF +K E  NH LF+ LLE+AE EYG+ S+GP++ PC+VD F +
Sbjct  69   -APDGCFSVYVGAEKQRFAVKAEFANHQLFKMLLEDAELEYGHNSEGPIMLPCDVDFFYK  127

Query  363  VLREMESSDDDDPTCEKINNGRGCSS----SFARNRN-----HTSYHLLTPPR  232
            VL EMES + DD     +NN   CSS    S AR  N     + +Y +L+P R
Sbjct  128  VLAEMESEEVDDI----MNNPPSCSSLALCSPARRFNSRKDGYGAYRILSPSR  176



>ref|XP_008239631.1| PREDICTED: uncharacterized protein LOC103338225 [Prunus mume]
Length=175

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 88/167 (53%), Gaps = 22/167 (13%)
 Frame = -2

Query  696  LIIKTWERC---KSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGW  526
            LI K W RC   +     G KL+      + K KSW       ++S+     G  AP G 
Sbjct  12   LIAKAWRRCSLQRESSNKGFKLSS-----LTKCKSWDCSFGNRKKSK-----GQVAPNGC  61

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              V VG ++QRF +KTE  NHPLF+ LLE+AE+EYGY  +GP++ PC VD F++VL EME
Sbjct  62   FSVYVGPQRQRFAVKTEFANHPLFKILLEDAETEYGYNWEGPILLPCGVDLFVKVLAEME  121

Query  345  SSDDD--DPTCEKINNGRGC-------SSSFARNRNHTSYHLLTPPR  232
             S+ D   P C  +N G           SS   N    +Y LL+P R
Sbjct  122  CSEKDVGTPNCGFVNYGSLILRSPTHHLSSSINNGYGGAYRLLSPSR  168



>ref|XP_004140543.1| PREDICTED: uncharacterized protein LOC101219164 [Cucumis sativus]
 ref|XP_004167966.1| PREDICTED: uncharacterized protein LOC101228593 [Cucumis sativus]
 gb|KGN46434.1| hypothetical protein Csa_6G092560 [Cucumis sativus]
Length=172

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 88/163 (54%), Gaps = 21/163 (13%)
 Frame = -2

Query  696  LIIKTWERCKSLG----------GLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVG  547
            LI+KTWERCKS+G          G+ + L    K  + + + +S G    E+  +R    
Sbjct  13   LILKTWERCKSMGRGQRNSPSSTGIKRFLTRKTK-SLPRLEVFSGGEDEDEKERRRSRKR  71

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
              APEG   V VG E+QRF+IKTE  NHPLFR LLEEAE+EYGY    PL  PC+V+ F 
Sbjct  72   RVAPEGCFTVYVGAERQRFVIKTECANHPLFRSLLEEAEAEYGYNCQAPLSLPCDVESFY  131

Query  366  QVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
             VL EM   DDD       +  RGC     +      Y+LL+P
Sbjct  132  SVLMEM---DDDSAG----DLRRGCGYPTPK---RFGYNLLSP  164



>ref|XP_002511133.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF51735.1| calmodulin binding protein, putative [Ricinus communis]
Length=170

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 14/135 (10%)
 Frame = -2

Query  696  LIIKTWERCKS--LGGLGKKLNHHCKFRMMKSKSW--------SHGLRIMERSEKRMGVG  547
            + +K WERCKS   G   K     C   + KS+SW        S     +E+ +K+  V 
Sbjct  13   IFLKVWERCKSWNAGSKTKTARIACN-SLTKSRSWHCPTTRSSSSEEENIEKGKKKPRV-  70

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
              AP G   V VGEEKQRF+I+TE  NHPLF+ LLE+AE EYG+ S+GPL+ PC+VD F 
Sbjct  71   --APAGCFPVYVGEEKQRFVIRTEIANHPLFKILLEDAELEYGFNSEGPLLLPCDVDLFY  128

Query  366  QVLREMESSDDDDPT  322
            +VL EM+S ++   T
Sbjct  129  KVLAEMDSGEEISTT  143



>ref|XP_009375239.1| PREDICTED: uncharacterized protein LOC103964074 [Pyrus x bretschneideri]
 ref|XP_009344297.1| PREDICTED: uncharacterized protein LOC103936179 [Pyrus x bretschneideri]
Length=172

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 87/163 (53%), Gaps = 21/163 (13%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            +I   W+RC     L ++ +      M KSKS          S  R   G  AP+G   V
Sbjct  12   MIANAWKRC----SLQRESSSKVLNLMTKSKSCHCS------STTRKSKGQVAPDGCFSV  61

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG ++QRF++KTE  NHPLF+ LL++AE EYGY  DGP++ PC+VD F  VL EMESS+
Sbjct  62   YVGPQRQRFVVKTEFANHPLFKMLLDDAEMEYGYNCDGPILLPCDVDLFYNVLAEMESSE  121

Query  336  D-DDPTCEKINNGRG----CSSSFARNRNHT-----SYHLLTP  238
            +   P C  +  G G    CS S   N +       +Y LL+P
Sbjct  122  EISTPNCGFV-KGYGSLMLCSPSRRLNSSINDGYGGAYRLLSP  163



>gb|EYU43035.1| hypothetical protein MIMGU_mgv1a025672mg [Erythranthe guttata]
Length=171

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  621  RMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLL  442
            R+ KS+SW        +++++      AP G   V VG E QRF+IK E  NHPLFR LL
Sbjct  41   RLTKSRSWHSSTTTRNKTKEK------APIGCFSVYVGPENQRFVIKAECANHPLFRRLL  94

Query  441  EEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSS-SFAR--N  271
            E+AESEYG + +GPL  PCEVD F ++L EM+S+  D    E    G GCSS   AR   
Sbjct  95   EDAESEYGLKVEGPLHIPCEVDLFCRILAEMDSNTGDQ---ELDTVGFGCSSFGPARWSG  151

Query  270  RNHTSYHLLTPP  235
            +  T Y LLTPP
Sbjct  152  KRGTGYGLLTPP  163



>ref|XP_002462638.1| hypothetical protein SORBIDRAFT_02g029390 [Sorghum bicolor]
 gb|EER99159.1| hypothetical protein SORBIDRAFT_02g029390 [Sorghum bicolor]
Length=122

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 67/109 (61%), Gaps = 13/109 (12%)
 Frame = -2

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
            A APEG   VCVG  +QRF+++TE VNHPLFR LLEEAE  +GY + GPL  PC+ D F+
Sbjct  16   APAPEGCFTVCVGAGRQRFMVRTECVNHPLFRALLEEAEDVFGYAAAGPLALPCDADAFV  75

Query  366  QVLREMESSDDDDPTCEKINNGRGCSSSFAR---NRNHTSY-HLLTPPR  232
            +VL ++E  D           G+  +++ AR    R H++Y  LL P R
Sbjct  76   RVLEQIEEED---------AAGQAAATTVARCGLVRGHSAYGRLLVPAR  115



>ref|XP_002462640.1| hypothetical protein SORBIDRAFT_02g029410 [Sorghum bicolor]
 gb|EER99161.1| hypothetical protein SORBIDRAFT_02g029410 [Sorghum bicolor]
Length=134

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 67/109 (61%), Gaps = 13/109 (12%)
 Frame = -2

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
            A APEG   VCVG  +QRF+++TE VNHPLFR LLEEAE  +GY + GPL  PC+ D F+
Sbjct  28   APAPEGCFTVCVGAGRQRFMVRTECVNHPLFRALLEEAEEVFGYAAAGPLALPCDADAFV  87

Query  366  QVLREMESSDDDDPTCEKINNGRGCSSSFAR---NRNHTSY-HLLTPPR  232
            +VL ++E  D           G+  +++ AR    R H++Y  LL P R
Sbjct  88   RVLEQIEEED---------AAGQAAATTVARCGLVRGHSAYGRLLVPAR  127



>ref|XP_009770249.1| PREDICTED: uncharacterized protein LOC104220973 [Nicotiana sylvestris]
Length=168

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 81/139 (58%), Gaps = 23/139 (17%)
 Frame = -2

Query  618  MMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLE  439
            + KSKSW HG     +S+        AP+G  WV VG EK+RF+IKT++ NHP+F+ LLE
Sbjct  35   LSKSKSW-HGTTTNIKSK-------VAPDGCFWVYVGPEKERFVIKTKYANHPMFKMLLE  86

Query  438  EAESEYGYR-SDGPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARN---  271
            +AE EYGY  S GP+  PC+VDHF +VL E+  S +     + +  G  CS  F+     
Sbjct  87   DAEKEYGYNYSQGPICLPCDVDHFYKVLAEIGRSKE----IQSLGCG-SCSPLFSPGKRL  141

Query  270  ------RNHTSYHLLTPPR  232
                  + + SY +LTPPR
Sbjct  142  GNSQMAKGYGSYRVLTPPR  160



>ref|XP_004298546.1| PREDICTED: uncharacterized protein LOC101293297 [Fragaria vesca 
subsp. vesca]
Length=174

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -2

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
              P G+  V VG EKQRF +K E+VNHPLF+ LLE+A  EYGYR+DGPL+ PC+VD F  
Sbjct  57   VTPVGYFSVYVGPEKQRFALKMEYVNHPLFKVLLEDAALEYGYRNDGPLLLPCDVDLFYN  116

Query  363  VLREMESSDDDD  328
            VL E+ES DD D
Sbjct  117  VLAEIESMDDID  128



>ref|NP_001150755.1| calmodulin binding protein [Zea mays]
 gb|ACN28791.1| unknown [Zea mays]
 tpg|DAA62156.1| TPA: calmodulin binding protein [Zea mays]
Length=136

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 17/106 (16%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            APEG   VCVG  +QRF+++TE VNHPLFR LLEEAE  +GY + GPL  PC+ D F++V
Sbjct  38   APEGCFTVCVGAGRQRFVVRTECVNHPLFRALLEEAEEAFGYAAAGPLALPCDADAFVRV  97

Query  360  LREMESSDDDDPTCEKINNGRGCSSSFAR---NRNHTSYHLLTPPR  232
            L ++E +              G +++ AR    R H++Y LL P R
Sbjct  98   LEQIEDA--------------GRAAAVARCGLVRGHSAYRLLVPAR  129



>gb|ACG40236.1| calmodulin binding protein [Zea mays]
Length=136

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 17/106 (16%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            APEG   VCVG  +QRF+++TE VNHPLFR LLEEAE  +GY + GPL  PC+ D F++V
Sbjct  38   APEGCFTVCVGAGRQRFVVRTECVNHPLFRALLEEAEEAFGYAAAGPLALPCDADAFVRV  97

Query  360  LREMESSDDDDPTCEKINNGRGCSSSFAR---NRNHTSYHLLTPPR  232
            L ++E +              G +++ AR    R H++Y LL P R
Sbjct  98   LEQIEDA--------------GRAAAVARCGLVRGHSAYRLLVPAR  129



>ref|XP_009383406.1| PREDICTED: uncharacterized protein LOC103971172 [Musa acuminata 
subsp. malaccensis]
Length=149

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 90/171 (53%), Gaps = 29/171 (17%)
 Frame = -2

Query  744  MEDVGRREgkaggkkALIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSE  565
            ME +G R+GK      +I+K +ERC+SLG               KSK W        +S 
Sbjct  1    MERLGSRKGKKS----IIVKVFERCRSLG----HRRSSAAAATPKSKPWDRS-----KST  47

Query  564  KRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPC  385
             R      APEG   V VG  K+RF+++ E VNHPLFR LL++AE  YG+ S GPL  PC
Sbjct  48   GRQ----RAPEGCFTVYVGPTKERFVVRMECVNHPLFRMLLDQAEMVYGFTSPGPLQLPC  103

Query  384  EVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            +VD F ++L EM+      PTC           SFA+  + T Y LL+PPR
Sbjct  104  DVDVFNKILCEMDQEMMAPPTC-----------SFAKCYS-TGYRLLSPPR  142



>gb|EYU43034.1| hypothetical protein MIMGU_mgv1a014941mg [Erythranthe guttata]
Length=173

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 69/106 (65%), Gaps = 5/106 (5%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            AP G   V VG E QRF+IK E  NHPLF+ LLE+AESEYG++ +GPL  PCEVD F ++
Sbjct  63   APIGCFSVYVGPENQRFVIKAECANHPLFKMLLEDAESEYGFKVEGPLRIPCEVDLFCRI  122

Query  360  LREMESSDDDDPTCEKINNGRGCSS-SFAR--NRNHTSYHLLTPPR  232
            L EM+S+   D   + +  G GCS  S AR   +  T Y LLTPPR
Sbjct  123  LAEMDSNIYGDQESDTL--GFGCSPFSPARRSGKGGTGYGLLTPPR  166



>ref|XP_006347628.1| PREDICTED: uncharacterized protein LOC102598616 [Solanum tuberosum]
Length=158

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 91/162 (56%), Gaps = 31/162 (19%)
 Frame = -2

Query  666  SLGGLGKKLNHHCKFR------MMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGE  505
            ++G + KKL  +   +      + KSKSW HG     RS   +     APEG  WV VG 
Sbjct  2    NIGEMLKKLEKYLPMKKVGGENLSKSKSW-HG-----RSTSTI-----APEGCFWVYVGP  50

Query  504  EKQRFLIKTEHVNHPLFRGLLEEAESEYGYR-SDGPLIFPCEVDHFLQVLREMESSDDDD  328
             K++F+IKT++ NHPLF+ LLE+AE EYGY  S GP++ PC+VD+F  VL +M ++ + D
Sbjct  51   NKEKFVIKTKYANHPLFKKLLEDAEKEYGYSYSQGPILLPCDVDYFYLVLADMVNNKEMD  110

Query  327  PTCEKINNGRGCSSSFARNR---------NHTSYHLLTPPRQ  229
               + I  G  CS  F+ +R          + SY  LTPPR 
Sbjct  111  ---DSIGCG-SCSPLFSPSRRLGNSQMAKGYGSYKSLTPPRS  148



>ref|XP_011083566.1| PREDICTED: uncharacterized protein LOC105166046 [Sesamum indicum]
Length=207

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 69/114 (61%), Gaps = 12/114 (11%)
 Frame = -2

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
            A  P G   V VG EKQRF+I+TE  NHP F+ LLE+AE EYG+++ GPL+ PCEVD F 
Sbjct  90   ATTPNGCFSVYVGPEKQRFVIRTEFANHPSFKMLLEDAEIEYGFKNQGPLLLPCEVDLFC  149

Query  366  QVLREMESSDDDDPTCEKINNGRGCSSSFARNR---------NHTSYHLLTPPR  232
            +VL EM+S  +D    ++ + G G  S F   R          + SY LLTPPR
Sbjct  150  KVLAEMDSCGED---FDQYSCGYGSCSPFNPARRLGKSRSAKGYRSYGLLTPPR  200



>ref|XP_010926791.1| PREDICTED: auxin-induced protein X15-like [Elaeis guineensis]
Length=130

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 82/155 (53%), Gaps = 41/155 (26%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI+KT ERC+S+GG                           + EKR+     APEG   V
Sbjct  10   LILKTLERCRSIGG-------------------------HRKGEKRL----MAPEGCFSV  40

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG  K+RF+++ E +NHPLF+ LL+EAE EYGY +DGPL  PC V+ F +VLREME   
Sbjct  41   YVGPAKERFVVRMECINHPLFQTLLDEAEMEYGYATDGPLELPCNVELFNRVLREMEQ--  98

Query  336  DDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
                  E +     CS +    R+H+ Y LL+P R
Sbjct  99   ------ELVAGPPRCSFT----RSHSGYCLLSPSR  123



>ref|XP_008446293.1| PREDICTED: uncharacterized protein LOC103489067 [Cucumis melo]
Length=160

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 80/156 (51%), Gaps = 16/156 (10%)
 Frame = -2

Query  687  KTWERCKSLGGLGKK--LNHHCKFRMMK-SKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            K W +   L GLG+   +       M K SKSW+ G +              AP+G   V
Sbjct  6    KKWSKYMGLKGLGRSRSVTGGTAVGMSKKSKSWNSGSKYKT---------PVAPDGCFAV  56

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG E+QRF+++TE  NHPLF+ LLE+AE EYGY S GP++ PCEV  F  VL EM+   
Sbjct  57   YVGAERQRFVVRTEFANHPLFQMLLEDAEVEYGYNSQGPILLPCEVGMFYNVLAEMDGG-  115

Query  336  DDDPTCEKINNGRGCSS---SFARNRNHTSYHLLTP  238
             D  +        GCS    +   +RN   Y +L+P
Sbjct  116  GDGLSSRWTGGESGCSPLRLTSCGSRNGVGYRVLSP  151



>ref|XP_010929727.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Elaeis 
guineensis]
Length=148

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 87/160 (54%), Gaps = 36/160 (23%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFR---MMKSKSWSHGLRIMERSEKRMGVGAAAPEGW  526
            LI+KT ERC SLG        H + R   M KSKSW      + RS  +  +   AP G+
Sbjct  13   LILKTLERCCSLG--------HRRSRPPSMPKSKSWQ-----LSRSSVKHRI---APGGY  56

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              V VG  K+RF+IK E VNHPLF+ LL+EAE EYG++S+GPL  PC+VD F +VL E++
Sbjct  57   FSVYVGPNKERFVIKMECVNHPLFKDLLDEAEMEYGFKSEGPLELPCDVDLFYRVLCEID  116

Query  345  SSDDDDPT--CEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
                  P     KI+NG               Y LL+P R
Sbjct  117  QEMAASPKRGFAKISNG---------------YRLLSPSR  141



>gb|AFK42411.1| unknown [Lotus japonicus]
Length=144

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 67/115 (58%), Gaps = 8/115 (7%)
 Frame = -2

Query  549  GAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
            G   P G   V VG E+QRF++KTE VNHPLF+ LL+EAE EYG+ SDGP+  PC VD F
Sbjct  26   GQRVPNGCFSVYVGAERQRFVVKTEFVNHPLFKMLLDEAEVEYGFNSDGPIWLPCNVDLF  85

