BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79418_g1_i1 len=886 path=[1:0-710 712:711-885]

Length=886
                                                                      Score     E

ref|XP_002265965.1|  PREDICTED: miraculin                             67.8    3e-10   Vitis vinifera
gb|ADD51186.1|  tumor-related protein                                 66.6    8e-10   Vitis cinerea var. helleri x Vitis riparia
ref|XP_004301214.1|  PREDICTED: miraculin-like                        67.0    8e-10   
emb|CAN81015.1|  hypothetical protein VITISV_025776                   66.6    9e-10   Vitis vinifera
ref|XP_002270111.1|  PREDICTED: miraculin                             65.5    2e-09   Vitis vinifera
emb|CBI35464.3|  unnamed protein product                              65.1    4e-09   
ref|XP_002266430.1|  PREDICTED: miraculin                             64.7    4e-09   Vitis vinifera
emb|CAN75396.1|  hypothetical protein VITISV_028636                   64.7    4e-09   Vitis vinifera
emb|CAN65022.1|  hypothetical protein VITISV_027379                   63.9    9e-09   Vitis vinifera
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  61.2    6e-08   
gb|ADK62529.1|  miraculin-like protein                                59.3    3e-07   
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              58.2    8e-07   
gb|AAC49969.1|  tumor-related protein                                 58.2    9e-07   Nicotiana tabacum [American tobacco]
ref|XP_009792285.1|  PREDICTED: miraculin                             58.2    1e-06   
ref|XP_002266302.2|  PREDICTED: miraculin-like                        57.0    1e-06   Vitis vinifera
ref|XP_009627067.1|  PREDICTED: miraculin                             57.8    1e-06   
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           57.4    2e-06   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        55.5    7e-06   
ref|XP_006493433.1|  PREDICTED: miraculin-like                        55.8    7e-06   
emb|CDP20822.1|  unnamed protein product                              55.5    8e-06   
emb|CBI35471.3|  unnamed protein product                              57.0    1e-05   
gb|AFL91226.1|  Kunitz-like protease inhibitor                        54.3    1e-05   
ref|XP_006493430.1|  PREDICTED: miraculin-like                        54.7    1e-05   
ref|XP_006493432.1|  PREDICTED: miraculin-like                        55.8    1e-05   
ref|XP_008238584.1|  PREDICTED: miraculin-like                        53.9    2e-05   
ref|XP_006495063.1|  PREDICTED: miraculin-like                        53.9    2e-05   
ref|XP_006495061.1|  PREDICTED: miraculin-like                        53.9    3e-05   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           53.9    3e-05   
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g           53.5    3e-05   
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           54.3    3e-05   
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...  53.1    4e-05   
gb|AFL91231.1|  Kunitz-like protease inhibitor                        52.8    4e-05   
ref|XP_009793041.1|  PREDICTED: miraculin-like                        53.1    5e-05   
gb|AFL91232.1|  Kunitz-like protease inhibitor                        52.4    6e-05   
gb|AFL91233.1|  Kunitz-like protease inhibitor                        52.0    7e-05   
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g           52.8    7e-05   
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           52.4    9e-05   
ref|XP_010279488.1|  PREDICTED: miraculin-like                        52.0    1e-04   
ref|XP_004299457.1|  PREDICTED: miraculin-like                        52.4    1e-04   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           52.0    1e-04   
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g           52.0    1e-04   
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           51.6    2e-04   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           51.2    2e-04   
gb|ACL12055.1|  Kunitz trypsin inhibitor                              51.2    2e-04   Nicotiana tabacum [American tobacco]
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           51.2    2e-04   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           51.2    2e-04   
ref|XP_010537532.1|  PREDICTED: miraculin                             50.4    3e-04   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           50.4    3e-04   
gb|AFL91227.1|  Kunitz-like protease inhibitor                        50.1    4e-04   
ref|XP_006353921.1|  PREDICTED: cysteine protease inhibitor 9-like    50.4    4e-04   
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                50.1    5e-04   Populus trichocarpa x Populus deltoides
ref|XP_006448699.1|  hypothetical protein CICLE_v10016767mg           49.7    6e-04   
gb|AFL91228.1|  Kunitz-like protease inhibitor                        49.3    6e-04   
ref|XP_004241479.1|  PREDICTED: miraculin-like                        49.7    7e-04   
dbj|BAA05474.1|  tumor-related protein                                48.1    8e-04   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_006351546.1|  PREDICTED: miraculin-like                        49.3    9e-04   
gb|AFL91229.1|  Kunitz-like protease inhibitor                        48.5    0.001   
gb|AFL91230.1|  Kunitz-like protease inhibitor                        48.5    0.001   



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 94/195 (48%), Gaps = 17/195 (9%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP ++ A+   V+DIEGK+L+ G+ Y  L  +     GL +  ++N+T  C  DVVQ  +
Sbjct  21   LPGAAEAAPDPVLDIEGKQLRSGVDYYILPVIRGRGGGLTVASVRNKT--CPLDVVQDKL  78

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDVFR  448
                   G P+ F TP N    +V++    + ++F   +A  +C Q   W L  D    +
Sbjct  79   EVSH---GLPLTF-TPVN-PKQDVIRVSTDHNIKF---SAATICAQSTVWKLEYDESTGQ  130

Query  449  KYVTT-----DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRL  613
            +++TT     +P  G     F+++K    YK+ +C T+      +C  VG+  Q GY RL
Sbjct  131  RFITTGGVEGNPGRGTLSNWFKIEKYGDDYKLVFCPTVCNFCKVICRDVGVYIQKGYRRL  190

Query  614  GIGFGVKPLQFTFSK  658
             +     P +  F K
Sbjct  191  ALTTDA-PFRVMFKK  204



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 82/171 (48%), Gaps = 16/171 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D EGK+L+ G+ Y  L        GL L    N+T  C  DVVQ     +    G P+
Sbjct  31   VLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET--CPLDVVQ---EQQEVSNGLPL  85

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDVFRKYVTTDPTAGV  481
             F TP N   G V++    + ++F   +A  +C+Q   W L  D    +++VTT    G 
Sbjct  86   TF-TPVNPKKG-VIRVSTDHNIKF---SASTICVQSTLWKLEYDESSGQRFVTTGGVEGN  140

Query  482  GGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
             G       F+++K    YK+ +C T+     PVC  +G+  QNGY RL +
Sbjct  141  PGRETLDNWFKIEKYDDDYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLAL  191



