BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7944_g1_i1 len=769 path=[1:0-768]

Length=769
                                                                      Score     E

ref|XP_009801176.1|  PREDICTED: cytochrome P450 CYP82D47-like           262   4e-80   
ref|XP_009616319.1|  PREDICTED: cytochrome P450 CYP82D47-like           261   6e-80   
gb|ABC69376.1|  CYP82M1v5                                               260   1e-79   Nicotiana tabacum [American tobacco]
gb|ABC69375.1|  CYP82M1v4                                               260   1e-79   Nicotiana tabacum [American tobacco]
gb|ABC69374.1|  CYP82M1v3                                               259   4e-79   Nicotiana tabacum [American tobacco]
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               259   6e-79   
gb|ABC69372.1|  CYP82M1v1                                               258   1e-78   Nicotiana tabacum [American tobacco]
gb|ABC69373.1|  CYP82M1v2                                               258   1e-78   Nicotiana tabacum [American tobacco]
ref|XP_011089652.1|  PREDICTED: cytochrome P450 82C2                    256   4e-78   
ref|XP_008372636.1|  PREDICTED: cytochrome P450 82C4-like               239   2e-75   
emb|CBI29742.3|  unnamed protein product                                237   4e-74   
ref|XP_010069626.1|  PREDICTED: cytochrome P450 CYP82D47-like           244   2e-73   
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           244   3e-73   
ref|XP_006339196.1|  PREDICTED: cytochrome P450 82C4-like               243   6e-73   
ref|XP_004249377.1|  PREDICTED: cytochrome P450 82C4-like               243   9e-73   
ref|XP_009348373.1|  PREDICTED: cytochrome P450 CYP82D47-like           243   1e-72   
ref|XP_006349946.1|  PREDICTED: cytochrome P450 82C2-like               240   8e-72   
gb|KDP26345.1|  hypothetical protein JCGZ_17503                         240   1e-71   
dbj|BAM36726.1|  nicotine N-demethylase                                 239   1e-71   
emb|CAN82329.1|  hypothetical protein VITISV_016031                     237   1e-71   Vitis vinifera
ref|XP_007200049.1|  hypothetical protein PRUPE_ppa023510mg             239   1e-71   
gb|KCW58034.1|  hypothetical protein EUGRSUZ_H00762                     239   2e-71   
dbj|BAM36725.1|  nicotine N-demethylase                                 239   2e-71   
emb|CAN77159.1|  hypothetical protein VITISV_019026                     241   2e-71   Vitis vinifera
ref|XP_009761500.1|  PREDICTED: cytochrome P450 82C2-like               240   2e-71   
emb|CBI25922.3|  unnamed protein product                                231   3e-71   
ref|XP_009758062.1|  PREDICTED: cytochrome P450 82C4-like               238   3e-71   
ref|XP_008372515.1|  PREDICTED: cytochrome P450 82C4-like               239   3e-71   
gb|KDP26343.1|  hypothetical protein JCGZ_17501                         233   3e-71   
emb|CAN64501.1|  hypothetical protein VITISV_020341                     236   4e-71   Vitis vinifera
dbj|BAM36727.1|  nicotine N-demethylase                                 238   5e-71   
ref|XP_009606611.1|  PREDICTED: cytochrome P450 82C4-like               239   5e-71   
gb|ABR57311.1|  cytochrome P450 monooxygenase                           237   8e-71   Nicotiana sylvestris
ref|XP_002531094.1|  cytochrome P450, putative                          238   8e-71   Ricinus communis
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                237   2e-70   Vitis vinifera
ref|XP_009757628.1|  PREDICTED: cytochrome P450 CYP82D47-like           236   2e-70   
gb|ADP65809.1|  nicotine N-demethylase                                  236   2e-70   
gb|ABA07807.1|  cytochrome P450 monooxygenase CYP82E3                   235   4e-70   Nicotiana tabacum [American tobacco]
ref|XP_009609537.1|  PREDICTED: cytochrome P450 82C4-like               235   4e-70   
ref|XP_010069622.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    234   6e-70   
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               235   6e-70   
ref|XP_010646216.1|  PREDICTED: cytochrome P450 82C2-like               233   6e-70   
ref|XP_008235430.1|  PREDICTED: cytochrome P450 CYP82D47-like           234   1e-69   
dbj|BAM36724.1|  nicotine N-demethylase                                 234   1e-69   
gb|KCW58033.1|  hypothetical protein EUGRSUZ_H00761                     234   1e-69   
dbj|BAM36723.1|  nicotine N-demethylase                                 234   2e-69   
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             234   2e-69   
ref|XP_008372514.1|  PREDICTED: cytochrome P450 CYP82D47-like           234   2e-69   
ref|XP_010104162.1|  Cytochrome P450 82C4                               233   3e-69   
gb|ABD39479.1|  CYP82E4v8                                               233   3e-69   Nicotiana tabacum [American tobacco]
ref|XP_010069621.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    234   4e-69   
gb|ABD39480.1|  CYP82E4v10                                              232   8e-69   Nicotiana tabacum [American tobacco]
gb|ABC69371.1|  CYP82E5                                                 232   1e-68   Nicotiana tabacum [American tobacco]
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               232   1e-68   
ref|XP_009619218.1|  PREDICTED: cytochrome P450 CYP82D47-like           231   1e-68   
gb|ABD39475.1|  CYP82E4v4                                               231   1e-68   Nicotiana tabacum [American tobacco]
gb|ABD39478.1|  CYP82E4v7                                               231   1e-68   Nicotiana tabacum [American tobacco]
gb|ABA07804.1|  cytochrome P450 monooxygenase CYP82E4v2                 231   1e-68   Nicotiana tabacum [American tobacco]
gb|ABX56037.1|  CYP82E5v2                                               231   1e-68   Nicotiana tabacum [American tobacco]
ref|XP_004248527.2|  PREDICTED: cytochrome P450 CYP82D47-like           231   1e-68   
gb|ABA07805.1|  cytochrome P450 monooxygenase CYP82E4v1                 231   1e-68   Nicotiana tabacum [American tobacco]
ref|XP_004236938.1|  PREDICTED: cytochrome P450 82C4-like               232   1e-68   
ref|XP_009609539.1|  PREDICTED: cytochrome P450 82C4-like               231   2e-68   
gb|ABD39481.1|  CYP82E4v11                                              231   2e-68   Nicotiana tabacum [American tobacco]
gb|ABD39483.1|  CYP82E2v2                                               231   2e-68   Nicotiana tabacum [American tobacco]
ref|XP_009768110.1|  PREDICTED: cytochrome P450 82A4-like               231   2e-68   
gb|ABA07806.2|  cytochrome P450 monooxygenase CYP82E2                   231   2e-68   Nicotiana tabacum [American tobacco]
gb|ABD39476.1|  CYP82E4v5                                               231   2e-68   Nicotiana tabacum [American tobacco]
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           231   2e-68   
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             230   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             231   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           230   4e-68   
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 230   5e-68   
ref|XP_011101555.1|  PREDICTED: cytochrome P450 CYP82D47-like           229   8e-68   
gb|ABD39485.1|  CYP82E2v4                                               229   1e-67   Nicotiana tabacum [American tobacco]
gb|ABD39474.1|  CYP82E4v3                                               229   1e-67   Nicotiana tabacum [American tobacco]
emb|CBI36493.3|  unnamed protein product                                224   1e-67   
emb|CAN65652.1|  hypothetical protein VITISV_016780                     228   1e-67   Vitis vinifera
ref|XP_011045174.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    229   1e-67   
ref|XP_011045172.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    229   2e-67   
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     228   2e-67   
gb|ABD39477.1|  CYP82E4v6                                               228   3e-67   Nicotiana tabacum [American tobacco]
gb|AGD93125.1|  CYP450 nicotine N-demethylase                           228   3e-67   
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                228   3e-67   Vitis vinifera
ref|XP_004292356.1|  PREDICTED: cytochrome P450 82C4-like               227   3e-67   
gb|KDP45300.1|  hypothetical protein JCGZ_15165                         226   5e-67   
emb|CBI36489.3|  unnamed protein product                                221   9e-67   
gb|KDP26346.1|  hypothetical protein JCGZ_17504                         226   1e-66   
gb|ABD39484.1|  CYP82E2v3                                               226   2e-66   Nicotiana tabacum [American tobacco]
ref|XP_006384482.1|  hypothetical protein POPTR_0004s15470g             221   2e-66   
gb|ABD39482.1|  CYP82E4v12                                              226   2e-66   Nicotiana tabacum [American tobacco]
emb|CDP15065.1|  unnamed protein product                                226   3e-66   
ref|XP_009778755.1|  PREDICTED: cytochrome P450 82C4-like               224   6e-66   
ref|XP_009595933.1|  PREDICTED: cytochrome P450 82A4-like               224   1e-65   
ref|XP_009627979.1|  PREDICTED: cytochrome P450 82C4-like               224   1e-65   
ref|XP_002264473.1|  PREDICTED: cytochrome P450 82C4-like               224   1e-65   Vitis vinifera
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               224   2e-65   
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             223   2e-65   
ref|XP_010106089.1|  Cytochrome P450 82C4                               223   4e-65   
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                222   5e-65   Vitis vinifera
gb|KHG01223.1|  Cytochrome P450 protein                                 222   8e-65   
ref|XP_009782771.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    216   9e-65   
gb|KDO38290.1|  hypothetical protein CISIN_1g0485651mg                  215   1e-64   
emb|CAN61061.1|  hypothetical protein VITISV_018742                     222   1e-64   Vitis vinifera
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             221   1e-64   
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             221   1e-64   
gb|KDO38173.1|  hypothetical protein CISIN_1g0106222mg                  211   1e-64   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   221   1e-64   
emb|CAN75482.1|  hypothetical protein VITISV_020998                     221   1e-64   Vitis vinifera
emb|CDP15067.1|  unnamed protein product                                220   2e-64   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               221   2e-64   
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             221   2e-64   
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               221   2e-64   
emb|CAN81014.1|  hypothetical protein VITISV_025152                     220   2e-64   Vitis vinifera
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               221   3e-64   
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           221   3e-64   Vitis vinifera
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               221   3e-64   
ref|XP_006347265.1|  PREDICTED: cytochrome P450 82C3-like isoform X1    212   3e-64   
ref|XP_006347266.1|  PREDICTED: cytochrome P450 82C3-like isoform X2    211   5e-64   
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    221   6e-64   
ref|XP_006479335.1|  PREDICTED: cytochrome P450 82G1-like               216   7e-64   
ref|XP_002264520.2|  PREDICTED: cytochrome P450 82C4                    220   8e-64   Vitis vinifera
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             219   8e-64   
emb|CAN63328.1|  hypothetical protein VITISV_012723                     210   9e-64   Vitis vinifera
gb|AJD25202.1|  cytochrome P450 CYP82U4                                 219   1e-63   
gb|KDO37196.1|  hypothetical protein CISIN_1g019564mg                   214   1e-63   
ref|XP_009770601.1|  PREDICTED: cytochrome P450 CYP82D47-like           219   1e-63   
ref|XP_009792748.1|  PREDICTED: cytochrome P450 CYP82D47-like           218   1e-63   
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    218   2e-63   
ref|XP_008343761.1|  PREDICTED: DNA mismatch repair protein MSH6-...    222   3e-63   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           218   4e-63   
gb|AAP49697.1|  cytochrome P-450-like protein                           210   4e-63   Vitis vinifera
gb|KEH18125.1|  cytochrome P450 family protein                          217   4e-63   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               216   5e-63   
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             217   5e-63   
ref|XP_008776071.1|  PREDICTED: cytochrome P450 82C4-like               208   5e-63   
dbj|BAA35080.1|  putative cytochrome P450                               217   6e-63   Nicotiana tabacum [American tobacco]
emb|CDY23316.1|  BnaA08g12300D                                          217   6e-63   
gb|AAS90126.1|  cytochrome P450                                         217   7e-63   Ammi majus [ameo mayor]
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    217   7e-63   Vitis vinifera
ref|XP_003548652.1|  PREDICTED: cytochrome P450 82C4-like               216   8e-63   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             216   8e-63   
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    216   8e-63   
gb|KHN03067.1|  Cytochrome P450 82G1                                    213   9e-63   
emb|CDY53704.1|  BnaC03g67210D                                          216   9e-63   
emb|CBI32517.3|  unnamed protein product                                210   1e-62   
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             215   1e-62   
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             216   1e-62   
ref|XP_010934114.1|  PREDICTED: cytochrome P450 82C4-like               216   1e-62   
ref|XP_007134137.1|  hypothetical protein PHAVU_010G022400g             216   2e-62   
ref|XP_002313829.2|  hypothetical protein POPTR_0009s11180g             213   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006428103.1|  hypothetical protein CICLE_v10026027mg             210   2e-62   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           215   2e-62   
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             215   2e-62   
ref|XP_002531093.1|  cytochrome P450, putative                          215   3e-62   Ricinus communis
gb|KFK29807.1|  hypothetical protein AALP_AA7G181700                    210   3e-62   
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   214   4e-62   
gb|KDP26347.1|  hypothetical protein JCGZ_17505                         214   5e-62   
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               214   5e-62   
gb|KEH25406.1|  cytochrome P450 family protein                          214   7e-62   
emb|CBI32508.3|  unnamed protein product                                209   7e-62   
ref|XP_004241385.1|  PREDICTED: cytochrome P450 82C2-like               214   7e-62   
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    214   9e-62   
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    214   1e-61   
gb|KDO36736.1|  hypothetical protein CISIN_1g026655mg                   205   1e-61   
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             213   1e-61   
emb|CAN72749.1|  hypothetical protein VITISV_004418                     206   1e-61   Vitis vinifera
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             213   1e-61   
ref|XP_006376421.1|  cytochrome P450 family protein                     213   1e-61   
ref|XP_006297447.1|  hypothetical protein CARUB_v10013469mg             207   1e-61   
ref|XP_006428104.1|  hypothetical protein CICLE_v10027210mg             209   2e-61   
ref|XP_007041358.1|  Cytochrome P450, putative                          212   2e-61   
ref|XP_002305292.2|  hypothetical protein POPTR_0004s10630g             213   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             213   2e-61   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   213   2e-61   
gb|AFK79026.1|  cytochrome P450 CYP82T1                                 213   3e-61   
gb|KDO44149.1|  hypothetical protein CISIN_1g037793mg                   203   3e-61   
emb|CBI36491.3|  unnamed protein product                                213   3e-61   
gb|ABC69420.1|  CYP82E8                                                 212   4e-61   Nicotiana tabacum [American tobacco]
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   212   5e-61   
ref|XP_003547786.2|  PREDICTED: cytochrome P450 82C2-like               212   5e-61   
ref|XP_004517185.1|  PREDICTED: cytochrome P450 82C4-like               212   5e-61   
ref|XP_002863089.1|  CYP82G1                                            210   6e-61   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   212   6e-61   Eschscholzia californica
ref|XP_006375028.1|  hypothetical protein POPTR_0014s03730g             206   8e-61   
gb|KHG07864.1|  Cytochrome P450 protein                                 211   9e-61   
ref|XP_011008137.1|  PREDICTED: cytochrome P450 82G1-like               211   9e-61   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   211   9e-61   
ref|XP_008382594.1|  PREDICTED: cytochrome P450 82G1-like               211   9e-61   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    211   9e-61   Vitis vinifera
ref|NP_189154.1|  cytochrome P450, family 82, subfamily G, polype...    211   9e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             209   1e-60   
emb|CBI32515.3|  unnamed protein product                                204   1e-60   
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             211   1e-60   
ref|XP_002885694.1|  CYP82G1                                            211   1e-60   
ref|XP_002531091.1|  cytochrome P450, putative                          203   1e-60   Ricinus communis
ref|XP_003548649.2|  PREDICTED: cytochrome P450 82C2-like               211   1e-60   
ref|XP_006428105.1|  hypothetical protein CICLE_v10027089mg             206   1e-60   
emb|CDY61596.1|  BnaC03g74240D                                          209   2e-60   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               210   2e-60   
gb|ABK55756.1|  P450 monooxygenase-like protein                         210   2e-60   Stylosanthes guianensis [stylo]
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                210   2e-60   
ref|XP_006838067.1|  hypothetical protein AMTR_s00091p00167660          203   2e-60   
emb|CBI32510.3|  unnamed protein product                                212   2e-60   
gb|KDP26344.1|  hypothetical protein JCGZ_17502                         210   3e-60   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     210   3e-60   Vitis vinifera
ref|XP_009372223.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    210   3e-60   
emb|CDY52276.1|  BnaA03g57690D                                          208   3e-60   
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                210   3e-60   Vitis vinifera
ref|XP_009372224.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    210   3e-60   
ref|XP_009372222.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    210   3e-60   
emb|CBI37514.3|  unnamed protein product                                216   3e-60   
ref|XP_007134139.1|  hypothetical protein PHAVU_010G022600g             209   4e-60   
emb|CDP00859.1|  unnamed protein product                                209   4e-60   
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               209   4e-60   
ref|XP_006375024.1|  hypothetical protein POPTR_0014s03690g             207   4e-60   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    209   5e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297448.1|  hypothetical protein CARUB_v10013469mg             207   5e-60   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               209   5e-60   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    209   6e-60   Vitis vinifera
ref|XP_008372516.1|  PREDICTED: cytochrome P450 82G1-like               209   6e-60   
ref|XP_009348372.1|  PREDICTED: cytochrome P450 82G1-like               209   6e-60   
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             209   7e-60   
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             209   7e-60   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               209   8e-60   
ref|XP_009136105.1|  PREDICTED: cytochrome P450 82G1                    208   8e-60   
gb|KDP45301.1|  hypothetical protein JCGZ_15166                         208   9e-60   
ref|XP_009372225.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    209   1e-59   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                209   2e-59   Vitis vinifera
ref|XP_002869304.1|  CYP82C4                                            207   2e-59   
gb|KFK29810.1|  hypothetical protein AALP_AA7G181800                    204   2e-59   
ref|XP_006297446.1|  hypothetical protein CARUB_v10013469mg             207   2e-59   
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               207   2e-59   
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           207   2e-59   
emb|CBI29738.3|  unnamed protein product                                211   2e-59   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                207   2e-59   
ref|XP_008382597.1|  PREDICTED: cytochrome P450 82G1-like               207   2e-59   
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               207   4e-59   
gb|KHN42045.1|  Cytochrome P450 82C4                                    205   4e-59   
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               207   4e-59   
gb|KDP46184.1|  hypothetical protein JCGZ_10024                         206   4e-59   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               206   5e-59   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               206   6e-59   
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               206   6e-59   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             207   7e-59   
ref|XP_010488628.1|  PREDICTED: cytochrome P450 82G1                    204   7e-59   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               206   7e-59   
ref|XP_002862854.1|  CYP82G1                                            205   7e-59   
ref|XP_004510285.1|  PREDICTED: uncharacterized protein LOC101505071    211   8e-59   
ref|XP_003611843.1|  Cytochrome P450 82A3                               197   9e-59   
ref|XP_010686300.1|  PREDICTED: cytochrome P450 CYP82D47-like           204   9e-59   
ref|XP_007049681.1|  Cytochrome P450                                    206   9e-59   
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           206   1e-58   
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               206   1e-58   
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               206   1e-58   
gb|AES94801.2|  cytochrome P450 family protein                          196   1e-58   
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    206   1e-58   
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             205   1e-58   
ref|XP_010513989.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    205   1e-58   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               205   1e-58   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    205   1e-58   
ref|XP_002510313.1|  cytochrome P450, putative                          205   1e-58   Ricinus communis
emb|CBI32505.3|  unnamed protein product                                211   1e-58   
ref|XP_008235427.1|  PREDICTED: cytochrome P450 82G1-like               206   1e-58   
ref|XP_002885686.1|  CYP82G1                                            205   1e-58   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           205   1e-58   
gb|KCW55291.1|  hypothetical protein EUGRSUZ_I01217                     199   2e-58   
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           205   2e-58   
ref|XP_002869302.1|  CYP82C4                                            205   2e-58   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            205   2e-58   
ref|XP_006355071.1|  PREDICTED: cytochrome P450 82C4-like               204   3e-58   
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               204   3e-58   
ref|XP_006431671.1|  hypothetical protein CICLE_v10002486mg             196   3e-58   
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    204   3e-58   
ref|XP_007017413.1|  Cytochrome P450                                    204   3e-58   
gb|KEH18124.1|  cytochrome P450 family 82 protein                       202   4e-58   
gb|KCW55290.1|  hypothetical protein EUGRSUZ_I01217                     200   4e-58   
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               204   4e-58   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               202   4e-58   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               204   4e-58   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             204   5e-58   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               204   5e-58   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             204   5e-58   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             204   6e-58   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    204   6e-58   
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           204   6e-58   
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             203   6e-58   
gb|ACU19971.1|  unknown                                                 193   8e-58   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    203   8e-58   
ref|XP_006856218.1|  hypothetical protein AMTR_s00059p00203770          203   8e-58   
ref|NP_194925.1|  cytochrome P450, family 82, subfamily C, polype...    203   9e-58   
gb|ABK28662.1|  unknown                                                 203   9e-58   
gb|KDP38424.1|  hypothetical protein JCGZ_04349                         203   9e-58   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               203   1e-57   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           203   1e-57   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           203   1e-57   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           202   1e-57   
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             202   1e-57   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     206   2e-57   
gb|KDO43360.1|  hypothetical protein CISIN_1g0369162mg                  194   2e-57   
ref|XP_002519131.1|  conserved hypothetical protein                     194   2e-57   
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             203   2e-57   
ref|XP_006856219.1|  hypothetical protein AMTR_s00059p00204120          202   2e-57   
gb|AJD25201.1|  cytochrome P450 CYP82D71                                202   2e-57   
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             202   2e-57   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           202   2e-57   
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               201   2e-57   
gb|KHN08850.1|  Cytochrome P450 82C4                                    200   2e-57   
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               202   3e-57   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               202   3e-57   
gb|KHN42044.1|  Cytochrome P450 82A3                                    202   3e-57   
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           202   4e-57   
ref|XP_010036785.1|  PREDICTED: cytochrome P450 82G1                    201   4e-57   
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    201   4e-57   
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           201   4e-57   
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         201   4e-57   
ref|XP_010091295.1|  Cytochrome P450 82G1                               202   5e-57   
ref|XP_006418652.1|  hypothetical protein EUTSA_v10002489mg             201   5e-57   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             201   5e-57   
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           202   5e-57   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               201   6e-57   
ref|XP_002510298.1|  cytochrome P450, putative                          201   6e-57   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             201   6e-57   
gb|AGO03797.1|  cytochrome P450-like protein                            201   6e-57   
gb|ABB20912.1|  P450 mono-oxygenase                                     201   7e-57   
ref|XP_010466938.1|  PREDICTED: cytochrome P450 82G1-like               201   7e-57   
emb|CBI19610.3|  unnamed protein product                                204   1e-56   
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           200   2e-56   
ref|XP_006431673.1|  hypothetical protein CICLE_v10003405mg             196   2e-56   
ref|XP_010686309.1|  PREDICTED: cytochrome P450 CYP82D47-like           199   2e-56   
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           199   2e-56   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           203   2e-56   
gb|KHN36186.1|  Cytochrome P450 82A3                                    199   2e-56   
ref|XP_008349629.1|  PREDICTED: cytochrome P450 82A3-like               191   2e-56   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    199   2e-56   
ref|XP_006346673.1|  PREDICTED: cytochrome P450 82C4-like               199   3e-56   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    199   4e-56   
emb|CDP15727.1|  unnamed protein product                                200   4e-56   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           199   4e-56   
ref|XP_002510297.1|  cytochrome P450, putative                          199   4e-56   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           199   4e-56   
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               199   4e-56   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             198   5e-56   
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    199   5e-56   
ref|XP_002510305.1|  cytochrome P450, putative                          199   5e-56   
ref|XP_010527268.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    198   5e-56   
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               198   5e-56   
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           199   6e-56   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    198   6e-56   
gb|KHN36187.1|  Cytochrome P450 82A3                                    198   6e-56   
ref|XP_010527265.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    198   7e-56   
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               198   7e-56   
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           198   7e-56   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           198   7e-56   
ref|XP_002510308.1|  cytochrome P450, putative                          198   8e-56   
ref|XP_010527266.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    198   8e-56   
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           198   8e-56   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       198   8e-56   
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             198   8e-56   
ref|NP_194923.1|  cytochrome P450, family 82, subfamily C, polype...    197   8e-56   
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           197   9e-56   
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     197   1e-55   
emb|CDP15728.1|  unnamed protein product                                197   1e-55   
ref|XP_006858796.1|  hypothetical protein AMTR_s00066p00165020          197   1e-55   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     197   1e-55   
ref|XP_004154827.1|  PREDICTED: cytochrome P450 82C4-like               191   1e-55   
gb|KDO42178.1|  hypothetical protein CISIN_1g043270mg                   191   1e-55   
ref|XP_002510311.1|  cytochrome P450, putative                          197   2e-55   
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           197   2e-55   
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               197   2e-55   
gb|KHG29587.1|  Cytochrome P450 protein                                 197   2e-55   
ref|XP_010527267.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    197   2e-55   
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               197   2e-55   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           197   2e-55   
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               196   3e-55   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           196   3e-55   
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     196   3e-55   
gb|KHG26594.1|  Cytochrome P450                                         196   3e-55   
ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               199   3e-55   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         196   4e-55   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           196   4e-55   
ref|XP_010036784.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    196   4e-55   
ref|XP_008349057.1|  PREDICTED: cytochrome P450 82G1-like               189   5e-55   
ref|XP_008454675.1|  PREDICTED: cytochrome P450 CYP82D47-like           193   5e-55   
ref|XP_010036783.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    196   5e-55   
ref|XP_010036782.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    196   5e-55   
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           196   5e-55   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           196   5e-55   
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     197   6e-55   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               196   6e-55   
ref|XP_010248151.1|  PREDICTED: cytochrome P450 82C4-like               194   7e-55   
ref|XP_008366282.1|  PREDICTED: cytochrome P450 82G1-like               187   8e-55   
ref|XP_010686299.1|  PREDICTED: cytochrome P450 CYP82D47-like           196   8e-55   
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               195   8e-55   
ref|XP_002863095.1|  CYP82G1                                            194   1e-54   
ref|XP_004154824.1|  PREDICTED: cytochrome P450 82C4-like isoform 1     188   1e-54   
ref|XP_006856215.1|  hypothetical protein AMTR_s00059p00202900          197   2e-54   
emb|CBI21487.3|  unnamed protein product                                196   2e-54   
ref|XP_004293232.1|  PREDICTED: cytochrome P450 82A3-like               193   2e-54   
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           194   2e-54   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               194   2e-54   
ref|XP_002862853.1|  predicted protein                                  186   2e-54   
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               194   2e-54   
gb|EYU23763.1|  hypothetical protein MIMGU_mgv1a023100mg                194   2e-54   
ref|XP_002883585.1|  CYP82G1                                            193   3e-54   
ref|XP_006856214.1|  hypothetical protein AMTR_s00059p00201650          193   3e-54   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           193   3e-54   
ref|XP_008372381.1|  PREDICTED: cytochrome P450 82G1-like               194   4e-54   
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           193   5e-54   
ref|XP_007158552.1|  hypothetical protein PHAVU_002G161900g             189   5e-54   
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               193   5e-54   
ref|XP_006830117.1|  hypothetical protein AMTR_s03564p00002300          193   6e-54   
ref|XP_002510301.1|  cytochrome P450, putative                          192   6e-54   
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   193   7e-54   
gb|AJD25200.1|  cytochrome P450 CYP82D70                                192   7e-54   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             193   7e-54   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           193   7e-54   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           193   8e-54   
ref|XP_007017411.1|  Cytochrome P450, putative                          192   8e-54   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         193   1e-53   
gb|KDP38433.1|  hypothetical protein JCGZ_04358                         191   1e-53   
ref|XP_011083776.1|  PREDICTED: cytochrome P450 CYP82D47-like           192   1e-53   
emb|CAN66023.1|  hypothetical protein VITISV_042713                     191   1e-53   
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           192   1e-53   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     192   1e-53   
ref|XP_008388074.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    186   1e-53   
ref|XP_006423131.1|  hypothetical protein CICLE_v10030381mg             190   1e-53   
gb|KHN04536.1|  Cytochrome P450 82A1                                    191   2e-53   
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     196   2e-53   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     192   2e-53   
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     191   2e-53   
emb|CAN82345.1|  hypothetical protein VITISV_023279                     189   2e-53   
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           192   2e-53   
gb|KDP38422.1|  hypothetical protein JCGZ_04347                         191   2e-53   
gb|KEH37856.1|  cytochrome P450 family protein                          191   2e-53   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               191   3e-53   
ref|XP_004308852.1|  PREDICTED: cytochrome P450 82A3-like               190   3e-53   
ref|XP_007151141.1|  hypothetical protein PHAVU_004G021200g             191   3e-53   
ref|XP_002883577.1|  predicted protein                                  183   3e-53   
ref|XP_002443439.1|  hypothetical protein SORBIDRAFT_08g019480          191   3e-53   
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           191   3e-53   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     191   3e-53   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               191   3e-53   
ref|XP_010686293.1|  PREDICTED: cytochrome P450 CYP82D47-like           191   3e-53   
gb|KDO37275.1|  hypothetical protein CISIN_1g012878mg                   189   4e-53   
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   190   4e-53   
gb|KDP38429.1|  hypothetical protein JCGZ_04354                         190   4e-53   
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               196   4e-53   
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   190   4e-53   
emb|CBI40977.3|  unnamed protein product                                191   4e-53   
ref|XP_011099830.1|  PREDICTED: cytochrome P450 CYP82D47-like           191   5e-53   
ref|XP_006830473.1|  hypothetical protein AMTR_s05472p00006060          180   5e-53   
gb|KDO79056.1|  hypothetical protein CISIN_1g020899mg                   185   6e-53   
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           190   6e-53   
gb|EMT01872.1|  Cytochrome P450 81D1                                    183   8e-53   
emb|CBI19611.3|  unnamed protein product                                194   8e-53   
dbj|BAF98469.1|  cytochrome P450                                        189   1e-52   
ref|XP_006435894.1|  hypothetical protein CICLE_v10033457mg             188   1e-52   
gb|KEH30996.1|  cytochrome P450 family protein                          182   1e-52   
emb|CDP01254.1|  unnamed protein product                                182   1e-52   
ref|XP_011029079.1|  PREDICTED: cytochrome P450 81D1-like               189   1e-52   
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               189   2e-52   
gb|KHN22284.1|  Cytochrome P450 82A3                                    187   2e-52   
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             189   2e-52   
ref|XP_010527272.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    188   2e-52   
ref|XP_002880657.1|  CYP82F1                                            189   2e-52   
ref|XP_002510312.1|  cytochrome P450, putative                          189   2e-52   
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           189   2e-52   
ref|XP_010527271.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    188   2e-52   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           189   2e-52   
ref|XP_008337049.1|  PREDICTED: cytochrome P450 81D1-like               183   2e-52   
ref|XP_006366436.1|  PREDICTED: cytochrome P450 82A3-like               182   3e-52   
ref|XP_010696237.1|  PREDICTED: cytochrome P450 82G1                    189   3e-52   
ref|XP_007017415.1|  Cytochrome P450, putative                          188   4e-52   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               188   4e-52   
ref|XP_007151140.1|  hypothetical protein PHAVU_004G021100g             187   4e-52   
gb|EYU23762.1|  hypothetical protein MIMGU_mgv1a004588mg                188   5e-52   
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    188   5e-52   
emb|CAN65592.1|  hypothetical protein VITISV_000532                     185   5e-52   
ref|XP_010527269.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    188   5e-52   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    190   5e-52   
ref|XP_010527270.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    188   5e-52   
ref|XP_010092357.1|  Cytochrome P450 82A3                               188   6e-52   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           187   6e-52   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             188   6e-52   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         187   6e-52   
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    187   7e-52   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             187   7e-52   
ref|XP_003618363.1|  Cytochrome P450                                    187   7e-52   
ref|XP_010106088.1|  Cytochrome P450 82A4                               187   8e-52   
ref|XP_010064545.1|  PREDICTED: cytochrome P450 82A3-like               181   8e-52   
gb|AII31758.1|  cytochrome P450 monooxygenase                           187   9e-52   
gb|KHG29694.1|  Cytochrome P450                                         187   9e-52   
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             187   9e-52   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               187   1e-51   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             187   1e-51   
ref|XP_007227313.1|  hypothetical protein PRUPE_ppa016513mg             186   1e-51   
gb|EMT15747.1|  Cytochrome P450 81D1                                    183   1e-51   
ref|XP_006858803.1|  hypothetical protein AMTR_s00066p00166610          178   1e-51   
ref|XP_008345296.1|  PREDICTED: cytochrome P450 CYP82D47-like           187   1e-51   