Query  369  LQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPRQRPPLSTDD  205
             +VL E+ + ++ D     +   +G SS F        + L +P R    +S+ D
Sbjct  86   YKVLAEILADEEYDKKVIIVAKAKGSSSLF--------FLLQSPARLLSYMSSRD  132



>ref|XP_008791133.1| PREDICTED: auxin-induced protein X15-like [Phoenix dactylifera]
Length=115

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 21/129 (16%)
 Frame = -2

Query  618  MMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLE  439
            M KSKSW        RS  +  +   APEG+  V VG  K+RF+IK E +NHPLF+ LL+
Sbjct  1    MPKSKSWQRS-----RSTVKHQI---APEGYFTVYVGSNKERFVIKVECMNHPLFKNLLD  52

Query  438  EAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHT  259
            EAE EYG++S+GPL  PC+V+ F QVLRE++      P C            FA  R+ +
Sbjct  53   EAEVEYGFKSEGPLELPCDVELFYQVLREIDQEMMASPKC-----------GFA--RSSS  99

Query  258  SYHLLTPPR  232
             Y + +P R
Sbjct  100  GYRIFSPSR  108



>ref|XP_010093925.1| hypothetical protein L484_008816 [Morus notabilis]
 gb|EXB54888.1| hypothetical protein L484_008816 [Morus notabilis]
Length=169

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -2

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
            AAP G   V VG EKQ+F+++ E  NH LF+ LLE+AESEYGY SDGP++ PC+   F +
Sbjct  58   AAPYGCFPVYVGPEKQKFVVRAEFANHQLFKILLEDAESEYGYNSDGPILLPCDAGLFYK  117

Query  363  VLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
            VL EMES D D  +     +   CS +      +  Y LL+P R
Sbjct  118  VLAEMESGDGDFTSTSPSCSFMLCSPNNGIGYKYGGYKLLSPSR  161



>emb|CDY71491.1| BnaCnng73150D [Brassica napus]
Length=174

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 70/121 (58%), Gaps = 11/121 (9%)
 Frame = -2

Query  690  IKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVG------AAAPEG  529
            ++TW + KS G     +       + KSKSW +G   +E +  +   G         P G
Sbjct  1    METWRKMKSFGHKSSSITAS----ITKSKSW-NGSAHLENANNKESTGNIKKKSPPPPHG  55

Query  528  WLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREM  349
               V VG  KQR ++KT+ +NHPLF+ LLEEAE+EYGYR DGP++ PCEVD F +VL  M
Sbjct  56   CFTVYVGPTKQRVVVKTKLLNHPLFKNLLEEAEAEYGYRRDGPIVLPCEVDFFYKVLANM  115

Query  348  E  346
            +
Sbjct  116  K  116



>ref|XP_008346665.1| PREDICTED: uncharacterized protein LOC103409638 [Malus domestica]
Length=157

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -2

Query  570  SEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIF  391
            S  R   G  AP+G   V VG ++QRF +KTE  NHPLF+ LL++AE EYGY  +GP++ 
Sbjct  44   SNTRKSKGQVAPDGCFSVYVGPQRQRFAVKTEFANHPLFKMLLDDAEMEYGYNCEGPILL  103

Query  390  PCEVDHFLQVLREMESSDD-DDPTC  319
            PC+VD F +VL EMESS++   P C
Sbjct  104  PCDVDLFYKVLAEMESSEEVSTPNC  128



>ref|XP_010939481.1| PREDICTED: uncharacterized protein LOC105058300 [Elaeis guineensis]
Length=257

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 81/137 (59%), Gaps = 21/137 (15%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFR---MMKSKSWSHGLRIMERSEKRMGVGAAAPEGW  526
            LI+KT + C+SLG        H + R   M KS+SW        RS  +  +   AP G+
Sbjct  13   LILKTIKWCRSLG--------HRRSRPTSMPKSESWQRS-----RSTVKHRI---APGGY  56

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
              V VG  K+R +IK E VNHPLF+ LL+EAE EYG++++GPL  PC+VD F QVLRE++
Sbjct  57   FSVYVGPNKERLMIKMECVNHPLFKDLLDEAEMEYGFKTEGPLELPCDVDLFHQVLREID  116

Query  345  SSDDDDPTC--EKINNG  301
                  P C   KI+NG
Sbjct  117  QEMTVSPECGFTKISNG  133



>ref|XP_004298547.1| PREDICTED: uncharacterized protein LOC101293586 [Fragaria vesca 
subsp. vesca]
Length=169

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -2

Query  564  KRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPC  385
            K+   G AAP G     VG EKQ+F++KTE  NHPLF+ LLE+A  +YGY++DGPL+ PC
Sbjct  54   KKNKAGRAAPAGCFPAYVGPEKQQFVVKTEIANHPLFKVLLEDAALKYGYKNDGPLLLPC  113

Query  384  EVDHFLQVLREMESSDDDDPTC  319
            +VD F  VL E+E S  +D  C
Sbjct  114  DVDLFCNVLTEIEGSIVEDMIC  135



>ref|XP_004235361.1| PREDICTED: uncharacterized protein LOC101246229 [Solanum lycopersicum]
Length=158

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 89/162 (55%), Gaps = 31/162 (19%)
 Frame = -2

Query  666  SLGGLGKKLNHHCKFR------MMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGE  505
            ++G + KKL  +   +      + KSKSW HG     RS         APEG  WV VG 
Sbjct  2    NIGEMFKKLEKYLPMKKVGRENLSKSKSW-HG-----RS-----TSTIAPEGCFWVYVGP  50

Query  504  EKQRFLIKTEHVNHPLFRGLLEEAESEYGYR-SDGPLIFPCEVDHFLQVLREMESSDDDD  328
             K++F+IKT++ NHP F+ LLE+AE EYGY    GP++ PC+VD+F  VL ++ ++ ++D
Sbjct  51   NKEKFVIKTKYANHPSFKKLLEDAEKEYGYSYCQGPILLPCDVDYFYLVLADVINNKEND  110

Query  327  PTCEKINNGRGCSSSFARNR---------NHTSYHLLTPPRQ  229
               + I  G  CS  F+ +R          + SY  LTPPR 
Sbjct  111  ---DSIVCG-SCSPLFSPSRRLGNSQMAKGYGSYKSLTPPRS  148



>ref|XP_009337547.1| PREDICTED: uncharacterized protein LOC103929995 [Pyrus x bretschneideri]
Length=157

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 72/127 (57%), Gaps = 11/127 (9%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI   W+R      L +K +      + KSKSW         S  R   G  AP+G   V
Sbjct  12   LIANAWKR----WSLQRKSSSKVHNSLTKSKSWHCS------SSTRKIKGLVAPDGCFSV  61

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG ++QRF +KTE  NH LF+ LL++A+ EYGY  +GP++ PC+VD F +VL EMESS+
Sbjct  62   YVGPQRQRFAVKTEFANHSLFKMLLDDAKMEYGYNCEGPILLPCDVDLFYKVLAEMESSE  121

Query  336  D-DDPTC  319
            +   P C
Sbjct  122  EVSTPNC  128



>gb|KEH20995.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=143

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = -2

Query  612  KSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEA  433
            +S S S+G    E  +K+       P G L V VG E+QRF+IK +  NHPLF+ LLE+ 
Sbjct  21   ESGSGSYGKLPKESHKKQKDSTKKPPHGCLCVYVGPERQRFVIKIKIFNHPLFKTLLEDV  80

Query  432  ESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDD  328
            E+EYGYR+DGPL  PC+VD F + L E+ES++D D
Sbjct  81   ENEYGYRNDGPLWLPCDVDLFCEALVEIESAEDHD  115



>ref|XP_010523232.1| PREDICTED: uncharacterized protein LOC104801612 [Tarenaya hassleriana]
Length=163

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 19/117 (16%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI+KTW+RCKS+G                 K+ +      +  E+R      AP G   V
Sbjct  13   LIVKTWKRCKSMG---------------NPKTAAAA----DDGERRRWRRVRAPGGCFTV  53

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
             VG ++QRF+++TE+ NHPLFR LL+EAESE+G+ SDGPL+ PC+V  F + L  M+
Sbjct  54   YVGPQRQRFVVRTEYANHPLFRVLLDEAESEFGFTSDGPLMLPCDVVSFREFLAAMD  110



>ref|XP_004241451.1| PREDICTED: uncharacterized protein LOC101265243 [Solanum lycopersicum]
Length=170

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 77/140 (55%), Gaps = 28/140 (20%)
 Frame = -2

Query  612  KSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEA  433
            KSKSW HG      S K       AP+G   V VG EK++F IK ++ NHPLF+ LLE+A
Sbjct  37   KSKSW-HG------SSKTKSPVVLAPQGCFCVYVGPEKEKFTIKAKYANHPLFKMLLEDA  89

Query  432  ESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCS----SSFARNR-  268
            E EYGY S GP++ PC+V+ F +VL +M+S        E+  NG GC     S F+  R 
Sbjct  90   EMEYGYCSQGPILLPCDVNLFHKVLGQMDS--------EREINGPGCGLASCSPFSPARV  141

Query  267  --------NHTSYHLLTPPR  232
                     + SY LLT PR
Sbjct  142  LGHGEMGKGYGSYGLLTTPR  161



>tpg|DAA40496.1| TPA: calmodulin binding protein [Zea mays]
Length=151

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 6/108 (6%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            APEG   V VG  +QRF+++TE VNHPLFR LLEEAE  +GY + GPL+ PC+ D F++V
Sbjct  46   APEGCFAVRVGAGRQRFVVRTECVNHPLFRALLEEAEEAFGYAAAGPLVLPCDADAFVRV  105

Query  360  LREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPRQRPPL  217
            L +++  ++D          R C       R H++Y LL  P  RP L
Sbjct  106  LEQIQEEEEDAAGQAAPAVAR-CGLV----RGHSAYRLLLVP-ARPLL  147



>gb|KGN64431.1| hypothetical protein Csa_1G051690 [Cucumis sativus]
Length=167

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 82/167 (49%), Gaps = 31/167 (19%)
 Frame = -2

Query  687  KTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRI----MERSEKRMGVGA-----AAP  535
            K W +   L GLG+            S+S + G  +    M +  K +  G       AP
Sbjct  6    KKWSKYMGLKGLGR------------SRSVTGGTAVGPEGMSKKSKSLNSGPKYKTPVAP  53

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            +G   V VG E+QRF+++TE  NHPLF+ LLE+AE EYGY S GP++ PCEV  F  VL 
Sbjct  54   DGCFAVYVGAERQRFVVRTEFANHPLFQMLLEDAEVEYGYNSQGPILLPCEVGMFYNVLA  113

Query  354  EMESSDDDDPTCEKINNGR-----GCSS---SFARNRNHTSYHLLTP  238
            EM+  D  D    +   G       CS    +   +RN   Y +L+P
Sbjct  114  EMD--DGGDGISNRWTGGESGGLIACSPLRLTSCGSRNGGGYRVLSP  158



>ref|XP_008804094.1| PREDICTED: auxin-induced protein X15-like [Phoenix dactylifera]
Length=130

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 79/155 (51%), Gaps = 41/155 (26%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI+KT ERC+S+GG  K+   H                              APEG   V
Sbjct  10   LILKTLERCRSIGGHRKEGKRH-----------------------------MAPEGCFAV  40

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG  K+RF+++ E +NHPLF+ LL+EAE EYGY ++GPL  PC V+ F +VL EME   
Sbjct  41   YVGPGKERFVVRMECINHPLFQMLLDEAEMEYGYATEGPLELPCNVELFNRVLWEMEQ--  98

Query  336  DDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
                  E +     CS +    R+H+ Y LL+P R
Sbjct  99   ------ELVAGTPKCSFT----RSHSGYRLLSPSR  123



>ref|NP_199889.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 dbj|BAA96989.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAQ56846.1| At5g50760 [Arabidopsis thaliana]
 gb|AED95989.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=183

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 87/182 (48%), Gaps = 40/182 (22%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNH--------HCKFRMMKSKSWSHGLRIMERSEKRMGVGAAA  538
            I+KTW + KS G                H  FR+  +KS          +E +      +
Sbjct  5    ILKTWRKVKSFGHTSSSTTPSFTKSKSCHGSFRLEDAKS----------NESKGKPKKES  54

Query  537  PE-GWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            P  G+  V VG  KQR ++KT+ +NHPLF+ LLE+AE+EYGYR DGP++ PCEVD F + 
Sbjct  55   PSHGFFTVYVGPTKQRIVVKTKLLNHPLFKNLLEDAETEYGYRRDGPIVLPCEVDFFFKA  114

Query  360  LREMESSD---------------DDDPTCEKI-----NNGRGCSSSFARNRNHTSYHLLT  241
            L +M+S+                 + P C  +     + G G +   A  RN  SY LL 
Sbjct  115  LADMKSNPGHHDHDDDYDDDDGFTNSPICGFVCSPYRSYGGGVTDPLAMKRN-GSYKLLR  173

Query  240  PP  235
             P
Sbjct  174  SP  175



>ref|XP_002864075.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40334.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
Length=180

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 71/126 (56%), Gaps = 17/126 (13%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNH--------HCKFRMMKSKSWSHGLRIMERSEKRMGVGAAA  538
            I+KTW + KS G                H  FR+  +KS         +S+K +      
Sbjct  5    ILKTWRKVKSFGHTSSSTTPSFTRSKSCHGSFRLEDAKSNES----KAKSKKEL-----P  55

Query  537  PEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVL  358
              G+  V VG  KQR ++KT+ +NHPLF+ LLE+AE+EYGYR DGP++ PCEVD F + L
Sbjct  56   SHGFFTVYVGPTKQRIVVKTKLLNHPLFKNLLEDAETEYGYRRDGPIVLPCEVDFFFKTL  115

Query  357  REMESS  340
             +M+S+
Sbjct  116  ADMKSN  121



>ref|XP_004145218.1| PREDICTED: uncharacterized protein LOC101219975 [Cucumis sativus]
 ref|XP_004153127.1| PREDICTED: uncharacterized protein LOC101220090 [Cucumis sativus]
 ref|XP_004166985.1| PREDICTED: uncharacterized LOC101220090 [Cucumis sativus]
Length=156

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 63/110 (57%), Gaps = 10/110 (9%)
 Frame = -2

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
             AP+G   V VG E+QRF+++TE  NHPLF+ LLE+AE EYGY S GP++ PCEV  F  
Sbjct  40   VAPDGCFAVYVGAERQRFVVRTEFANHPLFQMLLEDAEVEYGYNSQGPILLPCEVGMFYN  99

Query  363  VLREMESSDDDDPTCEKINNGR-----GCSS---SFARNRNHTSYHLLTP  238
            VL EM+  D  D    +   G       CS    +   +RN   Y +L+P
Sbjct  100  VLAEMD--DGGDGISNRWTGGESGGLIACSPLRLTSCGSRNGGGYRVLSP  147



>ref|XP_010663898.1| PREDICTED: auxin-induced protein X10A-like [Vitis vinifera]
Length=160

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 67/122 (55%), Gaps = 13/122 (11%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            +++  W+RC+S+    KK    C   +    S S+               +  P+G+  V
Sbjct  12   MMVGAWKRCQSICRRSKK----CMPNISPCSSVSN---------PEAAKPSKTPKGYFPV  58

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG +KQRFLIKT+  NHPLF  LLEEAE EYGY + GP+  PC VD F +VL EM+   
Sbjct  59   YVGAQKQRFLIKTQFTNHPLFMTLLEEAELEYGYSNGGPVSLPCHVDTFYEVLAEMDGGR  118

Query  336  DD  331
            D+
Sbjct  119  DE  120



>ref|XP_008670314.1| PREDICTED: uncharacterized protein LOC103647576 [Zea mays]
Length=203

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 6/108 (6%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            APEG   V VG  +QRF+++TE VNHPLFR LLEEAE  +GY + GPL+ PC+ D F++V
Sbjct  98   APEGCFAVRVGAGRQRFVVRTECVNHPLFRALLEEAEEAFGYAAAGPLVLPCDADAFVRV  157

Query  360  LREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPRQRPPL  217
            L +++  ++D          R C       R H++Y LL  P  RP L
Sbjct  158  LEQIQEEEEDAAGQAAPAVAR-C----GLVRGHSAYRLLLVP-ARPLL  199



>ref|NP_001149909.1| calmodulin binding protein [Zea mays]
 gb|ACG37162.1| calmodulin binding protein [Zea mays]
Length=153

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 5/108 (5%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            APEG   V VG  +QRF+++TE VNHPLFR LLEEAE  +GY + GPL+ PC+ D F++V
Sbjct  46   APEGCFAVRVGAGRQRFVVRTECVNHPLFRALLEEAEEAFGYAAAGPLVLPCDADAFVRV  105

Query  360  LREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPRQRPPL  217
            L +++  ++D          R C       R H++Y LL  P    PL
Sbjct  106  LEQIQEEEEDAAGQAAAAVAR-CGLV----RGHSAYRLLVVPAPARPL  148



>ref|XP_010045491.1| PREDICTED: uncharacterized protein LOC104434216 [Eucalyptus grandis]
Length=198

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 77/144 (53%), Gaps = 19/144 (13%)
 Frame = -2

Query  588  LRIMERSEKRMG--VGAAAPEGWLWVCVGEE--KQRFLIKTEHVNHPLFRGLLEEAESEY  421
            LR   ++ K  G  V A  P G   V VGE   K+RF++KTE+VNHPLF+ LLE+AESEY
Sbjct  27   LRKWLKTNKTSGPEVPALVPAGCFPVYVGEGGGKERFVVKTEYVNHPLFKSLLEDAESEY  86

Query  420  GYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYH---  250
            G+ S GPL  PC  D F +VL EMESS  D  +C   +   G    F  ++   S H   
Sbjct  87   GFCSQGPLSLPCHPDFFFKVLAEMESSHHDHCSCSDTD---GSDDLFPNSKTPGSNHEHK  143