>ref|XP_004301214.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=226

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 91/187 (49%), Gaps = 15/187 (8%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSIL-GWP  301
            V DI+G  LQ G+ Y  L  +     GL L   +N+T GC  DVVQ     +S +  G P
Sbjct  45   VRDIKGDNLQTGVEYWILPVIRGKGGGLTLASNRNKTIGCPLDVVQ----EQSEVSNGLP  100

Query  302  IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQ-EIFWGLADVD--VFRKYVTT---  463
            + F +P N+T G VV+      ++F  SAA  LC Q    W L +VD    ++ VTT   
Sbjct  101  LTF-SPVNLTKG-VVRLSTDLNIKFSTSAAVTLCPQTSKVWKLDEVDESTGQRSVTTGGV  158

Query  464  --DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKP  637
              +P+       F+++K    YK+ +C  +      +C  VG+  ++G  RL +   + P
Sbjct  159  EGNPSPKTLMNWFKIEKYDDDYKLVFCPKVCRFCRVICGDVGVHLESGVRRLALSDVIVP  218

Query  638  LQFTFSK  658
            L+  F +
Sbjct  219  LKVMFKR  225



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 88/184 (48%), Gaps = 16/184 (9%)
 Frame = +2

Query  86   RQLPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQC  265
            +  P ++ +S   V+D EGK+L+ G+ Y  L  +     GL L    N+   C  DVVQ 
Sbjct  18   KPFPVAAESSPDPVLDTEGKQLRSGVDYYILPVIRGRGGGLTLASTGNEN--CPLDVVQE  75

Query  266  SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDV  442
                 +   G P+ F TP N   G V++    + ++F   +A  +C+Q   W L  D   
Sbjct  76   QHEVSN---GLPLTF-TPVNPKKG-VIRVSTDHNIKF---SASTICVQSTLWKLEYDESS  127

Query  443  FRKYVTTDPTAGVGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYN  607
             +++VTT    G  G       F+++K    YK+ +C T+     PVC  +G+  QNGY 
Sbjct  128  GQRFVTTGGVEGNPGXETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGYR  187

Query  608  RLGI  619
            RL +
Sbjct  188  RLAL  191



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 86/184 (47%), Gaps = 16/184 (9%)
 Frame = +2

Query  86   RQLPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQC  265
            +  P ++ +S   V+D EGK+L  G+ Y  L  +     GL L    N+   C  DVVQ 
Sbjct  18   KPFPVAAESSPDPVLDTEGKQLWSGVDYYILPVIRGRGGGLTLASTGNEN--CPLDVVQ-  74

Query  266  SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDV  442
                     G P+ F TP N   G V++    + ++F   +A  +C+Q   W L  D   
Sbjct  75   --EQHEVSNGLPLTF-TPVNPKKG-VIRVSTDHNIKF---SASTICVQSTLWKLEYDESS  127

Query  443  FRKYVTTDPTAGVGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYN  607
             +++VTT    G  G       F+++K    YK+ +C T+     PVC  +G+  QNGY 
Sbjct  128  GQRFVTTGGVEGNPGHETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGYR  187

Query  608  RLGI  619
            RL +
Sbjct  188  RLAL  191



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 81/171 (47%), Gaps = 16/171 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D EGK+L+ G+ Y  L        GL L    N+T  C  DVVQ     +    G P+
Sbjct  53   VLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET--CPLDVVQ---EQQEVSNGLPL  107

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDVFRKYVTTDPTAGV  481
             F TP N   G V++    + ++F   +A  +C+Q   W L  D    +++VTT    G 
Sbjct  108  TF-TPVNPKKG-VIRVSTDHNIKF---SASTICVQSTLWKLEYDESSGQRFVTTGGVEGN  162

Query  482  GGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
             G       F+++K    YK+ +C T+     PVC  +G+  QN Y RL +
Sbjct  163  PGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNEYRRLAL  213



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 81/171 (47%), Gaps = 16/171 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D EGK+L+ G+ Y  L        GL L    N+T  C  DVVQ     +    G P+
Sbjct  31   VLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET--CPLDVVQ---EQQEVSNGLPL  85

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDVFRKYVTTDPTAGV  481
             F TP N   G V++    + ++F   +A  +C+Q   W L  D    +++VTT    G 
Sbjct  86   TF-TPVNPKKG-VIRVSTDHNIKF---SASTICVQSTLWKLEYDESSGQRFVTTGGVEGN  140

Query  482  GGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
             G       F+++K    YK+ +C T+     PVC  +G+  QN Y RL +
Sbjct  141  PGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNEYRRLAL  191



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 81/171 (47%), Gaps = 16/171 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D EGK+L+ G+ Y  L        GL L    N+T  C  DVVQ     +    G P+
Sbjct  31   VLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET--CPLDVVQ---EQQEVSNGLPL  85

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDVFRKYVTTDPTAGV  481
             F TP N   G V++    + ++F   +A  +C+Q   W L  D    +++VTT    G 
Sbjct  86   TF-TPVNPKKG-VIRVSTDHNIKF---SASTICVQSTLWKLEYDESSGQRFVTTGGVEGN  140

Query  482  GGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
             G       F+++K    YK+ +C T+     PVC  +G+  QN Y RL +
Sbjct  141  PGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNXYRRLAL  191



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 81/171 (47%), Gaps = 16/171 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D EGK+L+ G+ Y  L        GL L    N++  C  DVVQ     +    G P+
Sbjct  31   VLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNES--CPLDVVQ---EQQEVSNGLPL  85

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDVFRKYVTTDPTAGV  481
             F TP N   G V++    + ++F   +A  +C+Q   W L  D    + +VTT    G 
Sbjct  86   TF-TPVNPKKG-VIRVSTDHNIKF---SASTICVQSTLWKLEYDESSGQWFVTTGGVEGN  140

Query  482  GGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
             G       F+++K    YK+ +C T+     PVC  +G+  QNGY RL +
Sbjct  141  PGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLAL  191



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 86/186 (46%), Gaps = 22/186 (12%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+DI G+EL+ G  Y  L  +     GL L    N+T  C  DVVQ  +   +   G P+
Sbjct  26   VLDISGEELRTGTDYYILPVIRGGGGGLTLASTGNET--CPLDVVQEQLEVSN---GLPL  80

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG  484
             F +P N+T G VV+      ++F   +A  +C+Q   W L + +  +K V T  T GV 
Sbjct  81   TF-SPVNITKG-VVRVSTDLNIKF---SAATICVQSTVWKLDNDEATQKMVVT--TGGVE  133

Query  485  G--------ALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKPL  640
            G          F++++    YK+ +C  +     PVC  +G+    G  RL +     PL
Sbjct  134  GNPGIETLSNWFKIERYEDDYKLVFCPGVCDFCRPVCGDLGVFIDAGIRRLALSD--VPL  191