>ref|XP_009801176.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=517

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 148/170 (87%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER VED+DI+NLVYLQA+VKETLRL+PP+PFL+PHEA++DC V GYHIPK
Sbjct  341  QEEIDMKVGKERWVEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVAGYHIPK  400

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L++N W++HRDPEIWS+PE+F+PERFL  +A+V A  Q F+FIPFGSGRRSCPG+ +
Sbjct  401  GTRLHINAWKVHRDPEIWSEPERFMPERFLTSKANVDARGQNFEFIPFGSGRRSCPGINF  460

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A  VTHLT  RLLQGF+FST SN  +DMTEG+G+TLP+ N +EVL++PRL
Sbjct  461  ATLVTHLTFGRLLQGFDFSTPSNTPIDMTEGVGVTLPKVNQVEVLISPRL  510



>ref|XP_009616319.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=521

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 147/170 (86%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER +ED+DI+NLVYLQA+VKETLRL+PP+PFL+PHEA++DC V GYHIPK
Sbjct  345  QEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+LY+N W++HRDPEIWS+PEKF+P+RFL  +A++ A  Q F+FIPFGSGRRSCPG+ +
Sbjct  405  GTRLYINAWKVHRDPEIWSEPEKFMPDRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGF  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A  VTHLT  RLLQGF+FS  SN  +DMTEG+G+TLP+ N +EVL+TPRL
Sbjct  465  ATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRL  514



>gb|ABC69376.1| CYP82M1v5 [Nicotiana tabacum]
Length=521

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER +ED+DI+NLVYLQA+VKETLRL+PP+PFL+PHEA++DC V GYHIPK
Sbjct  345  QEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+LY+N W++HRDPEIWS+PEKF+P RFL  +A++ A  Q F+FIPFGSGRRSCPG+ +
Sbjct  405  GTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGF  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A  VTHLT  RLLQGF+FS  SN  +DMTEG+G+TLP+ N +EVL+TPRL
Sbjct  465  ATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRL  514



>gb|ABC69375.1| CYP82M1v4 [Nicotiana tabacum]
Length=521

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER +ED+DI+NLVYLQA+VKETLRL+PP+PFL+PHEA++DC V GYHIPK
Sbjct  345  QEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+LY+N W++HRDPEIWS+PEKF+P RFL  +A++ A  Q F+FIPFGSGRRSCPG+ +
Sbjct  405  GTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGF  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A  VTHLT  RLLQGF+FS  SN  +DMTEG+G+TLP+ N +EVL+TPRL
Sbjct  465  ATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRL  514



>gb|ABC69374.1| CYP82M1v3 [Nicotiana tabacum]
Length=521

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID K+G ER +ED+DI+NLVYLQA+VKETLRL+PP+PFL+PHEA++DC V GYHIPK
Sbjct  345  QEEIDMKMGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+LY+N W++HRDPEIWS+PEKF+P RFL  +A++ A  Q F+FIPFGSGRRSCPG+ +
Sbjct  405  GTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGF  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A  VTHLT  RLLQGF+FS  SN  +DMTEG+G+TLP+ N +EVL+TPRL
Sbjct  465  ATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRL  514



>ref|XP_006352674.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=520

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 143/171 (84%), Gaps = 5/171 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID K+G ER VE+ DI+NLVYLQA+VKETLRL+PP P  +PH AMEDCTVGGY +PK
Sbjct  344  QEEIDMKIGKERWVEECDIKNLVYLQAIVKETLRLYPPGPLAIPHAAMEDCTVGGYKVPK  403

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW+LHRDP+IWS PEKF+PERF+    E D++  + F+FIPFGSGRRSCPG+ 
Sbjct  404  GTRLMVNVWKLHRDPQIWSDPEKFMPERFMKSHSEIDISG-QNFEFIPFGSGRRSCPGIT  462

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +AM+VTHLTLARLLQGFNFST+ +  +D+T G  ITLP+ANPLEV V PRL
Sbjct  463  FAMQVTHLTLARLLQGFNFSTLGDLPVDLTVGNSITLPKANPLEVFVMPRL  513



>gb|ABC69372.1| CYP82M1v1 [Nicotiana tabacum]
Length=521

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER +ED+DI+NLVYLQA+VKETLRL+PP+PFL+PHEA++DC V GYHIPK
Sbjct  345  QEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+LY+N W++HRD EIWS+PEKF+P RFL  +A++ A  Q F+FIPFGSGRRSCPG+ +
Sbjct  405  GTRLYINAWKVHRDSEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGLGF  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A  VTHLT  RLLQGF+FS  SN  +DMTEG+G+TLP+ N +EVL+TPRL
Sbjct  465  ATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRL  514



>gb|ABC69373.1| CYP82M1v2 [Nicotiana tabacum]
Length=521

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER +ED+DI+NLVYLQA+VKETLRL PP+PFL+PHEA++DC V GYHIPK
Sbjct  345  QEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLFPPVPFLLPHEAVQDCKVTGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+LY+N W++HRDPEIWS+PEKF+P RFL  +A++ A  Q F+FIPFGSGRRSCPG+ +
Sbjct  405  GTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGF  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A  VTHLT  RLLQGF+FS  SN   DMTEG+G+TLP+ N +EVL+TPRL
Sbjct  465  ATLVTHLTFGRLLQGFDFSKPSNTPTDMTEGVGVTLPKVNQVEVLITPRL  514



>ref|XP_011089652.1| PREDICTED: cytochrome P450 82C2 [Sesamum indicum]
Length=528

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER V++SDI+NLVYLQAVVKETLRL PP P  VPHEAMEDC V GYH+PK
Sbjct  350  QEEIDMKVGKERWVQESDIKNLVYLQAVVKETLRLFPPGPLSVPHEAMEDCCVAGYHVPK  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW+LHRDP IW++P+ F+PERFL + VA +   +  +F+PFGSGRRSCPG+ +
Sbjct  410  GTRLLVNVWKLHRDPRIWAEPDNFVPERFLTSHVAVDFTGQNHEFVPFGSGRRSCPGITF  469

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+VTHLTLARLLQGF+ +T SN  +DMTEGL ITLP+A PLEV++TPRL
Sbjct  470  AMQVTHLTLARLLQGFDLATPSNGPVDMTEGLSITLPKATPLEVVITPRL  519



>ref|XP_008372636.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=205

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 137/167 (82%), Gaps = 4/167 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+ KVG ER VED+DIENL YLQA+VKETLRL+PP PF VPHEAMEDC V G HIPK
Sbjct  36   QEEINLKVGRERWVEDTDIENLTYLQAIVKETLRLYPPGPFSVPHEAMEDCQVCGLHIPK  95

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQFQFIPFGSGRRSCPGMLYAMR  360
            GT+L+VN+W+LHRDP +WS+PE F P+RF     A+ + F+FIPFGSGRRSCPG+ +AM+
Sbjct  96   GTRLFVNLWKLHRDPTVWSEPEVFSPDRF----DASGQHFEFIPFGSGRRSCPGLTFAMQ  151

Query  361  VTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            V HL L RL+QGF  +T  + ++DMTEGLG+TLP+A  LEV++TPRL
Sbjct  152  VIHLNLGRLIQGFELATPLDMSVDMTEGLGVTLPKATSLEVVLTPRL  198



>emb|CBI29742.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   237 bits (605),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R VE SDI+NLVYL+A+VKETLRL+P +P LVPHEAMEDC VGGYHIPK
Sbjct  56   QEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHVGGYHIPK  115

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN W+LHRDP +WS PE+F PERFL +    +   + F+ IPFGSGRRSCPG+  
Sbjct  116  GTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPFGSGRRSCPGINM  175

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HLT+A+LLQGF+ +T SN+ +DM E + IT+P+  PLEV++TPRL
Sbjct  176  ALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRL  225



>ref|XP_010069626.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=542

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 139/174 (80%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG +R V+DSDIENL+YLQA+VKETLRL+PP P LVPHEA  DC V GY IPK
Sbjct  362  QEEIDLKVGKDRWVQDSDIENLLYLQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPK  421

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+++VN W+LHRDP++WS+PEKFLPERFL       A+ + F+FIPFGSGRR CPG  +
Sbjct  422  GTRIFVNAWKLHRDPQVWSEPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAF  481

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+R THLTLARLLQGF+ +T  +  +DMTEGLG+ LP+A PL V++ PRL  VL
Sbjct  482  ALRATHLTLARLLQGFDLATSLDELVDMTEGLGVNLPKATPLRVVLNPRLPSVL  535



>ref|XP_010069627.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW58035.1| hypothetical protein EUGRSUZ_H00764 [Eucalyptus grandis]
Length=539

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG ++ ++DSDIENL YLQA+VKETLRL+P  P + PHEA  DCTV GY IPK
Sbjct  359  QEEMDLMVGKDKWIQDSDIENLPYLQAIVKETLRLYPTAPLVAPHEARADCTVSGYRIPK  418

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT++ VNVW+LHRDP++WS PEKFLPERFL       A  + F+FIPFGSGRRSCPG + 
Sbjct  419  GTRIIVNVWKLHRDPQVWSNPEKFLPERFLTNHSGMDALGQHFEFIPFGSGRRSCPGAML  478

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+RVTHLTLARLLQGF+ +T SN  +DMTEGLG+TLP+A+PL V++TPRL
Sbjct  479  ALRVTHLTLARLLQGFDLATPSNKPVDMTEGLGVTLPKASPLRVILTPRL  528



>ref|XP_006339196.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=524

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 145/174 (83%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID KVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHEA+EDCTV GY+IPK
Sbjct  348  QKEIDNKVGKDRWVEESDIKDLVYLQAIVKEALRLYPPAPLLVPHEAVEDCTVAGYNIPK  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L+ N W++ RDP ++S+P+KF+PERFL   ++V A  Q F+FIPFGSGRRSCPG+ +
Sbjct  408  GTRLFPNAWKIQRDPRVYSEPDKFMPERFLNEHSNVDARGQHFEFIPFGSGRRSCPGINF  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +V HLT+ RL+QGFNF T SN  +DMTEG GIT+P+A P+EV++TPRL+ +L
Sbjct  468  ATQVAHLTIGRLIQGFNFGTPSNLPVDMTEGQGITMPKAKPVEVVITPRLNSML  521



>ref|XP_004249377.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=524

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 146/174 (84%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID+KVG +R +E+SDI++LVYLQA+VKE LRL+PP P LVPHEA+EDCTV GY+IPK
Sbjct  348  QKEIDSKVGKDRWIEESDIKDLVYLQAIVKEALRLYPPAPLLVPHEAVEDCTVAGYNIPK  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L+ N W++ RDP ++S+P+KF+PERFL   ++V A  Q F+FIPFGSGRRSCPG+ +
Sbjct  408  GTRLFANAWKIQRDPRVYSEPDKFIPERFLNEHSNVDARGQHFEFIPFGSGRRSCPGINF  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +V HLT+ RL+QGF+F T SN  +DMTEG GIT+P+A P+EV++TPRL+ +L
Sbjct  468  ATQVAHLTIGRLIQGFSFGTPSNLPVDMTEGQGITMPKAKPVEVVITPRLNSML  521



>ref|XP_009348373.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=538

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 138/171 (81%), Gaps = 5/171 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+  VGTER VED+DIENL YLQA+VKETLRL+PP P  VPHEAMEDC V G+HIPK
Sbjct  362  QEEINLIVGTERWVEDTDIENLTYLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIPK  421

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEA----DVAANRQFQFIPFGSGRRSCPGML  348
            GT+L+VN+W+LHRDP +WS PE F P+RFL      DV+ N  F+FIPFGSGRRSCPG+ 
Sbjct  422  GTRLFVNLWKLHRDPTVWSDPEMFYPDRFLTTQASIDVSGN-HFEFIPFGSGRRSCPGLT  480

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +AM+V HLTL RL+QGF  +T  +  +DMTEGLG+TLP+A  LEV++TPRL
Sbjct  481  FAMQVIHLTLGRLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVLTPRL  531



>ref|XP_006349946.1| PREDICTED: cytochrome P450 82C2-like [Solanum tuberosum]
Length=531

 Score =   240 bits (613),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+DTKVG  R VE+SDI+NLVY QAVVKETLRL+PP P LVPHE++EDC V GYHIPK
Sbjct  355  QEELDTKVGRNRWVEESDIKNLVYFQAVVKETLRLYPPAPLLVPHESIEDCIVQGYHIPK  414

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN  +L RDP+IWS P  F PERFL +    +   +Q++FIPFGS RRSCPG+ Y
Sbjct  415  GTRLWVNTMKLQRDPKIWSNPNTFDPERFLTSQAGCDVRGQQYEFIPFGSRRRSCPGITY  474

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A++VTHL +A LLQGF+FST SN  LDM EGLG+T+ + NP+EV++TPR   VL
Sbjct  475  AIQVTHLAIAHLLQGFDFSTPSNEPLDMKEGLGMTMRKVNPIEVMITPRFPSVL  528



>gb|KDP26345.1| hypothetical protein JCGZ_17503 [Jatropha curcas]
Length=532

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 140/171 (82%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D KVG ER V+DSDIENLVYLQAVVKETLRL+PP P  VPHEA+ DC + GY+IPK
Sbjct  355  QQELDLKVGKERCVQDSDIENLVYLQAVVKETLRLYPPGPLAVPHEAINDCYISGYYIPK  414

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL---EADVA-ANRQFQFIPFGSGRRSCPGML  348
            GT++  N+W+LHRDP IWS P+KFLPERFL   + +V  + + F+++PFGSGRRSCPG+ 
Sbjct  415  GTRVLANLWKLHRDPNIWSNPDKFLPERFLANRDNNVDFSGQNFEYLPFGSGRRSCPGLN  474

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +A++  HLTLARLLQ F+ +T+ N  +DMTEGLGITLP+A PLE+ +TPRL
Sbjct  475  FAIQAIHLTLARLLQAFSLTTLFNQPVDMTEGLGITLPKATPLEIQITPRL  525



>dbj|BAM36726.1| nicotine N-demethylase [Nicotiana alata]
Length=515

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  343  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  402

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++W  P+KF PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  403  GTRLFANVMKLQRDPKLWPNPDKFDPERFIAGDIDFRGQHYEYIPFGSGRRSCPGMTYAL  462

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            +V HLT+ARL+QGFN+ T +N  LDM EG GIT+ + NP+EV++TPRL + L
Sbjct  463  QVEHLTMARLIQGFNYRTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAHEL  514



>emb|CAN82329.1| hypothetical protein VITISV_016031 [Vitis vinifera]
Length=432

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R VE SDI+NLVYL+A+VKETLRL+P +P LVPHEAMEDC VGGYHIPK
Sbjct  258  QEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAIPLLVPHEAMEDCHVGGYHIPK  317

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN W+LHRDP +WS PE+F PERFL +    +   + F+ IPFGSGRRSCPG+  
Sbjct  318  GTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPFGSGRRSCPGINM  377

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HLT+A+LLQGF+ +T SN+ +DM E + IT+P+  PLEV++TPRL
Sbjct  378  ALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRL  427



>ref|XP_007200049.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
 gb|EMJ01248.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
Length=517

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 138/172 (80%), Gaps = 3/172 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R +ED+DIENL YLQA+VKETLRL+PP P  VPHEAM+DC V G+HIPK
Sbjct  340  QEELDLKVGRDRWIEDTDIENLPYLQAIVKETLRLYPPGPLSVPHEAMQDCQVCGFHIPK  399

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN+W+LHRDP +W  PE F PERFL   V   A+ + F+FIPFGSGRRSCPG  +
Sbjct  400  GTRLFVNLWKLHRDPCLWPDPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATF  459

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHY  507
            A++VTHLTL RLLQGF  +T  +  +D+TEGLGIT+P+A  LEV++TPRL +
Sbjct  460  ALQVTHLTLGRLLQGFELATPMDMPVDLTEGLGITMPKATSLEVILTPRLSF  511



>gb|KCW58034.1| hypothetical protein EUGRSUZ_H00762, partial [Eucalyptus grandis]
Length=529

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 135/168 (80%), Gaps = 3/168 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG +R V+DSDIENL+YLQA+VKETLRL+PP P LVPHEA  DC V GY IPK
Sbjct  362  QEEIDLKVGKDRWVQDSDIENLLYLQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPK  421

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+++VN W+LHRDP++WS+PEKFLPERFL       A+ + F+FIPFGSGRR CPG  +
Sbjct  422  GTRIFVNAWKLHRDPQVWSEPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAF  481

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTP  495
            A+R THLTLARLLQGF+ +T  +  +DMTEGLG+ LP+A PL V++ P
Sbjct  482  ALRATHLTLARLLQGFDLATSLDELVDMTEGLGVNLPKATPLRVVLNP  529



>dbj|BAM36725.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  342  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  401

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  402  GTRLFANVMKLQRDPKLWSNPDKFDPERFIAGDIDFRGQHYEYIPFGSGRRSCPGMTYAL  461

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T +N  LDM EG GIT+ + NP+EV++TPRL
Sbjct  462  QVEHLTMAHLIQGFNYRTPTNEPLDMKEGAGITIRKVNPVEVIITPRL  509



>emb|CAN77159.1| hypothetical protein VITISV_019026 [Vitis vinifera]
Length=604

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG  R VE+SDI+NL+YLQAVVKETLRL+PP P  +PHEA+EDC V  YHIPK
Sbjct  430  QEEIDLKVGRGRWVEESDIZNLIYLQAVVKETLRLYPPAPLSIPHEAVEDCNVCEYHIPK  489

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VNVW+LHRDP +WS PE+F PERFL  +   N   + F+ IPF SGRRSCPG+  
Sbjct  490  GTRLFVNVWKLHRDPGVWSDPEEFQPERFLTTNANLNVFGQHFELIPFSSGRRSCPGIAL  549

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+++ HLT+ARLLQG++ +T  NA +DMTEG+GIT+PRA PLEV++TPRL  +L
Sbjct  550  ALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGITMPRATPLEVMLTPRLPSLL  603



>ref|XP_009761500.1| PREDICTED: cytochrome P450 82C2-like [Nicotiana sylvestris]
Length=555

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+DTK+   R VE+SDI+NLVY QAV+KETLRL+PP P LVPHE++EDC V GYHIPK
Sbjct  379  QEELDTKISRNRWVEESDIKNLVYFQAVIKETLRLYPPAPLLVPHESVEDCIVHGYHIPK  438

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN  +L RDPEIWS P+ F PERFL +    +   +Q++FIPFGSGRRSCPG+ Y
Sbjct  439  GTRLWVNTMKLQRDPEIWSNPDTFDPERFLTSQAGFDVRGQQYEFIPFGSGRRSCPGITY  498

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +VTHL +A LLQGF+FST+ N  LDM EGLG+T+ + NP+EVL+ PRL  VL
Sbjct  499  ATQVTHLAIAHLLQGFDFSTLLNEPLDMKEGLGMTMRKVNPIEVLIMPRLPSVL  552



>emb|CBI25922.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 137/174 (79%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI+NL+YLQA VKETLRL+PP P LVPHEA++DC+V GYHIPK
Sbjct  92   QEELDLKVGRGRWVEESDIQNLIYLQAAVKETLRLYPPGPLLVPHEAIQDCSVCGYHIPK  151

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW+LHRDP+ WS PE+F PERFL      N   +  + IPF SGRRSCPG+  
Sbjct  152  GTRLLVNVWKLHRDPDAWSDPEEFQPERFLTTHANLNVFGQHSELIPFSSGRRSCPGIAL  211

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+++ HLT+ARLLQG++ +T  NA +DMTEG+G+ +P+  PLEV++TPRL  +L
Sbjct  212  ALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGLAMPKETPLEVMLTPRLPSLL  265



>ref|XP_009758062.1| PREDICTED: cytochrome P450 82C4-like, partial [Nicotiana sylvestris]
Length=485

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE ++DC V GYHIPK
Sbjct  313  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVKDCVVSGYHIPK  372

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA-ANRQFQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF+  D+      ++FIPFGSGRRSCPGM YA+
Sbjct  373  GTRLFANVMKLQRDPKLWSNPDKFDPERFIAGDIDFRGHHYEFIPFGSGRRSCPGMTYAL  432

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++ ALDM EG GIT+ + NP+E+++TPRL
Sbjct  433  QVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRL  480



>ref|XP_008372515.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=524

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 135/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+ KVGTER VED+DIENL  LQA+VKETLRL+PP P  VPHEAMEDC V G+HI K
Sbjct  348  QEEINLKVGTERWVEDTDIENLTXLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIXK  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN+W+LHRDP +WS PE F P+RFL       A+   F+FIPFGSGRRSCPG+ +
Sbjct  408  GTRLFVNLWKLHRDPTMWSDPEMFYPDRFLTTQASIDASGNHFEFIPFGSGRRSCPGLTF  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+V HLTL RL+QGF  +T  +  +DMTEGLG+TLP+A  LEV++TPRL
Sbjct  468  AMQVIHLTLGRLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVLTPRL  517



>gb|KDP26343.1| hypothetical protein JCGZ_17501 [Jatropha curcas]
Length=333

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 139/175 (79%), Gaps = 4/175 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D KVG ER V+DSDIE  VYLQAV+KETLRL+PP P  VPHEA+EDC +  Y+IPK
Sbjct  156  QQELDLKVGRERCVQDSDIEKSVYLQAVIKETLRLYPPGPLAVPHEAVEDCYISRYYIPK  215

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA----ANRQFQFIPFGSGRRSCPGML  348
            GT+++ N+W+LHRDP +WS P++FLPERFL  +      + + F++IPFGSGRRSCPG+ 
Sbjct  216  GTRIFANLWKLHRDPNVWSNPDEFLPERFLANEGKNVDFSGQNFEYIPFGSGRRSCPGIN  275

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            +A++  H+T+ARLLQ F+F+T  + A+DMTEG+GITLP+A PLE+ +TPRL   L
Sbjct  276  FAIQAIHMTVARLLQAFSFTTPFDQAVDMTEGIGITLPKATPLEIQITPRLSSAL  330



>emb|CAN64501.1| hypothetical protein VITISV_020341 [Vitis vinifera]
Length=462

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R VE SDI+NLVYL+A+VKETLRL+P +P LVPHEAMEDC VGGYHIPK
Sbjct  288  QEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHVGGYHIPK  347

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN W+LHRDP +WS PE+F PERFL +    +   + F+ IPFGSGRRSCPG+  
Sbjct  348  GTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPFGSGRRSCPGINM  407

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HLT+A+LLQGF+ +T SN+ +DM E + IT+P+  PLEV++TPRL
Sbjct  408  ALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRL  457



>dbj|BAM36727.1| nicotine N-demethylase [Nicotiana langsdorffii]
Length=516

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  343  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  402

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++W  P+ F PERF+ AD+    Q +++IPFGSGRRSCPGM YA+
Sbjct  403  GTRLFANVMKLQRDPKLWPNPDNFDPERFVAADIDFRGQHYEYIPFGSGRRSCPGMTYAL  462

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+ARL+QGFN+ T +N  LDM EG GIT+ + NP+EV++TPRL
Sbjct  463  QVEHLTMARLIQGFNYRTPTNEPLDMKEGAGITIRKVNPVEVIITPRL  510



>ref|XP_009606611.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=548

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+DTKVG  R VE+SDI+NLVY QAV+KETLRL+PP P LVPHE++EDC V GYHIPK
Sbjct  372  QEELDTKVGRNRWVEESDIKNLVYFQAVIKETLRLYPPAPLLVPHESVEDCIVHGYHIPK  431

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN  +L RDPEIWS P+ F PERFL      +   +Q++FIPFGSGRRSCPG+ Y
Sbjct  432  GTRLWVNTMKLQRDPEIWSDPDTFDPERFLTCQAGFDVRGQQYEFIPFGSGRRSCPGITY  491

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +VTHL +A LLQGF+F+T  N  L+M EGLG+T+ + NP+EVL+TPRL  VL
Sbjct  492  ASQVTHLAIAHLLQGFDFTTPFNEPLEMKEGLGMTMRKVNPIEVLITPRLPSVL  545



>gb|ABR57311.1| cytochrome P450 monooxygenase [Nicotiana sylvestris]
Length=517

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE ++DC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVKDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA-ANRQFQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF+  D+      ++FIPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSNPDKFDPERFIAGDIDFRGHHYEFIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++ ALDM EG GIT+ + NP+E+++TPRL
Sbjct  465  QVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRL  512



>ref|XP_002531094.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31308.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 136/170 (80%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D KVG  R V+DSDI+NLVYL A+VKETLRL+PP P  VPHEA EDC++ GYHIPK
Sbjct  349  QQELDLKVGRNRCVQDSDIDNLVYLNAIVKETLRLYPPGPLAVPHEASEDCSIAGYHIPK  408

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+++ N+W+LHRDP +WS P +F+PERFL +      + + F++IPFGSGRRSCPG+ +
Sbjct  409  GTRVFANLWKLHRDPNVWSSPNEFVPERFLTSQANMDVSGQNFEYIPFGSGRRSCPGLNF  468

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++  HLTLA+LLQ F+F+T  N  +DMTEGLGITLP+A PLE+ + PRL
Sbjct  469  AIQAIHLTLAKLLQAFSFTTPLNVPVDMTEGLGITLPKATPLEIHIIPRL  518



>ref|XP_002264790.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R VE SDI+NLVYL+A+VKETLRL+P +P LVPHEAMEDC VGGYHIPK
Sbjct  345  QEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHVGGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN W+LHRDP +WS PE+F PERFL +    +   + F+ IPFGSGRRSCPG+  
Sbjct  405  GTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPFGSGRRSCPGINM  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HLT+A+LLQGF+ +T SN+ +DM E + IT+P+  PLEV++TPRL
Sbjct  465  ALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRL  514



>ref|XP_009757628.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
 gb|ADP65810.1| nicotine N-demethylase [Nicotiana sylvestris]
Length=517

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG +R VE+SDI++LVYLQ +VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDKKVGKDRWVEESDIKDLVYLQTIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF  AD+    Q ++FIPFGSGRRSCPGM YAM
Sbjct  405  GTRLFANVMKLQRDPKLWSNPDKFDPERFFAADIDFRGQHYEFIPFGSGRRSCPGMTYAM  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG G+T+ + NP+EV++TPRL
Sbjct  465  QVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPIEVVITPRL  512



>gb|ADP65809.1| nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG +R VE+SDI++LVYLQ +VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDKKVGKDRWVEESDIKDLVYLQTIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF  AD+    Q ++FIPFGSGRRSCPGM YAM
Sbjct  405  GTRLFANVMKLQRDPKLWSNPDKFDPERFFAADIDFRGQHYEFIPFGSGRRSCPGMTYAM  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG G+T+ + NP+EV++TPRL
Sbjct  465  QVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPIEVVITPRL  512



>gb|ABA07807.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tabacum]
Length=518

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  346  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  405

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF+  D+  + Q +++IPFGSGRRSCPGM YA+
Sbjct  406  GTRLFANVMKLQRDPKLWSNPDKFNPERFIARDIDFHGQHYEYIPFGSGRRSCPGMTYAL  465

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP++V++TPRL
Sbjct  466  QVEHLTMAHLIQGFNYRTPTDEPLDMKEGAGITIRKVNPVKVIITPRL  513



>ref|XP_009609537.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46919.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tomentosiformis]
Length=518

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  346  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  405

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF+  D+  + Q +++IPFGSGRRSCPGM YA+
Sbjct  406  GTRLFANVMKLQRDPKLWSNPDKFNPERFIARDIDFHGQHYEYIPFGSGRRSCPGMTYAL  465

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP++V++TPRL
Sbjct  466  QVEHLTMAHLIQGFNYRTPTDEPLDMKEGAGITIRKVNPVKVIITPRL  513



>ref|XP_010069622.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Eucalyptus 
grandis]
Length=478

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ++ V+DSDI +L YLQA+VKETLRL+PP P  +PHEA  DC V GY IPK
Sbjct  298  QEEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPK  357

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+++VNVW+LHRDP++WS PEKFLPERFL       A+ + F+FIPFGSGRR CPG  +
Sbjct  358  GTRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAF  417

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+R THLTLARLLQGF+ +  S+  +DMTEG+G+ LP+A PL V++ PRL
Sbjct  418  ALRATHLTLARLLQGFDLAISSDELVDMTEGIGLNLPKATPLRVVLNPRL  467



>ref|XP_008235431.1| PREDICTED: cytochrome P450 82C4-like [Prunus mume]
Length=517

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 136/170 (80%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R +ED+DIENL YLQA+VKETLRL+PP P  VPHEAM+DC V G+ IPK
Sbjct  340  QEELDLKVGRDRWIEDTDIENLPYLQAMVKETLRLYPPGPLSVPHEAMQDCQVCGFDIPK  399

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN+W+LHRDP +W  PE F PERFL   V   A+ + F+FIPFGSGRRSCPG  +
Sbjct  400  GTRLFVNLWKLHRDPSLWPDPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATF  459

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++VTHLTL RLLQGF  +T  +  +D+TEGLGIT+P+A  LEV++TPRL
Sbjct  460  ALQVTHLTLGRLLQGFELATPLDMPVDLTEGLGITMPKATSLEVILTPRL  509



>ref|XP_010646216.1| PREDICTED: cytochrome P450 82C2-like [Vitis vinifera]
Length=460

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG  R VE+SDI+NL+YLQAVVKETLRL+PP P  +PHEA+EDC V  YHIPK
Sbjct  286  QEEIDLKVGRGRWVEESDIQNLIYLQAVVKETLRLYPPAPLSIPHEAVEDCNVCEYHIPK  345

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VNVW+LHRDP +W  PE+F PERFL  +   N   + F+ IPF SGRRSCP +  
Sbjct  346  GTRLFVNVWKLHRDPGVWPDPEEFQPERFLTTNANLNVFGQHFELIPFSSGRRSCPRIAL  405

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+++ HLT+ARLLQG++ +T  NA +DMTEG+GIT+PRA PLEV++TPRL  +L
Sbjct  406  ALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGITMPRATPLEVMLTPRLPSLL  459



>ref|XP_008235430.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=517

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 136/172 (79%), Gaps = 3/172 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R +ED+DIENL YLQA+VKETLRL+PP P  VPHEAM+DC V G+HI K
Sbjct  340  QEELDLKVGRDRWIEDTDIENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQK  399

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT L+VN+W+LHRDP +W  PE F PERFL   V   A+ + F+FIPFGSGRRSCPG  +
Sbjct  400  GTLLFVNLWKLHRDPSLWPDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATF  459

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHY  507
            A++VTHLTL RLLQGF  +T  +  +D+TEGLGIT+P++  LEV++TPRL +
Sbjct  460  ALQVTHLTLGRLLQGFELATPMDMPVDLTEGLGITMPKSTSLEVILTPRLPF  511



>dbj|BAM36724.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  342  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  401

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++W  P+ F PERF+ A++    Q +++IPFGSGRRSCPGM YA+
Sbjct  402  GTRLFANVMKLQRDPKLWPNPDNFDPERFVAANIDFRGQHYEYIPFGSGRRSCPGMTYAL  461

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+ARL+QGFN+ T +   LDM EG GIT+ + NP+EV++TPRL
Sbjct  462  QVEHLTMARLIQGFNYRTPTKEPLDMKEGAGITIRKVNPVEVIITPRL  509



>gb|KCW58033.1| hypothetical protein EUGRSUZ_H00761 [Eucalyptus grandis]
Length=537

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 136/174 (78%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ++ V+DSDI +L YLQA+VKETLRL+PP P  +PHEA  DC V GY IPK
Sbjct  357  QEEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPK  416

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+++VNVW+LHRDP++WS PEKFLPERFL       A+ + F+FIPFGSGRR CPG  +
Sbjct  417  GTRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAF  476

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+R THLTLARLLQGF+ +  S+  +DMTEG+G+ LP+A PL V++ PRL  +L
Sbjct  477  ALRATHLTLARLLQGFDLAISSDELVDMTEGIGLNLPKATPLRVVLNPRLPSML  530



>dbj|BAM36723.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  342  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  401

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++W  P+ F PERF+ A++    Q +++IPFGSGRRSCPGM YA+
Sbjct  402  GTRLFANVMKLQRDPKLWPNPDNFDPERFVAANIDFRGQHYEYIPFGSGRRSCPGMTYAL  461

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+ARL+QGFN+ T +   LDM EG GIT+ + NP+EV++TPRL
Sbjct  462  QVEHLTMARLIQGFNYRTPTKEPLDMKEGAGITICKVNPVEVIITPRL  509



>ref|XP_007201695.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
 gb|EMJ02894.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
Length=517

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 135/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R +ED+DIENL YLQA+VKETLRL+PP P  VPHEAM+DC V G+HI K
Sbjct  340  QEELDLKVGRDRWIEDTDIENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQK  399

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT L+VN+W+LHRDP +W  PE F PERFL   V   A+ + F+FIPFGSGRRSCPG  +
Sbjct  400  GTLLFVNLWKLHRDPSLWPDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATF  459

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++VTHLTL RLLQGF  +T  +  +D+TEG+GIT+P++  LEV++TPRL
Sbjct  460  ALQVTHLTLGRLLQGFELATPMDMPVDLTEGVGITMPKSTSLEVILTPRL  509



>ref|XP_008372514.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=524

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QE I+ +VGTER VED+DI++L YLQA+VKETLRL+PP P  VPHEA EDC V G+HIPK
Sbjct  348  QEXINLQVGTERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSVPHEAXEDCQVCGFHIPK  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+ N+W+LHRDP +WS PE F P+RFL    + +   + F+FIPFGSGRRSCPG+ +
Sbjct  408  GTRLFANLWKLHRDPSVWSDPEVFCPDRFLTTQASTDVSGQHFEFIPFGSGRRSCPGLTF  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+V HLTL RL+QGF  +T  +  +DM EGLGIT+P+A  LEV++TPRL
Sbjct  468  AMQVIHLTLGRLIQGFELATPLDMPVDMAEGLGITMPKATSLEVVLTPRL  517



>ref|XP_010104162.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXB99094.1| Cytochrome P450 82C4 [Morus notabilis]
Length=482

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG ER VE SDI+NLVYLQA+VKETLRL+PP P  VPH+A EDCTV G+H+ K
Sbjct  306  QEELDLIVGKERWVEGSDIKNLVYLQAIVKETLRLYPPGPLAVPHQAREDCTVCGFHVRK  365

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN+W+LHRDP  W  PE F PERFL +    +   + F+ IPFGSGRRSCPGM +
Sbjct  366  GTRLFVNLWKLHRDPNTWPDPEAFSPERFLTSHAGIDVLGQHFELIPFGSGRRSCPGMAF  425

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++VTHL LARLLQGF F+T  +  +DM+EGLGITLPRA P+E ++TPRL
Sbjct  426  ALQVTHLALARLLQGFVFATKLDEPVDMSEGLGITLPRATPVEAVLTPRL  475



>gb|ABD39479.1| CYP82E4v8 [Nicotiana tabacum]
Length=517

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+VNV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFVNVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>ref|XP_010069621.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Eucalyptus 
grandis]
Length=542

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 136/174 (78%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ++ V+DSDI +L YLQA+VKETLRL+PP P  +PHEA  DC V GY IPK
Sbjct  362  QEEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPK  421

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+++VNVW+LHRDP++WS PEKFLPERFL       A+ + F+FIPFGSGRR CPG  +
Sbjct  422  GTRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAF  481

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+R THLTLARLLQGF+ +  S+  +DMTEG+G+ LP+A PL V++ PRL  +L
Sbjct  482  ALRATHLTLARLLQGFDLAISSDELVDMTEGIGLNLPKATPLRVVLNPRLPSML  535



>gb|ABD39480.1| CYP82E4v10 [Nicotiana tabacum]
Length=517

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIGFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>gb|ABC69371.1| CYP82E5 [Nicotiana tabacum]
Length=517

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDKKVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF   D+    Q ++FIPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSNPDKFDPERFFADDIDYRGQHYEFIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG G+T+ + NP+EV +T RL
Sbjct  465  QVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITARL  512



>ref|XP_011040244.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=544

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  VGT R VE+SDI+NLVYLQA+VKETLRL+PP P LVP E++EDC V GY +P+
Sbjct  368  QKEIDIHVGTTRWVEESDIKNLVYLQAIVKETLRLYPPGPLLVPRESLEDCYVDGYLVPR  427

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GTQL VN W+LHRD  IW  P +F PERFL +  + +   +QF+++PFGSGRRSCPG+  
Sbjct  428  GTQLLVNAWKLHRDARIWENPYEFHPERFLTSHGSTDVRGQQFEYVPFGSGRRSCPGISS  487

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            ++++ HLTL+RLLQGFNFST  NA +DM+EGLG+T+P+A PLEV++TPRL
Sbjct  488  SLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTMPKATPLEVVLTPRL  537



>ref|XP_009619218.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=517

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDKKVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF   D+    Q ++FIPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSNPDKFDPERFFADDIDYRGQHYEFIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG G+T+ + NP+EV +T RL
Sbjct  465  QVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITARL  512



>gb|ABD39475.1| CYP82E4v4 [Nicotiana tabacum]
Length=517

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>gb|ABD39478.1| CYP82E4v7 [Nicotiana tabacum]
Length=517

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>gb|ABA07804.1| cytochrome P450 monooxygenase CYP82E4v2 [Nicotiana tabacum]
 gb|ABB36475.1| nicotine demethylase [Nicotiana tabacum]
 gb|ABN42695.1| cytochrome P450 CYP82E4v2 nicotine demethylase [Nicotiana tabacum]
Length=517

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>gb|ABX56037.1| CYP82E5v2 [Nicotiana tabacum]
Length=517

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG ER VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDKKVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+KF PERF   D+    Q ++FIPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSNPDKFDPERFFADDIDYRGQHYEFIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG G+T+ + NP+EV +T RL
Sbjct  465  QVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITARL  512



>ref|XP_004248527.2| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=521

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG  R V +SD++NLVYLQA+VKET RL+PP+P L+PHEA++DC V GY IPK
Sbjct  345  QEEIDTKVGKSRWVGESDVKNLVYLQAIVKETSRLYPPVPLLLPHEAVQDCKVAGYDIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+ Y+N W++HRDP+IWS+ EKF+PERFL +  + +   + F+FIPFGSGRRSCPG+ +
Sbjct  405  GTRTYINAWKIHRDPKIWSESEKFMPERFLTSKSSVDARGQHFEFIPFGSGRRSCPGINF  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A  VTHLT ARLLQGF FST SN  +DMTEG+GITLP+ N +E+LVTPRL
Sbjct  465  ATLVTHLTFARLLQGFAFSTSSNTPIDMTEGVGITLPKVNQVEILVTPRL  514



>gb|ABA07805.1| cytochrome P450 monooxygenase CYP82E4v1 [Nicotiana tabacum]
Length=517

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>ref|XP_004236938.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=530

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG  R ++D+DI+NLVYLQA+VKETLRL+PP P LVPHE  E+C V GY IPK
Sbjct  354  QEEIDTKVGKARWIDDNDIKNLVYLQAIVKETLRLYPPSPLLVPHENTEECVVSGYRIPK  413

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+LY NV +L  DP++W  PE+F P+RFL  D+    Q ++FIPFGSGRRSCPG+ YA+
Sbjct  414  GTRLYANVMKLQLDPKVWPNPEQFNPDRFLSTDINFRGQDYEFIPFGSGRRSCPGISYAL  473

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            ++ HLT+  L+QGFN+ T SN  LD+ EG+G+T+P+ NP+EV++TPRL
Sbjct  474  QMEHLTIGHLIQGFNYQTPSNEPLDLQEGIGMTMPKVNPVEVIITPRL  521



>ref|XP_009609539.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46920.1| cytochrome P450 monooxygenase CYP82E4 [Nicotiana tomentosiformis]
Length=517

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>gb|ABD39481.1| CYP82E4v11 [Nicotiana tabacum]
Length=517

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTIAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>gb|ABD39483.1| CYP82E2v2 [Nicotiana tabacum]
Length=517

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VK+ LRL+PP P LVPHE ++DC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENVKDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA-ANRQFQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++ S P+KF PERF+  D+      ++FIPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLLSNPDKFDPERFIAGDIDFRGHHYEFIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++ ALDM EG GIT+ + NP+E+++TPRL
Sbjct  465  QVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRL  512



>ref|XP_009768110.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana sylvestris]
Length=520

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 136/174 (78%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EIDT VG +R VE+SDI+NLVYLQA+VKE LRL+PP P  VPHE++EDC V GYHIPK
Sbjct  344  QKEIDTIVGKDRWVEESDIKNLVYLQAIVKEALRLYPPAPLSVPHESVEDCVVNGYHIPK  403

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT L  NV +L RDP+IWS P+KF PERFL      +   + ++FIPFG+GRR+CP M Y
Sbjct  404  GTVLLPNVMKLQRDPKIWSDPDKFDPERFLTTHAKIDYRGQHYEFIPFGTGRRACPAMTY  463

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A++V +L++A L+QGFNF+T SN +LDM EG+GIT P+ NP+EVL+TPRL   L
Sbjct  464  ALQVEYLSIAHLIQGFNFNTPSNESLDMKEGVGITSPKKNPIEVLITPRLSTTL  517



>gb|ABA07806.2| cytochrome P450 monooxygenase CYP82E2 [Nicotiana tabacum]
Length=517

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VK+ LRL+PP P LVPHE ++DC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENVKDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA-ANRQFQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++ S P+KF PERF+  D+      ++FIPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLLSNPDKFDPERFIAGDIDFRGHHYEFIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++ ALDM EG GIT+ + NP+E+++TPRL
Sbjct  465  QVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRL  512



>gb|ABD39476.1| CYP82E4v5 [Nicotiana tabacum]
Length=517

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVVKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>ref|XP_009348374.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+ +VGTER VED+DI++L YLQA+VKETLRL+PP P    HEAMEDC V G++IPK
Sbjct  348  QEEINLQVGTERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSTSHEAMEDCQVCGFYIPK  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA---ANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+ N+W+LHRDP +WS PE F P+RFL    +   + + F+FIPFGSGRRSCPG+ +
Sbjct  408  GTRLFTNLWKLHRDPSVWSDPEVFCPDRFLTTQASIDVSGQHFEFIPFGSGRRSCPGLTF  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+V HLTL RL+QGF  +T  +  +DM EGLG+T+P+A  LEV++TPRL
Sbjct  468  AMQVIHLTLGRLIQGFELATPLDMPVDMAEGLGVTMPKATSLEVVLTPRL  517



>ref|XP_002323130.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
 gb|EEF04891.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
Length=499

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  VGT R VE+SDI+NLVYLQA+VKETLRL+PP P LVP E++EDC V GY +P+
Sbjct  323  QKEIDVHVGTTRWVEESDIKNLVYLQAIVKETLRLYPPGPLLVPRESLEDCYVDGYLVPR  382

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GTQL VN W+LHRD  IW  P +F PERFL +  + +   +QF+++PFGSGRR CPG+  
Sbjct  383  GTQLLVNAWKLHRDARIWENPYEFHPERFLTSHGSTDVRGQQFEYVPFGSGRRLCPGISS  442

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            ++++ HLTL+RLLQGFNFST  NA +DM+EGLG+TLP+A PLEV++TPRL
Sbjct  443  SLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTLPKATPLEVVLTPRL  492



>ref|XP_002300088.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
 gb|EEE84893.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
Length=527

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 134/171 (78%), Gaps = 5/171 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG ER  EDSDI NLVY+QA++KETLRL+PP P  VPHEA +D  V GYHIPK
Sbjct  350  QEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATKDFCVAGYHIPK  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GT+L+ N+W+LHRDP +WS P++++PERFL      DV  +  F+ IPFGSGRRSCPG+ 
Sbjct  410  GTRLFANLWKLHRDPNLWSNPDEYMPERFLTDHANVDVLGH-HFELIPFGSGRRSCPGIT  468

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +A++V HLT ARLLQGF+  T +  ++DMTEG+ ITLP+A PLE+ +TPRL
Sbjct  469  FALQVLHLTFARLLQGFDMKTPTGESVDMTEGVAITLPKATPLEIQITPRL  519



>ref|XP_003635525.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=518

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 135/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI+NL+YLQA VKETLRL+PP P LVPHEA++DC+V GYHIPK
Sbjct  344  QEELDLKVGRGRWVEESDIQNLIYLQAAVKETLRLYPPGPLLVPHEAIQDCSVCGYHIPK  403

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW+LHRDP+ WS PE+F PERFL      N   +  + IPF SGRRSCPG+  
Sbjct  404  GTRLLVNVWKLHRDPDAWSDPEEFQPERFLTTHANLNVFGQHSELIPFSSGRRSCPGIAL  463

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HLT+ARLLQG++ +T  NA +DMTEG+G+ +P+  PLEV++TPRL
Sbjct  464  ALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGLAMPKETPLEVMLTPRL  513



>gb|AJD25203.1| cytochrome P450 CYP82V2 [Salvia miltiorrhiza]
Length=534

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 133/170 (78%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q EID KVG +R V++SDI+NLVYLQAVVKE LRL PP P  VPHEAMEDC V GYH+ +
Sbjct  358  QAEIDDKVGKDRWVQESDIKNLVYLQAVVKEALRLFPPGPLAVPHEAMEDCRVAGYHVAR  417

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVA-ANRQFQFIPFGSGRRSCPGMLY  351
            GT++ VNVW+LHRDP +W +P++F+PERFL   ADV       +FIPFGSGRRSCPG+ +
Sbjct  418  GTRILVNVWKLHRDPRVWEEPDEFVPERFLTRHADVDFTGHHHEFIPFGSGRRSCPGITF  477

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A +VTHLT+ARL+QGF F T  +  +DMTEGLGITLP+A  L VLV PRL
Sbjct  478  ATQVTHLTMARLIQGFEFRTPLDEPVDMTEGLGITLPKATLLRVLVAPRL  527



>ref|XP_011101555.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=519

 Score =   229 bits (585),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 135/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            ++EID KVG +R V++SDI NL YLQA++KE+LRL+PPLP  +PH+A+EDC +  Y IPK
Sbjct  344  RQEIDDKVGNQRWVQESDINNLPYLQAIIKESLRLYPPLPLSIPHQAVEDCHLSNYLIPK  403

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT L+VN+W+LH D   W +P +F+PERFL      +   +Q+++IPFG+GRRSCPG  +
Sbjct  404  GTLLFVNIWKLHHDARFWPEPNRFMPERFLTGHTQVDVMGQQYEYIPFGTGRRSCPGTTF  463

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+VT LT+ARL+QGF+F+T  N A+DM EG+GIT+PR NPLEVLVTPRL
Sbjct  464  AMQVTSLTVARLIQGFDFATEGNEAVDMAEGIGITMPRKNPLEVLVTPRL  513



>gb|ABD39485.1| CYP82E2v4 [Nicotiana tabacum]
Length=517

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG  R VE+SDI++LVYLQA+VK+ LRL+PP P LVPHE ++DC V GYHIPK
Sbjct  345  QEEIDTKVGKYRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHEYVKDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA-ANRQFQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++ S P+KF PERF+  D+      ++FIPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLLSNPDKFDPERFIAGDIDFRGHHYEFIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++ ALDM EG GIT+ + NP+E+++TPRL
Sbjct  465  QVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRL  512



>gb|ABD39474.1| CYP82E4v3 [Nicotiana tabacum]
Length=517

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++   DM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPSDMKEGAGITIRKVNPVELIIAPRL  512



>emb|CBI36493.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI NL YLQAV+KETLRL+   P  VPHEAMEDC V GYHIPK
Sbjct  162  QEELDLKVGRGRWVEESDIPNLHYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPK  221

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAA-NRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE F PERFL   AD+    + F+ IPFGSGRRSCPG+  
Sbjct  222  GTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITM  281

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HL + RLLQGF+ ST  NA +DM EGL I L +  PLEV++TPRL
Sbjct  282  ALKLLHLVIGRLLQGFDLSTPLNAPVDMREGLSIILAKVTPLEVMLTPRL  331



>emb|CAN65652.1| hypothetical protein VITISV_016780 [Vitis vinifera]
Length=473

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R VE SDI+NLVY++A+VKETLRL+   P LVPHEAMEDC VGGYHI K
Sbjct  299  QEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISK  358

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN W+LHRDP +WS PE+F PERFL +    +   + F+ IPFGSGRRSCPG+  
Sbjct  359  GTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNM  418

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             +++ HLT+ARLLQGF+ +  SN+ +DMTEG+ + L +  PLEV++TPRL
Sbjct  419  GLQMLHLTIARLLQGFDMTKPSNSPVDMTEGISVALSKLTPLEVMLTPRL  468



>ref|XP_011045174.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=531

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG ER  EDSDI NLVY+QA++KETLRL+PP P  VPHEA ED  V GYH+PK
Sbjct  353  QEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATEDFCVAGYHMPK  412

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+ N+W+LHRDP +WS P++++PERFL      +     F+ IPFGSGRRSCPG+ +
Sbjct  413  GTRLFTNLWKLHRDPNLWSNPDEYMPERFLNDHANLDVLGHHFELIPFGSGRRSCPGITF  472

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLT ARLLQGF+  T    ++DMTEG+ ITLP+A PLE+ +TPRL
Sbjct  473  ALQVLHLTFARLLQGFDMKTPRGESVDMTEGVAITLPKATPLEIHITPRL  522



>ref|XP_011045172.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
 ref|XP_011045173.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=541

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG ER  EDSDI NLVY+QA++KETLRL+PP P  VPHEA ED  V GYH+PK
Sbjct  363  QEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATEDFCVAGYHMPK  422

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+ N+W+LHRDP +WS P++++PERFL      +     F+ IPFGSGRRSCPG+ +
Sbjct  423  GTRLFTNLWKLHRDPNLWSNPDEYMPERFLNDHANLDVLGHHFELIPFGSGRRSCPGITF  482

