BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7939_g2_i1 len=355 path=[2245:0-354]

Length=355
                                                                      Score     E

ref|XP_010249037.1|  PREDICTED: peroxidase 55-like                    89.7    6e-19   
ref|XP_006470079.1|  PREDICTED: peroxidase 55-like                    89.4    6e-19   
ref|XP_006447048.1|  hypothetical protein CICLE_v10016043mg           89.4    6e-19   
gb|KDO63914.1|  hypothetical protein CISIN_1g020449mg                 89.4    7e-19   
emb|CBI21341.3|  unnamed protein product                              89.0    9e-19   
ref|XP_009802952.1|  PREDICTED: peroxidase 55-like                    88.6    1e-18   
ref|XP_002509503.1|  Peroxidase 55 precursor, putative                88.6    1e-18   Ricinus communis
ref|XP_002274131.2|  PREDICTED: peroxidase 55-like                    88.2    2e-18   Vitis vinifera
ref|XP_009606506.1|  PREDICTED: peroxidase 55                         87.8    3e-18   
gb|KHG27040.1|  Peroxidase 51 -like protein                           87.0    4e-18   
ref|XP_011009184.1|  PREDICTED: peroxidase 55                         87.0    5e-18   
ref|XP_006373205.1|  hypothetical protein POPTR_0017s09640g           87.0    5e-18   
ref|XP_008231106.1|  PREDICTED: peroxidase 55                         86.7    7e-18   
ref|XP_006338701.1|  PREDICTED: peroxidase 51-like                    86.7    7e-18   
ref|XP_007216155.1|  hypothetical protein PRUPE_ppa015245mg           85.5    1e-17   
ref|XP_007031900.1|  Peroxidase superfamily protein                   85.5    2e-17   
gb|KDP46270.1|  hypothetical protein JCGZ_10110                       84.7    3e-17   
ref|XP_004303962.1|  PREDICTED: peroxidase 55-like                    84.3    5e-17   
ref|XP_010315910.1|  PREDICTED: peroxidase 51                         83.2    1e-16   
ref|XP_002298633.2|  hypothetical protein POPTR_0001s33680g           82.0    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009125965.1|  PREDICTED: peroxidase 55-like                    82.4    3e-16   
gb|AHL39115.1|  class III peroxidase                                  82.0    3e-16   
ref|XP_008441330.1|  PREDICTED: peroxidase 55-like                    82.0    4e-16   
ref|XP_003633781.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 55    82.8    5e-16   
ref|XP_004138796.1|  PREDICTED: peroxidase 51-like                    81.3    5e-16   
ref|XP_004166427.1|  PREDICTED: peroxidase 51-like                    81.3    5e-16   
ref|XP_006399923.1|  hypothetical protein EUTSA_v10014070mg           81.3    6e-16   
ref|XP_011097275.1|  PREDICTED: peroxidase 51                         80.5    1e-15   
emb|CDX91081.1|  BnaC02g05160D                                        80.5    1e-15   
emb|CDX85612.1|  BnaA02g02010D                                        80.5    2e-15   
ref|XP_010112376.1|  Peroxidase 55                                    79.0    4e-15   
ref|XP_010250695.1|  PREDICTED: peroxidase 51                         78.6    6e-15   
ref|XP_010492211.1|  PREDICTED: peroxidase 55-like                    78.6    6e-15   
ref|XP_006288149.1|  hypothetical protein CARUB_v10001386mg           78.6    6e-15   
ref|XP_002873650.1|  predicted protein                                78.6    7e-15   
gb|KFK25644.1|  hypothetical protein AALP_AA8G141400                  78.2    7e-15   
ref|XP_010679610.1|  PREDICTED: peroxidase 51-like                    78.2    8e-15   
emb|CDY58408.1|  BnaC09g54550D                                        77.8    9e-15   
ref|XP_009121694.1|  PREDICTED: peroxidase 55                         77.8    1e-14   
emb|CBI33713.3|  unnamed protein product                              77.0    1e-14   
ref|XP_006841967.1|  hypothetical protein AMTR_s00144p00031900        77.8    1e-14   
ref|XP_004138795.1|  PREDICTED: peroxidase 55-like                    77.4    1e-14   
ref|NP_196917.1|  peroxidase 55                                       77.4    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008441329.1|  PREDICTED: peroxidase 51-like                    77.4    1e-14   
gb|ABK21900.1|  unknown                                               77.4    2e-14   Picea sitchensis
ref|XP_007031901.1|  Peroxidase superfamily protein                   79.0    2e-14   
ref|XP_002284278.1|  PREDICTED: peroxidase 73                         77.0    2e-14   Vitis vinifera
ref|XP_004304524.1|  PREDICTED: peroxidase 55-like                    77.0    2e-14   
gb|KGN63166.1|  hypothetical protein Csa_2G406640                     77.0    2e-14   
ref|XP_010033422.1|  PREDICTED: peroxidase 51-like                    76.3    4e-14   
ref|XP_008441332.1|  PREDICTED: peroxidase 51-like                    75.9    5e-14   
emb|CDP02994.1|  unnamed protein product                              75.9    5e-14   
ref|XP_010905285.1|  PREDICTED: peroxidase 35-like                    75.9    5e-14   
gb|KGN61954.1|  hypothetical protein Csa_2G271470                     76.3    6e-14   
ref|XP_007047481.1|  Class III peroxidase                             75.9    6e-14   
gb|KHN28333.1|  Peroxidase 73                                         75.5    7e-14   
gb|EYU29643.1|  hypothetical protein MIMGU_mgv1a014486mg              73.9    9e-14   
ref|XP_010911693.1|  PREDICTED: peroxidase 51-like                    72.8    9e-14   
ref|XP_004513315.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...  74.7    1e-13   
gb|KDP35389.1|  hypothetical protein JCGZ_10373                       74.7    1e-13   
gb|KHN40966.1|  Peroxidase 55                                         73.6    2e-13   
ref|XP_010094192.1|  Peroxidase 45                                    74.7    2e-13   
ref|NP_001130210.1|  uncharacterized protein LOC100191304 precursor   74.7    2e-13   Zea mays [maize]
gb|ACG42971.1|  peroxidase 73 precursor                               74.7    2e-13   Zea mays [maize]
ref|XP_009344467.1|  PREDICTED: peroxidase 50-like                    74.7    2e-13   
ref|XP_006453319.1|  hypothetical protein CICLE_v10010461mg           74.3    2e-13   
gb|KDO61842.1|  hypothetical protein CISIN_1g046044mg                 74.3    2e-13   
ref|XP_009604475.1|  PREDICTED: peroxidase 51-like                    74.3    2e-13   
gb|EYU37318.1|  hypothetical protein MIMGU_mgv1a009838mg              73.9    2e-13   
ref|XP_010277087.1|  PREDICTED: peroxidase 51-like                    73.9    3e-13   
ref|XP_009421098.1|  PREDICTED: peroxidase 51                         73.9    3e-13   
ref|XP_003550018.1|  PREDICTED: peroxidase 50-like                    73.6    3e-13   
gb|ACU19256.1|  unknown                                               73.6    3e-13   Glycine max [soybeans]
ref|XP_010531296.1|  PREDICTED: peroxidase 50                         73.6    3e-13   
ref|XP_010680021.1|  PREDICTED: peroxidase 16-like                    73.9    4e-13   
gb|ACJ11763.1|  class III peroxidase                                  73.6    4e-13   Gossypium hirsutum [American cotton]
ref|XP_004234654.1|  PREDICTED: peroxidase 51                         73.6    4e-13   
gb|EYU34812.1|  hypothetical protein MIMGU_mgv1a025312mg              72.8    4e-13   
ref|XP_008441333.1|  PREDICTED: peroxidase 51-like                    73.6    4e-13   
ref|XP_003553930.1|  PREDICTED: peroxidase 55                         73.6    4e-13   
gb|KHG21770.1|  Peroxidase 51 -like protein                           73.6    4e-13   
ref|XP_003548517.2|  PREDICTED: peroxidase 55-like                    73.2    5e-13   