Query  641  QFTFSK  658
            +  F +
Sbjct  192  KVMFKR  197



>gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana]
Length=205

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 16/172 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+DI GK+L+ G+ Y  L  V     GL L    N++  C  D V      K    G+P+
Sbjct  31   VVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNES--CPLDAVVQE--QKEINNGFPL  86

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFRKYVTT------  463
             F TP N   G V++E     ++F   +A  +C+Q   W L D D    KY  T      
Sbjct  87   TF-TPVNPKKG-VIRESTDLNIKF---SAASICVQTTLWKLDDFDETTGKYFITIGGNEG  141

Query  464  DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
            +P        F+++K    YK+ YC T+      +C  +G+  Q+G  RL +
Sbjct  142  NPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDIGIFIQDGTRRLAL  193



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 85/187 (45%), Gaps = 19/187 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+DI GKEL+ G+ Y  L  +     GL L    N T  C   VVQ     K    G P+
Sbjct  33   VLDISGKELRAGVNYYILPVIRGRGGGLSLASTGNNT--CPLSVVQEQSELKK---GLPL  87

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKY------VTTD  466
             F+ P +   G VV+    + ++F   +A  +C+Q   W L + +   KY      V  +
Sbjct  88   TFH-PVDPKKG-VVRLSTDHNIKF---SASTICVQSTVWRLDNDESTGKYFVNTGGVEGN  142

Query  467  PTAGVGGALFQVQKEWSG-YKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGF--GVKP  637
            P +G     F+++   S  YK+ +C T+      +C  VG++ Q+G  RLG+     V P
Sbjct  143  PGSGSISNWFKIEAYGSSDYKLLFCPTVCNFCKVICRDVGIVVQDGKRRLGLTLTDDVTP  202

Query  638  LQFTFSK  658
                F K
Sbjct  203  FPIMFKK  209



>gb|AAC49969.1| tumor-related protein [Nicotiana tabacum]
Length=210

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 80/173 (46%), Gaps = 18/173 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHD-VVQCSIFSKSSILGWP  301
            V+DI GK+L+ G+ Y  L  V     GL L    N++  C  D VVQ     K+   G P
Sbjct  31   VVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNES--CPLDAVVQEQQEIKN---GLP  85

Query  302  IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFRKYVTT-----  463
            + F TP N   G V++E     ++F   +A  +C+Q   W L D D    KY  T     
Sbjct  86   LTF-TPVNPKKG-VIRESTDLNIKF---SAASICVQTTLWKLDDFDETTGKYFITIGGNE  140

Query  464  -DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
             +P        F+++K    YK+ YC T+      +C  VG+  Q+G  RL +
Sbjct  141  GNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGIRRLAL  193



>ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris]
Length=210

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 80/173 (46%), Gaps = 18/173 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHD-VVQCSIFSKSSILGWP  301
            V+DI GK+L+ G+ Y  L  V     GL L    N++  C  D VVQ     K+   G P
Sbjct  31   VVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNES--CPLDAVVQEQQEIKN---GLP  85

Query  302  IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFRKYVTT-----  463
            + F TP N   G V++E     ++F   +A  +C+Q   W L D D    KY  T     
Sbjct  86   LTF-TPVNPKKG-VIRESTDLNIKF---SAASICVQTTLWKLDDFDETTGKYFITIGGNE  140

Query  464  -DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
             +P        F+++K    YK+ YC T+      +C  VG+  Q+G  RL +
Sbjct  141  GNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGIRRLAL  193



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 69/145 (48%), Gaps = 16/145 (11%)
 Frame = +2

Query  203  GLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPV  382
            GL L    N+T  C  DVVQ     +    G P+ F TP N   G V++    + ++F  
Sbjct  16   GLTLASTGNET--CPLDVVQ---EQQEVSNGLPLTF-TPVNPKKG-VIRVSTDHNIKF--  66

Query  383  SAAGLLCIQEIFWGLA-DVDVFRKYVTTDPTAGVGGA-----LFQVQKEWSGYKIAYCVT  544
             +A  +C+Q   W L  D    +++VTT    G  G       F+++K    YK+ +C T
Sbjct  67   -SASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCPT  125

Query  545  IPVPRVPVCYPVGLIQQNGYNRLGI  619
            +     PVC  +G+  QNGY RL +
Sbjct  126  VCDFCKPVCGDIGIYIQNGYRRLAL  150



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 79/173 (46%), Gaps = 18/173 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHD-VVQCSIFSKSSILGWP  301
            VIDI GK+L+ G+ Y  L  V     GL L    N++  C  D VVQ     K+   G P
Sbjct  31   VIDIAGKKLRTGVDYYILPVVRGRGGGLTLDSTGNES--CPLDAVVQEHHEIKN---GLP  85

Query  302  IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFRKYVTT-----  463
            + F TP N   G V++E     ++F   +A  +C+Q   W L D D    KY  T     
Sbjct  86   LTF-TPVNPKKG-VIRESTDLNIKF---SAASICVQTTLWKLDDFDEATGKYFITIGGNE  140

Query  464  -DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
             +P        F++ K    YK+ YC T+      +C  VG+  Q+G  RL +
Sbjct  141  GNPGRETISNWFKIDKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGTRRLAL  193



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 79/173 (46%), Gaps = 18/173 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSIL-GWP  301
            V+DI G +LQ G+ Y  L  +     GL L    N+T  C  DVVQ     ++ +  G P
Sbjct  34   VLDITGNKLQTGVDYYILPVIRGRGGGLTLASTSNKT-SCPLDVVQ----EQNEVSNGLP  88

Query  302  IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-------VFRKYVT  460
            + F +P NVT G VV+      ++F   +A  +C+Q   W L   D       V    V 
Sbjct  89   LKF-SPVNVTKG-VVRVSTDLNIKF---SATTICVQSTVWKLGKFDEQTGQWFVTSGGVE  143

Query  461  TDPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
             +P        F+++K    YK+ +C T+      +C  VG+  Q+G  RL +
Sbjct  144  GNPGRQTTSNWFKIEKFGDDYKLVFCPTVCNFCKVICGDVGIFFQDGKRRLAL  196



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 83/185 (45%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +A    V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  21   LPVKGNAQPDPVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRSNN-KTCPVDVVQEQH  79

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFR  448
              K+   G+P+ F +P N   G VV+E     ++F  + +   C Q   W L + D  F 
Sbjct  80   SFKN---GFPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAAFG  131

Query  449  KYVTTDPTAGVGG--------ALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ YC ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 83/185 (45%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +A    V+DI GK+L+ G  Y  L        GL L   +N  K C  DVVQ   
Sbjct  21   LPVKGNAQPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRRNN-KTCPLDVVQEQH  79