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLT ARLLQGF+  T    ++DMTEG+ ITLP+A PLE+ +TPRL
Sbjct  483  ALQVLHLTFARLLQGFDMKTPRGESVDMTEGVAITLPKATPLEIHITPRL  532



>ref|XP_007049687.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOX93844.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 136/170 (80%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG ++ V+DSDIE LVYLQAV+KETLRL+PP P  VPHEA EDC++ GYH+ K
Sbjct  350  QEELDLTVGRDKWVQDSDIEKLVYLQAVIKETLRLYPPGPISVPHEAREDCSISGYHVQK  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT++ VN+ RLHRDP IWS P++F PERFL +    +   + F+ IPFGSGRRSCPGM  
Sbjct  410  GTRVIVNLRRLHRDPRIWSNPDEFQPERFLTSHANVDVLGQHFELIPFGSGRRSCPGMPL  469

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++THLT+AR LQGF+ +T  N ++DMTEGLGIT+P+A PL+VL++PRL
Sbjct  470  ALQITHLTIARTLQGFDLTTPFNESVDMTEGLGITMPKATPLDVLLSPRL  519



>gb|ABD39477.1| CYP82E4v6 [Nicotiana tabacum]
Length=517

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++W  P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLLRDPKLWPDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>gb|AGD93125.1| CYP450 nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L  DP++WS P+ F PERF+  D+    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQCDPKLWSDPDTFDPERFIAIDIDFRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>ref|XP_002264464.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R VE SDI+NLVY++A+VKETLRL+   P LVPHEAMEDC VGGYHI K
Sbjct  345  QEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN W+LHRDP +WS PE+F PERFL +    +   + F+ IPFGSGRRSCPG+  
Sbjct  405  GTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNM  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             +++ HLT+ARLLQGF+ +  SN+ +DMTEG+ + L +  PLEV++TPRL
Sbjct  465  GLQMLHLTIARLLQGFDMTKPSNSPVDMTEGISVALSKLTPLEVMLTPRL  514



>ref|XP_004292356.1| PREDICTED: cytochrome P450 82C4-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG  R VED+DI+NLVYLQA+ KETLRL+PP P  VPHEAMEDC VGG+H+PK
Sbjct  316  QEELDRIVGRHRWVEDTDIKNLVYLQAIAKETLRLYPPGPLSVPHEAMEDCKVGGFHVPK  375

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAA-NRQFQFIPFGSGRRSCPGMLY  351
            GT LYVN+W+LHRDP +W  PE F PERFL  +A V A  + F+FIPFG+GRR CPG+  
Sbjct  376  GTHLYVNLWKLHRDPNVWPDPEVFSPERFLTTQASVDAFGQHFEFIPFGAGRRICPGITL  435

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A ++ HLT+ARL+QGF  +T  + A+DMTEG G+++ RA  LEV++T RL Y L
Sbjct  436  AFQLMHLTVARLIQGFELATPLDKAVDMTEGSGLSMARATALEVVLTARLAYEL  489



>gb|KDP45300.1| hypothetical protein JCGZ_15165 [Jatropha curcas]
Length=475

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 137/172 (80%), Gaps = 5/172 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D KVG ER V+DSDIE LVYLQAV+KETLRL+PP P  VPHEA+EDC +  Y+IPK
Sbjct  297  QQELDLKVGRERCVQDSDIEKLVYLQAVIKETLRLYPPGPLAVPHEAVEDCYISRYYIPK  356

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA----ANRQFQFIPFGSGRRSCPGML  348
            GT+++ N+W+LHRDP +WS P++FLPERFL  +      + + F++IPFGSGRRSCPG+ 
Sbjct  357  GTRIFANLWKLHRDPNVWSNPDEFLPERFLANEGKNVDFSGQNFEYIPFGSGRRSCPGIN  416

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMT-EGLGITLPRANPLEVLVTPRL  501
            +A++   +T+ARLLQ F+F+T    A+DMT EG+GITLP+A PLE+ +TPRL
Sbjct  417  FAIQAIQMTVARLLQAFSFTTPFGQAVDMTHEGIGITLPKATPLEIQITPRL  468



>emb|CBI36489.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI NL+YLQAV+KETLRL+   P   PHEAMEDC V GYHIPK
Sbjct  139  QEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPK  198

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE F PERFL   AD+    + F+ IPFGSGRRSCPG+  
Sbjct  199  GTRLFVNAWKLHRDPSVWSDPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITM  258

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++  L + RLLQGF+ ST  NA +DM EGL ITL +  PLEV++TPRL
Sbjct  259  ALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRL  308



>gb|KDP26346.1| hypothetical protein JCGZ_17504 [Jatropha curcas]
Length=515

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R V+DSDIE L Y  AV+KETLRL+PP P  VP EA EDCT+ GYHIPK
Sbjct  337  QEELDQKVGRDRWVDDSDIEKLDYFSAVIKETLRLYPPGPLGVPREATEDCTIAGYHIPK  396

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+ N+W+LHRDP +W+ PE+F PERFL  +     + + F+++PFG+GRRSCPG+ +
Sbjct  397  GTRLFTNLWKLHRDPNVWADPEEFKPERFLTDNANLDVSGQHFEYLPFGAGRRSCPGLNF  456

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+V ++TLARLLQ ++F T  N  +DMTEG GI LP+  PLEV++TPRL
Sbjct  457  AMQVMNITLARLLQAYDFRTPGNEPVDMTEGKGIALPKITPLEVVLTPRL  506



>gb|ABD39484.1| CYP82E2v3 [Nicotiana tabacum]
Length=517

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VK+ LRL+PP P LVPHE ++DC V GYHIPK
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENVKDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA-ANRQFQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++ S P+KF PERF+  D+      ++FIP GSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLLSNPDKFDPERFIAGDIDFRGHHYEFIPSGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++TPRL
Sbjct  465  QVEHLTMAHLIQGFNYKTPNDEVLDMKEGAGITIRKVNPVELIITPRL  512



>ref|XP_006384482.1| hypothetical protein POPTR_0004s15470g [Populus trichocarpa]
 gb|ERP62279.1| hypothetical protein POPTR_0004s15470g [Populus trichocarpa]
Length=344

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 133/174 (76%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D +VG  R V+++DI+NLVYLQA+VKET+RL+P  P   P +AMEDCTV G+HIP 
Sbjct  168  QDELDIQVGKHRQVDETDIKNLVYLQAIVKETMRLYPAAPLSAPRQAMEDCTVAGFHIPA  227

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IWS P +F PERFL+     +   + F+++PFGSGRR CPG+  
Sbjct  228  GTRLLVNLWKLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEYVPFGSGRRMCPGISL  287

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A++V HLTLARLL GF   TVS+A +DM+EG GIT+P+  PLEV++ PRLH  L
Sbjct  288  ALQVLHLTLARLLHGFEMGTVSDALIDMSEGPGITIPKETPLEVILRPRLHSSL  341



>gb|ABD39482.1| CYP82E4v12 [Nicotiana tabacum]
Length=517

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKV  +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  345  QEEIDTKVCKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++WS P+ F PERF+  D+    Q +++IPFG GRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPFGPGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ T ++  LDM EG GIT+ + NP+E+++ PRL
Sbjct  465  QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRL  512



>emb|CDP15065.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID+ VG ER  E+SDI NLVYLQA+VKE++RL+PP P  +P +AMEDC V GY I  
Sbjct  349  QEEIDSNVGKERWAEESDINNLVYLQAIVKESIRLYPPAPLSLPRQAMEDCNVSGYRISM  408

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GTQL+VNVW+L RDP IWS+P++FLPERFL  +V     N +F F PFGSGRRSCPG+  
Sbjct  409  GTQLFVNVWKLQRDPRIWSEPDQFLPERFLNGEVDFSGKNFEFSFTPFGSGRRSCPGIPL  468

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A +VTHLTLARLLQGF+ +T S+  +DMTE   I++ +A PLEV++ PRL
Sbjct  469  ATQVTHLTLARLLQGFDLTTPSDLPVDMTEDTSISMGKATPLEVVILPRL  518



>ref|XP_009778755.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=515

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  346  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  405

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQFQFIPFGSGRRSCPGMLYAMR  360
            GT+L+ NV +L RDP++W  P+ F PERF+  D    + +++IPFGSGRRSCPGM YA++
Sbjct  406  GTRLFANVMKLQRDPKLWPNPDNFDPERFV-IDFRG-QHYEYIPFGSGRRSCPGMTYALQ  463

Query  361  VTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            V HLT+A L+QGFN+ T +N  LDM EG GIT+ + N +EVL+ PRL
Sbjct  464  VEHLTMAHLIQGFNYRTPTNEPLDMKEGAGITIRKVNSVEVLIKPRL  510



>ref|XP_009595933.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana tomentosiformis]
Length=523

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDT VG +R VE+SDI+NLVYLQA+VKE LRL+PP P  VPHE++EDC V GYHIPK
Sbjct  347  QEEIDTIVGKDRWVEESDIKNLVYLQAIVKEALRLYPPAPLSVPHESVEDCVVNGYHIPK  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT L  NV +L RDP++W  P KF PERFL      +   + ++ IPFG+GRR+CP M Y
Sbjct  407  GTVLLPNVMKLQRDPKMWLDPNKFDPERFLTTHAKIDYRGQHYELIPFGTGRRACPAMTY  466

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V +L++A L+QGFNF+T SN  LDM EG+GIT P+ NP+EVL+TPRL
Sbjct  467  ALQVEYLSIAHLIQGFNFNTPSNEPLDMKEGVGITSPKKNPIEVLITPRL  516



>ref|XP_009627979.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=517

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GY+I K
Sbjct  345  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENIEDCVVSGYYISK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++W  P+ F PERF+ A +    Q +++IPFGSGRRSCPGM YA+
Sbjct  405  GTRLFANVMKLQRDPKLWPNPDNFDPERFVAAGIDFRGQHYEYIPFGSGRRSCPGMTYAL  464

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V HLT+A L+QGFN+ST ++  LDM EG GIT+ + NP+EV++  RL
Sbjct  465  QVEHLTMAHLIQGFNYSTPNDEPLDMKEGAGITIRKVNPVEVIIMSRL  512



>ref|XP_002264473.1| PREDICTED: cytochrome P450 82C4-like [Vitis vinifera]
Length=519

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI+ L YL+A++KE+LRL+P  P LVPHEA +DC V GYHIPK
Sbjct  345  QEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYPAAPLLVPHEATQDCHVCGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE+F PERFL +    +    QF+ IPFGSGRR+CPG+  
Sbjct  405  GTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINM  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HLT ARLLQGF+ +T SNA +DMTEG+  T+P+  PL V++TPRL
Sbjct  465  ALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLRVMLTPRL  514



>ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
 gb|KHN04535.1| Cytochrome P450 82C4 [Glycine soja]
Length=526

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 128/169 (76%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG ER VE+SDI NL Y+QA++KETLRL+P  P L P EA EDC V GYH+P 
Sbjct  351  QEELDLNVGMERQVEESDIRNLAYVQAIIKETLRLYPAGPLLGPREAQEDCNVAGYHVPA  410

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANR--QFQFIPFGSGRRSCPGMLYA  354
            GT+L VN+W++HRDP +W +P  F PERFL +D    R   F+ IPFGSGRRSCPGM +A
Sbjct  411  GTRLVVNLWKIHRDPRVWQEPSAFRPERFLTSDAVDVRGQNFELIPFGSGRRSCPGMSFA  470

Query  355  MRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            ++V HLTLARLL  F F+T S+  +DMTE  G+T+P+A PLEVL+TPRL
Sbjct  471  LQVLHLTLARLLHAFEFATPSDQPVDMTESPGLTIPKATPLEVLLTPRL  519



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 128/169 (76%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG ER VE+SDI NL YLQA++KETLRL+P  P L P EA EDC VGGY +P 
Sbjct  353  QEELDLNVGMERQVEESDIRNLAYLQAIIKETLRLYPAGPLLGPREAQEDCNVGGYDVPA  412

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANR--QFQFIPFGSGRRSCPGMLYA  354
            GT+L VN+W++HRDP +W +P  F PERFL +D    R   F+ IPFGSGRRSCPGM +A
Sbjct  413  GTRLVVNLWKIHRDPRVWEEPSAFRPERFLTSDAVDVRGQNFELIPFGSGRRSCPGMSFA  472

Query  355  MRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            ++V HLTLARLL  F F+T S+  +DMTE  G+T+P+A PLEVL+TPRL
Sbjct  473  LQVLHLTLARLLHAFEFATPSDEPVDMTESPGLTIPKATPLEVLLTPRL  521



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 133/171 (78%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D +VGT RLV+DSDI+NLVYLQA++KETLRL+P  P L P EA+EDCTV GYH+P 
Sbjct  351  QQELDIEVGTNRLVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVSGYHVPA  410

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +WS PE F PERFL      +   +QF+ IPFGSGRRSCPG  +
Sbjct  411  GTRLVVNVWKIQRDPTVWSNPEAFEPERFLTTHAHVDVRGQQFELIPFGSGRRSCPGASF  470

Query  352  AMRVTHLTLARLLQGFNFST-VSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLLQ F FS  +    +DMTE  G+T+P+A+PLEVL++PRL
Sbjct  471  ALQVLHLTLARLLQAFEFSNPLDGRPVDMTENPGLTIPKAHPLEVLLSPRL  521



>ref|XP_002274740.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=518

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI NL+YLQAV+KETLRL+   P  VPHEAMEDC V GYHIPK
Sbjct  344  QEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPK  403

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE F PERFL   AD+    + F+ IPFGSGRRSCPG+  
Sbjct  404  GTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITM  463

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++  L + RLLQGF+ ST  NA +DM EGL ITL +  PLEV++TPRL
Sbjct  464  ALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVILTPRL  513



>gb|KHG01223.1| Cytochrome P450 protein [Gossypium arboreum]
Length=522

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R VE+SDI NLVYLQA+++ETLRL+P  P LVP EAMEDCTV G+HIP 
Sbjct  347  QEELDIHVGNQRQVEESDIANLVYLQAIIRETLRLYPATPILVPREAMEDCTVAGFHIPA  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+L RDP IW +P  FLPERFL   A++    Q F+ IPFGSGRR CPG+ +
Sbjct  407  GTRLLVNLWKLQRDPRIWHKPLDFLPERFLSDHANIDVRGQNFELIPFGSGRRICPGITF  466

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+   HLTLARLL GF + TVS+ A+DM E  GIT+P+A PLEV +TP+L
Sbjct  467  ALHFQHLTLARLLHGFKWGTVSDKAVDMCESPGITVPKATPLEVTITPKL  516



>ref|XP_009782771.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82G1-like, partial 
[Nicotiana sylvestris]
Length=309

 Score =   216 bits (549),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 129/168 (77%), Gaps = 4/168 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEIDTKVG +R VE+SDI++LVYLQA+VKE LRL+PP P LVPHE +EDC V GYHIPK
Sbjct  140  QEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPK  199

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L+ NV +L RDP++W  P+ F PERF+ AD+    Q +++IPFGSGRRSCPG+ YA+
Sbjct  200  GTRLFANVMKLQRDPKLWPNPDNFDPERFVAADIDFRGQHYEYIPFGSGRRSCPGVTYAL  259

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +V H     L+QGFN+ T +N  LDM EG  IT+ + NP+EVL+ P L
Sbjct  260  QVEH---XHLIQGFNYRTPTNEPLDMKEGARITIRKVNPVEVLIKPSL  304



>gb|KDO38290.1| hypothetical protein CISIN_1g0485651mg, partial [Citrus sinensis]
Length=302

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D +VGT+R V   DI+NLVYLQA++KE +RL+P +PFL PHE+ME+CTV GYH+P 
Sbjct  127  QNELDIQVGTKRQVNAEDIKNLVYLQAILKEAMRLYPAVPFLFPHESMEECTVNGYHVPA  186

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQL++N W++ RD  +W +P KF PERFL    D+    Q F+ +PFGSGRR CPG+ +
Sbjct  187  GTQLFINAWKIQRDASVWEEPSKFQPERFLTRHKDIDVKGQNFELLPFGSGRRMCPGVSF  246

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V   TLA LLQGF+F+T SN  +DM E LG+T+ ++ P EVLVTPRL     G
Sbjct  247  ALQVMQFTLASLLQGFDFATPSNEPVDMGERLGLTMEKSQPFEVLVTPRLSAAFYG  302



>emb|CAN61061.1| hypothetical protein VITISV_018742 [Vitis vinifera]
Length=542

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI NL+YLQAV+KETLRL+   P  VPHEAMEDC V GYHIPK
Sbjct  368  QEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPK  427

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE F PERFL +        + F+ IPFGSGRRSCPG+  
Sbjct  428  GTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADFDVLGQHFELIPFGSGRRSCPGITM  487

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++  L + RLLQGF+ ST  NA +DM EGL ITL +  PLEV++TPRL
Sbjct  488  ALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVILTPRL  537



>ref|XP_006375022.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
 gb|ERP52819.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
Length=519

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG ER VEDSD++NLVYLQA++KETLRL+P  P L P EAMEDC V GYH+P 
Sbjct  343  QEELDLHVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCKVAGYHVPA  402

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +W+ P  FLPERFL    DV    +QF+ IPFGSGRRSCPG+ +
Sbjct  403  GTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVRGQQFELIPFGSGRRSCPGVSF  462

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLL  F  +T  +  +D+TE  G+T+P+A PLEV++TPRL
Sbjct  463  ALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTIPKATPLEVILTPRL  512



>ref|XP_006423130.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
 ref|XP_006479372.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
 ref|XP_006479373.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
 ref|XP_006479374.1| PREDICTED: cytochrome P450 82C4-like isoform X3 [Citrus sinensis]
 gb|ESR36370.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
Length=524

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  VG  R VE+SDI+NL+YLQA+VKETLRL PPLP   P EAMEDCT+ G+HIP 
Sbjct  350  QDELDIHVGKNRQVEESDIKNLIYLQAIVKETLRLCPPLPLSAPREAMEDCTIDGFHIPA  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VN+W++HRDP IW+ P +F+P+RFL   A +  N Q F+F+PFGSGRR CPG+ +
Sbjct  410  GTRLIVNLWKMHRDPSIWANPSEFIPDRFLNENAKLDVNGQDFEFLPFGSGRRKCPGISF  469

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLL  F+  TVS+  +DM+   GIT+P+A PLEV +TPR+
Sbjct  470  ALQVQHLTLARLLHAFSLGTVSDTLVDMSGSPGITVPKATPLEVTLTPRV  519



>gb|KDO38173.1| hypothetical protein CISIN_1g0106222mg, partial [Citrus sinensis]
Length=171

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +1

Query  22   VGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPKGTQLYVN  201
            VG  R VE+SDI+NL+YLQA+VKETLRL+P LP   P EAMEDC +GG+HIP GT+L VN
Sbjct  3    VGNNRQVEESDIKNLIYLQAIVKETLRLYPALPLSAPREAMEDCIIGGFHIPAGTRLIVN  62

Query  202  VWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLYAMRVTHL  372
            +W++HRDP IW+ P +F+PERFL  +       + F+F+PFGSGRR CPG+ +A++V HL
Sbjct  63   LWKMHRDPSIWANPSEFIPERFLNENANLEVKGQDFEFLPFGSGRRKCPGISFALQVLHL  122

Query  373  TLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            TLARLL  F   TVS+  +DM E  G+T+P+A  LEV +TPRL
Sbjct  123  TLARLLHAFELGTVSDTLVDMRESPGMTVPKATALEVTLTPRL  165



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D ++G +R V+DSDI+NLVYLQA++KETLRL+P  P L P EAMEDCTV GYHIP 
Sbjct  323  QEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPA  382

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +W  P  F PERFL +    +   +QF+ IPFGSGRRSCPG  +
Sbjct  383  GTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASF  442

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLL  F  +T S+  +DMTE  G+T+P+A PLEV+++PRL
Sbjct  443  ALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLEVVLSPRL  492



>emb|CAN75482.1| hypothetical protein VITISV_020998 [Vitis vinifera]
Length=500

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI NL+YLQAV+KETLRL+   P   PHEAMEDC V GYHIPK
Sbjct  326  QEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPK  385

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE F PERFL   AD+    + F+ IPFGSGRRSCPG+  
Sbjct  386  GTRLFVNAWKLHRDPSVWSDPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITM  445

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++  L + RLLQGF+ ST  NA +DM EGL ITL +  PLEV++TPRL
Sbjct  446  ALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRL  495



>emb|CDP15067.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 130/175 (74%), Gaps = 9/175 (5%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG +R VE+SDI++L Y+QA+ KETLRL+PP P  VP  A+EDCTVGGY IPK
Sbjct  302  QEEIDRHVGKDRWVEESDIKSLAYIQAISKETLRLYPP-PISVPRRAIEDCTVGGYLIPK  360

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEA--------DVAANRQFQFIPFGSGRRSC  336
             T L+VNVW+LHRDP +WS+P+KFLPERFL +        D   +  + F PFGSGRRSC
Sbjct  361  NTLLFVNVWKLHRDPRVWSEPDKFLPERFLNSCNGPRKMHDDGYSLDYAFTPFGSGRRSC  420

Query  337  PGMLYAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            PGML A +V +L +ARLLQGF F+T SN  +DMTEGLG  L +  PLEVL+ PRL
Sbjct  421  PGMLMATQVIYLIVARLLQGFEFTTPSNLPVDMTEGLGTRLCKTTPLEVLIKPRL  475



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG ER VEDSD++NLVYLQA++KETLRL+P  P L P EAMEDC V GYH+P 
Sbjct  350  QEELDLLVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCKVAGYHVPA  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEA--DV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +W+ P  FLPERFL +  DV    +QF+ IPFGSGRRSCPG+ +
Sbjct  410  GTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVRGQQFELIPFGSGRRSCPGVSF  469

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLL  F  +T  +  +D+TE  G+T+P+A PLEV++TPRL
Sbjct  470  ALQVLHLTLARLLHSFQLATPMDQPVDLTESSGLTIPKATPLEVILTPRL  519



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D ++G +R V+DSDI+NLVYLQA++KETLRL+P  P L P EAMEDCTV GYHIP 
Sbjct  345  QEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPA  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +W  P  F PERFL +    +   +QF+ IPFGSGRRSCPG  +
Sbjct  405  GTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASF  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLL  F  +T S+  +DMTE  G+T+P+A PLEV+++PRL
Sbjct  465  ALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLEVVLSPRL  514



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D ++G +R V+DSDI+NLVYLQA++KETLRL+P  P L P EAMEDCTV GYHIP 
Sbjct  352  QEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPA  411

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +W  P  F PERFL +    +   +QF+ IPFGSGRRSCPG  +
Sbjct  412  GTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASF  471

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLL  F  +T S+  +DMTE  G+T+P+A PLEV+++PRL
Sbjct  472  ALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLEVVLSPRL  521



>emb|CAN81014.1| hypothetical protein VITISV_025152 [Vitis vinifera]
Length=519

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI+ L YL+A++KE+LRL+   P LVPHEA +DC V GYHIPK
Sbjct  345  QEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYXAAPLLVPHEATQDCHVCGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE+F PERFL +    +    QF+ IPFGSGRR+CPG+  
Sbjct  405  GTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINM  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HLT ARLLQGF+ +T SNA +DMTEG+  T+P+  PL V++TPRL
Sbjct  465  ALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLXVMLTPRL  514



>ref|XP_009364162.1| PREDICTED: cytochrome P450 82C4-like [Pyrus x bretschneideri]
Length=529

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VGTER VE+SDI NLVYLQA++KETLRL+P  P L P EA+EDCTV GY +P 
Sbjct  354  QEELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVAGYRVPA  413

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +W  P  F+PERFLE+    +   +QF  +PFG GRRSCPG+ +
Sbjct  414  GTRLVVNVWKIQRDPRVWESPSAFVPERFLESHSHVDVRGQQFNLMPFGFGRRSCPGVSF  473

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+V HLTLARLL GF   T S  A+D+TE  G+T+P+A PLE L++PRL
Sbjct  474  AMQVLHLTLARLLHGFKIETASGQAIDLTESPGLTIPKATPLEALLSPRL  523



>ref|XP_002274509.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=543

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI NL+YLQAV+KETLRL+   P   PHEAMEDC V GYHIPK
Sbjct  369  QEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPK  428

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE F PERFL   AD+    + F+ IPFGSGRRSCPG+  
Sbjct  429  GTRLFVNAWKLHRDPSVWSDPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITM  488

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++  L + RLLQGF+ ST  NA +DM EGL ITL +  PLEV++TPRL
Sbjct  489  ALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRL  538



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VGTER VE+SDI NLVYLQA++KETLRL+P  P L P EA+EDCTV GY +P 
Sbjct  354  QEELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVAGYRVPA  413

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +W  P  F+PERFLE+    +   +QF  +PFG GRRSCPG+ +
Sbjct  414  GTRLVVNVWKIQRDPRVWENPSAFVPERFLESHSHVDVRGQQFNLMPFGFGRRSCPGVSF  473

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+V HLTLARLL GF   T S  ++D+TE  G+T+P+A PLEVL++PRL
Sbjct  474  AMQVLHLTLARLLHGFKIETASGQSVDLTESPGLTIPKATPLEVLLSPRL  523



>ref|XP_006347265.1| PREDICTED: cytochrome P450 82C3-like isoform X1 [Solanum tuberosum]
Length=232

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 125/170 (74%), Gaps = 4/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
             EEIDTKVG  R VED DI+NL Y QA +KE LRL+PP P LV HEA+ DC V GYHI K
Sbjct  57   HEEIDTKVGKNRWVEDLDIKNLTYFQATIKEVLRLYPPSPMLV-HEALADCQVLGYHISK  115

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VNVW+L +D + W +PEKFLPERFL      +   +  +FIPFGSGRRSCPG+  
Sbjct  116  GTRLFVNVWKLQKDSKFWPEPEKFLPERFLTTKAKVDVYGKDLEFIPFGSGRRSCPGITM  175

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+VT+L++ARLLQ F+F T +N  +DMTEG G T  +  PLEV+V PR+
Sbjct  176  AMQVTYLSIARLLQAFDFETPNNEPVDMTEGPGFTAVKKIPLEVVVKPRM  225



>ref|XP_006347266.1| PREDICTED: cytochrome P450 82C3-like isoform X2 [Solanum tuberosum]
Length=221

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 125/170 (74%), Gaps = 4/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
             EEIDTKVG  R VED DI+NL Y QA +KE LRL+PP P LV HEA+ DC V GYHI K
Sbjct  46   HEEIDTKVGKNRWVEDLDIKNLTYFQATIKEVLRLYPPSPMLV-HEALADCQVLGYHISK  104

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VNVW+L +D + W +PEKFLPERFL      +   +  +FIPFGSGRRSCPG+  
Sbjct  105  GTRLFVNVWKLQKDSKFWPEPEKFLPERFLTTKAKVDVYGKDLEFIPFGSGRRSCPGITM  164

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+VT+L++ARLLQ F+F T +N  +DMTEG G T  +  PLEV+V PR+
Sbjct  165  AMQVTYLSIARLLQAFDFETPNNEPVDMTEGPGFTAVKKIPLEVVVKPRM  214



>ref|XP_007049686.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOX93843.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
Length=590

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 132/171 (77%), Gaps = 5/171 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D K+G +R VED DIE LVYLQA++KET RL+P  P  VPH+AME C + GYHIPK
Sbjct  414  QEELDLKIGRDRWVEDCDIEKLVYLQAIIKETFRLYPAAPLSVPHQAMEYCRISGYHIPK  473