gb|KHN09929.1|  Peroxidase 55                                         73.2    5e-13   
ref|XP_004147080.1|  PREDICTED: peroxidase 51-like                    73.2    5e-13   
ref|XP_002866704.1|  peroxidase 73                                    73.2    5e-13   
ref|XP_008238250.1|  PREDICTED: peroxidase 73-like                    73.2    6e-13   
ref|XP_007205527.1|  hypothetical protein PRUPE_ppa008489mg           73.2    6e-13   
gb|AAO45182.1|  peroxidase 1                                          73.2    6e-13   Artemisia annua [sweet Annie]
ref|XP_002462635.1|  hypothetical protein SORBIDRAFT_02g029340        73.2    6e-13   Sorghum bicolor [broomcorn]
ref|XP_006279521.1|  hypothetical protein CARUB_v10027970mg           73.2    6e-13   
gb|AFK33671.1|  unknown                                               72.8    7e-13   
ref|NP_001275041.1|  peroxidase 51-like precursor                     72.8    7e-13   
ref|XP_004231908.1|  PREDICTED: peroxidase 51                         72.8    7e-13   
gb|AFK48158.1|  unknown                                               72.8    7e-13   
ref|XP_006404085.1|  hypothetical protein EUTSA_v10010538mg           72.8    7e-13   
gb|EYU44477.1|  hypothetical protein MIMGU_mgv1a026768mg              72.8    7e-13   
ref|XP_004138794.1|  PREDICTED: peroxidase 51-like                    72.8    8e-13   
ref|XP_006339817.1|  PREDICTED: peroxidase 51-like                    72.8    8e-13   
gb|KGN63167.1|  hypothetical protein Csa_2G406650                     72.8    8e-13   
ref|XP_004166423.1|  PREDICTED: peroxidase 51-like                    72.8    9e-13   
ref|XP_010272213.1|  PREDICTED: peroxidase 73-like                    72.8    9e-13   
ref|XP_004509077.1|  PREDICTED: peroxidase 73-like                    72.4    9e-13   
ref|XP_008787159.1|  PREDICTED: peroxidase 50                         72.4    1e-12   
ref|XP_008781029.1|  PREDICTED: peroxidase 51-like                    72.4    1e-12   
ref|XP_010086957.1|  Peroxidase 51                                    72.4    1e-12   
ref|XP_009396783.1|  PREDICTED: peroxidase 55-like                    72.4    1e-12   
ref|XP_007155845.1|  hypothetical protein PHAVU_003G236500g           72.4    1e-12   
ref|XP_009763998.1|  PREDICTED: peroxidase 51-like                    72.4    1e-12   
ref|XP_007161721.1|  hypothetical protein PHAVU_001G092900g           72.0    1e-12   
ref|XP_011099352.1|  PREDICTED: peroxidase 73                         72.0    1e-12   
ref|XP_008792666.1|  PREDICTED: peroxidase 51-like                    72.0    1e-12   
gb|KHN06005.1|  Peroxidase 73                                         72.0    1e-12   
ref|XP_008457736.1|  PREDICTED: peroxidase 51-like                    72.0    1e-12   
ref|XP_004141876.1|  PREDICTED: peroxidase 73-like                    72.0    1e-12   
ref|XP_010547542.1|  PREDICTED: peroxidase 35-like                    72.0    1e-12   
ref|XP_008440361.1|  PREDICTED: peroxidase 73-like                    72.0    1e-12   
ref|NP_201541.1|  peroxidase 73                                       72.0    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525252.1|  Peroxidase 73 precursor, putative                72.0    2e-12   Ricinus communis
ref|XP_004288471.1|  PREDICTED: peroxidase 73-like                    71.6    2e-12   
ref|XP_007156729.1|  hypothetical protein PHAVU_002G012300g           71.6    2e-12   
gb|KDO78967.1|  hypothetical protein CISIN_1g0211121mg                70.1    2e-12   
ref|XP_004957292.1|  PREDICTED: peroxidase 73-like                    71.6    2e-12   
ref|XP_010028113.1|  PREDICTED: peroxidase 73-like                    71.6    2e-12   
gb|AAX84669.1|  secretory peroxidase PX3                              71.6    2e-12   Manihot esculenta [manioc]
ref|XP_010444652.1|  PREDICTED: peroxidase 73                         71.2    3e-12   
ref|XP_010484504.1|  PREDICTED: peroxidase 73-like                    71.2    3e-12   
gb|EYU37317.1|  hypothetical protein MIMGU_mgv1a009833mg              71.2    3e-12   
ref|XP_011013593.1|  PREDICTED: peroxidase 73-like                    71.2    3e-12   
ref|XP_006845692.1|  hypothetical protein AMTR_s00019p00237230        70.9    3e-12   
ref|XP_003549343.1|  PREDICTED: peroxidase 16                         70.9    3e-12   
gb|ACU23164.1|  unknown                                               70.9    3e-12   Glycine max [soybeans]
ref|XP_010679607.1|  PREDICTED: peroxidase 50-like isoform X1         70.9    4e-12   
gb|AFY97684.1|  peroxidase 1                                          70.9    4e-12   
gb|AAB41812.1|  peroxidase                                            70.9    4e-12   Medicago sativa [alfalfa]
emb|CAN64129.1|  hypothetical protein VITISV_039161                   71.2    4e-12   Vitis vinifera
ref|XP_002324463.1|  Peroxidase 16 precursor family protein           70.9    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004242911.1|  PREDICTED: peroxidase 16                         70.9    4e-12   
ref|XP_006344534.1|  PREDICTED: peroxidase 45-like                    70.5    5e-12   
ref|XP_006380636.1|  Peroxidase 50 precursor family protein           70.9    5e-12   
ref|XP_008340941.1|  PREDICTED: peroxidase 51-like                    70.5    5e-12   
emb|CDP02582.1|  unnamed protein product                              70.5    5e-12   
ref|XP_010906276.1|  PREDICTED: peroxidase 51-like                    70.5    5e-12   
ref|XP_002532803.1|  Peroxidase 16 precursor, putative                70.5    6e-12   Ricinus communis
ref|XP_004511856.1|  PREDICTED: peroxidase 51-like                    70.5    6e-12   
gb|KHN15314.1|  Peroxidase 16                                         70.5    6e-12   
ref|XP_008223742.1|  PREDICTED: peroxidase 16-like                    70.1    6e-12   
ref|XP_006573655.1|  PREDICTED: peroxidase 51                         70.1    6e-12   
ref|XP_008223743.1|  PREDICTED: peroxidase 16                         70.1    7e-12   
ref|XP_006466484.1|  PREDICTED: peroxidase 51-like                    70.1    7e-12   
ref|NP_001241630.1|  uncharacterized protein LOC100804350 precursor   70.1    7e-12   
gb|KHN12986.1|  Peroxidase 51                                         70.1    7e-12   
ref|XP_002877713.1|  predicted protein                                70.1    7e-12   
ref|XP_006426061.1|  hypothetical protein CICLE_v10026050mg           70.1    7e-12   
ref|XP_004296463.1|  PREDICTED: peroxidase 45-like                    70.1    8e-12   
ref|XP_010432051.1|  PREDICTED: peroxidase 50-like                    70.1    8e-12   
ref|XP_010437219.1|  PREDICTED: peroxidase 50                         70.1    9e-12   
ref|XP_010927767.1|  PREDICTED: peroxidase 55-like                    69.7    9e-12   
emb|CAA07352.1|  peroxidase                                           68.6    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003608472.1|  Peroxidase                                       68.6    9e-12   
ref|XP_010489449.1|  PREDICTED: peroxidase 16-like                    69.7    9e-12   
ref|XP_009342775.1|  PREDICTED: peroxidase 73-like                    69.7    9e-12   
gb|AAN60320.1|  unknown                                               68.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467737.1|  PREDICTED: peroxidase 16                         69.7    1e-11   
ref|XP_002268127.1|  PREDICTED: peroxidase 16                         69.7    1e-11   Vitis vinifera