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDV-FR  448
              K+   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D  F 
Sbjct  80   SFKN---GLPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAAFG  131

Query  449  KYVTTDPTAGVGGA--------LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ YC ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>emb|CDP20822.1| unnamed protein product [Coffea canephora]
Length=204

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 77/172 (45%), Gaps = 16/172 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V DI+GKE+ +G  Y  L  +     GL L    N+T  C  DV+Q     K    G P+
Sbjct  30   VRDIDGKEVIVGAHYYILPVIRGRGGGLTLGSADNET--CPLDVIQEQFEVKR---GLPL  84

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDVFRKYVTT-----D  466
             F TP N T G VV       ++F    A  +C+Q   W L  D D+ +  + +     +
Sbjct  85   TF-TPVNTTKG-VVPVSTDLNIKF---FAATICVQSTVWKLEFDADISQYVIVSGGIEGN  139

Query  467  PTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIG  622
            P        F+++K    YK+ YC T+      +C  VG+  QNG  RL + 
Sbjct  140  PGRETISNWFKIEKYDQDYKLVYCPTVCNFCKVICRDVGIFVQNGRRRLALS  191



>emb|CBI35471.3| unnamed protein product [Vitis vinifera]
Length=2095

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 69/145 (48%), Gaps = 16/145 (11%)
 Frame = +2

Query  203   GLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPV  382
             GL L    N+T  C  DVVQ     +    G P+ F TP N   G V++    + ++F  
Sbjct  1949  GLTLASTGNET--CPLDVVQ---EQQEVSNGLPLTF-TPVNPKKG-VIRVSTDHNIKF--  1999

Query  383   SAAGLLCIQEIFWGLA-DVDVFRKYVTTDPTAGVGGA-----LFQVQKEWSGYKIAYCVT  544
              +A  +C+Q   W L  D    +++VTT    G  G       F+++K    YK+ +C T
Sbjct  2000  -SASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCPT  2058

Query  545   IPVPRVPVCYPVGLIQQNGYNRLGI  619
             +     PVC  +G+  QNGY RL +
Sbjct  2059  VCDFCKPVCGDIGIYIQNGYRRLAL  2083



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 82/183 (45%), Gaps = 17/183 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V DI+G  L+ G  Y  L        G+ L   +N++  C  DVVQ      +   G P+
Sbjct  4    VRDIDGNLLRSGTEYYILPVFRGRGGGVTLAPTRNES--CPLDVVQEGFELDN---GLPL  58

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG  484
             F TP +   G V++E     + F  S+   +CIQ   W L + +  R       +   G
Sbjct  59   TF-TPVDPKKG-VIRESTDLNIIFSASS---ICIQSNVWMLEEYEGQRIISGRGTSGNPG  113

Query  485  GAL----FQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLI-QQNGYNRLGIGFGVKPLQFT  649
            G      F+++K  +GYK+ YC T+     PVC  +G++  +NG  RL I     P +  
Sbjct  114  GETISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAI--SDVPFKIK  171

Query  650  FSK  658
            F K
Sbjct  172  FRK  174



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 81/185 (44%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +A    V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  21   LPVKGNAQPDPVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRSNN-KTCPVDVVQ---  76

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFR  448
               S   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D  F 
Sbjct  77   EQHSFRNGLPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAAFG  131

Query  449  KYVTTDPTAGVGG--------ALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            ++V T  T GV G          F+++K +  YK+ YC ++      +C  VG+    G 
Sbjct  132  QWVVT--TGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 91/205 (44%), Gaps = 22/205 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP + +AS   V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  21   LPVNGNASPDPVVDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNN-KTCPLDVVQEQH  79

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFR  448
              ++   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D V  
Sbjct  80   SFRN---GLPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAVLG  131

Query  449  KYVTTDPTAGVGG--------ALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ +C ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGIGFGVKPLQFTFSKYNATTPH  679
             RL +     PL+  F K    + H
Sbjct  190  RRLAL--SDVPLKVVFKKLRVGSKH  212



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 75/172 (44%), Gaps = 16/172 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+DI G +LQ G+ Y  L  +     GL L    N+T  C  DVVQ     ++ +     
Sbjct  34   VLDITGNKLQTGVNYYILPVIRGRGGGLTLASTSNKTS-CPLDVVQ----EQNEVSNGLS  88

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-------VFRKYVTT  463
            +  +P NVT G VV       ++F   +A  +C+Q   W L   D       V    V  
Sbjct  89   LKFSPVNVTKG-VVLVSTDLNIKF---SATTICVQSTVWKLGKFDEQTGQWFVTSGGVEG  144

Query  464  DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
            +P        F+++K    YK+ +C T+      +C  VG+  Q+G  RL +
Sbjct  145  NPGRQTTSNWFKIEKFGDDYKLVFCPTVCNFCKVICRDVGIFFQDGKRRLAL  196



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 87/198 (44%), Gaps = 22/198 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +AS   V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNN-KTCPLDVVQ---  76

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDV-FR  448
               S   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D  F 
Sbjct  77   EQHSFRNGLPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDTAFG  131

Query  449  KYVTTDPTAGVGG--------ALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ +C ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGIGFGVKPLQFTFSK  658
             RL +     PL+  F K
Sbjct  190  RRLAL--SDVPLKVVFKK  205



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 82/185 (44%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +AS   V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNN-KTCPLDVVQ---  76

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDV-FR  448
               S   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D  F 
Sbjct  77   EQHSFRNGLPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAAFG  131

Query  449  KYVTTDPTAGVGGA--------LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ YC ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 82/185 (44%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +A    V+DI GK+L+ G  Y  L        GL L   +   K C  DVVQ   
Sbjct  21   LPVKGNAQPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAG-RGNNKTCPLDVVQEQH  79

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDV-FR  448
              K+   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D  F 
Sbjct  80   SFKN---GLPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAAFG  131

Query  449  KYVTTDPTAGVGGA--------LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ YC ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>ref|XP_006372654.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
 gb|ERP50451.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
Length=206

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 85/186 (46%), Gaps = 20/186 (11%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D+ GK L+ G  Y  L  +     GL +     +T  C  DVVQ   +  S+  G P+
Sbjct  32   VLDVTGKILRTGTSYYILPVIRGRGGGLKMASTVRRT--CPLDVVQ-DRYEASN--GLPL  86

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRK--YVTTDPTAG  478
             F TP N   G VV+      +RF   +AG +C Q   W L + D + K  +VTTD   G
Sbjct  87   KF-TPVNTKKG-VVRVHTDLNIRF---SAGSICHQSTAWKLDNYDEWTKQWFVTTDGVEG  141