Query  249  ------LLTP---PRQRPPLSTDD  205
                   +TP   PR R P S  D
Sbjct  144  FQWFPFRITPNNSPRVRWPTSKSD  167



>gb|KEH20999.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=158

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
             P G L V VG E+QRF+IK +  NHPLF+ LLE+ E+EYGYR+DGPL  PC+VD F + 
Sbjct  49   TPHGCLCVYVGPERQRFVIKIKIFNHPLFKTLLEDVENEYGYRNDGPLWLPCDVDLFCEA  108

Query  360  LREMESSDDDD  328
            L E+ES++D D
Sbjct  109  LVEIESAEDHD  119



>ref|XP_004298548.1| PREDICTED: uncharacterized protein LOC101293879 [Fragaria vesca 
subsp. vesca]
Length=152

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  555  GVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVD  376
            G    AP+G   V VG EKQRF++K E  NHPLF+ LLE+A  EYGY + GP++ PC+VD
Sbjct  35   GCRVLAPDGCFSVYVGPEKQRFVVKVEFANHPLFKVLLEDAAWEYGYSTGGPILLPCDVD  94

Query  375  HFLQVLREMESSDDDD  328
             F  VL EME++ D D
Sbjct  95   LFCNVLAEMENNVDGD  110



>ref|XP_009134069.1| PREDICTED: uncharacterized protein LOC103858456 [Brassica rapa]
 emb|CDX83154.1| BnaA03g23520D [Brassica napus]
Length=162

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 71/117 (61%), Gaps = 6/117 (5%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVC  514
            I+KTW + K+ G    + +   +    +SK+W +G    E ++    +G    +    V 
Sbjct  5    IMKTWRKIKTFG----QTSSSTRASFTRSKTW-NGSAHHEDAKNSESIGKIK-KNCFTVY  58

Query  513  VGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
            VG  KQR ++K + +NHPLF+ LLE AE+EYGYR DGP++ PCEVD F +VL +++S
Sbjct  59   VGPTKQRIVVKMKLLNHPLFKNLLEAAENEYGYRRDGPIVLPCEVDFFFKVLADIKS  115



>gb|KHN32562.1| Auxin-induced protein X15 [Glycine soja]
Length=169

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 66/117 (56%), Gaps = 11/117 (9%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            +I K WERC+       KL           KS S         +K+      AP G   V
Sbjct  1    MIFKAWERCRLTSRPHLKL-----------KSLSENDDHHHHEKKKKKNSQIAPHGCFSV  49

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
             VG E++RF++KT++VNHPLF+ LLEEAE EYG+ SDGP+  PC VD F +VL EM+
Sbjct  50   HVGPERKRFVVKTKYVNHPLFQMLLEEAEHEYGFESDGPIWLPCNVDLFYKVLAEMD  106



>ref|XP_004952566.1| PREDICTED: uncharacterized protein LOC101780971 [Setaria italica]
Length=156

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 77/158 (49%), Gaps = 21/158 (13%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPE-GWLW  520
            ++ KT +RC++      +          +S SW                GAA P  G+  
Sbjct  10   ILAKTLQRCRTSLAAAHRRRPPPAQAPDRSASWG---------------GAAVPAAGYFT  54

Query  519  VCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFLQVLREMES  343
            V VG EK+RF ++    NHPLFR LL+EAE+EYG+   DGPL  PC VD F+QV+ EME 
Sbjct  55   VLVGPEKERFGVRARCANHPLFRALLDEAETEYGFAGCDGPLELPCAVDDFMQVMWEMEQ  114

Query  342  SDDD-DPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
             D    P C +   G   SS        T Y +++P R
Sbjct  115  GDPTASPGCGRFAAG---SSRGHHLHQVTGYQMVSPAR  149



>ref|XP_010111738.1| hypothetical protein L484_008396 [Morus notabilis]
 gb|EXC31600.1| hypothetical protein L484_008396 [Morus notabilis]
Length=121

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 61/114 (54%), Gaps = 15/114 (13%)
 Frame = -2

Query  576  ERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSD-GP  400
            + + KR   G  AP G  WVCVG  KQRF IKTE+  HPLF+ L+EEAE EYG+R+  GP
Sbjct  13   KHARKRRRGGHTAPAGCFWVCVGAHKQRFAIKTEYTKHPLFKKLVEEAEKEYGHRNQLGP  72

Query  399  LIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            L  PC V  F   L +ME  D               ++  +  R   SYH ++P
Sbjct  73   LALPCSVHIFYNALIKMEFDDH--------------ANQLSTTRYPFSYHPISP  112



>ref|XP_006281172.1| hypothetical protein CARUB_v10027207mg [Capsella rubella]
 gb|EOA14070.1| hypothetical protein CARUB_v10027207mg [Capsella rubella]
Length=184

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPE-GWLWV  517
            I+ TW + KS G               KS   S  L   +  E +      +P  G+  V
Sbjct  5    IMTTWRKVKSFGHTSSTTTTPSL-TKSKSCYGSFRLEDAKSEEPKGKTKKESPSHGFFTV  63

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESS  340
             VG  KQR ++KT+ +NHPLF+ LLE+AE+EYGYR DGP++ PCEVD F + L +M+S+
Sbjct  64   YVGPTKQRIVVKTKLLNHPLFKNLLEDAETEYGYRHDGPIVLPCEVDFFFKALADMKSN  122



>gb|KHN23965.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=157

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (59%), Gaps = 15/123 (12%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            +I K WE C+    L  +  H      +K KS S      E+   ++     AP G   V
Sbjct  1    MISKAWEGCR----LTSRRPH------LKLKSLSENDDDHEKKGSQL-----APHGCFSV  45

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG E+QRF++KT++VNHPLF+ LLEE E EYG+ SDGP+  PC VD F +VL EM+  +
Sbjct  46   HVGPERQRFVVKTKYVNHPLFQMLLEETEQEYGFESDGPIWLPCNVDLFYKVLAEMDGEE  105

Query  336  DDD  328
            +++
Sbjct  106  NNN  108



>ref|XP_009132695.1| PREDICTED: uncharacterized protein LOC103857272 [Brassica rapa]
Length=175

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 69/122 (57%), Gaps = 12/122 (10%)
 Frame = -2

Query  690  IKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAP-------E  532
            ++TW + KS G      +      + KSKSW +G   +E +  +   G            
Sbjct  1    METWRKMKSFG----HKSSSSTASITKSKSW-NGSAHLENANNKESTGKIKKKSPPPPPH  55

Query  531  GWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLRE  352
            G   V VG  K+R ++KT+ +NHPLF+ LLEEAE+EYGYR DGP++ PCEVD F +VL  
Sbjct  56   GCFTVYVGPTKERVVVKTKLLNHPLFKNLLEEAEAEYGYRRDGPIVLPCEVDFFYKVLAN  115

Query  351  ME  346
            M+
Sbjct  116  MK  117



>emb|CDY45819.1| BnaC03g16420D [Brassica napus]
Length=175

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 69/122 (57%), Gaps = 12/122 (10%)
 Frame = -2

Query  690  IKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAP-------E  532
            ++TW + KS G      +      + KSKSW +G   +E +  +   G            
Sbjct  1    METWRKMKSFG----HKSSSSTASITKSKSW-NGSAHLENANNKESTGKIKKKSPPPPPH  55

Query  531  GWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLRE  352
            G   V VG  K+R ++KT+ +NHPLF+ LLEEAE+EYGYR DGP++ PCEVD F +VL  
Sbjct  56   GCFTVYVGPTKERVVVKTKLLNHPLFKNLLEEAEAEYGYRRDGPIVLPCEVDFFYKVLAN  115

Query  351  ME  346
            M+
Sbjct  116  MK  117



>ref|XP_003523159.1| PREDICTED: uncharacterized protein LOC100789525 [Glycine max]
Length=168

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            AP G   V VG E+QRF++KT++VNHPLF+ LLEE E EYG+ SDGP+  PC VD F +V
Sbjct  49   APHGCFSVHVGPERQRFVVKTKYVNHPLFQMLLEETEQEYGFESDGPIWLPCNVDLFYKV  108

Query  360  LREMESSDDDD  328
            L EM+  ++++
Sbjct  109  LAEMDGEENNN  119



>ref|XP_003602784.1| Auxin-induced protein 6B [Medicago truncatula]
 gb|AES73035.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=149

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 69/121 (57%), Gaps = 11/121 (9%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVC  514
            I+K W   +SLG  G   N      ++ +KS S        SE   G     P G   V 
Sbjct  13   ILKAW---RSLGRGGDNSNMR---SLLLNKSSSKSF-----SENAKGRIVKIPNGCFTVY  61

Query  513  VGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            VG + QRF++KT+ VNHP F+ LL+EAE EYG+++DGP+  PC VD F +VL EM + ++
Sbjct  62   VGLQSQRFVVKTKFVNHPKFKMLLDEAEVEYGFQNDGPIRLPCNVDMFYRVLDEMNNIEE  121

Query  333  D  331
            D
Sbjct  122  D  122



>dbj|BAK03180.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 73/148 (49%), Gaps = 17/148 (11%)
 Frame = -2

Query  618  MMKSKSWSHGL--RIMERSEKRMGVG----AAAPEGWLWVCVGEEKQRFLIKTEHVNHPL  457
            M  SK     L  R +ER    +  G    AA   G   V VG E++RF+++ +  NHPL
Sbjct  24   MAASKGARKSLVSRTLERCRSGLNSGGRSSAAVAPGCFSVYVGPERERFVVRADRANHPL  83

Query  456  FRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVL----REMESSDDDD-----PTCEKINN  304
            FR LL++AE EYGY + GPL  PC VD FL VL     +++  DD D     P       
Sbjct  84   FRRLLDDAEQEYGYAAQGPLALPCSVDAFLDVLWHMDHDVQDEDDGDEAAVAPRTPICGL  143

Query  303  GRGCSSSFARNRNHTSYHLLTPPRQRPP  220
             RG S +         Y +L+PP+  PP
Sbjct  144  QRGGSGNI--KVRPAGYRVLSPPKSTPP  169



>gb|EYU23063.1| hypothetical protein MIMGU_mgv1a015250mg [Erythranthe guttata]
Length=163

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQ  364
             AP G   V VG EK+RF IKTE  NHPLF+ LLE+AE EYG+ ++GPL+ PC VD F +
Sbjct  30   VAPTGCFTVYVGPEKRRFAIKTEFANHPLFKMLLEDAELEYGFANEGPLMLPCGVDLFCR  89

Query  363  VLREMESSD  337
            VL EM+  D
Sbjct  90   VLAEMDGGD  98



>gb|EPS74604.1| hypothetical protein M569_00152, partial [Genlisea aurea]
Length=80

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 4/75 (5%)
 Frame = -2

Query  537  PEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVL  358
            P G   V VG E++RF+I+TE VNHPLFR LLE+AESEYG+  +GP+  PCEVD F++V+
Sbjct  1    PTGRFSVYVGPERRRFVIRTESVNHPLFRALLEDAESEYGFDCNGPIHLPCEVDFFVEVM  60

Query  357  REMESSDDDDPTCEK  313
              +    DD P   +
Sbjct  61   AAL----DDQPKSHR  71



>ref|XP_004957298.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Setaria 
italica]
Length=137

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 60/114 (53%), Gaps = 10/114 (9%)
 Frame = -2

Query  573  RSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLI  394
            RS +R     A   G   VCVG  +QRF+++TE VNH LFR LLEEAE  +GY + GPL 
Sbjct  27   RSARRSKPQPAPAVGCFTVCVGAGRQRFVVRTECVNHRLFRALLEEAEEAFGYAAAGPLA  86

Query  393  FPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
             PC+ D F++VL ++E          +    RG          H++Y LL   R
Sbjct  87   LPCDADAFVRVLEQIEEEAAAGEVVPRCGLARG----------HSAYRLLAAGR  130



>ref|XP_009383865.1| PREDICTED: auxin-induced protein X15-like [Musa acuminata subsp. 
malaccensis]
Length=134

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 66/126 (52%), Gaps = 29/126 (23%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI+KT ERC+S+ G                             ++R G   A PEG   V
Sbjct  16   LILKTLERCRSMAG-----------------------------QRRGGRQEAPPEGCFAV  46

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG +++RF+I+TE VNHP FR LLEEAE E+GY + GPL  PC V+ F +VL EME   
Sbjct  47   YVGPDRERFVIRTECVNHPRFRVLLEEAEMEFGYSNSGPLELPCHVEVFHEVLWEMEQEA  106

Query  336  DDDPTC  319
             +   C
Sbjct  107  VESSWC  112



>ref|XP_002280410.1| PREDICTED: uncharacterized protein LOC100268140 [Vitis vinifera]
Length=164

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 16/110 (15%)
 Frame = -2

Query  531  GWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLRE  352
            G+  V VG +KQRF+IKT+   HPLF+ LLEEAE EYGY + GP++ PC+VD F +VL +
Sbjct  58   GYFPVYVGAQKQRFVIKTQLAKHPLFKTLLEEAELEYGYSNGGPVLLPCDVDTFYEVLVQ  117

Query  351  MESSDDDDPTCEKINNGRGCSSSFAR----------NRNHTSYHLLTPPR  232
            MES    +      ++ RG + SF               +  Y LL+P R
Sbjct  118  MESGGAQE------SSSRGGTFSFLSPSPRPGCGEMAEGYGHYSLLSPSR  161



>emb|CAN64976.1| hypothetical protein VITISV_027843 [Vitis vinifera]
Length=164

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 16/110 (15%)
 Frame = -2

Query  531  GWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLRE  352
            G+  V VG +KQRF+IKT+   HPLF+ LLEEAE EYGY + GP++ PC+VD F +VL +
Sbjct  58   GYFPVYVGAQKQRFVIKTQLAKHPLFKTLLEEAELEYGYSNGGPVLLPCDVDTFYEVLVQ  117

Query  351  MESSDDDDPTCEKINNGRGCSSSFAR----------NRNHTSYHLLTPPR  232
            MES    +      ++ RG + SF               +  Y LL+P R
Sbjct  118  MESGGAQE------SSSRGGTFSFLSPSPRPGCGEMAEGYGHYSLLSPSR  161



>ref|XP_006586323.1| PREDICTED: uncharacterized protein LOC102667331 [Glycine max]
Length=157

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            AP+G + V VG E++RF+IK +  NHPLF+ LL+ AE EYGYR++GPL  PC+VD F + 
Sbjct  39   APQGCICVYVGAERERFVIKVKIANHPLFKALLDAAEREYGYRNNGPLWLPCDVDLFSEA  98

Query  360  LREMESSDDDD  328
            L++ME+S  ++
Sbjct  99   LKDMENSIQEE  109



>gb|KEH20997.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=111

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
             P G++ V VG E+QRF+IK +  NHPLF+ LLE+ E+EYGYR+DGPL FPC+VD F ++
Sbjct  46   PPHGYICVYVGPERQRFIIKIKIFNHPLFKTLLEDVENEYGYRNDGPLWFPCDVDLFCEI  105

Query  360  LREME  346
            L ++E
Sbjct  106  LVDIE  110



>ref|XP_009385439.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Musa 
acuminata subsp. malaccensis]
Length=137

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 79/157 (50%), Gaps = 43/157 (27%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI+KT ERC+SLG                    SH  R  ++  +R       PEG   V
Sbjct  15   LILKTLERCRSLG--------------------SH--RKGDQKRQR------TPEGCFSV  46

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
             VG  ++RF+++TE VNHPLF+ LL+EAE E+GY + GPL  PC+VD F +VL E+E   
Sbjct  47   YVGPARERFVVRTECVNHPLFKMLLDEAEMEFGYSAAGPLELPCDVDLFQKVLWEVEQDA  106

Query  336  DD--DPTCEKINNGRGCSSSFARNRNHTSYHLLTPPR  232
             +   P C               ++ H  Y LL+P R
Sbjct  107  AELYSPRCN-------------FSKAHAGYLLLSPAR  130



>gb|KHN16861.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=157

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            AP+G + V VG E++RF+IK +  NHPLF+ LL+ AE EYGYR++GPL  PC+VD F + 
Sbjct  39   APQGCICVYVGAERERFVIKVKIANHPLFKALLDAAEREYGYRNNGPLWLPCDVDLFSEA  98

Query  360  LREMESS  340
            L++ME+S
Sbjct  99   LKDMENS  105



>ref|XP_007160002.1| hypothetical protein PHAVU_002G284700g [Phaseolus vulgaris]
 gb|ESW31996.1| hypothetical protein PHAVU_002G284700g [Phaseolus vulgaris]
Length=159

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
              AP G L V VG E++RF++K +  NHPLF+ LL+ AE EYGYR+DGPL  PC VD F 
Sbjct  42   CVAPHGCLCVYVGAERERFIVKIKIANHPLFKELLDGAEREYGYRNDGPLWLPCHVDFFC  101

Query  366  QVLREMESSDDDD  328
            + L EME S  ++
Sbjct  102  EALTEMEISTTEE  114



>ref|XP_010555564.1| PREDICTED: uncharacterized protein LOC104825028 [Tarenaya hassleriana]
Length=207

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 95/186 (51%), Gaps = 33/186 (18%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHH---------------CKFRMMKSKSW-----SHGLRIME  574
            I+KTW++ KSLG +  +   +                     KS+SW        L   +
Sbjct  15   ILKTWKKMKSLGHMSNRNKKNKTPDPCSSPLPSSSYSAPSFAKSRSWHCSALQSDLHEEK  74

Query  573  RS--EKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGP  400
            +S  +KR      AP G   V VG +K+RF+++T+  +HP+F+ LLE AE E+GYRS+GP
Sbjct  75   KSPNDKRDRTAMFAPRGCFTVYVGPKKERFVVRTKLASHPMFKILLEGAEEEFGYRSEGP  134