ref|XP_008379105.1|  PREDICTED: peroxidase 55-like                    69.7    1e-11   
emb|CDY29561.1|  BnaA03g54060D                                        69.7    1e-11   
ref|XP_007014305.1|  Peroxidase family protein                        69.7    1e-11   
gb|ACI42310.2|  peroxidase 5                                          69.3    1e-11   Litchi chinensis [litchi]
ref|XP_009130545.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 73    69.3    1e-11   
ref|XP_009347014.1|  PREDICTED: peroxidase 16-like                    69.3    1e-11   
ref|NP_001242402.1|  uncharacterized protein LOC100817540 precursor   69.3    1e-11   
ref|XP_008390952.1|  PREDICTED: peroxidase 16-like                    69.3    1e-11   
emb|CAA70034.1|  peroxidase ATP22a                                    69.3    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488001.1|  PREDICTED: peroxidase 16-like                    69.3    1e-11   
gb|KDP32054.1|  hypothetical protein JCGZ_12515                       69.3    1e-11   
ref|XP_010550341.1|  PREDICTED: peroxidase 35-like                    69.3    1e-11   
ref|XP_010426527.1|  PREDICTED: peroxidase 35-like                    69.3    1e-11   
ref|NP_179488.1|  peroxidase 16                                       69.3    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515362.1|  PREDICTED: peroxidase 35                         69.3    1e-11   
ref|XP_010503665.1|  PREDICTED: peroxidase 35-like                    69.3    2e-11   
ref|XP_006290363.1|  hypothetical protein CARUB_v10017623mg           69.3    2e-11   
ref|XP_006656422.1|  PREDICTED: peroxidase 16-like                    69.3    2e-11   
ref|XP_006300101.1|  hypothetical protein CARUB_v10016330mg           68.9    2e-11   
ref|XP_010464099.1|  PREDICTED: peroxidase 73-like                    68.9    2e-11   
ref|XP_009402171.1|  PREDICTED: peroxidase 51-like                    68.9    2e-11   
ref|XP_003608471.1|  Peroxidase                                       68.9    2e-11   
emb|CAC38106.1|  peroxidase2                                          68.9    2e-11   Medicago sativa [alfalfa]
ref|XP_007222667.1|  hypothetical protein PRUPE_ppa008569mg           68.9    2e-11   
emb|CAA62228.1|  peroxidase2                                          68.9    2e-11   Medicago sativa [alfalfa]
emb|CAA09881.1|  peroxidase                                           68.9    2e-11   Trifolium repens [creeping white clover]
ref|XP_009784349.1|  PREDICTED: peroxidase 51-like                    68.9    2e-11   
ref|XP_010550209.1|  PREDICTED: peroxidase 55                         68.9    2e-11   
emb|CAA67362.1|  peroxidase ATP9a                                     68.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408351.1|  PREDICTED: peroxidase 55-like                    68.9    2e-11   
gb|KEH22009.1|  peroxidase family protein                             68.6    2e-11   
gb|AFK49058.1|  unknown                                               68.6    2e-11   
ref|XP_009135008.1|  PREDICTED: peroxidase 50                         68.6    3e-11   
ref|XP_008790752.1|  PREDICTED: peroxidase 55                         68.6    3e-11   
emb|CDX69313.1|  BnaC01g01400D                                        68.6    3e-11   
gb|KHN22682.1|  Peroxidase 16                                         68.6    3e-11   
ref|NP_001078508.1|  peroxidase 51                                    67.8    3e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56994.1|  AT4G37530                                            67.8    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAA71495.1|  peroxidase                                           68.6    3e-11   Spinacia oleracea
gb|ACU20973.1|  unknown                                               67.4    3e-11   Glycine max [soybeans]
ref|NP_001190944.1|  peroxidase 50                                    68.6    3e-11   
ref|NP_195468.1|  peroxidase 50                                       68.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30370.1|  hypothetical protein AALP_AA7G252300                  68.2    3e-11   
gb|AAM63630.1|  peroxidase, prxr2                                     68.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411878.1|  hypothetical protein EUTSA_v10025695mg           68.2    3e-11   
ref|XP_008466661.1|  PREDICTED: peroxidase 45-like                    68.2    4e-11   
ref|XP_004136312.1|  PREDICTED: peroxidase 45-like                    68.2    4e-11   
ref|XP_003597106.1|  Peroxidase                                       67.0    4e-11   
ref|XP_009387951.1|  PREDICTED: peroxidase 51-like isoform X2         68.2    4e-11   
ref|XP_009387950.1|  PREDICTED: peroxidase 51-like isoform X1         68.2    4e-11   
gb|AFF57838.1|  peroxidase                                            68.2    4e-11   
gb|KFK29573.1|  peroxidase atp8a                                      68.2    4e-11   
ref|XP_003533723.1|  PREDICTED: peroxidase 16-like                    68.2    4e-11   
ref|XP_008352559.1|  PREDICTED: peroxidase 50-like                    66.6    4e-11   
ref|XP_007154738.1|  hypothetical protein PHAVU_003G143400g           67.8    4e-11   
ref|NP_195469.1|  peroxidase 51                                       68.2    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009783800.1|  PREDICTED: peroxidase 16-like                    67.8    5e-11   
ref|XP_009600643.1|  PREDICTED: peroxidase 16-like                    67.8    5e-11   
ref|XP_011069927.1|  PREDICTED: peroxidase 16                         67.8    5e-11   
ref|XP_003546418.1|  PREDICTED: peroxidase 16                         67.8    6e-11   
ref|XP_002459236.1|  hypothetical protein SORBIDRAFT_02g001130        65.9    6e-11   Sorghum bicolor [broomcorn]
ref|XP_006393941.1|  hypothetical protein EUTSA_v10004576mg           67.4    6e-11   
ref|NP_194746.1|  peroxidase 45                                       67.4    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597105.1|  Peroxidase                                       67.4    7e-11   
ref|XP_006284112.1|  hypothetical protein CARUB_v10005246mg           67.4    8e-11   
ref|XP_002868984.1|  peroxidase ATP9a                                 67.4    8e-11   
ref|XP_006658226.1|  PREDICTED: peroxidase 51-like                    67.0    9e-11   
gb|EAZ09688.1|  hypothetical protein OsI_31971                        64.7    9e-11   Oryza sativa Indica Group [Indian rice]
emb|CDP16702.1|  unnamed protein product                              67.0    9e-11   
ref|XP_002869392.1|  predicted protein                                67.0    9e-11   
gb|ACJ11759.1|  class III peroxidase                                  67.0    1e-10   Gossypium hirsutum [American cotton]
ref|XP_009137893.1|  PREDICTED: peroxidase 45                         67.0    1e-10   
ref|NP_190565.1|  peroxidase 35                                       67.0    1e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72214.1|  BnaC07g42360D                                        67.0    1e-10   
ref|XP_006282666.1|  hypothetical protein CARUB_v10005222mg           67.0    1e-10   
gb|ADD54643.1|  peroxidase                                            66.6    1e-10   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010526357.1|  PREDICTED: peroxidase 16                         66.6    1e-10   
emb|CDY37853.1|  BnaAnng05140D                                        67.0    1e-10   
ref|XP_006412738.1|  hypothetical protein EUTSA_v10025699mg           66.6    1e-10   