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEA----DVAANRQFQFIPFGSGRRSCPGML  348
            GT+L+VNVW+L RDP IWS PE+F PERFL +    D+   + F+ IPFGSGRRSCPGM 
Sbjct  474  GTRLFVNVWKLQRDPRIWSNPEEFEPERFLTSYQNVDILG-QHFELIPFGSGRRSCPGMS  532

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +A++V  LT+ARLLQGF+ +T  NA +DMTE  G T+ +A PL++++TPRL
Sbjct  533  WALQVIRLTIARLLQGFDLATPLNAPVDMTEEPGGTMSKATPLQLVLTPRL  583



>ref|XP_006479335.1| PREDICTED: cytochrome P450 82G1-like [Citrus sinensis]
Length=380

 Score =   216 bits (549),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V +SD++NL YL+A+VKETLR++PP P     EAMEDC +GGYH+PK
Sbjct  203  QEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVTGIREAMEDCEIGGYHVPK  262

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VNVW+LHRDP +W  P +F PERFL   ADV  N Q F++IPF  GRRSCPGM  
Sbjct  263  GTRLIVNVWKLHRDPRMWENPCEFRPERFLTTHADVDVNTQHFEYIPFSFGRRSCPGMTS  322

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             +++  LTLAR+LQGF+ +TV    +DM EGLGI LP+ NP+EV++ PRL
Sbjct  323  GLQIVQLTLARILQGFDLATVGGIPVDMKEGLGIALPKLNPVEVVIKPRL  372



>ref|XP_002264520.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=567

 Score =   220 bits (561),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI+ L YL+A++KE+LRL+   P LVPHEA +DC V GYHIPK
Sbjct  393  QEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYSAAPLLVPHEATQDCHVCGYHIPK  452

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE+F PERFL +    +    QF+ IPFGSGRR+CPG+  
Sbjct  453  GTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINM  512

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HLT ARLLQGF+ +T SNA +DMTEG+  T+P+  PL V++TPRL
Sbjct  513  ALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLCVMLTPRL  562



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE++ +VGTER V++SDI+NLVYLQA++KETLRL+P  P L P EA+EDCTV GYH+P 
Sbjct  343  QEELELQVGTERQVDESDIKNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVAGYHVPA  402

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEA----DVAANRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP +W  P  F PERFL +    DV   +QF+ +PFGSGRRSCPG+ 
Sbjct  403  GTRLVVNVWKIQRDPSVWENPSAFEPERFLTSHGHVDVRG-QQFELMPFGSGRRSCPGVS  461

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +AM+V HLTLARLL  F F T     +DMTE  G+T+P+A PLEVL+TPRL
Sbjct  462  FAMQVLHLTLARLLHAFEFETPLGQRIDMTESPGLTIPKATPLEVLLTPRL  512



>emb|CAN63328.1| hypothetical protein VITISV_012723 [Vitis vinifera]
Length=212

 Score =   210 bits (534),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E++  VG  R V+ SDI+NLVYLQA+VKETLRL+PP P  VPHEAMEDCTV G+HI  
Sbjct  33   QAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSVPHEAMEDCTVAGFHIQA  92

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F PERFL      +   + ++ +PFGSGRR CPG+ +
Sbjct  93   GTRLLVNLWKLHRDPRVWLDPLEFQPERFLTNHAGLDVRGKNYELLPFGSGRRVCPGISF  152

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+ +THL LARLL GF    V+++ +DMTEG G++ P+A PLEV + PRL + L
Sbjct  153  ALELTHLALARLLHGFELGVVADSPVDMTEGPGLSAPKATPLEVTIVPRLPFEL  206



>gb|AJD25202.1| cytochrome P450 CYP82U4 [Salvia miltiorrhiza]
Length=522

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  +G +R V++SDI NL YLQA+ KETLRL+PP P   P EA+EDC +GGYH+P+
Sbjct  345  QDEIDNNIGRDRFVQESDINNLTYLQAIFKETLRLYPPGPLSGPREALEDCHIGGYHVPR  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L +N+W+LHRDP IW  P++F PERFL      N   + F+FIPF SGRR CPGM +
Sbjct  405  GTRLVLNLWKLHRDPNIWFNPDEFRPERFLNEKSQMNFKGQYFEFIPFSSGRRMCPGMTF  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++V HLTLARLLQ F+FS  +   +DM EGLGI LP+  PL+V++TPRL
Sbjct  465  GLQVIHLTLARLLQSFDFSMPNGETVDMGEGLGIALPKLKPLDVVLTPRL  514



>gb|KDO37196.1| hypothetical protein CISIN_1g019564mg [Citrus sinensis]
Length=339

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D +VGT+R V +SDI+NLVYLQA++KET+RL+P +P LVPHE+ME+C V GYH+P 
Sbjct  164  QNELDIQVGTKRQVNESDIKNLVYLQAILKETMRLYPAVPLLVPHESMEECIVNGYHVPA  223

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQ+++N W+L RDP +W +P KF P+ FL  + D+    Q F+ +PF SGRR CPG+ +
Sbjct  224  GTQIFINAWKLQRDPRVWEEPCKFHPKTFLTRQKDIDVKGQNFELLPFSSGRRMCPGVSF  283

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V   TLA LL GF+F+T SN  +DM EGLG+T+ ++ PLEVLV PRL   L G
Sbjct  284  ALQVMQFTLASLLHGFDFATPSNEPVDMGEGLGLTMEKSTPLEVLVAPRLSASLYG  339



>ref|XP_009770601.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+DT VG +R VE+SDI+NLVYLQA+VKE LRLHPP P  V H +++DC V GYHIPK
Sbjct  343  QEEMDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPK  402

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT L  N+ +L RDP+IW+ P+KF PERFL    A +   + ++ IPFG+GRR+CP M Y
Sbjct  403  GTALLTNIMKLQRDPQIWADPDKFDPERFLTTHAAIDYRGQHYELIPFGTGRRACPAMNY  462

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +++V HL++A ++QGFNF+T +N  LDM +G+G+TLP+   +EVL+TPRL
Sbjct  463  SLQVEHLSIAHMIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRL  512



>ref|XP_009792748.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+DT VG +R VE+SDI+NLVYLQA+VKE LRLHPP P  V H +++DC V GYHIPK
Sbjct  343  QEEMDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPK  402

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT L  N+ +L RDP+IW+ P+KF PERFL    A +   + ++ IPFG+GRR+CP M Y
Sbjct  403  GTALLTNIMKLQRDPQIWADPDKFDPERFLTTHAAIDYRGQHYELIPFGTGRRACPAMNY  462

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +++V HL++A ++QGFNF+T +N  LDM +G+G+TLP+   +EVL+TPRL
Sbjct  463  SLQVEHLSIAHMIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRL  512



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D +VG ERLV++SDI+NLVYLQA++KETLRL+P  P L P EAM DCTV GYH+P 
Sbjct  351  QEELDLQVGRERLVDESDIQNLVYLQAIIKETLRLYPAGPLLGPREAMNDCTVAGYHVPA  410

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +WS P  F+PERFL +    +   +QF+ IPFGSGRRSCPG  +
Sbjct  411  GTRLIVNVWKIQRDPRVWSNPSAFVPERFLTSHANVDVRGQQFELIPFGSGRRSCPGASF  470

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+++ HLTLAR L  F  ST  +  +DMTE  G+T+P+A PLEVL+ PR+
Sbjct  471  ALQLLHLTLARFLHAFELSTPLDQPVDMTESPGLTIPKATPLEVLLKPRV  520



>ref|XP_008343761.1| PREDICTED: DNA mismatch repair protein MSH6-like [Malus domestica]
Length=771

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VGTER VE+SDI NLVYLQA++KETLRL+P  P L P EA+EDCTV GY +P 
Sbjct  596  QEELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVAGYRVPA  655

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP +W  P  F+PERFLE+    +   +QF  +PFG GRRSCPG+ +
Sbjct  656  GTRLVVNVWKIQRDPRVWENPSAFVPERFLESHSHVDVRGQQFNLMPFGFGRRSCPGVSF  715

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+V HLTLARLL GF   T S  ++D+TE  G+T+P+A PLEVL++PRL
Sbjct  716  AMQVLHLTLARLLHGFKIETASGQSVDLTESPGLTIPKATPLEVLLSPRL  765



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 134/178 (75%), Gaps = 5/178 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+DTKVG + LVE+SDI NLVYLQA+VKETLRL+P      P EAMEDCTV G+HIP 
Sbjct  351  QDELDTKVGRDGLVEESDIRNLVYLQAIVKETLRLYPAAAVSAPREAMEDCTVAGFHIPA  410

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA----ANRQFQFIPFGSGRRSCPGML  348
            GTQL VN+W+L RDP IW  P +F PERFL +  A      + F+ +PFGSGRR+CPG+ 
Sbjct  411  GTQLLVNIWKLQRDPSIWPHPCEFSPERFLTSHAADIDVRGQHFELLPFGSGRRACPGIS  470

Query  349  YAMRVTHLTLARLLQGFNFST-VSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            +A++V HLTLARL+QGF+  T   +A +DMT+G+G+T  +  PL+VL+TPRLH +L G
Sbjct  471  FAIQVLHLTLARLIQGFDLGTPCCDAMVDMTQGIGLTNHKKTPLDVLLTPRLHPLLYG  528



>gb|AAP49697.1| cytochrome P-450-like protein [Vitis vinifera]
Length=259

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E++  VG  R V+ SDI+NLVYLQA+VKETLRL+PP P  +PHEAMEDCTV G+HI  
Sbjct  80   QAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHEAMEDCTVAGFHIQA  139

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F PERFL      +   + ++ +PFGSGRR CPG+ +
Sbjct  140  GTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYELLPFGSGRRVCPGISF  199

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+ +THLTLARLL GF    V+++ +DMTE  G+T P+A PLEV + PRL + L
Sbjct  200  ALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVTIVPRLPFEL  253



>gb|KEH18125.1| cytochrome P450 family protein [Medicago truncatula]
Length=506

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  +G +R VE SDI+NLVYLQA+VKETLRL+PP P LVPHE  EDC +  Y++PK
Sbjct  330  QEEIDHHIGRDRRVESSDIKNLVYLQAIVKETLRLYPPGPLLVPHEVTEDCYIQDYYVPK  389

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ---FQFIPFGSGRRSCPGMLY  351
            GT+++ NVW+LHRDP IW +PEKFLPERF+  +   + +   F+++PFG GRR+CPG L+
Sbjct  390  GTRVFANVWKLHRDPSIWLEPEKFLPERFINENGEIDHESHHFEYLPFGLGRRACPGSLF  449

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A +V  +TLARLL GF+     +  +DM EGLGITLP+  PL+V++TPRL
Sbjct  450  ATQVILITLARLLHGFDLEVPMDEVVDMREGLGITLPKLTPLQVVLTPRL  499



>ref|XP_010547839.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=501

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 130/176 (74%), Gaps = 6/176 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG  R VEDSDIENLVYLQA++KETLRL+P  P L P EAMEDCTV GY +  
Sbjct  324  QEEIDIHVGKNRQVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYQVAA  383

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-----EADVAANRQFQFIPFGSGRRSCPGM  345
            GT+L VNVW++ RDP++W  PE+F PERFL     E DV   + F+ +PFGSGRRSCPG 
Sbjct  384  GTRLIVNVWKIQRDPKVWRNPEEFRPERFLTGKETEYDVRG-QNFELMPFGSGRRSCPGA  442

Query  346  LYAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
              A++V HL+LAR+L  F+  TVS++ +DM E  G+T+P+A PLEVL+TPRL   L
Sbjct  443  SLALQVLHLSLARVLHSFDLLTVSDSEVDMRESPGLTIPKATPLEVLLTPRLEQEL  498



>ref|XP_006423133.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
 ref|XP_006479370.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR36373.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
Length=524

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+   VG  R VE+SDI+NL+YLQA+VKETLRL+P LP   P EAMEDC +GG+HIP 
Sbjct  349  QDELSIHVGNNRQVEESDIKNLIYLQAIVKETLRLYPALPLSAPREAMEDCIIGGFHIPA  408

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W++HRDP IW+ P +F+PERFL  +       + F+F+PFGSGRR CPG+ +
Sbjct  409  GTRLIVNLWKMHRDPSIWANPSEFIPERFLNENANLEVKGQDFEFLPFGSGRRKCPGISF  468

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLL  F   TVS+  +DM E  G+T+P+A  LEV +TPRL
Sbjct  469  ALQVLHLTLARLLHAFELGTVSDTLVDMRESPGMTVPKATALEVTLTPRL  518



>ref|XP_008776071.1| PREDICTED: cytochrome P450 82C4-like [Phoenix dactylifera]
 ref|XP_008776074.1| PREDICTED: cytochrome P450 82C4-like [Phoenix dactylifera]
Length=205

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 124/175 (71%), Gaps = 4/175 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  VG +R V++SD++NLVYLQA+VKE  RLHP  P LVPHEAM DC +GGYH+P 
Sbjct  29   QDEIDAVVGKDRPVDESDVKNLVYLQAIVKEVFRLHPAAPLLVPHEAMADCRIGGYHVPA  88

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW+L RD  +W +P++  PERFL A  A      + F+ IPFGSGRRSCPG+ 
Sbjct  89   GTRLLVNVWKLQRDLGVWPEPDELRPERFLSAPHAGVDVRGQHFELIPFGSGRRSCPGIS  148

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            +A++V HLTLARL+QGF   T     L+M   LG+  P   PLEVL+ PRL  +L
Sbjct  149  FALQVMHLTLARLIQGFELETPGGGPLEMAYDLGLPYPNTTPLEVLLRPRLADIL  203



>dbj|BAA35080.1| putative cytochrome P450 [Nicotiana tabacum]
 gb|AAK62347.1| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=519

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+DT VG +R VE++DI+NLVYLQA+VKE LRLHPP P  V H +++DC V GYHIPK
Sbjct  343  QEEMDTIVGRDRWVEENDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPK  402

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT L  N+ +L RDP+IW  P+ F PERFL  + A +   + ++ IPFGSGRR+CP M Y
Sbjct  403  GTALLTNIMKLQRDPQIWVDPDTFDPERFLTTNAAIDYRGQHYELIPFGSGRRACPAMNY  462

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +++V HL++A L+QGFNF+T +N  LDM +G+G+TLP+   +EVL+TPRL
Sbjct  463  SLQVEHLSIAHLIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRL  512



>emb|CDY23316.1| BnaA08g12300D [Brassica napus]
Length=523

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 128/171 (75%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID +VGT+R VEDSDIENLVYLQA++KETLRL+P  P L P EAMEDCTV GYH+  
Sbjct  347  QDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHVAC  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP++W +P +F PERFL  +        + F+ IPFGSGRRSCPG  
Sbjct  407  GTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNFELIPFGSGRRSCPGSS  466

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             AM+V HL LAR L  F+  T  + A+DM+E  G+T+P+A PLEV+++PRL
Sbjct  467  LAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRL  517



>gb|AAS90126.1| cytochrome P450 [Ammi majus]
Length=530

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  VG +R V++SD++NL YLQA+VKETLRL+P  P  V H+AM DCTV G++IP 
Sbjct  355  QDEMDQYVGRDRQVKESDVKNLTYLQAIVKETLRLYPAAPLSVQHKAMADCTVAGFNIPA  414

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W++HRDP++WS P +F PERFL+  +  +   + F+ +PFGSGRRSCPG+ +
Sbjct  415  GTRLVVNLWKMHRDPKVWSDPLEFQPERFLQKHINVDIWGQNFELLPFGSGRRSCPGITF  474

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+V HLTLA+LL GF   TV ++++DMTE  GIT PRA PLEV +TPRL
Sbjct  475  AMQVLHLTLAQLLHGFELGTVLDSSIDMTESSGITDPRATPLEVTLTPRL  524



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 133/174 (76%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG ER VE+SD++NLVYLQA++KETLRL+P  P L P EA++DCTV GY++P 
Sbjct  351  QEELDLCVGMERQVEESDVKNLVYLQAIIKETLRLYPAGPLLGPREALDDCTVAGYNVPA  410

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+L RDP +W+ P  F PERFL   ADV    +QF+ +PFGSGRRSCPG+ +
Sbjct  411  GTRLIVNIWKLQRDPSVWTNPCAFQPERFLNAHADVDVKGQQFELMPFGSGRRSCPGVSF  470

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A++V HLTLARLL  F  ST  +  +DMTE  G+T+P+A PLEVL+TPRL+  L
Sbjct  471  ALQVLHLTLARLLHAFELSTPVDQPVDMTESSGLTIPKATPLEVLLTPRLNSKL  524



>ref|XP_003548652.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
Length=521

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 133/170 (78%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERL-VEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIP  177
            QEEID +VG ER  VE  DI++L+YLQA+VKETLRL+PP P LVPHEA EDC + GYH+P
Sbjct  346  QEEIDHQVGRERRRVEARDIKDLIYLQAIVKETLRLYPPGPVLVPHEAREDCNIQGYHVP  405

Query  178  KGTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQFQFIPFGSGRRSCPGMLY  351
            KGT+++ NVW+LHRDP +WS+PEKF PERF+    ++     F+++PFGSGRR+CPG  +
Sbjct  406  KGTRVFANVWKLHRDPSLWSEPEKFSPERFISENGELDEVHHFEYLPFGSGRRACPGSTF  465

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A +V  LTL+RLLQGF+     +  +D+ EGLGITLP+ NPL+++++PRL
Sbjct  466  ATQVCLLTLSRLLQGFDLHVPMDEPVDLEEGLGITLPKMNPLQIVLSPRL  515



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D +VGT+R V +SDI+NLVYLQA++KE +RL+P  P LVPHE++E+CTV GYH+P 
Sbjct  349  QNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAGPLLVPHESIEECTVNGYHVPA  408

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
             TQL++N W++ RDP +W +P KF PERFL    D+    Q F+ +PF SGRR CPG+ +
Sbjct  409  STQLFINAWKIQRDPSVWEEPSKFQPERFLTRHKDIDVKGQNFELLPFSSGRRMCPGVSF  468

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V   TLA LLQGFNF+T SN  +DM EGLG+T+ ++ P EVLVTPRL
Sbjct  469  ALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTMEKSQPFEVLVTPRL  518



>ref|XP_009109920.1| PREDICTED: cytochrome P450 82C4 [Brassica rapa]
Length=525

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 128/171 (75%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID +VGT+R VEDSDIENLVYLQA++KETLRL+P  P L P EAMEDCTV GYH+  
Sbjct  347  QDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHVAC  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP++W +P +F PERFL  +        + F+ IPFGSGRRSCPG  
Sbjct  407  GTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNFELIPFGSGRRSCPGSS  466

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             AM+V HL LAR L  F+  T  + A+DM+E  G+T+P+A PLEV+++PRL
Sbjct  467  LAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRL  517



>gb|KHN03067.1| Cytochrome P450 82G1 [Glycine soja]
Length=391

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+DT +G ER V++SDIENL YLQA++KETLRL+PP P     E MEDC V GYH+PK
Sbjct  214  QKELDTHLGKERWVQESDIENLTYLQAIIKETLRLYPPAPLTGIREVMEDCCVAGYHVPK  273

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L +N+W L RDP++W  P KF PERFL      N   + F+ IPF  GRRSCPGM +
Sbjct  274  GTRLLINLWNLQRDPKVWPNPNKFEPERFLTTHHDINFMSQNFELIPFSIGRRSCPGMTF  333

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++V HLTLARLLQGF+  T   A +DMTEGLG+ LP+ + L+V++ PRL
Sbjct  334  GLQVLHLTLARLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVMLQPRL  383



>emb|CDY53704.1| BnaC03g67210D [Brassica napus]
Length=523

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 128/171 (75%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID +VGT+R VEDSDIENLVYLQA++KETLRL+P  P L P EAMEDCT+ GYH+  
Sbjct  347  QDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTIAGYHVSC  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP++W +P +F PERFL  +        + F+ IPFGSGRRSCPG  
Sbjct  407  GTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNFELIPFGSGRRSCPGSS  466

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             AM+V HL LAR L  F+  T  + A+DM+E  G+T+P+A PLEV+++PRL
Sbjct  467  LAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRL  517



>emb|CBI32517.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG  + V +SDI+ LVYLQA++KETLRL+P  P  +PHEAMEDCT+ G+HI  
Sbjct  121  QEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQA  180

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA---ANRQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IWS P +F PERFL   V      + F+ +PFGSGRR CPG+  
Sbjct  181  GTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVGGQHFELLPFGSGRRMCPGISL  240

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+ +  LTLARLL GF    VS++ LDMTEG+G+ +P+A PLEV + PRL
Sbjct  241  ALEILQLTLARLLHGFELGVVSDSPLDMTEGVGLAMPKATPLEVTLVPRL  290



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D +VGT+R V +SD++NLVYLQA +KE +RL+P +P L+PHEA+E+CTV GYH+P 
Sbjct  298  QNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPAVPLLIPHEAIEECTVNGYHVPA  357

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQL +NVW+L RDP +W +P KF PERFL    D+    Q  + +PFGSGRR CPG+ +
Sbjct  358  GTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHKDIDVRGQHLELLPFGSGRRMCPGVSF  417

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V   T+A LLQGF+F+T SN  LDM EG G+T+ ++ PLEVL+ PRL   L G
Sbjct  418  ALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEKSRPLEVLIAPRLSASLYG  473



>ref|XP_006283535.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
 gb|EOA16433.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
Length=524

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 131/171 (77%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  VGTER VEDSDIENLVY+QA++KETLRL+P  P L P EAMEDCTV G+++ +
Sbjct  348  QDEIDLHVGTERNVEDSDIENLVYVQAIIKETLRLYPAGPLLGPREAMEDCTVAGHNVSR  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP ++ +P +F PERF+  +        + F+ +PFGSGRRSCPG  
Sbjct  408  GTRLIVNVWKIQRDPRVYMEPNEFRPERFVTGEAKKFDVRGQNFELMPFGSGRRSCPGSS  467

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             AM+V HL LAR+LQ F+  TVS+ A+DM+E  G+T+P+A PLEVL++PRL
Sbjct  468  LAMQVLHLGLARILQSFDVKTVSDMAVDMSESPGLTIPKATPLEVLISPRL  518



>ref|XP_010934114.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=527

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 128/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE++  VG  R V +SD+E LVYLQA+VKETLRL+PP P L+PH+AMEDC V G+ +P 
Sbjct  352  QEELEAHVGRARNVNESDVEKLVYLQAIVKETLRLYPPGPILLPHQAMEDCQVAGFDVPA  411

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAA-NRQFQFIPFGSGRRSCPGMLY  351
            GTQ+ VN W + RDP++W +P  F PERFL    DV    RQ + +PFGSGRR+CPG  +
Sbjct  412  GTQVLVNAWAIQRDPQVWPEPSAFRPERFLTSHGDVGVRGRQLELLPFGSGRRACPGASF  471

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A++V HLTLAR++ GF+  T +   +DMTEG G TLP+A PLEVLVTPRL  VL
Sbjct  472  ALQVVHLTLARIIHGFDLETPTGEPVDMTEGKGATLPKATPLEVLVTPRLAPVL  525



>ref|XP_007134137.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
 gb|ESW06131.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
Length=526

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 131/169 (78%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+ +VG ER VE  D++NL+YLQAVVKETLRL+PP P LVPHEA EDC + GY +PK
Sbjct  346  QEEIEDEVGRERKVEACDLKNLIYLQAVVKETLRLYPPGPLLVPHEAREDCCIQGYRVPK  405

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQFQFIPFGSGRRSCPGMLYA  354
            GT+++ NVW+LHRDP +WS+ EKF PERFL    +V   ++F+++PFGSGRR+CPG  +A
Sbjct  406  GTRVFANVWKLHRDPRVWSEAEKFSPERFLNENGEVDEGQRFEYLPFGSGRRACPGSTFA  465

Query  355  MRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++T +TLARLLQ F+     +  +D+ EGLGITLP+ NPL++L T RL
Sbjct  466  TQLTLITLARLLQAFHLDEPLDEPVDLEEGLGITLPKINPLQILFTSRL  514



>ref|XP_002313829.2| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
 gb|EEE87784.2| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
Length=407

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+DT VG  R V ++DI+NLVY+QA+VKET RLH P P   P EAMEDCTV G+HIP 
Sbjct  231  QCELDTHVGKHREVAETDIKNLVYMQAIVKETFRLHQPAPLSGPREAMEDCTVAGFHIPA  290

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IWS P +F PERFL+     +   + F+F PFGSGRR CP + +
Sbjct  291  GTRLVVNLWKLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEFTPFGSGRRMCPAVSF  350

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLL GF   TVS+  +DMTE  G+T+P+A PLEV++ PRL
Sbjct  351  AVQVVHLTLARLLHGFELRTVSDNPVDMTESPGLTVPKATPLEVVLRPRL  400



>ref|XP_006428103.1| hypothetical protein CICLE_v10026027mg [Citrus clementina]
 gb|ESR41343.1| hypothetical protein CICLE_v10026027mg [Citrus clementina]
Length=335

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 128/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D +VGT R V +SD++NL YLQ ++KETLRL+P  P LVPHE++EDCT+ GYH+P 
Sbjct  160  QNELDAQVGTNRQVNESDMKNLAYLQVILKETLRLYPAGPLLVPHESIEDCTIRGYHVPA  219

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQL VN W++ RDP +W +P KFLPERFL+   DV    Q F+FIPFGSGRR CPG+ +
Sbjct  220  GTQLIVNAWKVQRDPGVWEEPCKFLPERFLKKYKDVDLKGQNFEFIPFGSGRRMCPGISF  279

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +V  L LA LL GF+F+T S+A +DM E   +T  +A PLEVL+TPRL   L
Sbjct  280  AFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVLLTPRLSASL  333



>ref|XP_011005663.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=520

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 131/171 (77%), Gaps = 3/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D +VG  R V+++DI++LVYLQA+VKET+RL+P  P   P +AMEDCTV G+HIP 
Sbjct  344  QDELDIQVGKHRQVDETDIKSLVYLQAIVKETMRLYPAAPLSAPRQAMEDCTVAGFHIPA  403

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IWS P +F PERFL+     +   + F+++PFGSGRR CPG+  
Sbjct  404  GTRLLVNLWKLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEYVPFGSGRRMCPGISL  463

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLH  504
            A++V HL+LARLL GF   TVS+A +DM+EG GIT+ +  PLEV++ PRLH
Sbjct  464  ALQVLHLSLARLLHGFEMGTVSDALIDMSEGPGITITKETPLEVILRPRLH  514



>ref|XP_006443550.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
 ref|XP_006479221.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Citrus sinensis]
 ref|XP_006479222.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Citrus sinensis]
 gb|ESR56790.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
Length=520

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V +SD++NL YL+A+VKETLR++PP P     EAMEDC +GGYH+PK
Sbjct  343  QEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVTGIREAMEDCEIGGYHVPK  402

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VNVW+LHRDP +W  P +F PERFL   ADV  N Q F++IPF  GRRSCPGM  
Sbjct  403  GTRLIVNVWKLHRDPRMWENPCEFRPERFLTTHADVDVNTQHFEYIPFSFGRRSCPGMTS  462

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             +++  LTLAR+LQGF+ +TV    +DM EGLGI LP+ NP+EV++ PRL
Sbjct  463  GLQIVQLTLARILQGFDLATVGGIPVDMKEGLGIALPKLNPVEVVIKPRL  512



>ref|XP_002531093.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31307.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG E+ V++SDIENL YLQA+VKETLRL+PP P     EA EDC +GGY +PK
Sbjct  346  QEELDIHVGREKWVQESDIENLKYLQAIVKETLRLYPPGPLTGIREASEDCNLGGYFVPK  405