Query  479  VGG-----ALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGL-IQQNGYNRLGIGFGVKPL  640
              G       F+++K    YK+ +C T+      +C  +G+ +   G  RL +     PL
Sbjct  142  NPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTN--VPL  199

Query  641  QFTFSK  658
            +  F K
Sbjct  200  KVMFKK  205



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 84/185 (45%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP + +AS   V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  64   LPVNGNASPDPVLDIAGKQLRTGSKYYILPVTKGRGGGLTLAGRSNN-KTCPLDVVQEQH  122

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFR  448
              K+   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D V  
Sbjct  123  SFKN---GLPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAVLG  174

Query  449  KYVTTDPTAGVGGA--------LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ YC ++      +C  VG+    G 
Sbjct  175  QWLLT--TGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGV  232

Query  605  NRLGI  619
             RL +
Sbjct  233  RRLAL  237



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 76/172 (44%), Gaps = 17/172 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+DI GK+L+ G  Y  L        GL L    N++  C  DVVQ  +       G P+
Sbjct  22   VLDISGKKLRTGTDYYILPVFRGRGGGLTLASTGNES--CPLDVVQEQLEVSD---GLPV  76

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRK--YVTTDPTAG  478
             F +P N+  G VV+      ++F   +A  +C+Q   W L   D   +  +VTT    G
Sbjct  77   TF-SPVNIKKG-VVRVSTDQNIKF---SAATICVQPTLWKLDSFDDSTRQWFVTTGGVEG  131

Query  479  VGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI  619
              G       F+++K    YK+ +C T+      +C  VG+    G  RL +
Sbjct  132  NPGRETIDNWFKIEKYEDDYKLVFCPTVCDFCKVMCRDVGVFIDGGVRRLAL  183



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 85/184 (46%), Gaps = 19/184 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V DI+G  ++ G  Y  L        G+ L   +N++  C  DVVQ          G P+
Sbjct  4    VRDIDGNLVRSGTEYYILPVFRGRGGGVTLAPTRNES--CPLDVVQEGFELDD---GLPL  58

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG  484
             F TP +   G V++E     + F  S+   +CIQ   W L + +  ++ ++   TAG  
Sbjct  59   TF-TPVDPKKG-VIRESTDLNIIFSASS---ICIQSNVWMLEEYE-GQRIISGRGTAGNP  112

Query  485  GA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLI-QQNGYNRLGIGFGVKPLQF  646
            G       F+++K  +GYK+ YC T+     PVC  +G++  +NG  RL I     P + 
Sbjct  113  GGETISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAI--SDVPFKI  170

Query  647  TFSK  658
             F K
Sbjct  171  KFRK  174



>ref|XP_009793041.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 84/185 (45%), Gaps = 18/185 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+DI G ++++GL Y  L  +     GL   ++K Q   C  D++Q S   +    G P+
Sbjct  34   VLDINGDKVKVGLNYFVLPVIRGRGGGLLPSNVK-QNNTCPRDIIQNSDEVQE---GLPV  89

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFRKY------VTT  463
            +F TP N   G VV+  I   VRF       +C +E  W L   D   ++Y      V  
Sbjct  90   VF-TPFNTKKG-VVRLSIDLNVRF---FTPTICARETIWKLGTYDDKLKQYFIVTGGVEG  144

Query  464  DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKPLQ  643
            +P      + F+++K  + YK  +C ++      +C  VG+  ++G   L +     PL+
Sbjct  145  NPGPQTLSSWFKIEKLGTDYKFVFCPSVCKICKVICKDVGIYTKDGVRFLAL--SDTPLR  202

Query  644  FTFSK  658
              F K
Sbjct  203  VMFKK  207



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 84/184 (46%), Gaps = 19/184 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V DI+G  +  G  Y  L        G+ L   +N++  C  DVVQ          G P+
Sbjct  1    VRDIDGNLVXXGXEYYILPVFRGRGGGVTLAPTRNES--CPLDVVQEGFELDD---GLPL  55

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG  484
             F TP +   G V++E     + F  S+   +CIQ   W L + +  ++ ++   TAG  
Sbjct  56   TF-TPVDPKKG-VIRESTDLNIIFSASS---ICIQSNVWMLEEYE-GQRIISGRGTAGNP  109

Query  485  GA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLI-QQNGYNRLGIGFGVKPLQF  646
            G       F+++K  +GYK+ YC T+     PVC  +G++  +NG  RL I     P + 
Sbjct  110  GGETISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAI--SDVPFKI  167

Query  647  TFSK  658
             F K
Sbjct  168  KFRK  171



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 84/184 (46%), Gaps = 19/184 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V DI+G  +  G  Y  L        G+ L   +N++  C  DVVQ          G P+
Sbjct  4    VRDIDGNLVXSGTEYYILPVFRGXGGGVTLAPTRNES--CPLDVVQEGFELDD---GLPL  58

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG  484
             F TP +   G V++E     + F  S+   +CIQ   W L + +  ++ ++   TAG  
Sbjct  59   TF-TPVDPKKG-VIRESTDLNIIFSASS---ICIQSNVWMLEEYE-GQRIISGRGTAGNP  112

Query  485  GA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLI-QQNGYNRLGIGFGVKPLQF  646
            G       F+++K  +GYK+ YC T+     PVC  +G++  +NG  RL I     P + 
Sbjct  113  GGETISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAI--SDVPFKI  170

Query  647  TFSK  658
             F K
Sbjct  171  KFRK  174



>ref|XP_006372632.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
 gb|ERP50429.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
Length=206

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 85/186 (46%), Gaps = 20/186 (11%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D+ GK L++G  Y  L  +     GL +     +T  C  DVVQ   +  S+  G P+
Sbjct  32   VLDVTGKILRIGTSYYILPVIRGRGGGLKMASTVRRT--CPLDVVQ-DRYEASN--GLPL  86

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRK--YVTTDPTAG  478
             F TP N   G VV+      +RF   +A  +C Q   W L + D + K  +VTTD   G
Sbjct  87   KF-TPVNTKKG-VVRVHTDLNIRF---SAASICHQSTAWKLDNYDEWTKQWFVTTDGVEG  141

Query  479  VGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGL-IQQNGYNRLGIGFGVKPL  640
              G       F+++K    YK+ +C T+      +C  +G+ +   G  RL +     PL
Sbjct  142  NPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTN--VPL  199