ref|XP_007227473.1|  hypothetical protein PRUPE_ppa008550mg           66.6    1e-10   
ref|XP_010048567.1|  PREDICTED: peroxidase 16-like                    66.6    1e-10   
gb|ACN60160.1|  peroxidase                                            66.6    1e-10   Tamarix hispida
emb|CDY51649.1|  BnaAnng10890D                                        67.0    1e-10   
ref|XP_008350315.1|  PREDICTED: peroxidase 51-like                    66.6    1e-10   
ref|XP_008219934.1|  PREDICTED: peroxidase 16-like                    66.6    1e-10   
ref|XP_010048668.1|  PREDICTED: peroxidase 16                         66.2    2e-10   
ref|XP_008368006.1|  PREDICTED: peroxidase 51-like                    66.6    2e-10   
emb|CDY66754.1|  BnaCnng52220D                                        67.4    2e-10   
ref|XP_010438209.1|  PREDICTED: peroxidase 45-like                    66.2    2e-10   
ref|XP_002884180.1|  hypothetical protein ARALYDRAFT_900345           66.2    2e-10   
ref|XP_010447758.1|  PREDICTED: peroxidase 45                         66.2    2e-10   
ref|XP_011043934.1|  PREDICTED: peroxidase 45-like                    66.2    2e-10   
ref|XP_006284105.1|  hypothetical protein CARUB_v10005239mg           66.2    2e-10   
ref|XP_010433020.1|  PREDICTED: peroxidase 45-like                    66.2    2e-10   
ref|XP_007138800.1|  hypothetical protein PHAVU_009G238400g           66.2    2e-10   
ref|XP_009128021.1|  PREDICTED: peroxidase 45                         66.2    2e-10   
emb|CDY28166.1|  BnaA01g06830D                                        66.2    2e-10   
gb|AAL49862.1|  putative peroxidase                                   66.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669285.1|  PREDICTED: peroxidase 16-like                    66.2    2e-10   
ref|XP_010246527.1|  PREDICTED: peroxidase 16-like                    65.9    2e-10   
gb|AFK40484.1|  unknown                                               65.9    2e-10   
ref|XP_010525719.1|  PREDICTED: peroxidase 16-like                    65.9    2e-10   
gb|EMS53834.1|  Peroxidase 55                                         64.3    3e-10   
ref|NP_001241556.1|  uncharacterized protein LOC100793327 precursor   65.9    3e-10   
ref|XP_006600191.1|  PREDICTED: uncharacterized protein LOC100793...  65.9    3e-10   
ref|XP_008670022.1|  PREDICTED: peroxidase 50-like                    65.9    3e-10   
ref|XP_003610076.1|  Peroxidase                                       65.5    3e-10   
ref|NP_001063616.1|  Os09g0507500                                     65.5    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004507879.1|  PREDICTED: peroxidase 16-like                    65.5    3e-10   
emb|CDX72634.1|  BnaC07g46560D                                        65.5    3e-10   
ref|XP_004498581.1|  PREDICTED: peroxidase 45-like                    65.1    5e-10   
dbj|BAJ99589.1|  predicted protein                                    64.7    6e-10   
gb|ABS86778.1|  peroxidase 16 precursor protein                       65.1    6e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001058450.1|  Os06g0695500                                     65.1    6e-10   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85219.1|  predicted protein                                    64.7    6e-10   
ref|XP_006848256.1|  hypothetical protein AMTR_s00013p00052590        64.7    6e-10   
ref|XP_009607563.1|  PREDICTED: peroxidase 16-like                    64.7    7e-10   
ref|XP_010453527.1|  PREDICTED: peroxidase 55                         65.1    7e-10   
gb|KEH39755.1|  class III peroxidase                                  63.9    9e-10   
gb|KEH39756.1|  class III peroxidase                                  64.3    1e-09   
gb|EPS73647.1|  hypothetical protein M569_01108                       63.9    1e-09   
ref|XP_003563477.2|  PREDICTED: peroxidase 16-like                    63.9    1e-09   
ref|XP_006285849.1|  hypothetical protein CARUB_v10007328mg           63.9    1e-09   
ref|XP_002459238.1|  hypothetical protein SORBIDRAFT_02g001140        63.9    1e-09   
gb|EYU29641.1|  hypothetical protein MIMGU_mgv1a009564mg              63.9    2e-09   
ref|XP_010246526.1|  PREDICTED: peroxidase 16-like                    63.5    2e-09   
gb|AFK39314.1|  unknown                                               63.5    2e-09   
ref|XP_004966145.1|  PREDICTED: peroxidase 16-like                    63.5    2e-09   
gb|EEE66467.1|  hypothetical protein OsJ_22874                        63.5    2e-09   
ref|XP_009620453.1|  PREDICTED: peroxidase 51-like                    63.5    2e-09   
ref|XP_010420034.1|  PREDICTED: peroxidase 55-like                    63.5    2e-09   
ref|XP_002987236.1|  hypothetical protein SELMODRAFT_125631           63.2    2e-09   
ref|NP_001058755.1|  Os07g0115300                                     63.2    2e-09   
ref|XP_002976403.1|  hypothetical protein SELMODRAFT_104905           63.2    2e-09   
ref|XP_004291278.1|  PREDICTED: peroxidase 45-like                    63.2    3e-09   
ref|XP_008367710.1|  PREDICTED: peroxidase 16-like                    62.8    3e-09   
ref|NP_001054120.1|  Os04g0656800                                     62.4    5e-09   
emb|CAE03412.3|  OSJNBa0071I13.13                                     62.4    5e-09   
gb|EAZ32259.1|  hypothetical protein OsJ_16463                        62.4    5e-09   
ref|XP_008667326.1|  PREDICTED: hypothetical protein isoform X2       62.0    6e-09   
gb|ACJ11764.1|  class III peroxidase                                  62.0    6e-09   
ref|XP_008667325.1|  PREDICTED: hypothetical protein isoform X1       62.0    7e-09   
gb|EMT04725.1|  Peroxidase 35                                         61.6    8e-09   
ref|XP_009772707.1|  PREDICTED: peroxidase 16-like                    61.6    9e-09   
ref|XP_006411877.1|  hypothetical protein EUTSA_v10025717mg           61.6    9e-09   
ref|XP_004245302.1|  PREDICTED: peroxidase 45-like                    61.6    1e-08   
ref|XP_009363613.1|  PREDICTED: peroxidase 16-like                    61.2    1e-08   
ref|XP_004960136.1|  PREDICTED: peroxidase 16-like                    61.2    1e-08   
dbj|BAJ85420.1|  predicted protein                                    60.8    1e-08   
gb|EMS57821.1|  Peroxidase 51                                         60.8    1e-08   
ref|XP_008644997.1|  PREDICTED: peroxidase 45-like                    60.8    2e-08   
ref|XP_006652942.1|  PREDICTED: peroxidase 16-like                    60.8    2e-08   
gb|EMS50398.1|  Peroxidase 35                                         60.8    2e-08   
ref|XP_009112219.1|  PREDICTED: peroxidase 73                         60.8    2e-08   
emb|CDX81319.1|  BnaC09g07300D                                        60.8    2e-08   
gb|KFK28390.1|  hypothetical protein AALP_AA8G508800                  60.5    2e-08   
gb|EMS64964.1|  Peroxidase 16                                         59.7    2e-08   
ref|XP_007161310.1|  hypothetical protein PHAVU_001G059100g           60.5    2e-08   
ref|NP_001142258.1|  uncharacterized protein LOC100274427 precursor   60.1    3e-08   
ref|XP_006656421.1|  PREDICTED: peroxidase 16-like                    60.1    3e-08   
ref|XP_004955343.1|  PREDICTED: peroxidase 51-like                    60.1    3e-08   
gb|EAZ02213.1|  hypothetical protein OsI_24307                        59.7    4e-08   
ref|XP_002522523.1|  Peroxidase 19 precursor, putative                59.7    4e-08   
gb|EAZ07777.1|  hypothetical protein OsI_30030                        57.0    4e-08   