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L +N+W+L RDP +W  P +F PERFL   +DV    Q F+FIPF SGRRSCP + +
Sbjct  406  GTRLIINIWQLQRDPRVWKDPGEFQPERFLTTHSDVDFRGQNFEFIPFSSGRRSCPAITF  465

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++V HLTLAR+LQGF+ +T+    +DMTEGLGI LP+ NP+EV++ PRL
Sbjct  466  GLQVVHLTLARVLQGFDLTTIGGLPVDMTEGLGIALPKVNPVEVIIKPRL  515



>gb|KFK29807.1| hypothetical protein AALP_AA7G181700 [Arabis alpina]
Length=349

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  VGT+R VEDSDIENLVYLQA++KETLRL+P  P L P EA+EDCTV GY++ +
Sbjct  173  QDEIDLHVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREALEDCTVAGYNVSR  232

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP+++ +P +F PERF+  +        + F+ IPFGSGRRSCPG  
Sbjct  233  GTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKVFDVRGKNFELIPFGSGRRSCPGSS  292

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
             A++V HL LAR L  F   TV ++ +DM+E  G+T+P+A PLEVL++PRL   L
Sbjct  293  LALQVLHLGLARFLHSFEVKTVLDSPVDMSESPGLTIPKATPLEVLISPRLEKQL  347



>gb|KDO42181.1| hypothetical protein CISIN_1g009844mg [Citrus sinensis]
Length=524

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D +VG +R V +SDI+NLVYLQA++KE +RL+P  P LVPHE++E+CTV GYH+P 
Sbjct  349  QNELDIQVGAKRQVNESDIKNLVYLQAILKEAMRLYPAGPLLVPHESIEECTVNGYHVPA  408

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
             TQL++N W++ RDP +W +P KF PERFL    D+    Q F+ +PF SGRR CPG+ +
Sbjct  409  STQLFINAWKIQRDPSVWEEPSKFQPERFLTRHKDIDVKGQNFELLPFSSGRRMCPGVSF  468

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V   TLA LLQGFNF+T SN  +DM EGLG+T+ ++ P EVLVTPRL
Sbjct  469  ALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTMEKSQPFEVLVTPRL  518



>gb|KDP26347.1| hypothetical protein JCGZ_17505 [Jatropha curcas]
Length=526

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID KVG +R++E+SD ENLVYL+A++KETLRL+P  P  VP E+M DC   GYHIP+
Sbjct  346  QEEIDQKVGRDRILEESDCENLVYLKAIIKETLRLYPAGPLAVPRESMVDCNFYGYHIPR  405

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT+   N+W+LHRDP++W+ P++F PERFL   ADV    + F+ +PFGSGRRSCPG+ +
Sbjct  406  GTRFLTNLWKLHRDPKVWANPDEFKPERFLTSHADVDVVGQNFELLPFGSGRRSCPGLNF  465

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+V  L + RLLQGFN  T SN  +DMTE L I+L +  PLE+++TPRL
Sbjct  466  AMQVVQLGIGRLLQGFNLRTPSNELVDMTESLNISLSKETPLEIVLTPRL  515



>ref|XP_011037409.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
 ref|XP_011037412.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=511

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D +VG E+ VE+SDI+NLVYLQA+VKETLRL+PP P     EAMEDC + GY++PK
Sbjct  336  QEELDKQVGREKWVEESDIQNLVYLQAIVKETLRLYPPGPLTGIREAMEDCHICGYYVPK  395

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P  F PERFL   AD+    Q F+FIPF SGRRSCP +  
Sbjct  396  GTRLVVNIWKLHRDPRVWKNPNDFQPERFLTTHADLDFRGQDFEFIPFSSGRRSCPAINL  455

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             M V HLTLARLLQGF+ +TV+   +DM EG GI LP+  PLE +V PRL
Sbjct  456  GMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPKLIPLEAVVKPRL  505



>gb|KEH25406.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 131/174 (75%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  +G  R VE SDI+NLVYLQA++KETLRL+P  P L PHEA EDC + GY++PK
Sbjct  341  QEEIDHHIGKGRRVESSDIKNLVYLQAILKETLRLYPAAPLLAPHEATEDCNIQGYYVPK  400

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ---FQFIPFGSGRRSCPGMLY  351
            GT+++ NVW+LHRDP IWS+PEKFLPERF+  +   + +   F+++PFG GRR+CPG L+
Sbjct  401  GTRVFFNVWKLHRDPSIWSEPEKFLPERFINENGEIDHESHHFEYLPFGLGRRACPGSLF  460

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A + + +TLA LL GF+     +  +DM EGLGITLP+  PL+V++TPRL + L
Sbjct  461  ATQNSLITLACLLHGFDLEVPMDEVVDMREGLGITLPKLTPLQVVLTPRLPFEL  514



>emb|CBI32508.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG  + V +SDI+ LVYLQA++KETLRL+P  P  +PHEAMEDCT+ G+HI  
Sbjct  160  QEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQA  219

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IWS P +F PERFL   V  +   + F+ +PFGSGRR CPG+  
Sbjct  220  GTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISL  279

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+ +  LTLARLL GF    V+++ LDMTEG+G+ +P+A PLEV + PRL
Sbjct  280  ALEILQLTLARLLHGFELGVVADSPLDMTEGVGLAMPKATPLEVTLVPRL  329



>ref|XP_004241385.1| PREDICTED: cytochrome P450 82C2-like [Solanum lycopersicum]
Length=543

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 127/170 (75%), Gaps = 4/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
             EEIDTKVG +R VEDSDI+NL+Y QA +KE LRL+PP P LV HEA+ DC V GYHI K
Sbjct  368  HEEIDTKVGKDRWVEDSDIKNLMYFQATIKEVLRLYPPSPMLV-HEALADCQVLGYHISK  426

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VNVW+L +D + W +PEKFLPERFL      +   +  +FIPFGSGRRSCPG+  
Sbjct  427  GTRLFVNVWKLQKDSKFWPEPEKFLPERFLTTKAKVDVYGKDLEFIPFGSGRRSCPGITM  486

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            AM+VT+L++ARLLQ F+F   +N  LDMTEG G T  +  PLEV+V PR+
Sbjct  487  AMQVTYLSIARLLQAFDFDLPNNDPLDMTEGPGFTAVKKVPLEVVVKPRM  536



>ref|XP_010526010.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Tarenaya hassleriana]
Length=524

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 126/171 (74%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            +EEID  VG +R VEDSDIE LVYLQA+ KETLRL+P  P L P EA EDCTV GYH+  
Sbjct  347  REEIDFHVGKDRKVEDSDIEKLVYLQAITKETLRLYPAAPLLGPREATEDCTVAGYHVTA  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++HRDP+IW  P++F+PERFLE   +      + ++ +PFGSGRRSCPG+ 
Sbjct  407  GTRLMVNVWKVHRDPKIWPNPDEFIPERFLEGKASEYSVRGQSYELLPFGSGRRSCPGIS  466

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             A++V HL LAR L  F+ STVS   +DM E  G+T+P+  PLEVL++PRL
Sbjct  467  LAVQVLHLLLARFLHSFDMSTVSGMDVDMGESPGLTIPKTKPLEVLLSPRL  517



>ref|XP_010526011.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Tarenaya hassleriana]
Length=524

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 126/171 (74%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            +EEID  VG +R VEDSDIE LVYLQA+ KETLRL+P  P L P EA EDCTV GY +  
Sbjct  347  REEIDFHVGKDRKVEDSDIEKLVYLQAITKETLRLYPAAPLLGPREATEDCTVAGYQVTA  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++HRDP+IWS P++F+PERFLE   +      + ++ +PFGSGRRSCPG+ 
Sbjct  407  GTRLMVNVWKVHRDPKIWSNPDEFIPERFLEGKASEYSVRGQSYELLPFGSGRRSCPGIS  466

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             A++V HL LAR L  F+ STVS   +DM E  G+T+P+  PLEVL++PRL
Sbjct  467  LAVQVLHLLLARFLHSFDMSTVSGMDVDMGESPGLTIPKTKPLEVLLSPRL  517



>gb|KDO36736.1| hypothetical protein CISIN_1g026655mg [Citrus sinensis]
Length=235

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 128/176 (73%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D  VG +R V +SDI+NLVYLQA++KE +RL+P  P L+PHE++E+CT+ GY++P 
Sbjct  60   QNELDILVGAKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHESIEECTISGYNVPT  119

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
             TQL +NVW+L RDP +W +P KF PERFL    D+    Q F+ +PFGSGRR CPG+ +
Sbjct  120  STQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFELLPFGSGRRICPGVSF  179

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V   TLA LL GF+F+T SN   DM EG+G+T+ +A PLEVL+ PRL   L G
Sbjct  180  ALQVMEFTLASLLHGFDFATPSNEPPDMGEGIGLTIEKARPLEVLIAPRLSASLYG  235



>ref|XP_006379218.1| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
 gb|ERP57015.1| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
Length=487

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+DT VG  R V ++DI+NLVY+QA+VKET RLH P P   P EAMEDCTV G+HIP 
Sbjct  311  QCELDTHVGKHREVAETDIKNLVYMQAIVKETFRLHQPAPLSGPREAMEDCTVAGFHIPA  370

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IWS P +F PERFL+     +   + F+F PFGSGRR CP + +
Sbjct  371  GTRLVVNLWKLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEFTPFGSGRRMCPAVSF  430

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLARLL GF   TVS+  +DMTE  G+T+P+A PLEV++ PRL
Sbjct  431  AVQVVHLTLARLLHGFELRTVSDNPVDMTESPGLTVPKATPLEVVLRPRL  480



>emb|CAN72749.1| hypothetical protein VITISV_004418 [Vitis vinifera]
Length=259

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG  + V +SDI+ LVYLQA++KETLRL+P  P  +PHEAMEDCT+ G+HI  
Sbjct  84   QEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQA  143

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IW  P +F PERFL   V  +   + F+ +PFGSGRR CPG+  
Sbjct  144  GTRLLVNLWKLHRDPTIWLDPLEFQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISL  203

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+ +  LTLARLL GF    V+++ LDMTEG+G+ +P+A PLEV + PRL
Sbjct  204  ALEILQLTLARLLHGFELGVVADSPLDMTEGVGLAMPKATPLEVTLVPRL  253



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D +VG++R V +SDI+NLVYLQA++KET+RL+P +P LVPHE+ME+C V GYHIP 
Sbjct  350  QNELDIQVGSKRQVNESDIKNLVYLQAILKETMRLYPAVPLLVPHESMEECIVNGYHIPA  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GTQL++N W+L RDP +W +P KF P+RFL    + DV   + F+ +PF SGRR CPG+ 
Sbjct  410  GTQLFINAWKLQRDPRVWEEPYKFHPKRFLTRHKDIDVKG-QNFELLPFSSGRRMCPGVS  468

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            +A++V   TLA LL GF+F+T SN  +DM EGLG+T+ ++ PL VLV PRL   L G
Sbjct  469  FALQVMQFTLASLLHGFDFATPSNEPVDMGEGLGLTMEKSTPLVVLVAPRLSASLYG  525



>ref|XP_006376421.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP54218.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D +VG E+ VE+SDI+NL+YLQA+VKETLRL+PP P     EAMEDC + GY++PK
Sbjct  336  QEELDKQVGREKWVEESDIQNLMYLQAIVKETLRLYPPGPLTGIREAMEDCHICGYYVPK  395

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P+ F PERFL   AD+    Q F+FIPF SGRRSCP +  
Sbjct  396  GTRLVVNIWKLHRDPRVWKNPDDFQPERFLTTHADLDFRGQDFEFIPFSSGRRSCPAINL  455

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             M V HLTLARLLQGF+ +TV+   +DM EG GI LP+  PLE ++ PRL
Sbjct  456  GMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPKLIPLEAVIKPRL  505



>ref|XP_006297447.1| hypothetical protein CARUB_v10013469mg [Capsella rubella]
 gb|EOA30345.1| hypothetical protein CARUB_v10013469mg [Capsella rubella]
Length=320

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+  VG  R VE+SDI NL YLQA+VKET RL+PP P     EA EDC VGGY + K
Sbjct  145  QEEIEKCVGKGRWVEESDIGNLKYLQAIVKETHRLYPPAPLTGIREASEDCFVGGYRVEK  204

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-EADVAANRQFQFIPFGSGRRSCPGMLYAM  357
            GT+L VN+W+LHRDP+IW+ P+ F PERF+ E        F++IPF SGRRSCPG+   +
Sbjct  205  GTRLLVNIWKLHRDPKIWTDPKTFKPERFMDEKSQCGKSDFEYIPFSSGRRSCPGINLGL  264

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLH  504
            RV H+ LA+LLQGF    VSN  LDM EG G+ LP+ NP+EV+V PRL+
Sbjct  265  RVVHIVLAQLLQGFELRKVSNEPLDMAEGPGLALPKINPVEVVVMPRLN  313



>ref|XP_006428104.1| hypothetical protein CICLE_v10027210mg, partial [Citrus clementina]
 gb|ESR41344.1| hypothetical protein CICLE_v10027210mg, partial [Citrus clementina]
Length=367

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D  VGT R V +SD+ NL +LQ V+KETLRL+P  P L+PHE++EDCT+ GYH+P 
Sbjct  192  QNELDVHVGTNRQVNESDMINLAHLQVVLKETLRLYPAAPLLLPHESIEDCTISGYHVPA  251

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQL VN W++ RDP +W +P KFLPERFL    DV    Q F+FIPFGSGRR CPG+ +
Sbjct  252  GTQLIVNAWKIQRDPGVWEEPCKFLPERFLTKYKDVDLKGQNFEFIPFGSGRRMCPGISF  311

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +V  L LA LL GF+F+T S+AA+DM E   +T  +A PLEVL+TPRL   L
Sbjct  312  AFQVMPLILASLLHGFDFATPSDAAVDMEEAKSLTYAKATPLEVLLTPRLSASL  365



>ref|XP_007041358.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOX97189.1| Cytochrome P450, putative [Theobroma cacao]
Length=493

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  VG  R VE+SDI NLVYLQA+VKETLRLH  +P  VP EAMEDCT+ G+H+P 
Sbjct  318  QDELDIHVGKHRKVEESDINNLVYLQAIVKETLRLHTAVPLSVPREAMEDCTIAGFHVPA  377

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA---ANRQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+L RD  IW +P +FLPERFL         ++ F+F+PFGSGRR CPG+ +
Sbjct  378  GTRLLVNLWKLQRDRSIWQKPSEFLPERFLSDHANLDLKDQNFEFVPFGSGRRICPGISF  437

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V  L LA LL GF + TVS+ A+DM+E  G+T+P+A PLEV +TPRL  +L G
Sbjct  438  ALQVMPLALAGLLHGFEWGTVSDIAIDMSETPGLTVPKATPLEVTLTPRLPSMLYG  493



>ref|XP_002305292.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
 gb|EEE85803.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
Length=516

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D +VG ER VE+SDI+NL YLQA+VKETLRL+PP P     EAMEDC++GGY +PK
Sbjct  342  QEELDKQVGRERWVEESDIQNLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPK  401

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F P+RFL   AD+    Q  +FIPF SGRRSCP +  
Sbjct  402  GTRLVVNIWKLHRDPRVWKNPNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAINL  461

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             + V HLTLAR+LQGF+ +TV+   +DM EG GI LP+  PLEV++ PRL
Sbjct  462  GLIVVHLTLARILQGFDLTTVAGLPVDMIEGPGIALPKETPLEVVIKPRL  511



>ref|XP_006427755.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
 gb|ESR40995.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
Length=527

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 127/173 (73%), Gaps = 6/173 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D +VG ER V++SD ENLVYLQA++KETLRL+P  P L P EAMEDCTV GYH+P 
Sbjct  347  QEELDQQVGKERAVDESDTENLVYLQAIIKETLRLYPAGPLLAPREAMEDCTVSGYHVPA  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-----EADVAA-NRQFQFIPFGSGRRSCPG  342
            GT+L +N W++ RDP +W  P  F PERFL      ADV    +QF+ IPFGSGRRSCPG
Sbjct  407  GTRLMINAWKIQRDPSVWENPSAFQPERFLPGHGAHADVDVRGQQFELIPFGSGRRSCPG  466

Query  343  MLYAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
               A++V HLTLARLL  F  +T  +  +DM+E  G+T+P+A PL+VL++PRL
Sbjct  467  ASSALQVLHLTLARLLHSFELATPLDQPVDMSESPGLTIPKATPLKVLLSPRL  519



>gb|KDO39483.1| hypothetical protein CISIN_1g009723mg [Citrus sinensis]
Length=527

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 127/173 (73%), Gaps = 6/173 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D +VG ER V++SD ENLVYLQA++KETLRL+P  P L P EAMEDCTV GYH+P 
Sbjct  347  QEELDQQVGKERAVDESDTENLVYLQAIIKETLRLYPAGPLLAPREAMEDCTVSGYHVPA  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-----EADV-AANRQFQFIPFGSGRRSCPG  342
            GT+L +N W++ RDP +W  P  F PERFL      ADV    +QF+ IPFGSGRRSCPG
Sbjct  407  GTRLMINAWKIQRDPRVWENPSAFQPERFLPGHGAHADVDVRGQQFELIPFGSGRRSCPG  466

Query  343  MLYAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
               A++V HLTLARLL  F  +T  +  +DM+E  G+T+P+A PL+VL++PRL
Sbjct  467  ASSALQVLHLTLARLLHAFELATPLDQPVDMSESPGLTIPKATPLKVLLSPRL  519



>gb|AFK79026.1| cytochrome P450 CYP82T1 [Bupleurum chinense]
Length=526

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  +G +R VE+SDI +LVYLQA++KETLRL+P  P  +P +A EDCTV GYH+PK
Sbjct  349  QQELDDHIGKDRWVEESDIRHLVYLQAILKETLRLYPGGPLGIPRKAKEDCTVAGYHVPK  408

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GTQL+VN+W+LHRD E W+ P +F PERFL +    +   +QF++IP+ SGRRSCPG+  
Sbjct  409  GTQLWVNIWKLHRDSETWTAPYEFQPERFLTSHAGVDVRGQQFEYIPYSSGRRSCPGITA  468

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +M++  LTLARLLQGFN  + +N  +DMTE  GI++ R  P EV++TPRL
Sbjct  469  SMQMMQLTLARLLQGFNLVSPTNEPVDMTEAAGISMHRKYPFEVVLTPRL  518



>gb|KDO44149.1| hypothetical protein CISIN_1g037793mg, partial [Citrus sinensis]
Length=198

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E++  VG  R V +SDI+NLVYLQA++KET+RL+P  P L+PH++MEDCT+ GYH+P 
Sbjct  23   QDELNIHVGANRQVNESDIKNLVYLQAILKETMRLYPAAPLLLPHQSMEDCTISGYHVPA  82

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQL+VN W++H DP++W +P KFLPERFL    D+    Q F+ IPFGSGRR CPG+ +
Sbjct  83   GTQLFVNAWKVHHDPKVWKEPCKFLPERFLTTHKDIDLRGQNFELIPFGSGRRICPGISF  142

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A +V  L LA LL GF+ +T  +  +DM E   +T+ RA PL+VL+TPRL
Sbjct  143  AFQVMPLILASLLHGFDLATPLDEPVDMEEAKSLTITRATPLKVLLTPRL  192



>emb|CBI36491.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI NL+YLQAV+KETLRL+   P  VPHEAMEDC V GYHIPK
Sbjct  370  QEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPK  429

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE F PERFL   AD+    + F+ IPFGSGRRSCPG+  
Sbjct  430  GTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITM  489

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHY  507
            A+++  L + RLLQGF+ ST  NA +DM EGL ITL +  PLEV  T  + Y
Sbjct  490  ALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVNKTRVVFY  541



>gb|ABC69420.1| CYP82E8 [Nicotiana tabacum]
Length=519

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+DT VG +R VE+SDI+NLVYLQA+VKE LRLHPP P  V H ++EDC V GYHIPK
Sbjct  343  QEEMDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVEDCVVNGYHIPK  402

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT L  N+ +L RDP+ W  P+KF PERFL      +   + ++ IPFG+GRR+CP M Y
Sbjct  403  GTALLTNIMKLQRDPQTWPNPDKFDPERFLTTHATIDYRGQHYESIPFGTGRRACPAMNY  462

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            +++V HL++A ++QGF+F+T +N  LDM +G+G+TLP+   +EVL+TPRL
Sbjct  463  SLQVEHLSIAHMIQGFSFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRL  512



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D +VGT+R V +SD++NLVYLQA +KE +RL+P +P L+PHEA+E+CTV GYH+P 
Sbjct  356  QNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPAVPLLIPHEAIEECTVNGYHVPA  415

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
             TQL +NVW+L RDP +W +P KF PERFL    D+    Q  + +PFGSGRR CPG+ +
Sbjct  416  RTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHKDIDVRGQHLELLPFGSGRRMCPGVSF  475

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V   T+A LLQGF+F+T SN  LDM EG G+T+ ++ PLEVL+ PRL   L G
Sbjct  476  ALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEKSRPLEVLIAPRLSASLYG  531



>ref|XP_003547786.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+DT +G ER V++SDIENL YLQA++KETLRL+PP P     E MEDC V GYH+PK
Sbjct  364  QKELDTHLGKERWVQESDIENLTYLQAIIKETLRLYPPAPLTGIREVMEDCCVAGYHVPK  423

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L +N+W L RDP++W  P KF PERFL      N   + F+ IPF  GRRSCPGM +
Sbjct  424  GTRLLINLWNLQRDPKVWPNPNKFEPERFLTTHHDINFMSQNFELIPFSIGRRSCPGMTF  483

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++V HLTLARLLQGF+  T   A +DMTEGLG+ LP+ + L+V++ PRL
Sbjct  484  GLQVLHLTLARLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVMLQPRL  533



>ref|XP_004517185.1| PREDICTED: cytochrome P450 82C4-like [Cicer arietinum]
Length=522

 Score =   212 bits (539),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 129/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+  +G +R VE SDI+NLVYLQA++KETLRL+PP P LVPHEA +DC + GY++PK
Sbjct  347  QEEINHHIGKKRRVESSDIKNLVYLQAIMKETLRLYPPGPLLVPHEATKDCYIQGYNVPK  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL---EADVAANRQFQFIPFGSGRRSCPGMLY  351
            GT+++ NVW+LHRDP IW + EKF PERF+     ++     F+++PFG GRR+CPG ++
Sbjct  407  GTRVFANVWKLHRDPSIWLEAEKFSPERFINEKNGELYEGHNFEYLPFGLGRRACPGSMF  466

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +V  +TLARL+ GF+        +DM EGLGITLP+  PL V++TPRL Y L
Sbjct  467  ATQVCLITLARLIHGFDLEVPMGEDVDMREGLGITLPKLTPLNVILTPRLTYEL  520



>ref|XP_002863089.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39348.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata]
Length=470

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG  R VE+SDI+NL YLQA+VKET RL+PP P     EA EDC VGGY + K
Sbjct  295  QEEIDNCVGKGRWVEESDIQNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEK  354

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L VN+W+LHRDP+IW  P+ F PERF+E      +  F++IPF SGRRSCPG+   +
Sbjct  355  GTRLLVNIWKLHRDPKIWPDPKAFKPERFMEEKSQCEKSDFEYIPFSSGRRSCPGINLGL  414

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLH  504
            RV H  LARLLQGF    VS   LDM EG G+ LP+  P+EV+VTPRLH
Sbjct  415  RVVHFVLARLLQGFELRKVSGEPLDMAEGPGLDLPKIKPVEVVVTPRLH  463



>gb|AAC39454.1| (S)-N-methylcoclaurine 3'-hydroxylase [Eschscholzia californica]
Length=560

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 126/167 (75%), Gaps = 6/167 (4%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+DTKVG +R VE+ DI+NLVYLQA+VKETLR++P  P  VPHEA+EDC VGGYHI  
Sbjct  381  QDELDTKVGRDRHVEEKDIDNLVYLQAIVKETLRMYPAGPLSVPHEAIEDCNVGGYHIKT  440

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA------NRQFQFIPFGSGRRSCPG  342
            GT+L VN+W+L RDP +WS P +F PERFL+            + F++IPFGSGRR CPG
Sbjct  441  GTRLLVNIWKLQRDPRVWSNPSEFRPERFLDNQSNGTLLDFRGQHFEYIPFGSGRRMCPG  500

Query  343  MLYAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEV  483
            + +A  + H+TLARLLQ F+ ST S++ +DMTEG G+T+P+  PL+V
Sbjct  501  VNFATLILHMTLARLLQAFDLSTPSSSPVDMTEGSGLTMPKVTPLKV  547



>ref|XP_006375028.1| hypothetical protein POPTR_0014s03730g [Populus trichocarpa]
 gb|ERP52825.1| hypothetical protein POPTR_0014s03730g [Populus trichocarpa]
Length=342

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  VG ER V++SD++NLVYLQA++KET RL+P  P  VPHE+ME+CTVGGY IP 
Sbjct  165  QDELDIHVGRERQVKESDMKNLVYLQAIIKETFRLYPAAPLSVPHESMEECTVGGYQIPA  224

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+ N+ ++HRDP++WS P++F PERFL      +   + F+ IPFGSGRR CPG+ +
Sbjct  225  GTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELIPFGSGRRMCPGVSF  284

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V +L LA LL GF+  T+ +A +DMTE  GIT  +A PLE L+TPRL
Sbjct  285  ALQVVNLALATLLHGFDIETLDDAPIDMTETGGITNIKATPLEALLTPRL  334



>gb|KHG07864.1| Cytochrome P450 protein [Gossypium arboreum]
Length=515

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG +R VE+SDI+NL YLQA+VKETLRL+PP P     EAM+DC + GY +PK
Sbjct  338  QEEIDHHVGKQRWVEESDIKNLKYLQAIVKETLRLYPPGPITGIREAMQDCCIAGYDVPK  397

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADV---AANRQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W    +F PERF+   V      + F+++PF SGRRSCPGM +
Sbjct  398  GTRLIVNIWKLHRDPRVWENANEFHPERFMTTHVDFDVKGQNFEYMPFSSGRRSCPGMTF  457

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++V HLT+++L+QGF+       A+DM EGLG+ LP+ NPLEV+++PRL
Sbjct  458  GLQVVHLTVSKLIQGFDIRVAEGTAVDMEEGLGLALPKLNPLEVVLSPRL  507



>ref|XP_011008137.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=516

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D +VG ER VE+SDI++L YLQA+VKETLRL+PP P     EAMEDC++GGY +PK
Sbjct  342  QEELDKQVGRERWVEESDIQDLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPK  401

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F P+RFL   AD+    Q  +FIPF SGRRSCP +  
Sbjct  402  GTRLVVNIWKLHRDPRVWKNPNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAINL  461

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             + V HLTLAR+LQGF+ +TV+   +DM EG GI LP+  PLEV++ PRL
Sbjct  462  GLIVVHLTLARILQGFDLTTVAGLPVDMIEGPGIALPKETPLEVVIKPRL  511



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            + E+D +VGT+R V +SDI+NLVYLQA++KE +RL+P  P L+PHE++E+CTV GY++P 
Sbjct  350  RNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHESIEECTVSGYNVPS  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GTQL++NVW+L RDP +W +P KF PERFL    + DV   + F+ +PF SGRR CPG+ 
Sbjct  410  GTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRG-QNFELLPFSSGRRMCPGVS  468

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            +A++V   TLA LL GF+ +T SN  LDM EGLG+T+ ++ PLEVLV PRL   L G
Sbjct  469  FALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEKSTPLEVLVAPRLSASLYG  525