Query  641  QFTFSK  658
            +  F K
Sbjct  200  KVMFKK  205



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 89/198 (45%), Gaps = 22/198 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +AS   V+D+ GK+L+ G  Y  L  V   Q G   +  ++  K C  DVVQ   
Sbjct  21   LPVRGNASPDPVLDVAGKKLRAGSKYYILP-VTKGQGGGLTLAGRSNNKTCPLDVVQ---  76

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFR  448
               S   G P+ F +P N   G VV+E   + ++F  + +   C Q   W L + D    
Sbjct  77   EQHSFRNGLPVTF-SPVNPKKG-VVRESTDFNIKFDAATS---CAQSTVWKLDNFDAALG  131

Query  449  KYVTTDPTAGVGG--------ALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ +C ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGIGFGVKPLQFTFSK  658
             RL +     PL+  F K
Sbjct  190  RRLAL--SDVPLKVVFKK  205



>ref|XP_010279488.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=208

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/198 (25%), Positives = 78/198 (39%), Gaps = 17/198 (9%)
 Frame = +2

Query  86   RQLPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQC  265
            R  P  +     +V+D  G++L     Y  L  +     GL     KN T  C  DVVQ 
Sbjct  20   RWSPVIAQDEPEAVLDTMGRQLCSTATYFILPAISGMGGGLNFESTKNGT--CPFDVVQD  77

Query  266  SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF  445
                 +   G P+ F +P N     +++      +RF +     L  Q   W L D +  
Sbjct  78   EDEESN---GLPLAF-SPVNPKE-EIIRVLTDQNIRFAIDT---LLPQPTVWNLGDFNES  129

Query  446  RKYVTTDPTAGVGGALFQVQKEW-------SGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
             +    +    +G    +    W         YK+ +C T+     PVC  +G+  Q+G 
Sbjct  130  ARTFLVETCGSIGNPGIETLSNWFRIEPFDDDYKLVFCPTVCNFCRPVCGDLGIAIQDGV  189

Query  605  NRLGIGFGVKPLQFTFSK  658
              L +G G++PL+  F K
Sbjct  190  RHLALGSGLEPLKIKFKK  207



>ref|XP_004299457.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=218

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 86/187 (46%), Gaps = 16/187 (9%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKG-CSHDVVQCSIFSKSSILGWP  301
            V+DI+G  +Q G+ Y  L  +     GL L    N+ +  C  DVVQ     +    G P
Sbjct  38   VLDIKGHNIQTGVEYWILPVIRGRGGGLTLATTGNRNRSICPLDVVQ---EQQEVSNGLP  94

Query  302  IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQ-EIFWGLADVD--VFRKYVTTDPT  472
            + F +P N+  G VV+      ++F  SAA  +C+     W L ++D    +++VTT   
Sbjct  95   LTF-SPVNLKIG-VVRLSTDLNIKFSTSAAVTICLNTSKVWKLDNLDESTGQRFVTTGGV  152

Query  473  AGVGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKP  637
             G  G       F+++K    YK+ +C T+      +C  VG+  + G  RL +     P
Sbjct  153  EGNPGPKTISNWFKIEKYDKDYKLVFCPTVCNFCKVICGDVGIYLEGGVRRLVL--SKVP  210

Query  638  LQFTFSK  658
            L+  F +
Sbjct  211  LKVMFKR  217



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 82/185 (44%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +AS   V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNN-KTCLLDVVQ---  76

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFR  448
               S   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D V  
Sbjct  77   EQHSFRNGLPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAVLG  131

Query  449  KYVTTDPTAGVGGA--------LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ YC ++      +C  VG+    G 
Sbjct  132  QWLLT--TGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>ref|XP_006372633.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
 gb|ERP50430.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
Length=206

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 84/186 (45%), Gaps = 20/186 (11%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D+ GK L+ G  Y  L  +     GL +     +T  C  DVVQ   +  S+  G P+
Sbjct  32   VLDVTGKILRTGTSYYILPVIRGRGGGLKMASTVRRT--CPLDVVQ-DRYEASN--GLPL  86

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRK--YVTTDPTAG  478
             F TP N   G VV+      +RF   +A  +C Q   W L + D + K  +VTTD   G
Sbjct  87   KF-TPVNTKKG-VVRVHTDLNIRF---SAASICHQSTAWKLDNYDEWTKQWFVTTDGVEG  141

Query  479  VGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGL-IQQNGYNRLGIGFGVKPL  640
              G       F+++K    YK+ +C T+      +C  +G+ +   G  RL +     PL
Sbjct  142  NPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTN--VPL  199

Query  641  QFTFSK  658
            +  F K
Sbjct  200  KVMFKK  205



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 80/183 (44%), Gaps = 16/183 (9%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +AS   V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  21   LPVRGNASADPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNN-KTCPVDVVQ---  76

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VF  445
               S   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D  + 
Sbjct  77   EQHSFRNGLPVTF-SPVNPKKG-VVRESTDINIKFDAATS---CAQSTVWKLDNFDAAIG  131

Query  446  RKYVTTDPTAGVGGAL-----FQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNR  610
            +  VTT    G  G       F+++K +  YK+ YC ++      +C  VG+    G  R
Sbjct  132  QWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  611  LGI  619
            L +
Sbjct  192  LAL  194



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 84/185 (45%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +AS   V+DI GK+L+ G  Y  L  V   Q G   +  ++  K C  DVVQ   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILP-VTKGQGGGLTLAGRSNNKTCPLDVVQ---  76

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFR  448
               S   G+P+ F +P N   G VV+E     ++F  + +   C Q   W L + D    
Sbjct  77   EQHSLRNGFPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAALG  131

Query  449  KYVTTDPTAGVGG--------ALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ +C ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>gb|ACL12055.1| Kunitz trypsin inhibitor [Nicotiana tabacum]
Length=209

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 83/185 (45%), Gaps = 18/185 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+DI G ++++GL Y  L  +     GL   ++K Q   C  D++Q S   +    G P+
Sbjct  34   VLDINGDKVKVGLNYFVLPVIRGRGGGLLPSNVK-QNNTCPRDIIQNSDEVQE---GLPV  89

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFRKY------VTT  463
            +F  P N   G VV+  I   VRF       +C +E  W L   D   ++Y      V  
Sbjct  90   VF-APFNTKKG-VVRLSIDLNVRF---FTPTICARETIWKLGTYDDKLKQYFIVTGGVEG  144

Query  464  DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKPLQ  643
            +P      + F+++K  + YK  +C ++      +C  VG+  ++G   L +     PL+
Sbjct  145  NPGPQTLSSWFKIEKLGTDYKFVFCPSVCKICKVICKDVGIYTKDGVRFLAL--SDTPLR  202