dbj|BAD53899.1|  putative peroxidase                                  59.3    5e-08   
gb|KDP21043.1|  hypothetical protein JCGZ_21514                       59.3    5e-08   
ref|XP_003557666.1|  PREDICTED: peroxidase 50-like                    59.3    6e-08   
ref|NP_001147676.1|  peroxidase 45 precursor                          58.9    8e-08   
ref|XP_002437513.1|  hypothetical protein SORBIDRAFT_10g028470        58.9    8e-08   
emb|CBI30642.3|  unnamed protein product                              58.9    8e-08   
tpg|DAA48227.1|  TPA: hypothetical protein ZEAMMB73_235803            56.6    8e-08   
ref|NP_001241793.1|  uncharacterized protein LOC100856980 precursor   56.6    9e-08   
ref|XP_006656420.1|  PREDICTED: peroxidase 45-like                    58.5    1e-07   
ref|XP_002437516.1|  hypothetical protein SORBIDRAFT_10g028500        58.5    1e-07   
ref|XP_007011594.1|  Peroxidase superfamily protein                   58.5    1e-07   
ref|XP_002448675.1|  hypothetical protein SORBIDRAFT_06g031300        58.5    1e-07   
dbj|BAJ86125.1|  predicted protein                                    58.5    1e-07   
ref|XP_006650636.1|  PREDICTED: peroxidase 51-like                    58.5    1e-07   
dbj|BAK07855.1|  predicted protein                                    58.2    1e-07   
ref|XP_010540501.1|  PREDICTED: peroxidase 19-like                    58.2    2e-07   
gb|ACF84302.1|  unknown                                               58.2    2e-07   
gb|EMS54557.1|  Peroxidase 51                                         56.2    2e-07   
ref|XP_008665468.1|  PREDICTED: peroxidase 73-like                    57.4    2e-07   
ref|XP_010111940.1|  Peroxidase 45                                    57.8    2e-07   
ref|XP_010918952.1|  PREDICTED: peroxidase 19                         57.8    2e-07   
ref|XP_003559061.1|  PREDICTED: peroxidase 35-like                    57.4    2e-07   
emb|CDO96728.1|  unnamed protein product                              57.4    2e-07   
gb|AFW69262.1|  peroxidase 45                                         57.4    2e-07   
ref|XP_003579412.1|  PREDICTED: peroxidase 16-like                    57.4    3e-07   
dbj|BAD11654.1|  putative peroxidase                                  57.4    3e-07   
tpg|DAA51528.1|  TPA: hypothetical protein ZEAMMB73_497140            57.4    3e-07   
ref|XP_006657285.1|  PREDICTED: peroxidase 45-like                    56.6    3e-07   
ref|NP_001062342.1|  Os08g0532700                                     57.4    3e-07   
ref|XP_002437514.1|  hypothetical protein SORBIDRAFT_10g028480        57.0    3e-07   
ref|NP_001051360.1|  Os03g0762400                                     57.4    3e-07   
emb|CDX69314.1|  BnaC01g01390D                                        57.0    3e-07   
gb|ACF86227.1|  unknown                                               57.0    3e-07   
ref|NP_001152697.1|  LOC100286338 precursor                           57.0    4e-07   
ref|XP_010549389.1|  PREDICTED: peroxidase 19-like isoform X1         57.0    4e-07   
ref|XP_006367201.1|  PREDICTED: peroxidase 19-like                    56.6    5e-07   
ref|XP_002272881.1|  PREDICTED: peroxidase 19                         56.6    5e-07   
gb|EEE66279.1|  hypothetical protein OsJ_22484                        56.2    6e-07   
tpg|DAA48228.1|  TPA: hypothetical protein ZEAMMB73_235803            56.2    6e-07   
gb|EMT04726.1|  Peroxidase 35                                         55.8    6e-07   
ref|XP_009793056.1|  PREDICTED: peroxidase 19                         56.2    6e-07   
tpe|CAH69333.1|  TPA: class III peroxidase 91 precursor               56.2    6e-07   
gb|EMT21900.1|  Peroxidase 55                                         56.2    7e-07   
gb|ACF87131.1|  unknown                                               56.2    7e-07   
ref|NP_001058449.1|  Os06g0695400                                     56.2    7e-07   
gb|EYU41115.1|  hypothetical protein MIMGU_mgv1a024280mg              54.3    7e-07   
ref|XP_004974008.1|  PREDICTED: peroxidase 51-like                    56.2    7e-07   
ref|XP_008225182.1|  PREDICTED: peroxidase 19                         56.2    8e-07   
dbj|BAF97642.1|  peroxidase                                           54.3    8e-07   
ref|XP_004966146.1|  PREDICTED: peroxidase 45-like                    55.8    8e-07   
ref|XP_008811548.1|  PREDICTED: peroxidase 19                         56.2    8e-07   
dbj|BAF97645.1|  peroxidase                                           54.3    8e-07   
gb|EMT16598.1|  Peroxidase 16                                         55.8    8e-07   
ref|XP_004981669.1|  PREDICTED: peroxidase 51-like                    55.8    8e-07   
gb|EMS60412.1|  Peroxidase 55                                         56.2    9e-07   
ref|XP_007214109.1|  hypothetical protein PRUPE_ppa017084mg           55.8    9e-07   
emb|CAA05897.1|  peroxidase                                           55.8    1e-06   
dbj|BAF97643.1|  peroxidase                                           53.9    1e-06   
gb|EAZ02212.1|  hypothetical protein OsI_24306                        55.5    1e-06   
gb|EEE66278.1|  hypothetical protein OsJ_22482                        55.5    1e-06   
ref|XP_004232949.1|  PREDICTED: peroxidase 19                         55.8    1e-06   
dbj|BAD53897.1|  putative peroxidase                                  55.5    1e-06   
ref|XP_006659625.1|  PREDICTED: peroxidase 16-like                    55.5    1e-06   
ref|XP_002960519.1|  hypothetical protein SELMODRAFT_164271           55.5    1e-06   
ref|XP_002962173.1|  hypothetical protein SELMODRAFT_403769           55.5    1e-06   
ref|XP_007153695.1|  hypothetical protein PHAVU_003G057000g           55.5    1e-06   
gb|EEC81242.1|  hypothetical protein OsI_24308                        55.5    1e-06   
ref|NP_001058447.1|  Os06g0695200                                     55.5    1e-06   
gb|EMT07199.1|  Peroxidase 45                                         55.5    1e-06   
ref|XP_002466408.1|  hypothetical protein SORBIDRAFT_01g007240        55.5    1e-06   
gb|EMS49814.1|  Peroxidase 45                                         55.5    1e-06   
dbj|BAK05617.1|  predicted protein                                    55.1    1e-06   
dbj|BAJ98260.1|  predicted protein                                    55.1    2e-06   
ref|XP_002970089.1|  hypothetical protein SELMODRAFT_231472           55.1    2e-06   
dbj|BAK03977.1|  predicted protein                                    55.1    2e-06   
ref|XP_009388701.1|  PREDICTED: peroxidase P7-like                    55.5    2e-06   
emb|CDP11261.1|  unnamed protein product                              53.1    2e-06   
emb|CDP20370.1|  unnamed protein product                              53.1    2e-06   
ref|XP_003563475.1|  PREDICTED: peroxidase 45-like                    54.7    2e-06   
ref|XP_011027738.1|  PREDICTED: peroxidase 19                         55.1    2e-06   
gb|EPS60801.1|  hypothetical protein M569_13997                       54.7    2e-06   
ref|XP_009346467.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 19    54.7    2e-06   
ref|XP_004966148.1|  PREDICTED: peroxidase 45-like                    54.7    2e-06   
gb|EMS53156.1|  Peroxidase 2                                          53.9    2e-06   
ref|XP_003571918.1|  PREDICTED: peroxidase 16-like                    54.7    2e-06   
ref|XP_002444695.1|  hypothetical protein SORBIDRAFT_07g026130        54.7    2e-06   