Query  399  LIFPCEVDHFLQVLREMESS--------DDDDPTCEKINNGR---GCSSSFARNRNHTSY  253
            ++ PCEVD FL+VL EMES         +++ P C   +  R   G + S A  R  +  
Sbjct  135  IVLPCEVDFFLKVLAEMESLDEEDEEDWNNNLPVCGLCSPYRSYGGGADSTAVKRYGSYK  194

Query  252  HLLTPP  235
             L TPP
Sbjct  195  VLRTPP  200



>gb|EAY77041.1| hypothetical protein OsI_04997 [Oryza sativa Indica Group]
Length=176

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  531  GWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLRE  352
            G   V VG E++RFL++TE+ NHPLFR LL++AE EYGY + GPL  PC VD FL VL +
Sbjct  48   GCFSVYVGPERERFLVRTEYANHPLFRRLLDDAEREYGYAAQGPLALPCAVDAFLDVLWQ  107

Query  351  ME  346
            ME
Sbjct  108  ME  109



>emb|CDY34024.1| BnaC03g27910D [Brassica napus]
Length=162

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVC  514
            I+KTW + K+ G    + +        +SK+W +G   +E ++    +G    + +  V 
Sbjct  5    IMKTWRKIKTFG----QTSSSTTASFTRSKTW-NGSAHLEDAKNSESIGKIKKKCFT-VY  58

Query  513  VGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
            VG  KQR ++K + +NHPLF+ LLE AE+EYGYR DGP++ PCEVD F +VL +++S
Sbjct  59   VGPMKQRIVVKMKLLNHPLFKNLLEAAENEYGYRRDGPIVLPCEVDFFFKVLADIKS  115



>ref|XP_003572558.1| PREDICTED: uncharacterized protein LOC100829717 [Brachypodium 
distachyon]
Length=177

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 7/105 (7%)
 Frame = -2

Query  537  PEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFLQV  361
            P G   V VG EK+RF ++    NHPLFR LL+EAE+EYG+   DGPL  PC VD F++V
Sbjct  65   PAGCFAVLVGPEKERFAVRARCANHPLFRALLDEAETEYGFAGCDGPLELPCAVDDFMEV  124

Query  360  LREMES----SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            + EME          P+C +    R       ++     YH+++P
Sbjct  125  MWEMEQQGGHGGSASPSCARFAGAR--HHHHHQHHQQQGYHMMSP  167



>ref|XP_010045485.1| PREDICTED: uncharacterized protein LOC104434209 [Eucalyptus grandis]
Length=119

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = -2

Query  561  RMGVGAAAPEGWLWVCVGE--EKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFP  388
            ++   A  P G   V VGE  +K+RF++K E+VNHPLF+ LLE+AE EYG+ S GPL  P
Sbjct  38   KVATPALVPAGCFPVYVGEGDQKERFVVKMEYVNHPLFKSLLEDAELEYGFHSQGPLSLP  97

Query  387  CEVDHFLQVLREMESSDD  334
            C  D F +VL EME   D
Sbjct  98   CNSDFFCKVLAEMELRAD  115



>ref|NP_001172716.1| Os01g0924966 [Oryza sativa Japonica Group]
 dbj|BAD88039.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH91446.1| Os01g0924966 [Oryza sativa Japonica Group]
Length=173

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  531  GWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLRE  352
            G   V VG E++RF+++TE+ NHPLFR LL++AE EYGY + GPL  PC VD FL VL +
Sbjct  45   GCFSVYVGPERERFVVRTEYANHPLFRRLLDDAEREYGYAAQGPLALPCAVDAFLDVLWQ  104

Query  351  ME  346
            ME
Sbjct  105  ME  106



>gb|EAZ09691.1| hypothetical protein OsI_31974 [Oryza sativa Indica Group]
 gb|EAZ45311.1| hypothetical protein OsJ_29954 [Oryza sativa Japonica Group]
Length=138

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 59/99 (60%), Gaps = 4/99 (4%)
 Frame = -2

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG L V VG  +QRF+++T  VNHPLFR LLEEAE  +GY + GPL  PC+   F +VL 
Sbjct  34   EGCLSVYVGAARQRFVVRTASVNHPLFRPLLEEAEEAFGYAAAGPLQLPCDAAVFARVLE  93

Query  354  EMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            ++E  +++      +   R C  +    R H++Y LL P
Sbjct  94   QIEEEEEETAAAGDV-AARRCGLA---ARGHSAYRLLVP  128



>ref|XP_004503773.1| PREDICTED: uncharacterized protein LOC101489648 [Cicer arietinum]
Length=157

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
             P+G L V VG E+QRF+IK +  NHPLF+  LE+ E+E+GYR+DGPL  PC+VD F + 
Sbjct  48   PPQGCLCVYVGPERQRFVIKVKIANHPLFKTFLEDVENEFGYRNDGPLWIPCDVDLFYEA  107

Query  360  LREMESSD  337
            L E+E  D
Sbjct  108  LVEIEDDD  115



>ref|XP_002459008.1| hypothetical protein SORBIDRAFT_03g044380 [Sorghum bicolor]
 gb|EES04128.1| hypothetical protein SORBIDRAFT_03g044380 [Sorghum bicolor]
Length=156

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = -2

Query  519  VCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFP-CEVDHFLQVLREMES  343
            V VG E++RF+++ E  NHPLFR LL++AE EYGY + GPL  P C+VD FL VL +ME+
Sbjct  49   VYVGSERERFVVRAECANHPLFRRLLDDAEREYGYAAQGPLALPGCDVDAFLDVLWQMEN  108

Query  342  SDDDDPTCEKINNGRG---CSSSFARNRNHTSYHLLTP  238
            +D DD   +++        C            Y +L+P
Sbjct  109  ADADDGGQQQVAGAASSPICGLHSGSKGRAAGYRMLSP  146



>ref|XP_006647269.1| PREDICTED: auxin-induced protein 15A-like [Oryza brachyantha]
Length=140

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 67/136 (49%), Gaps = 23/136 (17%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            ++ KT +RC+SLG                     H       +       +  P G+  V
Sbjct  10   ILAKTIDRCRSLG---------------------HRTSRRPPAPPPSTASSGVPAGFFAV  48

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFLQVLREMESS  340
             VG EK+RF ++    NHPLFR LL++AE+EYG+   DGPL  PC+VD F+ V+ +ME +
Sbjct  49   LVGPEKERFAVRARCANHPLFRALLDQAETEYGFAGCDGPLELPCDVDAFMDVMWQMEQA  108

Query  339  DDD-DPTCEKINNGRG  295
            D    P C   +  +G
Sbjct  109  DPTASPRCRGYHQHQG  124



>ref|XP_009408359.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Musa 
acuminata subsp. malaccensis]
Length=128

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 71/128 (55%), Gaps = 30/128 (23%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
            LI+KT ERC+SLG                    SH     +  +KR       PEG   V
Sbjct  5    LILKTLERCRSLG--------------------SH----RKGDQKRQ----MPPEGCFSV  36

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME--S  343
             VG E++R++++TE VNHPLFR LL+EAE E+GY + GPL  PC V+ F +VL E+E  +
Sbjct  37   YVGPERERYVVRTECVNHPLFRMLLDEAEEEFGYAAAGPLELPCGVELFQRVLCEVEQDA  96

Query  342  SDDDDPTC  319
            ++   P C
Sbjct  97   AELHSPRC  104



>ref|XP_009393614.1| PREDICTED: auxin-induced protein 15A [Musa acuminata subsp. malaccensis]
Length=111

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 61/109 (56%), Gaps = 11/109 (10%)
 Frame = -2

Query  564  KRMGVGAAAPEGWLWVCVG---EEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLI  394
            +R   GA  P+GW+ V VG   EEKQRFL+   ++NHPLF  LL EAE EYG+   G + 
Sbjct  7    RRAAPGAPPPKGWMAVRVGGEGEEKQRFLVPVGYLNHPLFVALLREAEEEYGFHHAGAIT  66

Query  393  FPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHL  247
             PC V+HFL V   +   D D  +C    +G   +SS  R   H  +HL
Sbjct  67   IPCHVEHFLHVQGII---DRDTSSCS--TSGPAAASSGHR---HHHFHL  107



>ref|XP_004977952.1| PREDICTED: uncharacterized protein LOC101773448 [Setaria italica]
Length=262

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 68/118 (58%), Gaps = 11/118 (9%)
 Frame = -2

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGY--RSDGPLIFPCEVDHF  370
            AAP G   V VG E++RF+++ E  NHPLFR LL+EAE+EYG+   + GPL+ PC  + F
Sbjct  142  AAPPGCFAVLVGPERERFVVRAERANHPLFRALLDEAEAEYGFPHPAAGPLVLPCSAEEF  201

Query  369  LQVLREMESSDDDDPTCEKINNGRGCSSS------FARNRNHTSYHLLTP-PRQRPPL  217
             +V+ E+E   D+D   E +  G   ++S      F+   +H  Y  ++P P    PL
Sbjct  202  RRVMSEVER--DEDGEKEDVARGASVAASSPAWRFFSGGGDHAGYVKMSPEPHTYGPL  257



>emb|CDM85822.1| unnamed protein product [Triticum aestivum]
Length=158

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 54/96 (56%), Gaps = 6/96 (6%)
 Frame = -2

Query  618  MMKSKSWSHGL--RIMERSEKRMGVG----AAAPEGWLWVCVGEEKQRFLIKTEHVNHPL  457
            M  SK     L  R +ER    +  G    AA   G   V VG E++RF+++ +  NHPL
Sbjct  1    MAASKGARKSLVSRTLERCRSGLASGGRSSAAVAPGCFSVYVGPERERFVVRADRANHPL  60

Query  456  FRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREM  349
            FR LL++AE EYGY + GPL  PC VD FL VL  M
Sbjct  61   FRRLLDDAEQEYGYAAQGPLALPCSVDAFLDVLWHM  96



>ref|XP_007136076.1| hypothetical protein PHAVU_009G015600g [Phaseolus vulgaris]
 gb|ESW08070.1| hypothetical protein PHAVU_009G015600g [Phaseolus vulgaris]
Length=136

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (56%), Gaps = 7/113 (6%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
            GGL K  ++ H  + R M  + W    R   R     G+ +  P G + VCVG   +RF+
Sbjct  8    GGLAKCSRIRHIVRLRQMLRR-W----RSKARLSAHRGIPSDVPAGHVAVCVGSNSRRFV  62

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDD  328
            ++  ++NHP+F+ LL EAE EYG+ + GPL  PC+   F Q+LR +  S+  D
Sbjct  63   VRATYLNHPVFKKLLVEAEEEYGFSNHGPLAIPCDETLFEQLLRFISRSNRSD  115



>ref|XP_002459007.1| hypothetical protein SORBIDRAFT_03g044370 [Sorghum bicolor]
 gb|EES04127.1| hypothetical protein SORBIDRAFT_03g044370 [Sorghum bicolor]
Length=158

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -2

Query  519  VCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFP-CEVDHFLQVLREMES  343
            V VG E++RF+++ E  NHPLFR LL++AE EYGY + GPL  P C+VD FL VL +ME 
Sbjct  49   VYVGPERERFVVRAECANHPLFRRLLDDAEREYGYATQGPLALPGCDVDAFLDVLWQMER  108

Query  342  SDDDD  328
             DD D
Sbjct  109  GDDAD  113



>ref|XP_003550112.1| PREDICTED: uncharacterized protein LOC100779842 [Glycine max]
 gb|KHN25013.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=173

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = -2

Query  606  KSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAES  427
            KS     R +  SE+  G     P+G+L VCVGEE +RF I TEH+ H  F+ LL EAE 
Sbjct  47   KSMKFLKRTLSLSEREGGSSNVVPKGYLAVCVGEELKRFTIPTEHLGHQAFQILLREAEE  106

Query  426  EYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            E+G++  G L  PCEV  F  +L+ +E  +D
Sbjct  107  EFGFQQTGVLRIPCEVAAFESILKMVEGKED  137



>ref|XP_004971120.1| PREDICTED: uncharacterized protein LOC101781779 [Setaria italica]
Length=157

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -2

Query  543  AAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFP-CEVDHFL  367
            A+P G   V VG E++RF+++ E  NHPLFR LL++AE EYGY + GPL  P C+VD FL
Sbjct  39   ASPAGCFSVYVGTERERFVVRAECANHPLFRRLLDDAEREYGYAAQGPLALPGCDVDAFL  98

Query  366  QVLREMES  343
             VL +ME+
Sbjct  99   DVLWQMEN  106



>gb|KDP33420.1| hypothetical protein JCGZ_06991 [Jatropha curcas]
Length=168

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 10/155 (6%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGK-KLNHHCKFRMMKSKSWSHGLRIMERSE--KRMGVGAAAPEGWL  523
            I+K W +   L    K K N +       SKS     R +  SE   +     A P+G+L
Sbjct  18   ILKKWRK---LANSSKAKANTNTNTSNGSSKSIKFLRRTLSLSETSSQSTPSNAVPKGYL  74

Query  522  WVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMES  343
             +CVGEE +RF+I TE++ HP F  LL EAE E+G++  G L  PCEV  F  +L+ +E 
Sbjct  75   AICVGEELKRFIIPTEYLGHPAFHFLLREAEEEFGFQQTGVLRIPCEVAVFESILKLVEE  134

Query  342  SDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            + D   T + +    G +   ++N    S+H  +P
Sbjct  135  NKDVYFTQDSV----GLAHCSSKNHQTPSHHPQSP  165



>ref|XP_010232765.1| PREDICTED: uncharacterized protein LOC100825908 [Brachypodium 
distachyon]
Length=184

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 83/172 (48%), Gaps = 32/172 (19%)
 Frame = -2

Query  729  RREgkaggkkALIIKTWERCKS-LGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMG  553
            R+E +   K++L+ +T ERC++ LGG G                             R  
Sbjct  17   RKEKENKQKQSLVSRTLERCRTGLGGGG-----------------------------RAS  47

Query  552  VGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFP-CEVD  376
            + A AP G   V VG E++RF+++ +  +HP FR LL++AESEYGY + GPL  P C V+
Sbjct  48   MAAVAPAGCFSVYVGPERERFVVRADRASHPRFRRLLDDAESEYGYSAHGPLALPSCAVE  107

Query  375  HFLQVLREME-SSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTPPRQRP  223
             FL VL  M+  ++ DD   + ++       +    R  + Y  L+  R  P
Sbjct  108  DFLDVLWHMDHDAEIDDGEIDGLSLKSPVCGAGGLQRARSGYRALSTARSSP  159



>ref|XP_004144827.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cucumis 
sativus]
 ref|XP_004169865.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cucumis 
sativus]
 gb|KGN43195.1| hypothetical protein Csa_7G007930 [Cucumis sativus]
Length=151

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 60/109 (55%), Gaps = 3/109 (3%)
 Frame = -2

Query  657  GLGKKLNHH--CKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLI  484
            G+GK  N       R M  + W    R+   S +     +  P G + +CVG   +RF++
Sbjct  4    GIGKSNNIRRIVSIRQMLQR-WRKKARVTASSRRAGDAPSDVPAGHVAICVGSSCRRFVV  62

Query  483  KTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            +  ++NHP+F+ LL +AE EYG+R+ GPL  PCE   F +VLR +  S+
Sbjct  63   RATYLNHPIFQKLLSQAEEEYGFRNQGPLAIPCEESVFEEVLRTVSRSE  111



>ref|XP_007161535.1| hypothetical protein PHAVU_001G077500g [Phaseolus vulgaris]
 gb|ESW33529.1| hypothetical protein PHAVU_001G077500g [Phaseolus vulgaris]
Length=173

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -2

Query  606  KSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAES  427
            KS     R +  SE+  G     P+G+L VCVGEE +RF I TE++ H  F+ LL EAE 
Sbjct  47   KSIKFLKRTLSLSEREGGSSNVVPKGYLAVCVGEELKRFTIPTEYLGHQAFQILLREAEE  106

Query  426  EYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPT  322
            E+G++  G L  PCEV  F  +L+ +E   D  P+
Sbjct  107  EFGFQQTGVLRIPCEVAVFQSILKMVERKGDMSPS  141



>ref|XP_010271410.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Nelumbo 
nucifera]
Length=158

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 61/111 (55%), Gaps = 3/111 (3%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
             G+GK  K+ H  + R M  K W     +  R   R  + +  P G + VCVG   +RF+
Sbjct  3    AGIGKCSKIRHIVRLRQMLRK-WRQKAALAARISSRARIPSDVPAGHVAVCVGRNYRRFV  61

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            ++  ++NHP+F+ LL +AE EYG+ + GPL  PC+   F ++L  +  S+ 
Sbjct  62   VRATYLNHPVFKKLLVQAEEEYGFTNQGPLAIPCDESLFEEILLYLSRSES  112



>ref|XP_010539863.1| PREDICTED: indole-3-acetic acid-induced protein ARG7 [Tarenaya 
hassleriana]
Length=152

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 64/111 (58%), Gaps = 6/111 (5%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
            GGLGK  K+ H  + R M  + W +  R+   S     V +  P G + VCVG   +RF+
Sbjct  3    GGLGKCSKIRHIVRLRQMLRR-WRNKARM---SSAAKFVPSDVPAGHVAVCVGSSCKRFI  58

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            ++  ++NHP+FR LL +AE E+G+ + GPL+ PC+   F + +R +  SD 
Sbjct  59   VRATYLNHPIFRKLLVQAEEEFGFSNQGPLVIPCDESVFEEAIRFISRSDS  109



>ref|XP_010061488.1| PREDICTED: uncharacterized protein LOC104449147 [Eucalyptus grandis]
 gb|KCW68431.1| hypothetical protein EUGRSUZ_F02085 [Eucalyptus grandis]
Length=149

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMG--VGAAAPEGWLWVCVGEEKQR  493
             G+GK  K+ H  + R M  + W    RI  R+    G  + A  P G + VCVGE  +R
Sbjct  3    AGIGKCSKIRHIVRLRQMLRR-W----RIKARASSAAGGRIPADVPAGHVAVCVGEGCRR  57