Query  644  FTFSK  658
              F K
Sbjct  203  VMFKK  207



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 81/185 (44%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +AS   V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNN-KTCPVDVVQ---  76

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDV-FR  448
               S   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D    
Sbjct  77   EQHSFRNGLPVTF-SPVNPKKG-VVRESTDLNIKFDAATS---CAQSTVWKLDNFDAALG  131

Query  449  KYVTTDPTAGVGGA--------LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ YC ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFFGNYKLVYCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 81/185 (44%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +A    V+DI GK+L+ G  Y  L        GL L   +   K C  DVVQ   
Sbjct  21   LPVKGNAQPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAG-RGNNKTCPLDVVQEQH  79

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDV-FR  448
              K+   G P+ F +P N   G VV+E     ++   + +   C Q   W L + D  F 
Sbjct  80   SFKN---GLPVTF-SPVNPKKG-VVRESTDINIKLDAATS---CAQSTVWKLDNFDAAFG  131

Query  449  KYVTTDPTAGVGGA--------LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ YC ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>ref|XP_010537532.1| PREDICTED: miraculin [Tarenaya hassleriana]
Length=202

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 83/185 (45%), Gaps = 20/185 (11%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V DI GK ++ GL Y  L  V     GL +    N+T  C   VVQ   F  S   G+P+
Sbjct  30   VRDIRGKPVRAGLDYYILPVVRGRGGGLTMASAGNKT--CPMSVVQ-DKFEVSP--GFPL  84

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRK--YVTTDPTAG  478
             F +P++     +V       V+F   +A  +C+Q   W L   D   K  +VTT    G
Sbjct  85   TF-SPSD--KSRIVGISTDQNVKF---SAATICVQSTVWKLESFDETTKQWFVTTGGVEG  138

Query  479  VGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKPLQ  643
              G       F+++K  + YK+ +C T+      +C  +G+  Q+G  RL +     PL+
Sbjct  139  NPGRETISNWFKIEKLGNDYKLVFCPTVCNFCKVICRDIGVFVQDGKRRLAL--SDVPLK  196

Query  644  FTFSK  658
              F +
Sbjct  197  VMFKR  201



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 82/185 (44%), Gaps = 20/185 (11%)
 Frame = +2

Query  92   LPssssasgasVIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSI  271
            LP   +AS   V+DI GK+L+ G  Y  L        GL L    N  K C  DVVQ   
Sbjct  21   LPVRGNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNN-KTCPLDVVQEQH  79

Query  272  FSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFR  448
              ++   G P+ F +P N   G VV+E     ++F  + +   C Q   W L + D    
Sbjct  80   SFRN---GLPVTF-SPVNPKKG-VVRESTDINIKFDAATS---CAQSTVWKLDNFDAALG  131

Query  449  KYVTTDPTAGVGG--------ALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGY  604
            +++ T  T GV G          F+++K +  YK+ +C ++      +C  VG+    G 
Sbjct  132  QWLVT--TGGVEGNPGPRTMRNWFKIEKFYGDYKLVFCPSVCNIFRGLCRDVGIFINGGV  189

Query  605  NRLGI  619
             RL +
Sbjct  190  RRLAL  194



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 83/184 (45%), Gaps = 19/184 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V D +G  +  G  Y  L        G+ L   +N++  C  DVVQ          G P+
Sbjct  4    VRDXDGNLVXSGTEYYILPVFRGRGGGVTLAPTRNES--CPLDVVQEGFELDD---GLPL  58

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG  484
             F TP +   G V++E     + F  S+   +CIQ   W L + +  ++ ++   TAG  
Sbjct  59   TF-TPVDPKKG-VIRESTDLNIIFSASS---ICIQSNVWMLEEYE-GQRIISGRGTAGNP  112

Query  485  GA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLI-QQNGYNRLGIGFGVKPLQF  646
            G       F+++K  +GYK+ YC T+     PVC  +G++  +NG  RL I     P + 
Sbjct  113  GGETISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAI--SDVPFKI  170

Query  647  TFSK  658
             F K
Sbjct  171  KFRK  174



>ref|XP_006353921.1| PREDICTED: cysteine protease inhibitor 9-like [Solanum tuberosum]
Length=227

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 87/197 (44%), Gaps = 33/197 (17%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQ--CSIFSKSSILGW  298
            V+D+EG  L++   Y+ LS  F     + L DI N+T+ C + VVQ     F  S+    
Sbjct  39   VLDMEGHSLKINEEYSILSIPFG-GGSVYLADIDNRTE-CPNGVVQDRSGDFDHST----  92

Query  299  PIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWG-----LADVDVFRKYVTT  463
            P++F      T  N V E    ++ F  S++   C  E  W      L  +    ++V T
Sbjct  93   PVLF-----YTMDNFVFEDQDVSIMFSTSSSTKSCFNETVWQAGNHMLGPIRPPPRFVIT  147

Query  464  DPTAGVGGA-----LFQVQKEWS----GYKIAYCVT---IPVPRVPVCYPVGLIQQNGYN  607
              T G+ G       F+++K  +     YK+ YC +    P  +   C  VGL +  GY 
Sbjct  148  GGTLGIPGPNTLNNWFKIEKYETERPHSYKLRYCPSKYMCPTCQFD-CADVGLYEDRGYT  206

Query  608  RLGIGFGVKPLQFTFSK  658
            RL +    KP  F FSK
Sbjct  207  RLAL--NNKPYPFGFSK  221



>gb|ACS92516.1| Kunitz-type protease inhibitor KPI-D12 [Populus trichocarpa x 
Populus deltoides]
Length=206

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 82/186 (44%), Gaps = 20/186 (11%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D+ GK L+ G  Y  L  +     GL +     +T  C  DVVQ    + +   G P+
Sbjct  32   VLDVTGKILRTGTGYYILPVIRGRGGGLKMASTGRRT--CPLDVVQDRYEASN---GLPL  86

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRK--YVTTDPTAG  478
             F TP N   G VV+      +RF   +A  +C Q   W L   D + K  +VTT+   G
Sbjct  87   KF-TPVNTKKG-VVRVHTDLNIRF---SAASICHQSTAWKLGSYDEWTKQWFVTTNGVEG  141

Query  479  VGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGL-IQQNGYNRLGIGFGVKPL  640
              G       F+++K    YK+ +C T+      +C  +G+ +   G  RL +     PL
Sbjct  142  NPGPETTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLAL--SSVPL  199

Query  641  QFTFSK  658
            +  F K
Sbjct  200  KVMFKK  205



>ref|XP_006448699.1| hypothetical protein CICLE_v10016767mg [Citrus clementina]
 gb|ESR61939.1| hypothetical protein CICLE_v10016767mg [Citrus clementina]
Length=200