ref|XP_010655890.1|  PREDICTED: peroxidase 51-like                    54.7    2e-06   
ref|XP_006377454.1|  hypothetical protein POPTR_0011s06080g           54.7    3e-06   
gb|EMT04711.1|  putative Peroxidase 2                                 53.9    3e-06   
ref|XP_006449451.1|  hypothetical protein CICLE_v10017786mg           54.7    3e-06   
gb|EMS67394.1|  Peroxidase 45                                         54.3    3e-06   
ref|XP_004966147.1|  PREDICTED: peroxidase 45-like                    54.3    3e-06   
dbj|BAJ84815.1|  predicted protein                                    54.3    3e-06   
ref|XP_003574829.1|  PREDICTED: peroxidase 51-like                    54.3    3e-06   
ref|XP_009615522.1|  PREDICTED: peroxidase 19                         54.3    3e-06   
gb|AHL39169.1|  class III peroxidase                                  54.3    3e-06   
ref|XP_008244957.1|  PREDICTED: peroxidase 6-like                     54.3    3e-06   
ref|XP_006650635.1|  PREDICTED: peroxidase 51-like                    53.9    4e-06   
ref|XP_006468207.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 1...  54.3    4e-06   
ref|XP_002438930.1|  hypothetical protein SORBIDRAFT_10g028460        53.9    4e-06   
ref|XP_011045887.1|  PREDICTED: peroxidase 19-like                    53.9    4e-06   
emb|CAI47635.1|  peroxidase precursor                                 53.9    4e-06   
ref|XP_002985280.1|  hypothetical protein SELMODRAFT_122015           53.9    4e-06   
ref|XP_002872000.1|  hypothetical protein ARALYDRAFT_489097           53.9    4e-06   
ref|XP_010101879.1|  Peroxidase 25                                    53.9    4e-06   
gb|KDO77766.1|  hypothetical protein CISIN_1g036989mg                 53.5    5e-06   
gb|AAL34125.1|AC090713_12  putative peroxidase                        53.5    5e-06   
gb|KHN47154.1|  Peroxidase 25                                         53.5    5e-06   
ref|NP_001051358.1|  Os03g0762300                                     53.5    5e-06   
gb|EAY91949.1|  hypothetical protein OsI_13636                        53.5    5e-06   
ref|XP_011096394.1|  PREDICTED: peroxidase 19                         53.5    5e-06   
gb|KEH30935.1|  peroxidase family protein                             53.5    5e-06   
ref|NP_001241840.1|  uncharacterized protein LOC100857040 precursor   52.4    5e-06   
gb|AFW69258.1|  hypothetical protein ZEAMMB73_925002                  52.4    5e-06   
ref|XP_008371438.1|  PREDICTED: peroxidase 19                         53.5    6e-06   
ref|XP_002965084.1|  hypothetical protein SELMODRAFT_230472           53.5    6e-06   
ref|XP_003541513.1|  PREDICTED: peroxidase 19-like                    53.5    6e-06   
ref|XP_006653496.1|  PREDICTED: peroxidase 31-like                    53.1    6e-06   
ref|XP_007226656.1|  hypothetical protein PRUPE_ppa021819mg           53.1    7e-06   
ref|XP_010101536.1|  Peroxidase 19                                    53.1    7e-06   
ref|XP_004299587.1|  PREDICTED: peroxidase 41-like                    53.1    7e-06   
ref|NP_180953.1|  peroxidase 19                                       53.1    7e-06   
gb|AAL86286.1|  putative peroxidase                                   53.1    7e-06   
ref|XP_006594277.1|  PREDICTED: peroxidase 25-like                    53.1    7e-06   
dbj|BAF97644.1|  peroxidase                                           51.6    7e-06   
ref|XP_006410550.1|  hypothetical protein EUTSA_v10016874mg           53.1    7e-06   
ref|XP_002305096.1|  hypothetical protein POPTR_0004s05140g           53.1    8e-06   
ref|XP_007025480.1|  Peroxidase 19, putative isoform 2                53.1    9e-06   
emb|CDP11670.1|  unnamed protein product                              52.8    9e-06   
ref|XP_009419956.1|  PREDICTED: peroxidase 19                         52.8    1e-05   
ref|XP_007025479.1|  Peroxidase 19, putative isoform 1                52.8    1e-05   
ref|NP_001152260.1|  peroxidase 51 precursor                          52.8    1e-05   
ref|XP_010057321.1|  PREDICTED: peroxidase 19-like                    52.8    1e-05   
tpg|DAA51532.1|  TPA: hypothetical protein ZEAMMB73_619996            51.6    1e-05   
ref|XP_007036111.1|  Peroxidase superfamily protein                   52.8    1e-05   
gb|AFW69259.1|  peroxidase 16                                         52.4    1e-05   
ref|XP_007043233.1|  Uncharacterized protein TCM_007682               50.1    1e-05   
ref|XP_004292438.1|  PREDICTED: peroxidase 19-like                    52.4    1e-05   
ref|NP_001151822.1|  peroxidase 16 precursor                          52.4    1e-05   
ref|XP_001759079.1|  predicted protein                                52.4    1e-05   
emb|CDY64769.1|  BnaCnng44830D                                        52.0    1e-05   
ref|XP_003624734.1|  Peroxidase                                       52.4    1e-05   
ref|XP_008643820.1|  PREDICTED: peroxidase 16 isoform X1              52.4    1e-05   
gb|ACU18723.1|  unknown                                               50.1    1e-05   
ref|XP_004505395.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 1...  52.4    1e-05   
ref|XP_002972219.1|  hypothetical protein SELMODRAFT_97331            52.0    2e-05   
gb|AHL39116.1|  class III peroxidase                                  52.0    2e-05   
ref|XP_002298516.2|  Peroxidase 63 precursor family protein           52.0    2e-05   
ref|XP_010687995.1|  PREDICTED: peroxidase 25                         52.0    2e-05   
gb|ABK94345.1|  unknown                                               52.0    2e-05   
emb|CDM86909.1|  unnamed protein product                              52.0    2e-05   
dbj|BAJ85566.1|  predicted protein                                    52.0    2e-05   
ref|XP_008790007.1|  PREDICTED: peroxidase P7-like                    52.0    2e-05   
ref|NP_001168671.1|  hypothetical protein precursor                   52.0    2e-05   
ref|XP_007138302.1|  hypothetical protein PHAVU_009G197100g           52.0    2e-05   
ref|XP_006438488.1|  hypothetical protein CICLE_v10031996mg           52.0    2e-05   
ref|XP_002979285.1|  hypothetical protein SELMODRAFT_233271           52.0    2e-05   
ref|XP_002466407.1|  hypothetical protein SORBIDRAFT_01g007230        52.0    2e-05   
emb|CAA71492.1|  peroxidase                                           51.6    2e-05   
gb|EMT29593.1|  Peroxidase 34                                         49.3    2e-05   
ref|XP_002310058.2|  hypothetical protein POPTR_0007s07330g           51.6    2e-05   
ref|XP_001761216.1|  predicted protein                                51.6    2e-05   
tpg|DAA51529.1|  TPA: hypothetical protein ZEAMMB73_619996            51.6    2e-05   
ref|XP_002988594.1|  hypothetical protein SELMODRAFT_272010           51.6    2e-05   
emb|CDY49518.1|  BnaC05g03300D                                        51.6    2e-05   
gb|EMT27344.1|  Peroxidase 4                                          52.0    2e-05   
ref|XP_002992995.1|  hypothetical protein SELMODRAFT_236645           51.6    2e-05   
ref|XP_009143810.1|  PREDICTED: peroxidase 19-like                    51.6    3e-05   
ref|XP_008353006.1|  PREDICTED: peroxidase 6-like                     51.6    3e-05   
ref|XP_008644003.1|  PREDICTED: hypothetical protein isoform X1       51.2    3e-05   
ref|XP_002455567.1|  hypothetical protein SORBIDRAFT_03g013210        51.6    3e-05   
gb|EMS53818.1|  Cationic peroxidase 1                                 51.2    3e-05   