Query  492  FLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            F+++  H+NHP+FR LL +AE EYG+ + GPL  PC+   F + LR +   D
Sbjct  58   FVVRATHLNHPIFRKLLVQAEEEYGFANHGPLTIPCDESFFEEALRLVSRPD  109



>ref|XP_010246411.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Nelumbo 
nucifera]
Length=155

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
             G+GK  K+ H  + R M  K W     +  R      + +  P G + +CVG   +RF+
Sbjct  3    AGIGKCSKIRHIVRLRQML-KRWRQKAALAARISASARIPSDVPAGHVALCVGSNYRRFV  61

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDD  328
            ++  ++NHP+F+ LL +AE EYG+ + GPL+ PC+   F ++LR +  S+  +
Sbjct  62   VRATYLNHPVFKKLLVQAEEEYGFTNQGPLVIPCDESLFEEILRCISRSESGN  114



>ref|XP_004501724.1| PREDICTED: uncharacterized protein LOC101509958 [Cicer arietinum]
Length=131

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
            AP G   V VG +++RF++KT+ +NHPLF  LL+EAE EY +++DGP++ PC+V+ F +V
Sbjct  30   APNGCFSVYVGAQRKRFVLKTKFINHPLFMMLLDEAEVEYEFQNDGPILLPCKVELFNKV  89

Query  360  LREMES  343
            L E+ +
Sbjct  90   LAEINN  95



>gb|EMT25620.1| hypothetical protein F775_26776 [Aegilops tauschii]
Length=158

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 6/93 (6%)
 Frame = -2

Query  618  MMKSKSWSHGL--RIMERSEKRMGVG----AAAPEGWLWVCVGEEKQRFLIKTEHVNHPL  457
            M  SK     L  R +ER    +  G    AA   G   V VG E++RFL++ +  +HPL
Sbjct  1    MAASKGARKSLVSRTLERCRSGLNSGGKSSAAVAPGCFSVYVGPERERFLVRADRADHPL  60

Query  456  FRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVL  358
            FR LL++AE EYGY + GPL  PC VD FL VL
Sbjct  61   FRRLLDDAEQEYGYAAKGPLTLPCSVDAFLDVL  93



>ref|XP_003544655.2| PREDICTED: uncharacterized protein LOC100799598 [Glycine max]
 gb|KHN11388.1| Auxin-induced protein 15A [Glycine soja]
Length=177

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = -2

Query  606  KSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAES  427
            KS  +  R +  SE+  G     P+G+L VCVGEE +RF I TE++ H  F+ LL EAE 
Sbjct  51   KSMKYLKRTLSLSEREGGSSNVVPKGYLAVCVGEELKRFTIPTEYLGHQAFQILLREAEE  110

Query  426  EYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            E+G++  G L  PCEV  F  +L+ +E  +D
Sbjct  111  EFGFQQTGVLRIPCEVAVFESILKMVEGKED  141



>emb|CDM85823.1| unnamed protein product [Triticum aestivum]
Length=242

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 6/93 (6%)
 Frame = -2

Query  618  MMKSKSWSHGL--RIMERSEKRMGVG----AAAPEGWLWVCVGEEKQRFLIKTEHVNHPL  457
            M  SK     L  R +ER    +  G    AA   G   V VG E++RF+++ +  NHPL
Sbjct  1    MAASKGARKSLVSRTLERCRSGLNSGGKSSAAVAPGCFSVYVGPERERFVVRADRANHPL  60

Query  456  FRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVL  358
            FR LL++AE EYGY + GPL  PC VD FL VL
Sbjct  61   FRRLLDDAEQEYGYAAQGPLTLPCSVDAFLDVL  93


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  468  NHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVL  358
            +HPLFR LL++AE EYGY + GPL  PC VD FL VL
Sbjct  141  DHPLFRRLLDDAEQEYGYAAQGPLTLPCSVDAFLDVL  177



>ref|XP_003523572.1| PREDICTED: indole-3-acetic acid-induced protein ARG7 [Glycine 
max]
 gb|KHN45913.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=128

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 64/114 (56%), Gaps = 14/114 (12%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMG---VGAAAPEGWLWVCVGEEKQ  496
              LGK  ++ H  + R M  + W        RS+ R     + +  P G + VCVG   +
Sbjct  3    AALGKCSRIRHIVRLRQMLRR-W--------RSKARTSAHRIPSDVPAGHVAVCVGNNSK  53

Query  495  RFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            RF+++T ++NHP+F+ LL EAE EYG+ + GPL  PC+   F Q+LR +  SDD
Sbjct  54   RFVVRTTYLNHPVFKRLLVEAEEEYGFSNHGPLAIPCDEAIFEQLLRFVSHSDD  107



>ref|XP_002513015.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus 
communis]
 gb|EEF49518.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus 
communis]
Length=142

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 60/107 (56%), Gaps = 2/107 (2%)
 Frame = -2

Query  651  GKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEH  472
              K+ H  + + M  K W    R+   S +     A  P G + VCVGE  +RF+++  +
Sbjct  4    SNKIRHIVRVQQML-KRWRRKARLTA-SSRGAAAPADVPAGHVAVCVGESYKRFIVRATY  61

Query  471  VNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDD  331
            +NHP+F+ LL +AE EYG+++ GPL  PC+   F ++LR + S  + 
Sbjct  62   LNHPIFKNLLVQAEEEYGFKNIGPLTIPCDESVFEEILRVVSSRSES  108



>gb|EYU21194.1| hypothetical protein MIMGU_mgv1a024031mg [Erythranthe guttata]
Length=199

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -2

Query  555  GVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVD  376
             VG A P+G++ VCVG+E +R++I TE+++H +F  LL EAE E+G++ +G L FPCEV+
Sbjct  69   AVGNAVPKGYIAVCVGKEMKRYVIPTEYLSHQMFGILLREAEEEFGFQQEGVLKFPCEVE  128

Query  375  HFLQVLREMESSD  337
             F ++++ M   D
Sbjct  129  LFDKIIKMMMVED  141



>ref|XP_004307934.1| PREDICTED: auxin-induced protein 10A5-like [Fragaria vesca subsp. 
vesca]
Length=122

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  537  PEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVL  358
            P+G + V VGEE++RF+I   H+NHPLF  LL+EAE EYG+  DGP+  PC V+ FL V 
Sbjct  33   PKGCMAVMVGEEQKRFVIPVAHINHPLFYHLLKEAEKEYGFDHDGPITIPCHVEEFLAVE  92

Query  357  REM  349
             E+
Sbjct  93   GEI  95



>emb|CDX75459.1| BnaA01g02430D [Brassica napus]
Length=143

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = -2

Query  657  GLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKT  478
            G   K+    + R M  K W     I    E+ +   +  P G + V VGE ++R++++ 
Sbjct  2    GKNNKIGSVVRIRQM-VKQWQKKAHIGSNKEEPV---SDVPPGHVAVSVGENRRRYVVRA  57

Query  477  EHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            +H+NHP+FR LL EAE EYG+ S GPL FPC+   F ++++ +  SD 
Sbjct  58   KHLNHPIFRRLLAEAEEEYGFSSVGPLAFPCDESLFEEIIKVVSRSDS  105



>ref|XP_009367954.1| PREDICTED: uncharacterized protein LOC103957507 [Pyrus x bretschneideri]
Length=172

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 5/104 (5%)
 Frame = -2

Query  549  GAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
             AA P+G+L VCVGEE +RF+I T+++  P F  LL EAE E+G++  G L  PCEV  F
Sbjct  71   NAAVPKGYLAVCVGEELKRFVIPTDYLGRPAFHILLREAEEEFGFQQTGVLRIPCEVSVF  130

Query  369  LQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
              +L+ +E   D        NN  G  S+ +  + + S+HL  P
Sbjct  131  EGILKMVEEDKD-----LFFNNMVGGCSTASDGQLNFSHHLENP  169



>emb|CCH47223.1| similar to auxin-induced protein 6B [Lupinus angustifolius]
Length=178

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 4/105 (4%)
 Frame = -2

Query  555  GVGAA----APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFP  388
            G+G++     P+G+L VCVGEE +RF+I T+++ H  F+ LL EAE E+G+   G L  P
Sbjct  63   GIGSSNNVVVPKGYLAVCVGEELKRFIIPTQYLTHQAFQILLREAEEEFGFEQVGVLRIP  122

Query  387  CEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSY  253
            CEV  F ++L+ +E   D   + ++          F   +NH+SY
Sbjct  123  CEVSVFEKILKMVEGKKDKFSSTQECRLSVQEIMGFCSFQNHSSY  167



>ref|XP_010034089.1| PREDICTED: uncharacterized protein LOC104423276 [Eucalyptus grandis]
 gb|KCW53982.1| hypothetical protein EUGRSUZ_J03183 [Eucalyptus grandis]
Length=178

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = -2

Query  609  SKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAE  430
            SKS     R +  S+       A P+G+L V VG+E +RF+I TEH+ HP F  LL+EAE
Sbjct  54   SKSIKFLKRTLSFSDVTASSSDAVPKGFLAVSVGKELKRFVIPTEHLRHPAFGILLQEAE  113

Query  429  SEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
             E+G++ +G L  PCEV  F  +L+ +E   D
Sbjct  114  EEFGFQQEGVLKIPCEVRVFEMILKAVEEKRD  145



>ref|XP_008645719.1| PREDICTED: uncharacterized protein LOC103627198 [Zea mays]
 gb|AFW71553.1| hypothetical protein ZEAMMB73_727533 [Zea mays]
Length=162

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 55/103 (53%), Gaps = 4/103 (4%)
 Frame = -2

Query  528  WLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFLQVLRE  352
            +  V VG EK+RF ++    NHPLFR LL+ AE+EYG+   DGPL  PC VD F++V+ E
Sbjct  56   YFTVLVGPEKERFGVRARCANHPLFRALLDAAEAEYGFAGCDGPLELPCAVDDFMEVMWE  115

Query  351  MESSDDD-DPTCEKINNGRGCSSSFARNRNHTSYHLLTPPRQR  226
            ME  D    P C +   G   +  +        Y L+  P  R
Sbjct  116  MELGDPSASPGCGRFAAGS--TRGYHHVHQLAGYQLVVSPPAR  156



>ref|XP_008448020.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cucumis 
melo]
Length=151

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = -2

Query  600  WSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEY  421
            W    R+   S +        P G + +CVG   +RF+++   +NHP+F+ LL +AE EY
Sbjct  24   WRKKARVTASSRRASDAPTDVPAGHVAICVGSSCRRFVVRATFLNHPIFQKLLLQAEEEY  83

Query  420  GYRSDGPLIFPCEVDHFLQVLREMESSD  337
            G+R+ GPL  PCE   F +VLR +  S+
Sbjct  84   GFRNQGPLAIPCEESVFEEVLRSVSRSE  111



>gb|KDP27624.1| hypothetical protein JCGZ_19629 [Jatropha curcas]
Length=139

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 8/105 (8%)
 Frame = -2

Query  618  MMKSKSWSHGLRIME-----RSEKRMGVGAA---APEGWLWVCVGEEKQRFLIKTEHVNH  463
            M KS    H +RI +     R + R+    A    P G + VCVG   +RF+++  ++NH
Sbjct  1    MSKSNKIRHIVRIQQMLRRWRRKARLTAARAPSDVPSGHVAVCVGASCKRFIVRATYLNH  60

Query  462  PLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDD  328
            P+F+ LL +AE EYG+++ GPL  PC+   F ++LR +  S+  +
Sbjct  61   PIFKKLLVQAEEEYGFKNIGPLTIPCDESLFEEILRVVSQSESSN  105



>ref|XP_009122007.1| PREDICTED: uncharacterized protein LOC103846762 [Brassica rapa]
 emb|CDX69794.1| BnaA10g21430D [Brassica napus]
Length=148

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 63/109 (58%), Gaps = 6/109 (6%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
            GG+ K  K+ H  K R M  + W +  R+   S  R  V +  P G++ V VG  ++RF+
Sbjct  3    GGIAKCSKIRHIVKLRQML-RQWRNKARM---SSARRCVPSDVPSGYVAVYVGSSRRRFV  58

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESS  340
            ++  H+NHP+ + LL +AE E+G+ + GPL+ PCE   F + +R +  S
Sbjct  59   VRATHLNHPVLKNLLVKAEEEFGFANHGPLVIPCEESVFEESIRLINRS  107



>emb|CDX97071.1| BnaC09g45540D [Brassica napus]
Length=148

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 63/109 (58%), Gaps = 6/109 (6%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
            GG+ K  K+ H  K R M  + W +  R+   S  R  V +  P G++ V VG  ++RF+
Sbjct  3    GGIAKCSKIRHIVKLRQML-RQWRNKARM---SSARRCVPSDVPSGYVAVYVGSSRRRFV  58

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESS  340
            ++  H+NHP+ + LL +AE E+G+ + GPL+ PCE   F + +R +  S
Sbjct  59   VRATHLNHPVLKNLLVKAEEEFGFANHGPLVIPCEESVFEESIRLINRS  107



>ref|XP_009396221.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Musa 
acuminata subsp. malaccensis]
Length=145

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -2

Query  612  KSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEA  433
            KS   S  ++ ++R+          P+G+L VCVGEE +RF+I TE++ H  F  LL EA
Sbjct  30   KSGGGSKSIKFLKRTLSFTDASGDVPKGYLAVCVGEEMRRFVIPTEYLGHRAFAALLREA  89

Query  432  ESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            E E+G++ +G L  PCEV  F  +L+ +E + +
Sbjct  90   EEEFGFQQEGVLRIPCEVAVFESILKVVEKNKE  122



>ref|NP_178034.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 gb|AAC17066.1| Contains similarity to auxin-induced protein TM018A10.6 from 
A. thaliana BAC gb|AF013294 [Arabidopsis thaliana]
 gb|ABD59133.1| At1g79130 [Arabidopsis thaliana]
 gb|AEE36208.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=134

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 1/90 (1%)
 Frame = -2

Query  564  KRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPC  385
            KR  V ++ P G + V VGE+K+RF++  E +NHP+F GLL  +  EYGY   G L  PC
Sbjct  40   KRATVASSVPSGHVPVNVGEDKERFVVSAELLNHPVFVGLLNRSAQEYGYTQKGVLHIPC  99

Query  384  EVDHFLQVLREMESSDDDDPTCEKINNGRG  295
             V  F QV+  + S   DD T E I +  G
Sbjct  100  NVFVFEQVVESLRSGIADD-TSELIASLSG  128



>ref|XP_004303802.1| PREDICTED: uncharacterized protein LOC101309563 [Fragaria vesca 
subsp. vesca]
Length=185

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 57/89 (64%), Gaps = 5/89 (6%)
 Frame = -2

Query  597  SHGLRIMERSEKRMGVGAA-----APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEA  433
            S G++ ++R+     V AA      P+G+L VCVG+E +RF+I TE++ H  FR LL EA
Sbjct  56   SRGIKFLKRTLSFTDVSAAHQSDVVPKGFLAVCVGKELKRFIIPTEYLGHQAFRILLREA  115

Query  432  ESEYGYRSDGPLIFPCEVDHFLQVLREME  346
            E E+G++  G L  PCEV  F ++L+ +E
Sbjct  116  EEEFGFQQAGVLKIPCEVSVFEKILKVVE  144



>ref|XP_003576721.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Brachypodium 
distachyon]
Length=143

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 5/97 (5%)
 Frame = -2

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG  +QRF+++TE VNHPLF  LLEEAE  +GY + GPL  PC  + F  VL 
Sbjct  40   EGCFSVYVGAGRQRFVVRTECVNHPLFVALLEEAEEVFGYAATGPLQLPCNAEAFTGVLE  99

Query  354  EMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLL  244
            ++   +     C K   G+GC  +    R  ++Y LL
Sbjct  100  QIR-EEKQAAACRKAAAGKGCGLA----RGQSAYRLL  131



>ref|XP_007023649.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOY26271.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=173

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 79/155 (51%), Gaps = 15/155 (10%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAA----PEGW  526
            I+K W   K L    K ++     ++  S S S  +R ++R+     V AA+    P+G+
Sbjct  18   ILKKW---KKLANAPKNISGSSSSQLTTSGS-SKSIRFLKRTLSFTDVSAASADAVPKGF  73

Query  525  LWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
            L VCVG+E +RF+I TE++ H  F  LL +AE E+G++ +G L  PCEV  F ++L  ++
Sbjct  74   LAVCVGKELKRFVIPTEYLGHQAFGVLLRKAEEEFGFQQEGVLKIPCEVSTFEKILEMVQ  133

Query  345  SSDDD----DPTCEKINNGRGCSSS---FARNRNH  262
               D     D  C       GC S    F  N +H
Sbjct  134  HRKDAIFSHDSGCNVDKEIIGCYSPDCEFTPNAHH  168



>ref|XP_007017754.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
 gb|EOY14979.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
Length=150

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 65/114 (57%), Gaps = 14/114 (12%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVG---AAAPEGWLWVCVGEEKQ  496
             GLGK  K+ H  + R M  + W        R++ RM  G   +  PEG + VCVG   +
Sbjct  3    AGLGKCSKIRHIVRLRQMLRR-W--------RNKARMSAGRIPSDVPEGHVAVCVGTSCR  53

Query  495  RFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            RF+++  ++NHP+F+ LL +AE EYG+ + GPL  PC+   F +V+R +  S+ 
Sbjct  54   RFVVRATYLNHPVFKKLLVQAEEEYGFTNQGPLAIPCDESVFEEVIRFISRSES  107



>gb|EMT16843.1| hypothetical protein F775_31032 [Aegilops tauschii]
Length=130

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG  +QRF+++TE +NHPLFR LLEEAE  +GY   GPL  PC  + F +VL 
Sbjct  35   EGCFSVYVGAGRQRFVVRTECLNHPLFRALLEEAEEAFGYADAGPLELPCNTEAFTKVLE  94