>ref|XP_008382594.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=540

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 123/171 (72%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V++SD+ NL YLQA++KETLRL+PP P     EAMEDC +GGY +PK
Sbjct  362  QEELDIHVGKDRWVQESDLTNLKYLQAILKETLRLYPPGPITGLREAMEDCHLGGYFVPK  421

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GT+L VN+W+L RDP +W+ P +F PERF+    + D      F++IPF +GRRSCPGM 
Sbjct  422  GTRLLVNIWKLQRDPRMWANPCEFQPERFMTTHADVDFKGQSNFEYIPFSAGRRSCPGMT  481

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
                V  L LARL+QGFN S V + A+DM EGLG+ LP+ANPLEV + PRL
Sbjct  482  LGSHVVQLVLARLIQGFNMSRVGDGAVDMKEGLGLALPKANPLEVFLAPRL  532



>ref|XP_002281431.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG  + V +SDI+ LVYLQA++KETLRL+P  P  +PHEAMEDCT+ G+HI  
Sbjct  341  QEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQA  400

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IWS P +F PERFL   V  +   + F+ +PFGSGRR CPG+ +
Sbjct  401  GTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISF  460

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+ +  LTLARLL GF    V+++ LDMTEG+G+ LP+A PLEV + PRL
Sbjct  461  ALEILQLTLARLLHGFELGVVADSPLDMTEGVGLALPKATPLEVTLVPRL  510



>ref|NP_189154.1| cytochrome P450, family 82, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
 sp|Q9LSF8.1|C82G1_ARATH RecName: Full=Cytochrome P450 82G1 [Arabidopsis thaliana]
 dbj|BAB02077.1| cytochrome p450 [Arabidopsis thaliana]
 gb|AEE76989.1| cytochrome P450, family 82, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
Length=515

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 121/168 (72%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG  R +E+SDI+NL YLQA+VKET RL+PP P     EA EDC VGGY + K
Sbjct  340  QEEIDNSVGKGRWIEESDIQNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEK  399

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANR-QFQFIPFGSGRRSCPGMLYAM  357
            GT+L VN+W+LHRDP+IW  P+ F PERF+E      +  F++IPFGSGRRSCPG+   +
Sbjct  400  GTRLLVNIWKLHRDPKIWPDPKTFKPERFMEDKSQCEKSNFEYIPFGSGRRSCPGVNLGL  459

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            RV H  LARLLQGF    VS+  LDM EG G+ LP+ NP+EV+V PRL
Sbjct  460  RVVHFVLARLLQGFELHKVSDEPLDMAEGPGLALPKINPVEVVVMPRL  507



>ref|XP_006432705.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
 gb|ESR45945.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
Length=452

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D  VGT+R V +SDI+NLVYLQA++KE +RL+P  P L+PH+++E+CT+ GY++P 
Sbjct  277  QNELDILVGTKRQVNESDIKNLVYLQAILKEAMRLYPGSPLLIPHKSIEECTISGYNVPT  336

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
             TQL +NVW+L RDP +W +P KF PERFL    D+    Q F+ +PFGSGRR+CPG+ +
Sbjct  337  STQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFELLPFGSGRRTCPGVSF  396

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V   TLA LL GF+F+T SN  LDM EGLG+++ +A PLEVL+ PRL   L G
Sbjct  397  ALQVMEFTLAALLHGFDFATPSNEPLDMGEGLGLSIQKARPLEVLIAPRLSASLYG  452



>emb|CBI32515.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE++  VG  R V+ SDI+NLVYLQA+VKETLRL+PP P  +PHEA+E+CTV G+HI  
Sbjct  94   QEELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHEAIENCTVAGFHIQA  153

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F PERFL      +   + ++ +PFGSGR+ CPG+ +
Sbjct  154  GTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYELLPFGSGRKVCPGISF  213

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+ +THLTLARLL GF    V+++ +DMTE  G+T  +A PLEV + PRL + L
Sbjct  214  ALELTHLTLARLLHGFELGAVADSRVDMTESPGLTALKATPLEVTIVPRLPFEL  267



>ref|XP_006443549.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
 ref|XP_006479223.1| PREDICTED: cytochrome P450 82G1-like [Citrus sinensis]
 gb|ESR56789.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
Length=525

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V +SD++ L YL+A+VKETLR++PP P     EAMEDC +GGYH+PK
Sbjct  348  QEELDVHVGRDRWVNESDMKKLKYLRAIVKETLRIYPPGPVTGIREAMEDCEIGGYHVPK  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F PERFL   ADV  N Q F+++PF  GRRSCPGM  
Sbjct  408  GTRLIVNIWKLHRDPRMWENPCEFRPERFLTTHADVDVNTQHFEYVPFSFGRRSCPGMTS  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             +++  LTLAR+LQGF+ +TV    +DM  GLG+ LP++NPLEV++ PRL
Sbjct  468  GLQIVQLTLARILQGFDLATVGGTPVDMQIGLGLALPKSNPLEVIIKPRL  517



>ref|XP_002885694.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61953.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata]
Length=515

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG  R VE+SDI+NL YLQA+VKET RL+PP P     EA EDC VGGY + K
Sbjct  340  QEEIDNCVGKGRWVEESDIQNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEK  399

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L VN+W+LHRDP+IW  P+ F PERF+E      +  F++IPF SGRRSCPG+   +
Sbjct  400  GTRLLVNIWKLHRDPKIWPDPKAFKPERFMEEKSQCEKSDFEYIPFSSGRRSCPGINLGL  459

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLH  504
            RV H  LARLLQGF    VS   LDM EG G+ LP+  P+EV+VTPRLH
Sbjct  460  RVVHFVLARLLQGFELRKVSGEPLDMAEGPGLDLPKIKPVEVVVTPRLH  508



>ref|XP_002531091.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31305.1| cytochrome P450, putative [Ricinus communis]
Length=262

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 127/173 (73%), Gaps = 2/173 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG ER VE+SD +NL  LQA++KET+RL+P  P  +P EAMEDC +GG+H+ K
Sbjct  89   QEELDNNVGKERWVEESDFKNLPLLQAIIKETMRLYPAGPLSLPREAMEDCYIGGFHVRK  148

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQFQ--FIPFGSGRRSCPGMLYA  354
            GT L VNV++LH DP IW  P +F PERFL +++  + + Q  +IPF SGRRSCPG+  A
Sbjct  149  GTILLVNVYKLHHDPRIWPNPCEFQPERFLGSNIELDDRSQQFYIPFSSGRRSCPGISSA  208

Query  355  MRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            M++ HL LAR+LQGFN ST  NA +DM+E  GI+L ++ PLE ++TPRL   L
Sbjct  209  MQMNHLMLARVLQGFNLSTPMNAPVDMSEASGISLVKSAPLEAIITPRLQSNL  261



>ref|XP_003548649.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+DT +G ER V++SDI+NL YLQA++KETLRL+PP P     E MEDC V GYH+PK
Sbjct  364  QKELDTHLGKERWVQESDIKNLTYLQAIIKETLRLYPPAPLTGIREVMEDCCVAGYHVPK  423

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L +N+W L RDP++W  P KF PERFL      N   + F+ IPF  GRRSCPGM +
Sbjct  424  GTRLLINLWNLQRDPKVWPNPNKFEPERFLTTHHDINFMSQNFELIPFSIGRRSCPGMTF  483

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++V HLTLARLLQGF+  T   A +DMTEGLG+ LP+ + L+V++ PRL
Sbjct  484  GLQVLHLTLARLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVMLQPRL  533



>ref|XP_006428105.1| hypothetical protein CICLE_v10027089mg, partial [Citrus clementina]
 gb|ESR41345.1| hypothetical protein CICLE_v10027089mg, partial [Citrus clementina]
Length=367

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 124/174 (71%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D  VGT R V +SD+ NL YLQ V+KETLRL+P  P LVPHE++EDC + GYH+P 
Sbjct  192  QNELDVHVGTNRQVNESDMINLAYLQVVLKETLRLYPAAPLLVPHESIEDCNISGYHVPA  251

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQL VN W++ RDP +W +P +FLPERFL    DV    Q F+FIPFGSGRR CPG+ +
Sbjct  252  GTQLIVNAWKIQRDPGVWEEPCRFLPERFLTKYKDVDLKGQNFEFIPFGSGRRMCPGISF  311

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +V  L LA LL GF+F+T S+A +DM E   +T  +A PLEVL+TPRL   L
Sbjct  312  AFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVLLTPRLSASL  365



>emb|CDY61596.1| BnaC03g74240D [Brassica napus]
Length=448

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 118/168 (70%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG  R VE+SDI NL YLQA+VKET RL+PP P     EA EDC +G YH+ +
Sbjct  273  QEEIDNSVGKGRWVEESDIRNLKYLQAIVKETHRLYPPAPLTGIREAREDCLLGEYHVKR  332

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-EADVAANRQFQFIPFGSGRRSCPGMLYAM  357
            G++L VN+W+LHRDP+IW  PE F PERF+ E  +     F+FIPF SGRRSCPGM   +
Sbjct  333  GSRLLVNIWKLHRDPKIWHDPETFKPERFMEEKSLCEKSDFEFIPFSSGRRSCPGMNLGL  392

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            RV HL LARL+QGF     S+  LDM EG G+ LP+ NP+EV+  PRL
Sbjct  393  RVVHLVLARLIQGFELHKASDEPLDMAEGPGLALPKINPVEVMAMPRL  440



>ref|XP_006464300.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 128/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D +VGT R V +SD++NL YLQ ++KETLRL+P  P LVPHE++EDCT+ GYH+P 
Sbjct  347  QNELDAQVGTNRQVNESDMKNLAYLQVILKETLRLYPAGPLLVPHESIEDCTIRGYHVPA  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQL VN W++ RDP +W +P KFLPERFL+   DV    Q F+FIPFGSGRR CPG+ +
Sbjct  407  GTQLIVNAWKVQRDPGVWEEPCKFLPERFLKKYKDVDLKGQNFEFIPFGSGRRMCPGISF  466

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +V  L LA LL GF+F+T S+A +DM E   +T  +A PLEVL+TPRL   L
Sbjct  467  AFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVLLTPRLSASL  520



>gb|ABK55756.1| P450 monooxygenase-like protein [Stylosanthes guianensis]
Length=521

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 128/169 (76%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID +VG ++ V+ SDI+NLVYLQA+ KETLRL+PP P LVPHEA EDC + GY++PK
Sbjct  353  QEEIDLRVGKDKSVKASDIKNLVYLQAIFKETLRLYPPGPLLVPHEAREDCYIQGYYVPK  412

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANR--QFQFIPFGSGRRSCPGMLYA  354
            GT+++ NVW+LHRDP IWS+PEKF PERF+  +   N    F+++PFGSGRR+CP   +A
Sbjct  413  GTRVFANVWKLHRDPSIWSEPEKFSPERFINGNGELNEDHNFEYLPFGSGRRACPESTFA  472

Query  355  MRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            ++V+ +TLA LLQ F+        +D+ EGLGITLP+  PL++ +T R+
Sbjct  473  IQVSFITLALLLQKFDLDVPMCETVDLREGLGITLPKLTPLQITLTSRI  521



>ref|XP_010647827.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=516

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG  + V +SDI+ LVYLQA++KETLRL+P  P  +PHEAMEDCT+ G+HI  
Sbjct  341  QEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQA  400

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA---ANRQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IWS P +F PERFL   V      + F+ +PFGSGRR CPG+  
Sbjct  401  GTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVGGQHFELLPFGSGRRMCPGISL  460

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+ +  LTLARLL GF    VS++ LDMTEG+G+ +P+A PLEV + PRL
Sbjct  461  ALEILQLTLARLLHGFELGVVSDSPLDMTEGVGLAMPKATPLEVTLVPRL  510



>ref|XP_006838067.1| hypothetical protein AMTR_s00091p00167660 [Amborella trichopoda]
 gb|ERN00636.1| hypothetical protein AMTR_s00091p00167660 [Amborella trichopoda]
Length=270

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 127/169 (75%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            +EE DTK+G ER VE++DI NL YLQA++K+TLRL+PP P LVPHE++EDC V G+H+P 
Sbjct  94   KEEHDTKIGKERRVEEADIANLPYLQAIIKDTLRLYPPGPLLVPHESIEDCVVAGFHMPA  153

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L +N W++ RDP  W QP KF  ERF+ ++V    Q FQ +PFG+GRR+CPGM  A+
Sbjct  154  GTRLLMNAWKIQRDPRWWQQPLKFELERFIGSEVDVKGQHFQLLPFGAGRRACPGMSRAL  213

Query  358  RVTHLTLARLLQGFNFST-VSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             V HL LARLL  F++   +  ++LDMTE +G+T PRA+PLE L+ PRL
Sbjct  214  SVVHLALARLLHSFDWHLPLGCSSLDMTEVVGLTTPRASPLEALMEPRL  262



>emb|CBI32510.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 6/190 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E++  VG  R V+ SDI+NLVYLQA+VKETLRL+PP P  +PHEAMEDCTV G+HI  
Sbjct  416  QAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHEAMEDCTVAGFHIQA  475

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F PERFL      +   + ++ +PFGSGRR CPG+ +
Sbjct  476  GTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYELLPFGSGRRVCPGISF  535

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*GQYHK  531
            A+ +THLTLARLL GF    V+++ +DMTE  G+T P+A PLEV + PRL + L   Y K
Sbjct  536  ALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVTIVPRLPFEL---YKK  592

Query  532  IHHVGLAK*E  561
             +++ + K E
Sbjct  593  KNNLAIKKWE  602



>gb|KDP26344.1| hypothetical protein JCGZ_17502 [Jatropha curcas]
Length=528

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 128/172 (74%), Gaps = 3/172 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+++ VG  + V++SDI NL YLQA++KETLRL+PP P     EAMEDC + GY+IPK
Sbjct  348  QEELNSYVGKSKWVQESDIPNLKYLQAIIKETLRLYPPGPITGIREAMEDCDINGYYIPK  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+L RDP +W+ P +FLPERFL      +   + F+FIPF SGRR+CP + +
Sbjct  408  GTRLIVNIWKLQRDPRVWNNPHEFLPERFLTTHSGIDLRGQNFEFIPFSSGRRACPAINF  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHY  507
             ++V HLTLARL+QGF+ S + N  +DM EG G++LP+ NP+EV++ PRL +
Sbjct  468  GLQVVHLTLARLIQGFDLSRIGNEPVDMKEGPGLSLPKVNPVEVILKPRLRF  519



>emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera]
Length=527

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E++  VG  R V+ SDI+NLVYLQA+VKETLRL+PP P  +PHEAMEDCTV G+HI  
Sbjct  348  QAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHEAMEDCTVAGFHIQA  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F PERFL      +   + ++ +PFGSGRR CPG+ +
Sbjct  408  GTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYELLPFGSGRRVCPGISF  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+ +THLTLARLL GF    V+++ +DMTE  G+T P+A PLEV + PRL + L
Sbjct  468  ALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVTIVPRLPFEL  521



>ref|XP_009372223.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Pyrus x bretschneideri]
Length=541

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 123/171 (72%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V++SD+ NL YLQA++KETLRL+PP P     EAMEDC +GGY +PK
Sbjct  363  QEELDIHVGKDRWVQESDLTNLKYLQAILKETLRLYPPGPITGLREAMEDCHLGGYFVPK  422

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
             T+L VN+W+L RDP IW+ P +F PERF+    + D      F++IPF +GRRSCPGM 
Sbjct  423  STRLLVNIWKLQRDPRIWANPCEFQPERFMTTHADMDFKGQSNFEYIPFSAGRRSCPGMT  482

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
              + V  L LARL+QGFN S V + A+DM EGLG+ LP+ANPLEV + PRL
Sbjct  483  LGLHVVQLILARLIQGFNMSRVGDGAVDMKEGLGLPLPKANPLEVFLAPRL  533



>emb|CDY52276.1| BnaA03g57690D [Brassica napus]
Length=448

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 118/168 (70%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG  R VE+SDI NL YLQA+VKET RL+PP P     EA EDC +G YH+ +
Sbjct  273  QEEIDNSVGKGRWVEESDIRNLKYLQAIVKETHRLYPPAPLTGIREAREDCLLGEYHVKR  332

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-EADVAANRQFQFIPFGSGRRSCPGMLYAM  357
            G++L VN+W+LHRDP+IW  PE F PERF+ E  +     F+FIPF SGRRSCPGM   +
Sbjct  333  GSRLLVNIWKLHRDPKIWHDPETFKPERFMEEKSLCEKSDFEFIPFSSGRRSCPGMNLGL  392

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            RV HL LARL+QGF     S+  LDM EG G+ LP+ NP+EV+  PRL
Sbjct  393  RVVHLVLARLIQGFELHKASDEPLDMAEGPGLALPKINPVEVVAMPRL  440



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E++  VG  R V+ SDI+NLVYLQA+VKETLRL+PP P  VPHEAMEDCTV G+HI  
Sbjct  348  QAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSVPHEAMEDCTVAGFHIQA  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F PERFL      +   + ++ +PFGSGRR CPG+ +
Sbjct  408  GTRLLVNLWKLHRDPRVWLDPLEFQPERFLTNHAGLDVRGKNYELLPFGSGRRVCPGISF  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+ +THL LARLL GF    V+++ +DMTEG G++ P+A PLEV + PRL + L
Sbjct  468  ALELTHLALARLLHGFELGVVADSPVDMTEGPGLSAPKATPLEVTIVPRLPFEL  521



>ref|XP_009372224.1| PREDICTED: cytochrome P450 82G1-like isoform X3 [Pyrus x bretschneideri]
Length=541

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 123/171 (72%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V++SD+ NL Y QA++KETLRL+PP P     EAMEDC +GGY +PK
Sbjct  363  QEELDIHVGRDRWVQESDLTNLKYFQAILKETLRLYPPGPITGLREAMEDCHLGGYFVPK  422

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GT+L VN+W+L RDP +W+ P +F PERF+    + D      F++IPF +GRRSCPGM 
Sbjct  423  GTRLLVNIWKLQRDPRMWTNPCEFQPERFMTTHADVDFKGQSNFEYIPFSAGRRSCPGMT  482

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
              + V  L LARL+QGF  S V + A+DM EGLG+ LP+ANPLEVL+ PRL
Sbjct  483  LGLHVVQLVLARLIQGFEMSRVGDGAVDMKEGLGLALPKANPLEVLLAPRL  533



>ref|XP_009372222.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Pyrus x bretschneideri]
Length=541

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 123/171 (72%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V++SD+ NL YLQA++KETLRL+PP P     EAMEDC +GGY +PK
Sbjct  363  QEELDIHVGKDRWVQESDLTNLKYLQAILKETLRLYPPGPITGLREAMEDCHLGGYFVPK  422

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
             T+L VN+W+L RDP IW+ P +F PERF+    + D      F++IPF +GRRSCPGM 
Sbjct  423  STRLLVNIWKLQRDPRIWANPCEFQPERFMTTHADMDFKGQSNFEYIPFSAGRRSCPGMT  482

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
              + V  L LARL+QGFN S V + A+DM EGLG+ LP+ANPLEV + PRL
Sbjct  483  LGLHVVQLILARLIQGFNMSRVGDGAVDMKEGLGLPLPKANPLEVFLAPRL  533



>emb|CBI37514.3| unnamed protein product [Vitis vinifera]
Length=1113

 Score =   216 bits (549),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 127/168 (76%), Gaps = 3/168 (2%)
 Frame = +1

Query  1     QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
             QEE+D KVG  R VE+SDI+ L YL+A++KE+LRL+P  P LVPHEA +DC V GYHIPK
Sbjct  942   QEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYPAAPLLVPHEATQDCHVCGYHIPK  1001

Query  181   GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
             GT+L+VN W+LHRDP +WS PE+F PERFL +    +    QF+ IPFGSGRR+CPG+  
Sbjct  1002  GTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINM  1061

Query  352   AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTP  495
             A+++ HLT ARLLQGF+ +T SNA +DMTEG+  T+P+  PL   + P
Sbjct  1062  ALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLRSSINP  1109


 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG  R VE+SDI+ L YL+A++KE+LRL+   P LVPHEA +DC V GYHIPK
Sbjct  345  QEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYSAAPLLVPHEATQDCHVCGYHIPK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+VN W+LHRDP +WS PE+F PERFL +    +    QF+ IPFGSGRR+CPG+  
Sbjct  405  GTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINM  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPL  477
            A+++ HLT ARLLQGF+ +T SNA +DMTEG+  T+P+  PL
Sbjct  465  ALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPL  506



>ref|XP_007134139.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
 gb|ESW06133.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
Length=530

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 126/169 (75%), Gaps = 3/169 (2%)
 Frame = +1

Query  4    EEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPKG  183
            +E+DT VG ER VE+SDI+NL YL A++KETLRL+PP P     E MEDC++ GYH+PKG
Sbjct  354  QELDTHVGKERWVEESDIKNLNYLHAIIKETLRLYPPAPLTGIREVMEDCSLVGYHVPKG  413

Query  184  TQLYVNVWRLHRDPEIWSQPEKFLPERFLEA--DVA-ANRQFQFIPFGSGRRSCPGMLYA  354
            T+L +N+W L RDPE+W+ P +F PERFL +  D+   ++ F+ IPF  GRRSCPGM + 
Sbjct  414  TRLLINLWNLQRDPEVWANPNEFQPERFLSSHRDIDFMSQDFELIPFSFGRRSCPGMAFG  473

Query  355  MRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            ++VTHLTLARLLQGF+      A +DMTEGLG+ LP+  PL V++ PRL
Sbjct  474  LQVTHLTLARLLQGFHICLKDGAEVDMTEGLGVALPKEQPLRVMLQPRL  522



>emb|CDP00859.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 126/173 (73%), Gaps = 10/173 (6%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID+ VG ER VE+SDI+NLVYLQA+VKET+RLHPP P  +P +A EDC V GY IPK
Sbjct  353  QEEIDSFVGKERWVEESDIKNLVYLQAIVKETMRLHPPAPVPMPRQADEDCNVAGYFIPK  412

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVA------ANRQFQFIPFGSGRRSCPG  342
            GTQLYVNVW++ RDP IW +PEKF PERFL  D A      +++ F+  PFG+GRR CPG
Sbjct  413  GTQLYVNVWKIQRDPRIWPEPEKFFPERFLSGDHAGAQLDFSSQNFELNPFGNGRRICPG  472

Query  343  MLYAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            M +A++V HLTLARLLQ F+ S VS+  +D     G    +A PLE L+ PRL
Sbjct  473  MSFALQVMHLTLARLLQAFDISRVSDLPVDTAGYEG----KAPPLEALMMPRL  521



>ref|XP_006465163.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=527

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 126/173 (73%), Gaps = 6/173 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
             EE+D +VG ER V++SD +NLVYLQA++KETLRL+P  P L P EAMEDCTV GYH+P 
Sbjct  347  HEELDQQVGKERAVDESDTQNLVYLQAIIKETLRLYPAGPLLAPREAMEDCTVSGYHVPA  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-----EADV-AANRQFQFIPFGSGRRSCPG  342
            GT+L +N W++ RDP +W  P  F PERFL      ADV    +QF+ IPFGSGRRSCPG
Sbjct  407  GTRLMINAWKIQRDPRVWENPSAFQPERFLPGHGAHADVDVRGQQFELIPFGSGRRSCPG  466

Query  343  MLYAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
               A++V HLTLARLL  F  +T  +  +DM+E  G+T+P+A PL+VL++PRL
Sbjct  467  ASSALQVLHLTLARLLHAFELATPLDQPVDMSESPGLTIPKATPLKVLLSPRL  519



>ref|XP_006375024.1| hypothetical protein POPTR_0014s03690g [Populus trichocarpa]
 gb|ERP52821.1| hypothetical protein POPTR_0014s03690g [Populus trichocarpa]
Length=425

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  VG ER V++SD++NLVYLQA++KET RL+P  P  VPHE+ME+CTVGGYHIP 
Sbjct  248  QDELDIHVGRERQVKESDMKNLVYLQAIIKETFRLYPAAPLSVPHESMEECTVGGYHIPA  307

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+ N+ ++HRDP++WS P++F PERFL      +   + F+ IPFGSGRR CPG+ +
Sbjct  308  GTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELIPFGSGRRMCPGVSF  367

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V +L LA LL GF+  T+ +A +DMTE  GIT  +A PLE L+TPRL
Sbjct  368  ALQVLNLALATLLHGFDIETLDDAPIDMTETGGITNIKATPLEALLTPRL  417



>ref|NP_194922.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9SZ46.1|C82C4_ARATH RecName: Full=Cytochrome P450 82C4 [Arabidopsis thaliana]
 emb|CAA16595.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79912.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85981.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
Length=524

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 127/171 (74%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  VG +R VEDSDIENLVYLQA++KETLRL+P  P L P EAMEDCTV GY++P 
Sbjct  348  QDEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYYVPC  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP+++ +P +F PERF+  +        + F+ +PFGSGRRSCPG  
Sbjct  408  GTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSS  467

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             AM+V HL LAR L  F+  TV +  +DM+E  G+T+P+A PLEVL++PR+
Sbjct  468  LAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPGLTIPKATPLEVLISPRI  518



>ref|XP_006297448.1| hypothetical protein CARUB_v10013469mg [Capsella rubella]
 gb|EOA30346.1| hypothetical protein CARUB_v10013469mg [Capsella rubella]
Length=448

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+  VG  R VE+SDI NL YLQA+VKET RL+PP P     EA EDC VGGY + K
Sbjct  273  QEEIEKCVGKGRWVEESDIGNLKYLQAIVKETHRLYPPAPLTGIREASEDCFVGGYRVEK  332

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-EADVAANRQFQFIPFGSGRRSCPGMLYAM  357
            GT+L VN+W+LHRDP+IW+ P+ F PERF+ E        F++IPF SGRRSCPG+   +
Sbjct  333  GTRLLVNIWKLHRDPKIWTDPKTFKPERFMDEKSQCGKSDFEYIPFSSGRRSCPGINLGL  392

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLH  504
            RV H+ LA+LLQGF    VSN  LDM EG G+ LP+ NP+EV+V PRL+
Sbjct  393  RVVHIVLAQLLQGFELRKVSNEPLDMAEGPGLALPKINPVEVVVMPRLN  441



>ref|XP_006471495.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D  VGT+R V +SDI+NLVYLQA++KE +RL+P  P L+PH+++E+CT+ GY++P 
Sbjct  350  QNELDILVGTKRQVNESDIKNLVYLQAILKEAMRLYPGSPLLIPHKSIEECTISGYNVPT  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
             TQL +NVW+L RDP +W +P KF PERFL    D+    Q F+ +PFGSGRR+CPG+ +
Sbjct  410  STQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFELLPFGSGRRTCPGVSF  469

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V   TLA LL GF+F+T SN  LDM EGLG+++ +A PLEVL+ PRL   L G
Sbjct  470  ALQVMEFTLASLLHGFDFATPSNEPLDMGEGLGLSIQKARPLEVLIAPRLSASLYG  525



>ref|XP_002281361.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG  + V +SDI+ LVYLQA++KETLRL+P  P  +PHEAMEDCT+ G+HI  
Sbjct  341  QEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQA  400

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP IWS P +F PERFL   V  +   + F+ +PFGSGRR CPG+  
Sbjct  401  GTRLLVNLWKLHRDPTIWSDPLEFQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISL  460

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A+ +  LTLARLL GF    V+++ LDMTEG+G+ +P+A PLEV + PRL
Sbjct  461  ALEILQLTLARLLHGFELGVVADSPLDMTEGVGLAMPKATPLEVTLVPRL  510