>ref|XP_010249037.1| PREDICTED: peroxidase 55-like [Nelumbo nucifera]
Length=326

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  148  WRAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             R EGQLAENFYA TCPNVE IV+Q V+TKFSQTF T+PATLRLFFHDC
Sbjct  20   GRGEGQLAENFYAFTCPNVEAIVRQTVSTKFSQTFTTIPATLRLFFHDC  68



>ref|XP_006470079.1| PREDICTED: peroxidase 55-like [Citrus sinensis]
Length=326

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R +GQL ENFY+STCPNVE IV +VV+TKFSQTF+TVPATLRLFFHDC
Sbjct  22   RGDGQLVENFYSSTCPNVESIVNRVVSTKFSQTFITVPATLRLFFHDC  69



>ref|XP_006447048.1| hypothetical protein CICLE_v10016043mg [Citrus clementina]
 gb|ESR60288.1| hypothetical protein CICLE_v10016043mg [Citrus clementina]
Length=307

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R +GQL ENFY+STCPNVE IV +VV+TKFSQTF+TVPATLRLFFHDC
Sbjct  3    RGDGQLVENFYSSTCPNVESIVNRVVSTKFSQTFITVPATLRLFFHDC  50



>gb|KDO63914.1| hypothetical protein CISIN_1g020449mg [Citrus sinensis]
Length=326

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R +GQL ENFY+STCPNVE IV +VV+TKFSQTF+TVPATLRLFFHDC
Sbjct  22   RGDGQLVENFYSSTCPNVESIVNRVVSTKFSQTFITVPATLRLFFHDC  69



>emb|CBI21341.3| unnamed protein product [Vitis vinifera]
Length=292

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  148  WRAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             + EGQLAENFY+S+CPNVE IV+Q V+TKFSQTF T+PATLRLFFHDC
Sbjct  7    GQGEGQLAENFYSSSCPNVEAIVKQEVSTKFSQTFTTIPATLRLFFHDC  55



>ref|XP_009802952.1| PREDICTED: peroxidase 55-like [Nicotiana sylvestris]
Length=325

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            AEGQL ENFY  TCPNVE IVQQ V+TKFSQTFVT+PATLRLFFHDC
Sbjct  21   AEGQLVENFYGFTCPNVEFIVQQAVSTKFSQTFVTIPATLRLFFHDC  67



>ref|XP_002509503.1| Peroxidase 55 precursor, putative [Ricinus communis]
 gb|EEF50890.1| Peroxidase 55 precursor, putative [Ricinus communis]
Length=330

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  148  WRAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             R EGQL ENFY+S CPNVE IV+QVV+TKF QTF T+PATLRLFFHDC
Sbjct  24   GRGEGQLTENFYSSNCPNVEAIVKQVVSTKFRQTFTTIPATLRLFFHDC  72