Query  354  EME  346
            ++E
Sbjct  95   KIE  97



>ref|XP_008387015.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=127

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = -2

Query  597  SHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYG  418
            SH   ++  SE+     A  P G+L + VGEE+QRFL+ T  ++HPLF+ LLE+A +EYG
Sbjct  27   SHHEYLLRNSEQGGSPSAKTPTGFLALYVGEERQRFLVPTSSLSHPLFKMLLEKAYNEYG  86

Query  417  YRSDGPLIFPCEVDHFLQVLREMESSD  337
            ++    L+ PC V  F +VL  +E S+
Sbjct  87   FQQRYGLVVPCSVSAFEEVLNAVECSN  113



>ref|XP_009391841.1| PREDICTED: auxin-induced protein 6B [Musa acuminata subsp. malaccensis]
Length=172

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 60/107 (56%), Gaps = 8/107 (7%)
 Frame = -2

Query  645  KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAA----PEGWLWVCVGEEKQRFLIKT  478
            K+ H  + R M  + W   LR    S  R G GA A    P G + VCVG   +RF+++ 
Sbjct  14   KIRHIVRLRQMLRR-WR--LRAAALSSLRRGGGAGAAPDVPAGHVAVCVGSSSRRFVVRA  70

Query  477  EHVNHPLFRGLLEEAESEYGY-RSDGPLIFPCEVDHFLQVLREMESS  340
             H+NHP+FR LL +AE EYG+  S GP+  PC+   F  VLR + SS
Sbjct  71   SHLNHPVFRQLLRQAEEEYGFPSSPGPVSLPCDESLFEDVLRLISSS  117



>ref|XP_002513310.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus 
communis]
 gb|EEF48713.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus 
communis]
Length=166

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 71/126 (56%), Gaps = 13/126 (10%)
 Frame = -2

Query  693  IIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAA------PE  532
            I+K W++  +    G   N +       + + S  ++ ++R+     V AAA      P+
Sbjct  18   ILKKWKKAATSAPKGSTSNSN-------ASTGSKSIKFIKRTLSFTDVSAAASGDNVVPK  70

Query  531  GWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLRE  352
            G++ VCVG+E +R++I TEH+ H  F  LL EAE E+G++ +G L  PC+V  F ++L+ 
Sbjct  71   GFVAVCVGKELKRYVIPTEHLGHQAFGVLLREAEEEFGFQQEGVLKIPCDVPVFEKILKL  130

Query  351  MESSDD  334
            +E + D
Sbjct  131  VEENRD  136



>ref|XP_011037237.1| PREDICTED: auxin-induced protein 10A5 [Populus euphratica]
Length=145

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  645  KLNHHCKFRMMKSKSWSHGLRIME-RSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHV  469
            K+ H  + + M  K W    R+    +  R    +  P G + VCVG   +RF+++  ++
Sbjct  6    KIRHIVRIQQM-LKRWRRKARVTGGATSSRTAAPSDVPAGHVAVCVGASCKRFVVRATYL  64

Query  468  NHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            NHP+F+ LL EAE  YG+++ GPL  PC+   F ++LR +  SD
Sbjct  65   NHPIFKNLLVEAEEVYGFKTAGPLAIPCDEAVFEEILRVVSRSD  108



>emb|CDY51099.1| BnaCnng20020D [Brassica napus]
Length=148

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = -2

Query  657  GLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKT  478
            G+  K+ H  K R M  + W    RI   S  R  V +  P G++ V VG   +RF+++ 
Sbjct  6    GICSKIRHIVKLRQML-RQWRSKARI---SSVRRCVPSDVPSGYVAVHVGSSCRRFVVRA  61

Query  477  EHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESS  340
             H+NHP+ R LL +AE E+G+ + GPL+ PCE   F + +R +  S
Sbjct  62   THLNHPIIRSLLAKAEEEFGFANHGPLVIPCEESVFEESIRLITRS  107



>ref|XP_002305471.1| hypothetical protein POPTR_0004s17130g [Populus trichocarpa]
 gb|EEE85982.1| hypothetical protein POPTR_0004s17130g [Populus trichocarpa]
Length=145

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  645  KLNHHCKFRMMKSKSWSHGLRIME-RSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHV  469
            K+ H  + + M  K W    R+    +  R    +  P G + VCVG   +RF+++  ++
Sbjct  6    KIRHIVRIQQM-LKRWRRKARVTGGATSSRTAAPSDVPAGHVAVCVGASCKRFVVRATYL  64

Query  468  NHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            NHP+F+ LL EAE  YG+++ GPL  PC+   F ++LR +  SD
Sbjct  65   NHPIFKNLLVEAEEVYGFKTAGPLAIPCDEAVFEEILRVVSRSD  108



>gb|KHN39378.1| Auxin-induced protein 15A [Glycine soja]
Length=142

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = -2

Query  591  GLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYR  412
            G++ ++R+          P+G+L VCVG+E +RF+I T+++ H  F  LL+EAE E+G++
Sbjct  38   GIKFLKRTLSFTDTNDIVPKGFLAVCVGKELKRFIIPTDYLRHQAFEMLLQEAEEEFGFQ  97

Query  411  SDGPLIFPCEVDHFLQVLREMESSDDDDP  325
             +G L  PC+V  F ++L+ +E  D+ +P
Sbjct  98   QEGVLKIPCQVSVFEKILKAVE--DNKEP  124



>ref|XP_010940987.1| PREDICTED: auxin-induced protein 6B [Elaeis guineensis]
Length=160

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 4/100 (4%)
 Frame = -2

Query  645  KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVN  466
            K+ H  + R M  + W   LR +  +    G  A  P G + VCVG   +RF+++  H+N
Sbjct  6    KIRHIARLRQMLRR-WR--LRAVASASASRGAPADVPVGHVAVCVGSSSRRFVVRAAHLN  62

Query  465  HPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFLQVLREM  349
            HP+FR LL +AE EYG+ S  GPL  PC+   F  +LR +
Sbjct  63   HPVFRQLLRQAEEEYGFSSHPGPLALPCDESLFEHILRHL  102



>dbj|BAK04310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=133

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  579  MERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSD-G  403
            + R   R    A  P G + VCVG   +RFL++  H+NHP+FR LL ++E EYG+ S  G
Sbjct  17   LRRWRSRAASAAPVPSGHVAVCVGGGSRRFLVRAAHLNHPVFRELLRQSEEEYGFPSTPG  76

Query  402  PLIFP-CEVDHFLQVLREMESSD  337
            P+  P C+ D FL VLR + S D
Sbjct  77   PVALPCCDEDRFLDVLRRVSSED  99



>ref|XP_010417533.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=131

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -2

Query  564  KRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPC  385
            KR  V ++ P G + V VGEEK+RF++  E +NHP+F GLL  +  EYGY   G L  PC
Sbjct  35   KRATVDSSVPSGHVPVNVGEEKERFVVSAELLNHPVFVGLLNRSAQEYGYAQKGVLHIPC  94

Query  384  EVDHFLQVLREMESSDDDDPT  322
             V  F QV+  ++S   DD +
Sbjct  95   NVFVFEQVVESLQSGVFDDTS  115



>ref|XP_008378142.1| PREDICTED: uncharacterized protein LOC103441218 [Malus domestica]
Length=173

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = -2

Query  549  GAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
             AA P+G+L VCVGE  +RF+I T+++  P F  LL EAE E+G++  G L  PCEV  F
Sbjct  74   NAAVPKGYLAVCVGEXLKRFVIPTDYLGRPAFHILLREAEEEFGFQQTGVLRIPCEVSVF  133

Query  369  LQVLREMESSDDDDPTCEKINNGRGCSSS  283
              +L+ +E   D        NN   CSSS
Sbjct  134  EGILKMVEEDKD-----MFFNNMGACSSS  157



>ref|NP_001046940.1| Os02g0512000 [Oryza sativa Japonica Group]
 dbj|BAD23093.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD23234.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08854.1| Os02g0512000 [Oryza sativa Japonica Group]
 dbj|BAG98524.1| unnamed protein product [Oryza sativa Japonica Group]
Length=166

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -2

Query  528  WLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFLQVLRE  352
            +  V VG EK+RF ++    NHPLFR LL++AE+EYG+   +GPL  PC+VD F+ V+ E
Sbjct  52   FFAVLVGPEKERFAVRARCANHPLFRALLDQAETEYGFAGCEGPLELPCDVDAFMDVMWE  111

Query  351  MESSDD-DDPTCEKINNGRGCSSS  283
            ME +D    P C     G   + S
Sbjct  112  MEQADPAASPRCGARFGGPAAAGS  135



>gb|EAY86017.1| hypothetical protein OsI_07378 [Oryza sativa Indica Group]
Length=166

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -2

Query  528  WLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFLQVLRE  352
            +  V VG EK+RF ++    NHPLFR LL++AE+EYG+   +GPL  PC+VD F+ V+ E
Sbjct  52   FFAVLVGPEKERFAVRARCANHPLFRALLDQAETEYGFAGCEGPLELPCDVDAFMDVMWE  111

Query  351  MESSDD-DDPTCEKINNGRGCSSS  283
            ME +D    P C     G   + S
Sbjct  112  MEQADPAASPRCGARFGGPAAAGS  135



>ref|XP_009109163.1| PREDICTED: uncharacterized protein LOC103834796 [Brassica rapa]
Length=143

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = -2

Query  657  GLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKT  478
            G   K+    + R M  K W     I    E+ +   +  P G + V VGE ++R+++  
Sbjct  2    GKNNKIGSVVRIRQM-VKQWQKKAHIGSNKEEPV---SDVPPGHVAVSVGENRRRYVVCA  57

Query  477  EHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            +H+NHP+FR LL EAE EYG+ S GPL FPC+   F ++++ +  SD 
Sbjct  58   KHLNHPIFRRLLAEAEEEYGFSSVGPLAFPCDESLFEEIIKVVSRSDS  105



>ref|NP_001045869.2| Os02g0143400 [Oryza sativa Japonica Group]
 gb|EAZ21715.1| hypothetical protein OsJ_05348 [Oryza sativa Japonica Group]
 dbj|BAF07783.2| Os02g0143400 [Oryza sativa Japonica Group]
Length=130

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 0/96 (0%)
 Frame = -2

Query  606  KSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAES  427
            K W       +  +   G GA+ P+G+  VCVGEE +RF+I TE++ H  F  LL +AE 
Sbjct  24   KRWKRAALAPKAGKNNNGGGASVPKGFFAVCVGEEMRRFVIPTEYLGHWAFEQLLRKAEE  83

Query  426  EYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTC  319
            E+G++ +G L  PC+V+ F  +LR +   D+    C
Sbjct  84   EFGFQHEGALRIPCDVEVFEGILRLVGRKDEKAAMC  119



>ref|XP_003631581.1| PREDICTED: auxin-induced protein 6B-like [Vitis vinifera]
Length=141

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 4/111 (4%)
 Frame = -2

Query  657  GLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKT  478
            G   K+ H  + R M  + W    R    S  R+ V +  P G + +CVG   +RF+++ 
Sbjct  5    GSSDKIRHIVRIRKMLRR-WR---RKAASSGGRIRVPSDVPAGHVAICVGSGCRRFIVRA  60

Query  477  EHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDP  325
             ++NHP+F+ L  EAE EYG+ + GPL  PC+   F +VLR +  S+   P
Sbjct  61   SYLNHPVFKALFLEAEEEYGFANHGPLAIPCDESVFEEVLRVVSRSESSHP  111



>ref|XP_003588611.1| Auxin-induced protein 6B [Medicago truncatula]
 gb|AES58862.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=179

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 5/94 (5%)
 Frame = -2

Query  612  KSKSWSHGLRIMERSEKRMGVGAA-----APEGWLWVCVGEEKQRFLIKTEHVNHPLFRG  448
            +SKS     R +  SE+  G  ++      P+G+L VCVGEE +RF+I TE++ H  F+ 
Sbjct  42   RSKSMKFLKRTLSLSEREGGTTSSNNNGSVPKGYLAVCVGEELKRFIIPTEYLGHQAFQI  101

Query  447  LLEEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
            LL EAE E+G++  G L  PCEV  F  +L+ +E
Sbjct  102  LLREAEEEFGFQQAGVLRIPCEVSTFESILKMVE  135



>ref|XP_006382198.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ERP59995.1| auxin-responsive family protein [Populus trichocarpa]
Length=169

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = -2

Query  606  KSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAES  427
            K     L I E S K      A P+G+L V VGEE++RF+I TE+++HP F  LL EAE 
Sbjct  44   KFLKRTLSIPENSAKETS-SNAVPKGYLAVGVGEEQKRFIIPTEYLSHPAFLILLREAEE  102

Query  426  EYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            E+G++  G L  PCEV  F  +L+ +E   D
Sbjct  103  EFGFQQAGVLRIPCEVAVFESILKLVEEKKD  133



>ref|XP_010474488.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=131

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -2

Query  564  KRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPC  385
            KR  V ++ P G + V VGEEK+RF++  E +NHP+F GLL  +  EYGY   G L  PC
Sbjct  35   KRATVDSSVPSGHVPVNVGEEKERFVVSAELLNHPVFVGLLNRSAQEYGYAQKGVLHIPC  94

Query  384  EVDHFLQVLREMESSDDDD  328
             V  F QV+  + S   DD
Sbjct  95   NVFVFEQVVESLRSGVADD  113



>gb|EMT16846.1| hypothetical protein F775_03778 [Aegilops tauschii]
Length=129

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = -2

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG  +QRF+++TE VNHPLFR LL+EAE  +GY   GPL  PC  + F  VL 
Sbjct  34   EGCFSVYVGAGRQRFVVRTECVNHPLFRALLKEAEEVFGYADAGPLELPCNAEAFAGVLE  93

Query  354  EMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLL  244
            ++E         +++  GR C    AR +   SY LL
Sbjct  94   QIEEE-------KQMAGGRRC--GLARGK---SYRLL  118



>ref|XP_004309365.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like, partial 
[Fragaria vesca subsp. vesca]
Length=119

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 69/119 (58%), Gaps = 13/119 (11%)
 Frame = -2

Query  687  KTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAA--PEGWLWVC  514
            K  ++ KS+GG G+ ++            +SH   ++  S+ + G   +   P G+L V 
Sbjct  11   KLAKKVKSVGGTGRVVD-----------PYSHHECLLRDSDVQGGNSPSTKTPTGFLAVY  59

Query  513  VGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            VGEE+QRF++ T  ++HPLF+ LLE+A +E+G++    L+ PC V  F +V+  +E S+
Sbjct  60   VGEERQRFVVPTSFLSHPLFKMLLEKAYNEFGFQQRNGLVVPCSVSAFEEVVNAVECSN  118



>ref|XP_008783079.1| PREDICTED: auxin-induced protein 6B-like [Phoenix dactylifera]
Length=148

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 5/96 (5%)
 Frame = -2

Query  606  KSWSHGLRIMERS-----EKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLL  442
            KS S  ++ ++R+          +    P+G+L VCVGEE QRF+I TE++ H  F  LL
Sbjct  30   KSNSKSIKFLKRTLSFSDTSYSALSGDVPKGYLAVCVGEEMQRFVIPTEYLGHRAFAVLL  89

Query  441  EEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
             EAE E+G++ +G L  PCEV  F  +L+ +E + +
Sbjct  90   REAEEEFGFQQEGVLRIPCEVSAFESILKVVEKNKE  125



>gb|EMT16842.1| hypothetical protein F775_18859 [Aegilops tauschii]
Length=129

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG +KQR++++TE +NHPLF+ LLEEAE  +GY   GPL  PC  + F +VL 
Sbjct  34   EGCFSVYVGADKQRYVVRTECLNHPLFQALLEEAEEAFGYADAGPLELPCNTEAFTKVLE  93

Query  354  EME  346
            ++E
Sbjct  94   KIE  96



>ref|XP_010259870.1| PREDICTED: uncharacterized protein LOC104599158 [Nelumbo nucifera]
Length=169

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 62/110 (56%), Gaps = 2/110 (2%)
 Frame = -2

Query  609  SKSWSHGLRIMERSEKRMGV--GAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEE  436
            SKS     + +  SE  M    G   P+G+L VCVGEE +RF+I TE+++H  F  LL E
Sbjct  44   SKSIKFLKKTLSFSEISMSALSGDTVPKGYLAVCVGEEMKRFIIPTEYLSHRAFGILLRE  103

Query  435  AESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSS  286
            AE E+G++ +G L  PCEV  F ++L+ ++   +     E    G  CSS
Sbjct  104  AEEEFGFQQEGVLRIPCEVAVFEKILKVVQEKKEALFINEYGFGGESCSS  153



>gb|EMS53831.1| hypothetical protein TRIUR3_00762 [Triticum urartu]
Length=173

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG  KQRF+++TE VNHPLFR LLEEAE  +GY   GPL  PC  + F +VL+
Sbjct  35   EGCFSVYVGAGKQRFVVRTECVNHPLFRALLEEAEEVFGYADAGPLELPCNAEAFARVLQ  94

Query  354  EME  346
            +++
Sbjct  95   QIK  97



>gb|EMT16845.1| hypothetical protein F775_03777 [Aegilops tauschii]
Length=165

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG  +QRF+++TE VNHPLFR LLEEAE  +GY   GPL  PC  + F  VL+
Sbjct  35   EGCFSVYVGAGRQRFVVRTECVNHPLFRALLEEAEEVFGYADAGPLELPCNTEAFAGVLQ  94

Query  354  EME  346
            ++E
Sbjct  95   QIE  97



>ref|XP_004147834.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus]
 ref|XP_004166942.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus]
Length=150

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
             GLGK  K+ H  + R M  + W +  R+   S  R  + +  P G + VCVG   +RF+
Sbjct  3    AGLGKCSKIRHIVRLRQMLRR-WRNKARM---SANR--IPSDVPAGHVAVCVGTSSRRFV  56