>ref|XP_008372516.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=539

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 125/171 (73%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V++SD+ NL YLQA++KETLRL+PP P     EAMEDC +GGY +PK
Sbjct  361  QEELDIHVGRDRWVQESDLTNLKYLQAILKETLRLYPPGPVTGLREAMEDCHLGGYFVPK  420

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GT+L VN+W+L RDP +W+ P +F PERF+    + D      F+++PF +GRRSCPGM 
Sbjct  421  GTRLIVNIWKLQRDPRMWANPCEFQPERFMTTHADVDFKGQCNFEYVPFSAGRRSCPGMT  480

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
              + V  L LARL+QGFN + V +  +DM EGLG+ LP+ANPLEVL+TPRL
Sbjct  481  LGLHVVQLVLARLIQGFNMNRVGDGPVDMKEGLGLALPKANPLEVLLTPRL  531



>ref|XP_009348372.1| PREDICTED: cytochrome P450 82G1-like [Pyrus x bretschneideri]
Length=539

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 123/171 (72%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG  R V++SD+ NL YLQA++KETLRL+PP P     EAMEDC +GGY +PK
Sbjct  361  QEELDIHVGRNRWVQESDLTNLKYLQAILKETLRLYPPGPVTGLREAMEDCHLGGYFVPK  420

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GT+L VN+W+L RDP +W+ P +F PERF+    + D      F+++PF +GRRSCPGM 
Sbjct  421  GTRLIVNIWKLQRDPRMWANPCEFQPERFMTTHADVDFKGQSNFEYVPFSAGRRSCPGMT  480

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
              + V  L LARL+QGFN S V +  +DM EGLG+ LP+ANPLEVL+ PRL
Sbjct  481  LGLHVVQLVLARLIQGFNMSRVGDGPVDMKEGLGLALPKANPLEVLLAPRL  531



>ref|XP_007134140.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
 gb|ESW06134.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
Length=530

 Score =   209 bits (531),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  VG ER V++SDI+NL YL A++KETLRL+PP P     EAMEDC V GYH+PK
Sbjct  353  QQELDNSVGKERWVQESDIKNLNYLHAIIKETLRLYPPAPLTGIREAMEDCCVAGYHVPK  412

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEA--DVA-ANRQFQFIPFGSGRRSCPGMLY  351
            G +L +N+W L RDPE+WS P +F PERFL    D+   ++ F+ IPF  GRRSCPG+ +
Sbjct  413  GARLLINLWELQRDPEVWSNPNEFNPERFLTTHRDIDFMSQNFELIPFSFGRRSCPGVTF  472

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
             ++V HLTLARL+QGF+ ST   A +DMTEGLG+ LP+ N L++ + PRL  +L
Sbjct  473  GLQVLHLTLARLIQGFDMSTKDGAEVDMTEGLGVALPKENELQLTLAPRLPLML  526



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   209 bits (531),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 131/177 (74%), Gaps = 5/177 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            + E+D +VGT+R V +SDI+ LVYLQA++KE +RL+P  P L+PHE++E+CTV GY++P 
Sbjct  350  RNELDIQVGTKRQVNESDIKKLVYLQAILKEAMRLYPAAPLLIPHESIEECTVSGYNVPS  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GTQL++NVW+L RDP +W +P KF PERFL    + DV   + F+ +PF SGRR CPG+ 
Sbjct  410  GTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRG-QNFELLPFSSGRRMCPGVS  468

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            +A++V   TLA LL GF+ +T SN  LDM EGLG+T+ ++ PLEVLV PRL   L G
Sbjct  469  FALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEKSTPLEVLVAPRLSASLYG  525



>ref|XP_006464299.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   209 bits (531),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D  VGT R V +SD+ NL +LQ V+KETLRL+P  P L+PHE++EDCT+ GYH+P 
Sbjct  347  QNELDVHVGTNRQVNESDMINLAHLQVVLKETLRLYPAAPLLLPHESIEDCTISGYHVPA  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQL VN W++ RDP +W +P KFLPERFL    DV    Q F+FIPFGSGRR CPG+ +
Sbjct  407  GTQLIVNAWKIQRDPGVWEEPCKFLPERFLTKYKDVDLKGQNFEFIPFGSGRRMCPGISF  466

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +V  L LA LL GF+F+T S+AA+DM E   +T  +A PLEVL+TPRL   L
Sbjct  467  AFQVMPLILASLLHGFDFATPSDAAVDMEEAKSLTYAKATPLEVLLTPRLSASL  520



>ref|XP_009136105.1| PREDICTED: cytochrome P450 82G1 [Brassica rapa]
Length=513

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 118/168 (70%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG  R VE+SDI NL YLQA+VKET RL+PP P     EA EDC +G YH+ +
Sbjct  338  QEEIDNSVGKGRWVEESDIRNLKYLQAIVKETHRLYPPAPLTGIREAREDCLLGEYHVKR  397

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-EADVAANRQFQFIPFGSGRRSCPGMLYAM  357
            G++L VN+W+LHRDP+IW  PE F PERF+ E  +     F+FIPF SGRRSCPGM   +
Sbjct  398  GSRLLVNIWKLHRDPKIWHDPETFKPERFMEEKSLCEKSDFEFIPFSSGRRSCPGMNLGL  457

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            RV HL LARL+QGF     S+  LDM EG G+ LP+ NP+EV+  PRL
Sbjct  458  RVVHLVLARLIQGFELHKASDEPLDMAEGPGLALPKINPVEVVAMPRL  505



>gb|KDP45301.1| hypothetical protein JCGZ_15166 [Jatropha curcas]
Length=525

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+++ VG  + V++SDI NL YLQA++KETLRL+PP P     EAMEDC + G++IPK
Sbjct  348  QEELNSYVGKSKWVQESDIPNLKYLQAIIKETLRLYPPGPITGIREAMEDCDINGHYIPK  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+L RDP +W+ P++FLPERFL   +D+    Q F+FIPF SGRR+CP + +
Sbjct  408  GTRLIVNIWKLQRDPRVWNNPDEFLPERFLTTHSDIDLRGQNFEFIPFSSGRRACPAINF  467

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++V HLTLARL+QGF+ S + N  +DM EG G++LP+ NP+EV++ PRL
Sbjct  468  GLQVVHLTLARLIQGFDLSRIGNVPVDMKEGPGLSLPKVNPIEVILKPRL  517



>ref|XP_009372225.1| PREDICTED: cytochrome P450 82G1-like isoform X4 [Pyrus x bretschneideri]
Length=541

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 122/171 (71%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V++SD+ NL Y QA++KETLRL+PP P     EAMEDC +GGY +PK
Sbjct  363  QEELDIHVGRDRWVQESDLTNLKYFQAILKETLRLYPPGPITGLREAMEDCHLGGYFVPK  422

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GT+L VN+W+L RDP +W+ P +F PERF+    + D      F++IPF +GRRSCPGM 
Sbjct  423  GTRLLVNIWKLQRDPRMWTNPCEFQPERFMTTHADVDFKGQSNFEYIPFSAGRRSCPGMT  482

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
              + V  L LARL+QGF  S V + A+DM EGLG+ LP+ANPLEV + PRL
Sbjct  483  LGLHVVQLVLARLIQGFEMSRVGDGAVDMKEGLGLALPKANPLEVFLAPRL  533



>ref|XP_002284810.3| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=610

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E++  VG  R V+ SDI+NLVYLQA+VKETLRL+PP P  +PHEAMEDCTV G+HI  
Sbjct  431  QAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSLPHEAMEDCTVAGFHIQA  490

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN+W+LHRDP +W  P +F PERFL      +   + ++ +PFGSGRR CPG+ +
Sbjct  491  GTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVRGKNYELLPFGSGRRVCPGISF  550

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+ +THLTLARLL GF    V+++ +DMTE  G+T P+A PLEV + PRL + L
Sbjct  551  ALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKATPLEVTIVPRLPFEL  604



>ref|XP_002869304.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45563.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 128/172 (74%), Gaps = 4/172 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  VGT++ VEDSDIENLVYLQA++KETLRL+P  P L P EAMEDC V GY++P 
Sbjct  348  QDEIDLHVGTDKNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCRVAGYNVPC  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP+++++P +F PERF+  +        + F+ +PFGSGRRSCPG  
Sbjct  408  GTRLIVNVWKIQRDPKVYTEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSS  467

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLH  504
             AM+V HL LAR L  F   TV +  +DM+E  G+T+P+A PLEVL++PRL+
Sbjct  468  LAMQVLHLGLARFLHSFEAKTVLDLPVDMSESPGLTIPKATPLEVLISPRLN  519



>gb|KFK29810.1| hypothetical protein AALP_AA7G181800 [Arabis alpina]
Length=370

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 127/175 (73%), Gaps = 4/175 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID +VGT+R VEDSDIENLVYLQA++KETLRL+P  P L P EA+E+CTV GY++ +
Sbjct  194  QDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREALENCTVAGYNVSR  253

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            G +L VNVW++ RDP+++ +P +F PERF+  +        + F+ IPFGSGRRSCPG  
Sbjct  254  GKRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVRGKNFELIPFGSGRRSCPGSS  313

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
             A++V HL LAR L  F   T+ +  +DM+E  G+T+P+A P EVL++PRL   L
Sbjct  314  LALQVLHLGLARFLHSFEVKTILDLPVDMSESPGLTIPKATPFEVLISPRLEKQL  368



>ref|XP_006297446.1| hypothetical protein CARUB_v10013469mg [Capsella rubella]
 gb|EOA30344.1| hypothetical protein CARUB_v10013469mg [Capsella rubella]
Length=515

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+  VG  R VE+SDI NL YLQA+VKET RL+PP P     EA EDC VGGY + K
Sbjct  340  QEEIEKCVGKGRWVEESDIGNLKYLQAIVKETHRLYPPAPLTGIREASEDCFVGGYRVEK  399

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL-EADVAANRQFQFIPFGSGRRSCPGMLYAM  357
            GT+L VN+W+LHRDP+IW+ P+ F PERF+ E        F++IPF SGRRSCPG+   +
Sbjct  400  GTRLLVNIWKLHRDPKIWTDPKTFKPERFMDEKSQCGKSDFEYIPFSSGRRSCPGINLGL  459

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLH  504
            RV H+ LA+LLQGF    VSN  LDM EG G+ LP+ NP+EV+V PRL+
Sbjct  460  RVVHIVLAQLLQGFELRKVSNEPLDMAEGPGLALPKINPVEVVVMPRLN  508



>ref|XP_006471496.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D  VGT+R V +SDI+NLVYLQA++KE +RL+P  P L+PH+++E+CT+ GY++P 
Sbjct  350  QNELDILVGTKRQVNESDIKNLVYLQAILKEAMRLYPGSPLLIPHKSIEECTISGYNVPT  409

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
             TQL +NVW+L RDP +W +P KF PERFL    D+    Q F+ +PFGSGRR CPG+ +
Sbjct  410  STQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFELLPFGSGRRICPGVSF  469

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V   TLA LL GF+F+T SN  LDM EGLG+++ +A PLEVL+ PRL   L G
Sbjct  470  ALQVMEFTLASLLHGFDFATPSNEPLDMGEGLGLSIQKARPLEVLIAPRLSASLYG  525



>ref|XP_008796321.1| PREDICTED: cytochrome P450 CYP82D47-like [Phoenix dactylifera]
Length=527

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            +EE+D++VG ER V++SD+E LVYLQA+VKETLRL+PP P L+PH+AME+C V G+ +P 
Sbjct  352  REELDSRVGKERNVDESDVEKLVYLQAIVKETLRLYPPGPVLIPHQAMEECQVRGFDVPA  411

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEA--DV-AANRQFQFIPFGSGRRSCPGMLY  351
            GT++ VN W +  DPE+W  P  F PERFL +  DV    R F+ +PFGSGRR+CPG  +
Sbjct  412  GTRVLVNAWAIQHDPEVWPDPSAFRPERFLTSHKDVDIRGRHFELLPFGSGRRACPGASF  471

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V HLTLAR++ GF+  T     +DMTEG G TLP+A PL VLV PRL
Sbjct  472  ALQVLHLTLARVIHGFHMRTPGGGPVDMTEGKGATLPKATPLHVLVAPRL  521



>emb|CBI29738.3| unnamed protein product [Vitis vinifera]
Length=727

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 124/162 (77%), Gaps = 5/162 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D KVG +R VE SDI+NLVY++A+VKETLRL+   P LVPHEAMEDC VGGYHI K
Sbjct  345  QEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISK  404

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VN W+LHRDP +WS PE+F PERFL +    +   + F+ IPFGSGRRSCPG+  
Sbjct  405  GTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNM  464

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPL  477
             +++ HLT+ARLLQGF+ +  SN+ +DMTE  GIT+ +  PL
Sbjct  465  GLQMLHLTIARLLQGFDMTKPSNSPVDMTE--GITIKKLVPL  504


 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 8/80 (10%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVG------  162
            QEE+D KVG +R VE SDI+NLVYL+A+VKETLRL P +P LVP EAMED  VG      
Sbjct  620  QEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLCPAIPLLVPLEAMEDYHVGYHSNSP  679

Query  163  GYHIPKGTQLYVN--VWRLH  216
            GYHIPKGT+L  +  +W +H
Sbjct  680  GYHIPKGTRLLSHFLLWNVH  699



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            +EE+D+ VG ER VE+ D++NL YL A+VKETLRL+P  P   PHE+ EDC +GGYHIP 
Sbjct  359  REELDSHVGRERQVEERDMKNLAYLNAIVKETLRLYPAGPLTAPHESTEDCLLGGYHIPA  418

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L  N+W++HRDP IWS P++F PERFL    DV    Q F+ IPFGSGRR CPG+ +
Sbjct  419  GTRLLANLWKIHRDPSIWSDPDEFRPERFLTTHKDVDVKGQHFELIPFGSGRRICPGISF  478

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++    TLA L+QGF F+T+S+  +DMTE +G+T  +A PLEVLV PRL
Sbjct  479  GLQFMQFTLASLIQGFEFATMSDEPVDMTESIGLTNLKATPLEVLVAPRL  528



>ref|XP_008382597.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=540

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 123/171 (72%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEE+D  VG +R V++SD+ NL YLQA++KET+RL+PP P     EA EDC +GGY +PK
Sbjct  362  QEELDIHVGRDRWVQESDLTNLKYLQAILKETIRLYPPGPITGLREATEDCHLGGYFVPK  421

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GT+L VN+W+L RDP +W+ P +F PERF+    + D      F++IPF +GRRSCPGM 
Sbjct  422  GTRLLVNIWKLQRDPRMWANPCEFQPERFMTTHADVDFKGQSNFEYIPFSAGRRSCPGMT  481

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
              + V  L LARL+QGFN S V + A+DM E LG+ LP+ANPLEVL+ PRL
Sbjct  482  LGLHVVQLVLARLIQGFNMSRVGDGAVDMKEALGLALPKANPLEVLLAPRL  532



>ref|XP_010432796.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 124/171 (73%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  VG +R VEDSDI NLVYLQA++KETLRL+P  P L P EAMEDCTV GY++  
Sbjct  348  QDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSS  407

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP+++ +P +F PERF+  +        + F+ +PFGSGRRSCPG  
Sbjct  408  GTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSS  467

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             AM+V HL LAR L  F   TV +  +DMTE  G+T+P+A PLEVL++PRL
Sbjct  468  LAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKATPLEVLISPRL  518



>gb|KHN42045.1| Cytochrome P450 82C4 [Glycine soja]
Length=462

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 125/171 (73%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTV-GGYHIP  177
            Q+E+DT +G +R VE+SDI  LVYLQA+VKET+RL+PP P +    AMEDCT  GGYHIP
Sbjct  285  QDELDTYIGKDRKVEESDITKLVYLQAIVKETMRLYPPSPLITLRAAMEDCTFSGGYHIP  344

Query  178  KGTQLYVNVWRLHRDPEIWSQPEKFLPERFLEA--DVAANRQ-FQFIPFGSGRRSCPGML  348
             GT+L VN W++HRD  +WS P  F P RFL +  DV    Q ++ +PFGSGRR+CPG  
Sbjct  345  AGTRLMVNAWKIHRDGRVWSDPHDFKPGRFLTSHKDVDVKGQNYELVPFGSGRRACPGAS  404

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             A+RV HLT+ARLL  FN ++ SN  +DMTE +G+T  +A PLE+L+TPRL
Sbjct  405  LALRVVHLTMARLLHSFNVASPSNQVVDMTESIGLTNLKATPLEILLTPRL  455



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 129/177 (73%), Gaps = 5/177 (3%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D +VGTER V +SD  NLVYLQA++KET+RL+P  P L+PHE +E+C V GYH+P 
Sbjct  353  QDELDIQVGTERPVNESDARNLVYLQAIIKETMRLYPAAPLLLPHECIEECIVNGYHVPA  412

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL----EADVAANRQFQFIPFGSGRRSCPGML  348
            GTQL+VN W++ RDP +W +P +F PERFL    + DV   + F+ IPFGSGRR CP + 
Sbjct  413  GTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGG-QDFELIPFGSGRRMCPAVS  471

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            + ++V  L LA L+ GF+F+T S+  +DM E +G+T+ +A PLEVLV+PRL   L G
Sbjct  472  FGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKATPLEVLVSPRLSASLYG  528



>gb|KDP46184.1| hypothetical protein JCGZ_10024 [Jatropha curcas]
Length=507

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEI+  VG    V++S I+NLVYLQA+V ETLRL+P  P   P EAMEDCT+ G+HIP 
Sbjct  331  QEEIEIHVGKHHQVKESHIKNLVYLQAIVNETLRLNPAAPLSAPREAMEDCTIAGFHIPA  390

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GT+L+VN+W+LHRDP IW  P +F PERFL   A++    Q F+++PF SGRR CPG+  
Sbjct  391  GTRLFVNLWKLHRDPSIWKNPSEFQPERFLNEHANLDVRGQDFEYLPFSSGRRMCPGVSL  450

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A+RV HLTLARLL GF   TVS+  +DM+E  G+T+P+A  LEV++ PRL  VL
Sbjct  451  ALRVLHLTLARLLHGFELGTVSDTPVDMSESPGMTVPKAKELEVVLRPRLPAVL  504



>ref|XP_010437977.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=525

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 125/172 (73%), Gaps = 4/172 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+EID  VG +R VEDSDI NLVYLQA++KETLRL+P  P L P EAMEDCTV GY++  
Sbjct  349  QDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSS  408

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAA----NRQFQFIPFGSGRRSCPGML  348
            GT+L VNVW++ RDP+++ +P +F PERF+  +        + F+ +PFGSGRRSCPG  
Sbjct  409  GTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSS  468

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLH  504
             AM+V HL LAR L  F   TV +  +DMTE  G+T+P+A PLEVL++PRL+
Sbjct  469  LAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKATPLEVLISPRLN  520



>ref|XP_006464298.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 124/174 (71%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q E+D  VGT R V +SD+ NL YLQ V+KETLRL+P  P LVPHE++EDC + GYH+P 
Sbjct  347  QNELDVHVGTNRQVNESDMINLAYLQVVLKETLRLYPAAPLLVPHESIEDCNISGYHVPA  406

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLE--ADVAANRQ-FQFIPFGSGRRSCPGMLY  351
            GTQL VN W++ RDP +W +P +FLPERFL    DV    Q F+FIPFGSGRR CPG+ +
Sbjct  407  GTQLIVNAWKIQRDPGVWEEPCRFLPERFLTKYKDVDLKGQNFEFIPFGSGRRMCPGISF  466

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
            A +V  L LA LL GF+F+T S+A +DM E   +T  +A PLEVL+TPRL   L
Sbjct  467  AFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVLLTPRLSASL  520



>ref|XP_008235428.1| PREDICTED: cytochrome P450 82G1-like [Prunus mume]
Length=535

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 127/171 (74%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  VG +R V++SD+ NL YLQA++KETLR++PP P     EA EDC + GYH+PK
Sbjct  359  QQELDIHVGRDRWVQESDLPNLKYLQAILKETLRVYPPGPLTGLREATEDCHLAGYHVPK  418

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFL--EADVAANRQ--FQFIPFGSGRRSCPGML  348
            GT+L VN+W+L RDP +W+ P +F PERF+   ADV    Q  F++IPF SGRRSCPGM+
Sbjct  419  GTRLLVNIWKLQRDPRMWANPSEFQPERFMTTHADVEFKGQNNFEYIPFSSGRRSCPGMV  478

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
              ++V  L LARL+QGF+ S V   A+DM EGLG+ LP+ANPLE L++PRL
Sbjct  479  LGLQVVQLILARLVQGFDMSRVGEEAVDMREGLGLALPKANPLEALLSPRL  529



>ref|XP_006375025.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
 gb|ERP52822.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
Length=569

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  VG ER V++SD++NLVYLQA++KET RL+P  P  VPHE+ME+CTVGGY IP 
Sbjct  392  QDELDIHVGRERQVKESDMKNLVYLQAIIKETFRLYPAAPLSVPHESMEECTVGGYQIPA  451

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L+ N+ ++HRDP++WS P++F PERFL      +   + F+ IPFGSGRR CPG+ +
Sbjct  452  GTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTQKDCDFRGQHFELIPFGSGRRMCPGVSF  511

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            A++V +L LA LL GF+  TV +A +DMTE  GIT  +A PLE L+TPRL
Sbjct  512  ALQVVNLALATLLHGFDIETVDDAPIDMTETGGITNIKATPLEALLTPRL  561



>ref|XP_010488628.1| PREDICTED: cytochrome P450 82G1 [Camelina sativa]
Length=448

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 119/169 (70%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG  R VE+SDI NL YLQA+VKET RL+PP P     EA EDC VGGY + K
Sbjct  273  QEEIDNCVGKGRWVEESDIPNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEK  332

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L VN+W+LHRDP+IW  P+ F PERF+E      +  F++IPF SGRRSCPG+   +
Sbjct  333  GTRLLVNIWKLHRDPKIWPDPKIFKPERFMEEKSQCGKSDFEYIPFSSGRRSCPGINLGL  392

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLH  504
            RV H+ LA+LLQGF     S   LDM EG G+ LP+ NP+EV+V PRL+
Sbjct  393  RVVHIVLAKLLQGFELRKASGEPLDMAEGPGLALPKINPVEVVVMPRLN  441



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 130/177 (73%), Gaps = 4/177 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG +R V++SDI+NL Y+QA++KETLRL+P  P L P EAM++C VGGY I  
Sbjct  346  QEEIDVHVGKDRQVDESDIQNLAYIQAIIKETLRLYPAGPLLGPREAMDECEVGGYKITP  405

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAAN---RQFQFIPFGSGRRSCPGMLY  351
            GT+L VNVW++ RDP IW  P+ F P+RFL ++   +   + F+ IPFGSGRRSCPG+  
Sbjct  406  GTRLIVNVWKIQRDPRIWEDPDSFKPDRFLMSNSNVDVKGQDFELIPFGSGRRSCPGVSL  465

Query  352  AMRVTHLTLARLLQGFNFST-VSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL*G  519
            A++V HLTLAR LQ F FS  V +  +D+TE  G+T+P+A PL+VL+TPRL+  L G
Sbjct  466  ALQVLHLTLARFLQAFEFSKPVGDQLIDLTESPGLTIPKATPLDVLITPRLNANLYG  522



>ref|XP_002862854.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39112.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata]
Length=483

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 119/168 (71%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            QEEID  VG  R VE+SD++NL YLQA+VKET RL+PP P     EA EDC VGGY + K
Sbjct  308  QEEIDNCVGKGRWVEESDLQNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRVKK  367

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ-FQFIPFGSGRRSCPGMLYAM  357
            GT+L  N+W+LHRDP+IW  P+ F PERF+E      +  F +IPFGSGRRSCPG+   +
Sbjct  368  GTRLLANIWKLHRDPKIWPDPQAFEPERFMEEKSQCEKSDFGYIPFGSGRRSCPGVNLGL  427

Query  358  RVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
            RV H  LAR+LQGF    VS+  +DM EG G+ LP+ NP+EV+V PRL
Sbjct  428  RVVHFVLARMLQGFELRKVSDEPVDMAEGPGLALPKINPVEVVVMPRL  475



>ref|XP_004510285.1| PREDICTED: uncharacterized protein LOC101505071 [Cicer arietinum]
Length=1052

 Score =   211 bits (538),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 129/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  1     QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
             QEEI+  +G +R VE SDI+NLVYLQA++KETLRL+PP P LVPHEA +DC + GY++PK
Sbjct  877   QEEINHHIGKKRRVESSDIKNLVYLQAIMKETLRLYPPGPLLVPHEATKDCYIQGYNVPK  936

Query  181   GTQLYVNVWRLHRDPEIWSQPEKFLPERFL---EADVAANRQFQFIPFGSGRRSCPGMLY  351
             GT+++ NVW+LHRDP IW + EKF PERF+     ++     F+++PFG GRR+CPG ++
Sbjct  937   GTRVFANVWKLHRDPSIWLEAEKFSPERFINEKNGELYEGHNFEYLPFGLGRRACPGSMF  996

Query  352   AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRLHYVL  513
             A +V  +TLARL+ GF+        +DM EGLGITLP+  PL V++TPRL Y L
Sbjct  997   ATQVCLITLARLIHGFDLEVPMGEDVDMREGLGITLPKLTPLNVILTPRLTYEL  1050


 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 122/170 (72%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVGGYHIPK  180
            Q+E+D  +G  + V++S+I+NL YLQA++KETLRL+PP P     E+++DC V GYH+PK
Sbjct  334  QQELDNNIGKHKWVQESNIKNLKYLQAIIKETLRLYPPAPLTGLRESIDDCHVAGYHVPK  393

Query  181  GTQLYVNVWRLHRDPEIWSQPEKFLPERFLEADVAANRQ---FQFIPFGSGRRSCPGMLY  351
            GT+L +N+W+L RDP IW  P +F PERFL ++   + Q   F F+PF  GRRSC G  +
Sbjct  394  GTRLLINIWKLQRDPHIWPNPNEFQPERFLTSNGQIDSQHYDFGFVPFSYGRRSCVGSTF  453

Query  352  AMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             ++V HLTLARL+QGF+  T     +DM+EG+G+ LP+ NPL +++ PRL
Sbjct  454  GLQVLHLTLARLIQGFDIYTKDGGVVDMSEGVGLALPKENPLSLMLQPRL  503



>ref|XP_003611843.1| Cytochrome P450 82A3 [Medicago truncatula]
Length=213

 Score =   197 bits (501),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 4/171 (2%)
 Frame = +1

Query  1    QEEIDTKVGTERLVEDSDIENLVYLQAVVKETLRLHPPLPFLVPHEAMEDCTVG-GYHIP  177
            Q+E++T +G +R V++SDI+NLVYLQAVVKETLRL+PP P +  H AM DCT   GYHIP
Sbjct  36   QDELNTHIGKDRKVDESDIKNLVYLQAVVKETLRLYPPSPIITLHAAMNDCTFSCGYHIP  95

Query  178  KGTQLYVNVWRLHRDPEIWSQPEKFLPERFLEA--DVAANR-QFQFIPFGSGRRSCPGML  348
             GTQL VNVW++HRD  +W+ P  F P RFL +  DV      ++ +PFGSGRR CPG  
Sbjct  96   AGTQLIVNVWKIHRDARVWTDPHDFKPGRFLTSHRDVDVRSPNYELVPFGSGRRVCPGAS  155

Query  349  YAMRVTHLTLARLLQGFNFSTVSNAALDMTEGLGITLPRANPLEVLVTPRL  501
             A+RV  LTLARLL  FN  + SN ++DMT   G+T  +A PLEV++TPRL
Sbjct  156  LALRVVQLTLARLLHSFNVVSPSNQSVDMTGSPGLTNLKATPLEVVLTPRL  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1384280488360