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 78/177 (44%), Gaps = 17/177 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+D  G+ LQ GL Y  L +      GL L+D   +   C   V Q        +  +P+
Sbjct  35   VLDTNGQALQRGLEYYILPEDNATGGGLTLVD---RNDSCPLYVGQKETSGSEGL--FPV  89

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFW--GLADVDVFRKYVTTDPTAG  478
             F+    V   N+V+E   + V F   +A   CIQ   W  G +D +  R+++    T G
Sbjct  90   TFS--PFVGEENIVRESHDFIVTF---SAFTTCIQSTAWRVGESDPETGRRFIV---TGG  141

Query  479  VGGALFQVQKEWSGYKIAYCVTIPVPRVPV-CYPVGLIQQNGYNRLGIGFGVKPLQF  646
            V G  F++ +  + Y + +C ++  P   + C   G++ +NG   L +     P  F
Sbjct  142  VPG-FFRIDRNGTSYNLGWCPSMACPNCRLRCGFAGILIENGKRLLALDGPALPFVF  197



>gb|AFL91228.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 79/171 (46%), Gaps = 17/171 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V DI+G  +  G  Y  L        G+ L   +N++  C  DVVQ          G P+
Sbjct  4    VRDIDGNLVXXGXEYYILPXFRGRGGGVTLAPTRNES--CPLDVVQEGFELDD---GLPL  58

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG  484
             F TP +   G V++E     + F  S+   +CIQ   W L + +  ++ ++   TAG  
Sbjct  59   TF-TPVDPKKG-VIRESTDLNIIFSASS---ICIQSNVWMLEEYE-GQRIISGRGTAGNP  112

Query  485  GA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLI-QQNGYNRLGI  619
            G       F+++K  +GYK+ YC T+     PVC  +G++  +NG   L I
Sbjct  113  GGETISNWFKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRXLXI  163



>ref|XP_004241479.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=200

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 78/186 (42%), Gaps = 18/186 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVF-IFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP  301
            V+D+ G E+Q G  Y  L  +      GL   ++KN    C  D++Q   +      G P
Sbjct  23   VLDVNGDEVQAGPNYFILPVIRGRGGGGLSPFNVKNNNT-CPRDIIQ---WDDEEQEGLP  78

Query  302  IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFRKY------VT  460
            ++F         +VV+      VRF       +C +E  W L D D   +KY      V 
Sbjct  79   VVFTRID--AKKSVVRVSTDVNVRFYTPT---ICARETIWKLGDYDDKLKKYFVVTGGVE  133

Query  461  TDPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKPL  640
             +P     G  F++++  SGYK+ YC ++      +C  VG+   N   RL +     P 
Sbjct  134  GNPGLKTVGNWFKIERFGSGYKLVYCPSVCKFCKVICKDVGIFITNDGVRL-LALSDTPY  192

Query  641  QFTFSK  658
            +  F K
Sbjct  193  KVMFKK  198



>dbj|BAA05474.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=125

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 53/117 (45%), Gaps = 12/117 (10%)
 Frame = +2

Query  293  GWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD-VFRKYVTT--  463
            G P+ F TP N   G V++E     ++F   +A  +C+Q   W L D D    KY  T  
Sbjct  3    GLPLTF-TPVNPKKG-VIRESTDLNIKF---SAASICVQTTLWKLDDFDETTGKYFITIG  57

Query  464  ----DPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIG  622
                +P        F+++K    YK+ YC T+      +C  VG+  Q+G  RL + 
Sbjct  58   GNEGNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGIRRLALS  114



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 80/185 (43%), Gaps = 18/185 (10%)
 Frame = +2

Query  125  VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI  304
            V+DI+GK L+ G+ Y  L  V     GL +  I +  K C  D V           G P+
Sbjct  31   VVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGD--KICPLDAVVQEHHEIDQ--GLPL  86

Query  305  IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDPTAG  478
             F TP N   G V++E     + F   +A  +C+Q   W L D D    + ++T   T G
Sbjct  87   TF-TPVNPKKG-VIRESTDLNIIF---SANSICVQTTQWKLDDFDETTGQYFITLGGTQG  141

Query  479  VGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKPLQ  643
              G        +++K    YK+ YC T+      +C  +G+  Q+G  RL +     P +
Sbjct  142  NPGRETVSNWIKIEKFDRDYKLLYCPTVCDICKVICKDIGIFIQDGVRRLALSDA--PFK  199

Query  644  FTFSK  658
              F K
Sbjct  200  VMFKK  204



>gb|AFL91229.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=164

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 75/158 (47%), Gaps = 19/158 (12%)
 Frame = +2

Query  203  GLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPV  382
            G+ L   +N++  C  DVVQ          G P+ F TP +   G V++E     + F  
Sbjct  19   GVTLAPTRNES--CPLDVVQEGFELDD---GLPLTF-TPVDPKKG-VIRESTDLNIIFSA  71

Query  383  SAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVGGA-----LFQVQKEWSGYKIAYCVTI  547
            S+   +CIQ   W L + +  ++ ++   TAG  G       F+++K  +GYK+ YC T+
Sbjct  72   SS---ICIQSNVWMLEEYE-GQRIISGRGTAGNPGGETISNWFKIEKYENGYKLVYCPTV  127

Query  548  PVPRVPVCYPVGLI-QQNGYNRLGIGFGVKPLQFTFSK  658
                 PVC  +G++  +NG  RL I     P +  F K
Sbjct  128  CDLCRPVCGDIGVVFAENGSRRLAI--SDVPFKIKFRK  163



>gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=159

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 75/158 (47%), Gaps = 19/158 (12%)
 Frame = +2

Query  203  GLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPV  382
            G+ L   +N++  C  DVVQ          G P+ F TP +   G V++E     + F  
Sbjct  14   GVTLAPTRNES--CPLDVVQEGFELDD---GLPLTF-TPVDPKKG-VIRESTDLNIIFSA  66

Query  383  SAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVGGA-----LFQVQKEWSGYKIAYCVTI  547
            S+   +CIQ   W L + +  ++ ++   TAG  G       F+++K  +GYK+ YC T+
Sbjct  67   SS---ICIQSNVWMLEEYEG-QRIISGRGTAGNPGGETISNWFKIEKYENGYKLVYCPTV  122

Query  548  PVPRVPVCYPVGLI-QQNGYNRLGIGFGVKPLQFTFSK  658
                 PVC  +G++  +NG  RL I     P +  F K
Sbjct  123  CDLCRPVCGDIGVVFAENGSRRLAI--SDVPFKIKFRK  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1790173656348