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDD  328
            ++  ++NHP+F+ LL +AE EYG+ + GPL  PC+   F +V+R +  S+  +
Sbjct  57   VRATYLNHPVFKKLLVQAEEEYGFTNQGPLAIPCDESVFEEVIRFISRSESPN  109



>ref|XP_010263287.1| PREDICTED: uncharacterized protein LOC104601591 [Nelumbo nucifera]
Length=174

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 65/118 (55%), Gaps = 2/118 (2%)
 Frame = -2

Query  609  SKSWSHGLRIMERSEKRMGV--GAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEE  436
            SKS     + +  SE  +    G   P+G+L VCVGEE +RF+I TE+++H  F  LL E
Sbjct  49   SKSIKFLKKTLSFSESSLSTLSGDTVPKGFLAVCVGEEMKRFIIPTEYLSHRAFGILLRE  108

Query  435  AESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNH  262
            AE E+G++ +G L  PCEV  F ++L+ ++   +     E    G  CSS     ++H
Sbjct  109  AEEEFGFQQEGVLRIPCEVSVFEKILKVVQDKKEVFFINEHGFGGESCSSEADLAQSH  166



>ref|XP_008243661.1| PREDICTED: auxin-induced protein X10A [Prunus mume]
Length=129

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 12/117 (10%)
 Frame = -2

Query  687  KTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVG  508
            K  ++ K +GG  +  +H C             LR    +E+        P G+L + VG
Sbjct  11   KLAKKVKVMGGANEPSHHECL------------LRESSAAEQGGSPSTKPPTGFLALYVG  58

Query  507  EEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            EE+QRFL++T  ++HPLF+ LLE+A +EYG+     L+ PC V  F +V+  +E S+
Sbjct  59   EERQRFLVRTSFLSHPLFKMLLEKAYNEYGFEQRNGLVVPCSVSAFEEVVNAVECSN  115



>ref|XP_006414980.1| hypothetical protein EUTSA_v10026472mg [Eutrema salsugineum]
 gb|ESQ56433.1| hypothetical protein EUTSA_v10026472mg [Eutrema salsugineum]
Length=153

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 60/104 (58%), Gaps = 6/104 (6%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
            GGLGK  K+ H  + R M  + W +  R+   S     V +  P G + VCVG + +RF+
Sbjct  3    GGLGKCSKIRHIVRLRQMLRR-WRNKARLSSVSR---CVPSDVPSGHVAVCVGSDCRRFV  58

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            ++  ++NHP+   LL +AE EYG+ + GPL+ PCE   F + +R
Sbjct  59   VRASYLNHPILSNLLVQAEEEYGFANQGPLVIPCEESVFEEAIR  102



>ref|XP_009418176.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=122

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 3/93 (3%)
 Frame = -2

Query  597  SHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYG  418
            S  +R ++R+   + +    P+G   VCVG+E QRF+I TE ++H  F  LL EAE EYG
Sbjct  33   SKSIRFLKRA---LSLSGYIPKGCFVVCVGQEMQRFVIPTECLSHTAFAVLLREAEEEYG  89

Query  417  YRSDGPLIFPCEVDHFLQVLREMESSDDDDPTC  319
            +  +G L  PCEV  F  +L+ +E + +    C
Sbjct  90   FEQEGVLRIPCEVSVFRSILKMVEKTKEGIYYC  122



>gb|EAY84447.1| hypothetical protein OsI_05820 [Oryza sativa Indica Group]
Length=130

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = -2

Query  606  KSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAES  427
            K W       +  +   G GA+ P+G+  VCVGEE +RF+I TE++ H  F  LL +AE 
Sbjct  24   KRWKRAALAPKPGKNNNGGGASVPKGFFAVCVGEEMRRFVIPTEYLGHWAFEQLLRKAEE  83

Query  426  EYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTC  319
            E+G++ +G L  PC+V+ F  +LR     D+    C
Sbjct  84   EFGFQHEGALRIPCDVEVFEGILRLFGRKDEKAAMC  119



>ref|XP_008466498.1| PREDICTED: auxin-induced protein 6B [Cucumis melo]
Length=150

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
             GLGK  K+ H  + R M  + W +  R+   S  R  + +  P G + VCVG   +RF+
Sbjct  3    AGLGKCSKIRHIVRLRQMLRR-WRNKARM---SANR--IPSDVPAGHVAVCVGTSSRRFV  56

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDD  328
            ++  ++NHP+F+ LL +AE EYG+ + GPL  PC+   F +V+R +  S+  +
Sbjct  57   VRATYLNHPVFKKLLIQAEEEYGFTNQGPLAIPCDESVFEEVIRFISRSESPN  109



>ref|XP_010095665.1| hypothetical protein L484_012237 [Morus notabilis]
 gb|EXB61804.1| hypothetical protein L484_012237 [Morus notabilis]
Length=148

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 64/120 (53%), Gaps = 12/120 (10%)
 Frame = -2

Query  645  KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVN  466
            K+ H  + R M  + W    RI   + + +      P G L VCVG   +RF+++  ++N
Sbjct  11   KIRHIVRIRQMLQQ-WRRKARIA--ASRALPPPPDVPAGHLAVCVGSSSRRFIVRATYMN  67

Query  465  HPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFL-QVLREMESSDDDDPTCEKINNGRGC  292
            HP+F+ LL +AE EYG+ S +GPL  PC  + F  +VLR +  SD         N+GR C
Sbjct  68   HPMFKKLLVQAEEEYGFASYNGPLSIPCVDEAFFEEVLRVVSRSDSS-------NSGRFC  120



>ref|XP_010431642.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=131

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -2

Query  564  KRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPC  385
            KR  V ++ P G + V VGEEK+RF++  E +NHP+F GLL  +  EYGY   G L  PC
Sbjct  35   KRATVDSSVPSGHVPVNVGEEKERFVVSAELLNHPVFVGLLNRSAQEYGYAQKGVLHIPC  94

Query  384  EVDHFLQVLREMESSDDDDPT  322
             V  F QV+  + S   DD +
Sbjct  95   NVFVFEQVVESLRSGVVDDTS  115



>gb|AGQ56868.1| SAUR family protein 39 [Morus alba]
Length=148

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 64/120 (53%), Gaps = 12/120 (10%)
 Frame = -2

Query  645  KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVN  466
            K+ H  + R M  + W    RI   + + +      P G L VCVG   +RF+++  ++N
Sbjct  11   KIRHIVRLRQMLQQ-WRRKARIA--ASRALPPPPDVPAGHLAVCVGSSSRRFIVRATYMN  67

Query  465  HPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFL-QVLREMESSDDDDPTCEKINNGRGC  292
            HP+F+ LL +AE EYG+ S +GPL  PC  + F  +VLR +  SD         N+GR C
Sbjct  68   HPMFKKLLVQAEEEYGFASYNGPLSIPCVDEAFFEEVLRVVSRSDSS-------NSGRFC  120



>dbj|BAD13235.1| auxin-induced protein-like [Oryza sativa Japonica Group]
Length=154

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 0/96 (0%)
 Frame = -2

Query  606  KSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAES  427
            K W       +  +   G GA+ P+G+  VCVGEE +RF+I TE++ H  F  LL +AE 
Sbjct  24   KRWKRAALAPKAGKNNNGGGASVPKGFFAVCVGEEMRRFVIPTEYLGHWAFEQLLRKAEE  83

Query  426  EYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPTC  319
            E+G++ +G L  PC+V+ F  +LR +   D+    C
Sbjct  84   EFGFQHEGALRIPCDVEVFEGILRLVGRKDEKAAMC  119



>ref|XP_006850943.1| hypothetical protein AMTR_s00025p00192620 [Amborella trichopoda]
 gb|ERN12524.1| hypothetical protein AMTR_s00025p00192620 [Amborella trichopoda]
Length=162

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -2

Query  537  PEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVL  358
            P G+L V VG E+QRF+I  +++N P+FR +L+ A  EYG+  +G L+FPCEV  F Q+L
Sbjct  54   PAGYLAVYVGLERQRFVIPAKYINLPVFRPILQRAAEEYGFHFNGGLVFPCEVGFFKQLL  113

Query  357  REMESSD  337
              +E S+
Sbjct  114  LILEKSE  120



>ref|XP_006416459.1| hypothetical protein EUTSA_v10009868mg [Eutrema salsugineum]
 gb|ESQ34812.1| hypothetical protein EUTSA_v10009868mg [Eutrema salsugineum]
Length=153

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 60/104 (58%), Gaps = 6/104 (6%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
            GGLGK  K+ H  + R M  + W +  R+   S     V +  P G + VCVG + +RF+
Sbjct  3    GGLGKCSKIRHIVRLRQMLRR-WRNKARLSSVSR---CVPSDVPSGHVAVCVGSDCRRFV  58

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            ++  ++NHP+   LL +AE EYG+ + GPL+ PCE   F + +R
Sbjct  59   VRASYLNHPILSNLLVQAEEEYGFANQGPLVIPCEESVFEEAIR  102



>ref|XP_009375726.1| PREDICTED: uncharacterized protein LOC103964518 [Pyrus x bretschneideri]
Length=173

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = -2

Query  549  GAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
             AA P+G+L VCVGEE +RF+I T+++    F  LL EAE E+G++  G L  PCEV  F
Sbjct  74   NAAVPKGYLAVCVGEELKRFVIPTDYLGRSAFHILLREAEEEFGFQQTGVLRIPCEVSVF  133

Query  369  LQVLREMESSDDDDPTCEKINNGRGCSSS  283
              +L+ +E  +D D      N   GCSSS
Sbjct  134  EGILKMVE--EDKDMI---FNTMGGCSSS  157



>ref|XP_011047078.1| PREDICTED: auxin-induced protein 10A5-like [Populus euphratica]
Length=146

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 3/105 (3%)
 Frame = -2

Query  645  KLNHHCKFRMMKSKSWSHGLRIME--RSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEH  472
            K+ H  + + M  K W    R+     S +     +  P G + +CVG   +RF+++  +
Sbjct  6    KIRHIVRIQQML-KRWRRKARVTAGATSSRTAAAPSDVPVGHVAICVGASCKRFVVRATY  64

Query  471  VNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            +NHP+F+ LL EAE  YG+++ GPL  PC+   F +++R +  SD
Sbjct  65   LNHPIFKNLLVEAEEVYGFKNTGPLTIPCDEAVFEEIIRAVSISD  109



>ref|XP_007203531.1| hypothetical protein PRUPE_ppa026695mg [Prunus persica]
 gb|EMJ04730.1| hypothetical protein PRUPE_ppa026695mg [Prunus persica]
Length=129

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 12/117 (10%)
 Frame = -2

Query  687  KTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVG  508
            K  ++ K +GG  +  +H C             LR    +E+        P G+L + VG
Sbjct  11   KLAKKVKVMGGANEPSHHECL------------LRESAAAEQGGSPSTKPPTGFLALYVG  58

Query  507  EEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            EE+QRFL++T  ++HPLF+ LLE+A +EYG+     L+ PC V  F +V+  +E S+
Sbjct  59   EERQRFLVRTSFLSHPLFKMLLEKAYNEYGFEQRNGLVVPCSVSAFEEVVNAVECSN  115



>ref|XP_004498552.1| PREDICTED: uncharacterized protein LOC101505346 [Cicer arietinum]
Length=181

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = -2

Query  552  VGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDH  373
            +  A P+G+L VCVGEE +RF+I TE+++H  F+ LL EAE E+G++  G L  PCEV  
Sbjct  67   INNAVPKGYLAVCVGEELKRFIIPTEYLSHQAFQILLREAEEEFGFQQTGVLKIPCEVCV  126

Query  372  FLQVLREMESSDDDD  328
            F  +L+ +E    ++
Sbjct  127  FESILKMVEDQGKNN  141



>ref|XP_009337658.1| PREDICTED: uncharacterized protein LOC103930093 [Pyrus x bretschneideri]
Length=150

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 61/114 (54%), Gaps = 8/114 (7%)
 Frame = -2

Query  657  GLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLI  484
            GLGK  K+ H  + R +  +  S      +R      + +  P G + VCVG    RF++
Sbjct  4    GLGKCSKIRHIVRLRQLLRRGGSKACTSTKR------IPSDVPAGHVAVCVGTSCTRFVV  57

Query  483  KTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPT  322
            +  ++NHP+F+ LL +AE EYG+ + GPL  PC+   F +VLR +  S+    T
Sbjct  58   RASYLNHPVFKKLLVQAEEEYGFSNSGPLAIPCDESLFEEVLRFISRSESRKST  111



>ref|XP_004303544.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=132

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 69/119 (58%), Gaps = 13/119 (11%)
 Frame = -2

Query  687  KTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAA--PEGWLWVC  514
            K  ++ KS+GG G+ ++            +SH   ++  S+ + G   +   P G+L V 
Sbjct  11   KLAKKVKSVGGTGRVVD-----------PYSHHECLLRDSDVQGGNSPSTKTPTGFLAVY  59

Query  513  VGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            VGEE+QRF++ T  ++HPLF+ LLE+A +E+G++    L+ PC V  F +V+  +E S+
Sbjct  60   VGEERQRFVVPTSFLSHPLFKMLLEKAYNEFGFQQRNGLVVPCSVSAFEEVVNAVECSN  118



>gb|EMS53829.1| hypothetical protein TRIUR3_00760 [Triticum urartu]
Length=130

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG  +QRF+++ E +NHPLFR LLEEAE  +GY   GPL  PC  + F +VL 
Sbjct  35   EGCFSVYVGAGRQRFVVRMECLNHPLFRALLEEAEEAFGYADSGPLELPCNTEAFTKVLE  94

Query  354  EME  346
            ++E
Sbjct  95   KIE  97



>gb|EMT06448.1| hypothetical protein F775_14394 [Aegilops tauschii]
Length=123

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  534  EGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            EG   V VG ++QR++++TE +NHPLF+ LLEEAE  +GY   GPL  PC  + F +VL 
Sbjct  34   EGCFSVYVGADRQRYVVRTECLNHPLFQALLEEAEEAFGYADAGPLELPCNTEAFAKVLE  93

Query  354  EME  346
            ++E
Sbjct  94   KIE  96



>ref|XP_002446314.1| hypothetical protein SORBIDRAFT_06g014230 [Sorghum bicolor]
 gb|EES10642.1| hypothetical protein SORBIDRAFT_06g014230 [Sorghum bicolor]
Length=172

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 30/119 (25%)
 Frame = -2

Query  696  LIIKTWERCKSLGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWV  517
             + KT ERC SLGG                              +R       P G   V
Sbjct  25   FLAKTLERCWSLGG----------------------------GRRRPRWPTTTPPGCFVV  56

Query  516  CVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDG--PLIFPCEVDHFLQVLREME  346
             VG E++RF ++ E  NHPLFR LL+EAE+EYG+      PL+ PC  D FL+V+ E+E
Sbjct  57   LVGPERERFAVRAEGANHPLFRALLDEAEAEYGFPRPAAEPLLLPCAADEFLRVMSEVE  115



>ref|XP_008804009.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Phoenix 
dactylifera]
Length=161

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 9/106 (8%)
 Frame = -2

Query  657  GLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLI  484
            G+ K  K+ H  + R M  + W      M  +    G  A  P G + VCVG   +RF++
Sbjct  6    GMAKCSKIRHIVRLRQMLRR-WR-----MRAASASRGAPADVPAGHVAVCVGSSSRRFVV  59

Query  483  KTEHVNHPLFRGLLEEAESEYGYRS-DGPLIFPCEVDHFLQVLREM  349
            +  H+NHP+FR LL +AE EYG+ S  GPL  PC+   F  +LR +
Sbjct  60   RAAHLNHPVFRQLLRQAEEEYGFSSRPGPLALPCDESFFEHILRHL  105



>ref|XP_008466269.1| PREDICTED: uncharacterized protein LOC103503729 [Cucumis melo]
Length=170

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -2

Query  549  GAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
            G A P+G+L V VGEE++RF+I T ++ HP F  LL EAE E+G++  G L  PCEV  F
Sbjct  65   GGAVPKGYLAVSVGEEQKRFVIPTSYLGHPAFEILLREAEEEFGFQQTGVLRLPCEVFVF  124

Query  369  LQVLREMESSDDDD  328
              V++ +E     D
Sbjct  125  ENVVKLVEEKKKGD  138



>ref|XP_004242870.1| PREDICTED: uncharacterized protein LOC101250316 [Solanum lycopersicum]
Length=159

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
             P G L V VG E+ RF+I T  +N P+F  LL++AE E+GY+  G L+ PCEVD+F ++
Sbjct  56   TPSGSLAVYVGPERTRFVIPTRFLNLPVFISLLDKAEEEFGYQRTGGLVLPCEVDYFSEI  115

Query  360  LREMESSDD  334
            LR +   +D
Sbjct  116  LRLLNRDED  124



>ref|XP_006450104.1| hypothetical protein CICLE_v10010302mg [Citrus clementina]
 gb|ESR63344.1| hypothetical protein CICLE_v10010302mg [Citrus clementina]
 gb|KDO67187.1| hypothetical protein CISIN_1g048575mg [Citrus sinensis]
Length=172

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 4/99 (4%)
 Frame = -2

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
            +  P+G+L VCVGEE +RF+I T++++H  F  LL EAE E+G++  G L  PCEV  F 
Sbjct  66   STVPKGYLAVCVGEELKRFIIPTDYLSHQAFHILLREAEEEFGFQQTGVLRIPCEVAVFE  125

Query  366  QVLREMESSDDD--DPTCE-KINNGRG-CSSSFARNRNH  262
             +L+ +E   D      C   I++ +G CSS + +  +H
Sbjct  126  SILKMVEQKKDTFFMQDCRFNIDDTKGYCSSEYQQTPSH  164



>ref|XP_010913783.1| PREDICTED: auxin-induced protein 6B-like [Elaeis guineensis]
Length=148

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 57/92 (62%), Gaps = 5/92 (5%)
 Frame = -2

Query  606  KSWSHGLRIMERSEKRMGVGAA-----APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLL  442
            KS S  ++ ++R+       +A      P+G+L VCVGEE QRF+I T++++H  F  LL
Sbjct  30   KSNSKSIKFLKRTLSFSDTSSALSGDHVPKGYLAVCVGEEMQRFVIPTQYLSHRAFAVLL  89

Query  441  EEAESEYGYRSDGPLIFPCEVDHFLQVLREME  346
             EAE E+G++ +G L  PCEV  F  +L+ +E
Sbjct  90   REAEEEFGFQQEGVLRIPCEVSVFESILKVVE  121



>gb|KDP36945.1| hypothetical protein JCGZ_08236 [Jatropha curcas]
Length=150

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 64/113 (57%), Gaps = 8/113 (7%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
             G GK  K+ H  + R M  + W +  R+   S  R  + +  P G + VCVG   +RF+
Sbjct  3    AGFGKCSKIRHIVRLRQMLRR-WRNKARM---SANR--IPSDVPAGHVAVCVGTTGRRFV  56

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDD  328
            ++  ++NHP+F+ LL +AE EYG+ + GPL  PC+   F +VLR +  S+  +
Sbjct  57   VRATYLNHPVFKKLLVQAEEEYGFSNQGPLAIPCDETVFEEVLRYISRSESGN  109



>ref|XP_002313749.1| hypothetical protein POPTR_0009s12880g [Populus trichocarpa]
 gb|EEE87704.1| hypothetical protein POPTR_0009s12880g [Populus trichocarpa]
Length=146

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 3/105 (3%)
 Frame = -2

Query  645  KLNHHCKFRMMKSKSWSHGLRIME--RSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEH  472
            K+ H  + + M  K W    R+     S +     +  P G + +CVG   +RF+++  +
Sbjct  6    KIRHIVRIQQML-KRWRRKARVTAGATSSRTAAAPSDVPVGHVAICVGASCKRFVVRATY  64

Query  471  VNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            +NHP+F+ LL EAE  YG+++ GPL  PC+   F +++R +  SD
Sbjct  65   LNHPIFKNLLVEAEEVYGFKNTGPLTIPCDEAVFEEIIRVVSISD  109



>ref|XP_009630044.1| PREDICTED: uncharacterized protein LOC104120067 [Nicotiana tomentosiformis]
Length=165

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
             P G L V VG E+ RF+I T  +N P+F  LL++AE E+GY+S G L+ PCEVD+F ++
Sbjct  54   TPSGSLAVYVGPERLRFVIPTRFLNLPVFISLLDKAEEEFGYQSTGGLVLPCEVDYFSEI  113

Query  360  LREME  346
            LR ++
Sbjct  114  LRLLD  118



>ref|XP_010498406.1| PREDICTED: uncharacterized protein LOC104776100 [Camelina sativa]
Length=157

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
            GGL K  K+ H  + R M  + W +  R+   S     V +  P G + VCVG + +RF+
Sbjct  4    GGLVKCSKIRHIVRLRQMLRR-WRNKARL---SSVTRCVPSDVPSGHVAVCVGNDCRRFV  59

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDD  331
            ++  ++NHP+   LL +AE E+G+ + GPL+ PCE   F + +R +  SD  
Sbjct  60   VRASYLNHPILSNLLVQAEEEFGFANQGPLVIPCEESVFEEAIRFISRSDSS  111



>ref|XP_006435148.1| hypothetical protein CICLE_v10003150mg [Citrus clementina]
 gb|ESR48388.1| hypothetical protein CICLE_v10003150mg [Citrus clementina]
Length=150

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = -2

Query  657  GLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLI  484
            G GK  K+ H  + R M  + W +  R+   S  R  + +  P G++ VCVG   +RF++
Sbjct  4    GFGKCSKIRHIVRLRQMLRR-WRNKARM---SAAR--IPSDVPAGYVAVCVGTSCRRFVV  57

Query  483  KTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            +T ++NHP+F+ LL +AE EYG+ + GPL  PC+   F + +R +  S+ 
Sbjct  58   RTTYLNHPVFKKLLVQAEEEYGFTNQGPLAIPCDESLFEEAIRFISRSES  107



>ref|XP_008361160.1| PREDICTED: uncharacterized protein LOC103424846 [Malus domestica]
 ref|XP_008367703.1| PREDICTED: uncharacterized protein LOC103431331 [Malus domestica]
Length=172

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -2

Query  549  GAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHF  370
             AA P+G+L VCVGEE +RF+I T+++  P F  LL EAE E+G++  G L  PCEV  F
Sbjct  71   NAAVPKGYLAVCVGEELKRFVIPTDYLGGPAFHILLREAEEEFGFQQTGVLRIPCEVSVF  130

Query  369  LQVLREMESSDD  334
              +L+ +E   D
Sbjct  131  EGILKMVEEDKD  142



>gb|ADE76442.1| unknown [Picea sitchensis]
Length=177

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
             PEG+L V VG E++RF+I T++++ P+FR LL+ AE E+G+   G L  PCEV+ F QV
Sbjct  65   VPEGYLAVYVGRERRRFIIPTDYLSRPVFRTLLDRAEEEFGFDHQGGLTIPCEVNVFKQV  124

Query  360  LREMESSD  337
            LR +  +D
Sbjct  125  LRVLGRND  132



>emb|CDX68733.1| BnaC01g07200D [Brassica napus]
Length=188

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = -2

Query  609  SKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAE  430
            S S S G++ ++R+     V  A P+G+L V VG+E++R+ I T++++H  F  LL EAE
Sbjct  57   SGSASKGIKFLKRTLSFTDV-TAVPKGYLAVSVGKEEKRYKIPTDYLSHQAFHALLREAE  115

Query  429  SEYGYRSDGPLIFPCEVDHFLQVLREMESSDDD  331
             E+G++  G L  PCEV  F  +L+ ME +  D
Sbjct  116  EEFGFQQAGVLKIPCEVAVFESILKIMEDNKAD  148



>ref|XP_002510511.1| Auxin-induced protein 6B, putative [Ricinus communis]
 gb|EEF52698.1| Auxin-induced protein 6B, putative [Ricinus communis]
Length=151

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 6/114 (5%)
 Frame = -2

Query  663  LGGLGKKLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLI  484
            + G   K+ H  + R M  + W +  RI   S  R  + +  P G + VCVG   +RF++
Sbjct  4    MMGKCSKIRHIVRLRQMLRR-WRNKARI---SANR--IPSDVPAGHVAVCVGSSCRRFVV  57

Query  483  KTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDDPT  322
            +  ++NHP+F+ LL +AE EYG+ + GPL+ PC+   F +V+  +  S+  + T
Sbjct  58   RATYLNHPVFKKLLMQAEEEYGFSNQGPLVIPCDETVFEEVINYISRSESGNST  111



>ref|XP_010928766.1| PREDICTED: auxin-induced protein 6B-like [Elaeis guineensis]
Length=147

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
             P+G+L VCVGEE QRF+I TE++ H  F  LL EAE E+G++ +G L  PCEV  F  +
Sbjct  56   VPKGYLAVCVGEEMQRFVIPTEYLGHRAFAVLLREAEEEFGFQQEGVLRIPCEVSVFESI  115

Query  360  LREMESSDDDDPTC  319
            L+ +E + +    C
Sbjct  116  LKVVEKNKEGVCYC  129



>gb|KGN60020.1| hypothetical protein Csa_3G866530 [Cucumis sativus]
Length=200

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
             GLGK  K+ H  + R M  + W +  R+   S  R  + +  P G + VCVG   +RF+
Sbjct  3    AGLGKCSKIRHIVRLRQMLRR-WRNKARM---SANR--IPSDVPAGHVAVCVGTSSRRFV  56

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDDD  328
            ++  ++NHP+F+ LL +AE EYG+ + GPL  PC+   F +V+R +  S+  +
Sbjct  57   VRATYLNHPVFKKLLVQAEEEYGFTNQGPLAIPCDESVFEEVIRFISRSESPN  109



>ref|XP_007041996.1| F10A5.20, putative [Theobroma cacao]
 gb|EOX97827.1| F10A5.20, putative [Theobroma cacao]
Length=160

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 59/105 (56%), Gaps = 5/105 (5%)
 Frame = -2

Query  657  GLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAA--PEGWLWVCVGEEKQRF  490
            G+GK  K+ H  + R+M  K W    RI   S       A +  P G + VCVG   +R+
Sbjct  4    GMGKCQKIRHIVRIRLML-KQWRRKARITASSSNNNNGRAPSDVPAGHVAVCVGTSLRRY  62

Query  489  LIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLR  355
            +++  ++NHP+F+ LL + E EYG+ + GPL  PC+   F ++LR
Sbjct  63   IVRATYLNHPIFKKLLVQTEEEYGFNNVGPLTIPCDESFFEEILR  107



>ref|XP_007160682.1| hypothetical protein PHAVU_001G008100g [Phaseolus vulgaris]
 gb|ESW32676.1| hypothetical protein PHAVU_001G008100g [Phaseolus vulgaris]
Length=149

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = -2

Query  573  RSEKRMG---VGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDG  403
            R++ RM    + +  P G + VCVG    RF+++  ++NHP+F+ LL +AE EYG+ + G
Sbjct  22   RNKARMSANRIPSDVPAGHVAVCVGTNLTRFVVRATYLNHPVFKKLLLQAEEEYGFSNPG  81

Query  402  PLIFPCEVDHFLQVLREMESSDDDDPT  322
            PL+ PC+   F +VLR +  S+ + P 
Sbjct  82   PLVIPCDETLFHEVLRFISWSESEKPN  108



>ref|XP_008358422.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
 ref|XP_008365899.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=146

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 56/91 (62%), Gaps = 5/91 (5%)
 Frame = -2

Query  585  RIMERSEKRMGVGAA-----APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEY  421
            ++++R  K+  + AA      P G + VCVG   +RF+++  ++NHP+F+ LL EAE EY
Sbjct  19   QMLQRWHKKARLTAARAPSDVPSGHVAVCVGSNCKRFIVRATYLNHPIFQKLLVEAEEEY  78

Query  420  GYRSDGPLIFPCEVDHFLQVLREMESSDDDD  328
            G+ + GPL  PC+   F +VLR +  S+  +
Sbjct  79   GFANQGPLAIPCDESFFEEVLRVLARSESGN  109



>ref|XP_009347330.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=146

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = -2

Query  585  RIMERSEKRMGVGAAA-----PEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEY  421
            ++++R  K+  + AA+     P G + VCVG   +RF+++  ++NHP+F+ LL EAE EY
Sbjct  19   QMLQRWHKKARLTAASAPSDVPSGHVAVCVGSSCKRFIVRATYLNHPIFQKLLVEAEEEY  78

Query  420  GYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            G+ + GPL  PC+   F +VLR +  S+ 
Sbjct  79   GFANQGPLAIPCDESFFEEVLRVLARSES  107



>ref|XP_004517301.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cicer 
arietinum]
Length=142

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = -2

Query  540  APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQV  361
             PEG + VCVG   +RF+++  ++NHP+F+ LL +AE EYG+R+ GPL  PC+   F ++
Sbjct  35   VPEGHVAVCVGPSMKRFIVRASYLNHPIFKKLLMQAEEEYGFRNHGPLAIPCDEFLFEEL  94

Query  360  LREMESSDDDDPTCEKIN-----NGRGCSSSF  280
            LR M   +    T E +      + R  +++F
Sbjct  95   LRVMARPEPRLYTLEDLKRRCHVDVRNSTTTF  126



>ref|XP_008781914.1| PREDICTED: auxin-induced protein 6B-like [Phoenix dactylifera]
Length=147

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -2

Query  609  SKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAE  430
            SKS     R +  S+    +    P+G+L VCVGEE QRF+I TE+++   F  LL EAE
Sbjct  33   SKSIKFLKRTLSFSDASSALSGDVPKGYLAVCVGEEMQRFVIPTEYLSRRAFAVLLREAE  92

Query  429  SEYGYRSDGPLIFPCEVDHFLQVLR  355
             E+G++ +G L  PCEV  F  +L+
Sbjct  93   EEFGFQQEGVLRIPCEVSVFESILK  117



>ref|XP_010462797.1| PREDICTED: uncharacterized protein LOC104743408 [Camelina sativa]
Length=157

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
 Frame = -2

Query  660  GGLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFL  487
            GGL K  K+ H  + R M  + W +  R+   S     V +  P G + VCVG + +RF+
Sbjct  3    GGLVKCSKIRHIVRLRQMLRR-WRNKARLSSVSR---CVPSDVPSGHVAVCVGIDCRRFV  58

Query  486  IKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSDDD  331
            ++  ++NHP+   LL +AE E+G+ + GPL+ PCE   F + +R +  SD  
Sbjct  59   VRASYLNHPILSNLLVQAEEEFGFANQGPLVIPCEESVFEEAIRFISRSDSS  110



>ref|XP_009379214.1| PREDICTED: uncharacterized protein LOC103967662 [Pyrus x bretschneideri]
Length=186

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -2

Query  585  RIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSD  406
            R +  S+         P+G+L +CVG+E +RF++ TE++ H  FR LL+EAE E+G++ +
Sbjct  65   RTLSFSDVSTAQNVIVPKGFLAMCVGKELKRFVVPTEYLGHQAFRILLQEAEEEFGFQQE  124

Query  405  GPLIFPCEVDHFLQVLREME  346
            G L  PCEV  F ++L+ +E
Sbjct  125  GVLKIPCEVSVFEKILKMVE  144



>ref|XP_010648451.1| PREDICTED: uncharacterized protein LOC100250771 [Vitis vinifera]
Length=162

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 64/116 (55%), Gaps = 10/116 (9%)
 Frame = -2

Query  585  RIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSD  406
            R +  SEK        P+G+L VCVGEE +RF+I T++++H  F  LL EAE E+G++  
Sbjct  54   RTLSLSEK----SDVVPKGYLAVCVGEELKRFVIPTKYLSHQAFIILLREAEEEFGFQQA  109

Query  405  GPLIFPCEVDHFLQVLREMESSDDDDPTCEKINNGRGCSSSFARNRNHTSYHLLTP  238
            G L  PCEV  F  +L+ +E  D          +  GC SS   ++ + SYH  +P
Sbjct  110  GVLQIPCEVSAFENILKVVEKKDFRFLG----EDAIGCCSS--ESQLNQSYHPQSP  159



>emb|CDY62584.1| BnaA08g31240D [Brassica napus]
Length=146

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 61/109 (56%), Gaps = 6/109 (6%)
 Frame = -2

Query  657  GLGK--KLNHHCKFRMMKSKSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLI  484
            G+GK  K+ H  K R M  + W +  R+   S     V +  P G + VCVG   +RF++
Sbjct  4    GVGKCSKIRHIVKLRQMLRR-WRNKARLSSVSR---SVPSDVPSGHVAVCVGSGCRRFVV  59

Query  483  KTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFLQVLREMESSD  337
            +  ++NHP+   LL +AE EYG+ + GPL+ PCE   F + +R +  S+
Sbjct  60   RASYLNHPILSNLLVQAEEEYGFVNQGPLVIPCEESVFEEAIRFISRSN  108



>ref|XP_008219982.1| PREDICTED: uncharacterized protein LOC103320129 [Prunus mume]
Length=188

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -2

Query  546  AAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEYGYRSDGPLIFPCEVDHFL  367
            AA P+G+L VCVGEE +RF+I T+++  P F  LL EAE E+G+   G L  PCEV  F 
Sbjct  79   AAVPKGYLAVCVGEELKRFVIPTDYLGRPAFHILLREAEEEFGFHQTGVLRIPCEVSVFE  138

Query  366  QVLREMESSDD  334
             +L+ +E   D
Sbjct  139  DILKMVEEDRD  149



>ref|XP_009378468.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=146

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = -2

Query  585  RIMERSEKRMGVGAA-----APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEY  421
            ++++R  K+  + AA      P G + VCVG   +RF+++  ++NHP+F+ LL EAE EY
Sbjct  19   QMLQRWHKKARLTAARAPSDVPSGHVAVCVGSSCKRFIVRATYLNHPIFQKLLVEAEEEY  78

Query  420  GYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            G+ + GPL  PC+   F +VLR +  S+ 
Sbjct  79   GFANQGPLAIPCDESFFEEVLRVLARSES  107



>ref|XP_008342622.1| PREDICTED: uncharacterized protein LOC103405398 [Malus domestica]
Length=191

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = -2

Query  588  LRIMERSEKRMGVGAA----APEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAESEY  421
            ++  +R+     V AA     P+G+L +CVG+E +RF+I TE++ H  FR LL+EAE E+
Sbjct  64   MKFFKRTLSFTDVSAAQNDIVPKGFLAMCVGKELKRFIIPTEYLGHQAFRILLQEAEEEF  123

Query  420  GYRSDGPLIFPCEVDHFLQVLREME  346
            G++  G L  PCEV  F ++L+ +E
Sbjct  124  GFQQAGVLKIPCEVSVFEKILKMVE  148



>ref|XP_011006641.1| PREDICTED: uncharacterized protein LOC105112603 [Populus euphratica]
 ref|XP_011008683.1| PREDICTED: uncharacterized protein LOC105113999 [Populus euphratica]
Length=169

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = -2

Query  606  KSWSHGLRIMERSEKRMGVGAAAPEGWLWVCVGEEKQRFLIKTEHVNHPLFRGLLEEAES  427
            K     L I + S K      A P+G+L V VGEE++RF+I T++++HP F  LL EAE 
Sbjct  44   KFLKRTLSISDNSAKETS-SNAVPKGYLAVGVGEEQKRFIIPTDYLSHPAFLVLLREAEE  102

Query  426  EYGYRSDGPLIFPCEVDHFLQVLREMESSDD  334
            E+G++  G L  PCEV  F  +L+ +E   D
Sbjct  103  EFGFQQAGVLRIPCEVAVFESILKLVEEKKD  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2254357392324