>ref|XP_002274131.2| PREDICTED: peroxidase 55-like [Vitis vinifera]
 ref|XP_010660749.1| PREDICTED: peroxidase 55-like [Vitis vinifera]
Length=336

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  148  WRAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             + EGQLAENFY+S+CPNVE IV+Q V+TKFSQTF T+PATLRLFFHDC
Sbjct  30   GQGEGQLAENFYSSSCPNVEAIVKQEVSTKFSQTFTTIPATLRLFFHDC  78



>ref|XP_009606506.1| PREDICTED: peroxidase 55 [Nicotiana tomentosiformis]
Length=354

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            AEGQL ENFY  TCPNVE +VQQ V+TKFSQTFVT+PATLRLFFHDC
Sbjct  50   AEGQLVENFYGFTCPNVEFMVQQAVSTKFSQTFVTIPATLRLFFHDC  96



>gb|KHG27040.1| Peroxidase 51 -like protein [Gossypium arboreum]
Length=324

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R EGQL ENFY  TCPN+E+IV+QVV+ KFSQTFVT+PATLRLFFHDC
Sbjct  19   RGEGQLFENFYRGTCPNLEMIVKQVVSIKFSQTFVTIPATLRLFFHDC  66



>ref|XP_011009184.1| PREDICTED: peroxidase 55 [Populus euphratica]
Length=323

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  148  WRAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             R EGQL ENFY+S+CPNVE IV+Q V+TKF QTF T+PATLRLFFHDC
Sbjct  17   GRGEGQLVENFYSSSCPNVEGIVRQAVSTKFRQTFTTIPATLRLFFHDC  65



>ref|XP_006373205.1| hypothetical protein POPTR_0017s09640g [Populus trichocarpa]
 gb|ERP51002.1| hypothetical protein POPTR_0017s09640g [Populus trichocarpa]
 gb|AHL39192.1| class III peroxidase [Populus trichocarpa]
Length=323

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  148  WRAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             R EGQL ENFY+S+CPNVE IV+Q V+TKF QTF T+PATLRLFFHDC
Sbjct  17   GRGEGQLVENFYSSSCPNVEGIVRQAVSTKFRQTFTTIPATLRLFFHDC  65



>ref|XP_008231106.1| PREDICTED: peroxidase 55 [Prunus mume]
Length=326

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             +EGQLAENFY+STCPNVELIV+Q V+TK SQT +T+P+TLRLFFHDC
Sbjct  23   ESEGQLAENFYSSTCPNVELIVKQAVSTKLSQTPITIPSTLRLFFHDC  70



>ref|XP_006338701.1| PREDICTED: peroxidase 51-like [Solanum tuberosum]
Length=325

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            AEGQL ENFY  TCPNVE IVQQ V+ KFSQTFVT+PATLRLFFHDC
Sbjct  21   AEGQLVENFYGFTCPNVEFIVQQAVSIKFSQTFVTIPATLRLFFHDC  67



>ref|XP_007216155.1| hypothetical protein PRUPE_ppa015245mg [Prunus persica]
 gb|EMJ17354.1| hypothetical protein PRUPE_ppa015245mg [Prunus persica]
Length=310

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             +EGQLAENFY+STCPNVE IV+Q V+TK SQT +T+PATLRLFFHDC
Sbjct  7    ESEGQLAENFYSSTCPNVEFIVKQAVSTKLSQTPITIPATLRLFFHDC  54



>ref|XP_007031900.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY02826.1| Peroxidase superfamily protein [Theobroma cacao]
Length=324

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R E QL+ENFY++TCPN+E IV+Q V+TKFSQTFVT+PATLRLFFHDC
Sbjct  19   RGEAQLSENFYSNTCPNLESIVKQEVSTKFSQTFVTIPATLRLFFHDC  66



>gb|KDP46270.1| hypothetical protein JCGZ_10110 [Jatropha curcas]
Length=326

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R EGQL ENFY+S+CPNVE IV+QVV  KF++TF TVPATLRLFFHDC
Sbjct  21   RGEGQLIENFYSSSCPNVEAIVKQVVTKKFTETFPTVPATLRLFFHDC  68



>ref|XP_004303962.1| PREDICTED: peroxidase 55-like [Fragaria vesca subsp. vesca]
Length=329

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +E QL ENFY+S+CPNVE IV+Q V+TKFSQTF T+PATLRLFFHDC
Sbjct  25   SEAQLVENFYSSSCPNVESIVKQAVSTKFSQTFTTIPATLRLFFHDC  71



>ref|XP_010315910.1| PREDICTED: peroxidase 51 [Solanum lycopersicum]
Length=325

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            EG+L ENFY  TCPNVE IVQQ V+ KFSQTFVT+PATLRLFFHDC
Sbjct  22   EGELVENFYGFTCPNVEFIVQQAVSLKFSQTFVTIPATLRLFFHDC  67



>ref|XP_002298633.2| hypothetical protein POPTR_0001s33680g [Populus trichocarpa]
 gb|EEE83438.2| hypothetical protein POPTR_0001s33680g [Populus trichocarpa]
Length=315

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R EGQL E+FY+ TCPNVE +V++ V+TKF+QTF T+PATLRLFFHDC
Sbjct  10   RGEGQLVEDFYSLTCPNVEALVKKAVSTKFNQTFTTIPATLRLFFHDC  57



>ref|XP_009125965.1| PREDICTED: peroxidase 55-like [Brassica rapa]
Length=332

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            ++ QL+ENFYASTCPNVELIV+Q VATK+ QT +T PATLR+FFHDC
Sbjct  28   SDAQLSENFYASTCPNVELIVRQAVATKYQQTTITAPATLRMFFHDC  74



>gb|AHL39115.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R EGQL E+FY+ TCPNVE +V++ V+TKF+QTF T+PATLRLFFHDC
Sbjct  20   RGEGQLVEDFYSLTCPNVEALVKKAVSTKFNQTFTTIPATLRLFFHDC  67



>ref|XP_008441330.1| PREDICTED: peroxidase 55-like [Cucumis melo]
Length=335

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R EGQL ENFY STCP +E IV+Q V  KFSQT +T+PATLRLFFHDC
Sbjct  34   RGEGQLVENFYKSTCPKLEQIVRQAVRNKFSQTIITIPATLRLFFHDC  81



>ref|XP_003633781.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 55 [Vitis vinifera]
Length=421

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 2/52 (4%)
 Frame = -1

Query  151  EW--RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +W  + EGQLAENFY+S+CPNVE +V+Q V+ K SQTF T+PA+LRLFFHDC
Sbjct  112  QWVGKGEGQLAENFYSSSCPNVEAMVKQSVSVKVSQTFNTIPASLRLFFHDC  163



>ref|XP_004138796.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
 gb|KGN63165.1| hypothetical protein Csa_2G406630 [Cucumis sativus]
Length=331

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R E QL ENFY S CPN+E IV Q V TKF+QTFVT+PATLRLFFHDC
Sbjct  26   RGEAQLVENFYGSNCPNLEQIVTQSVQTKFAQTFVTIPATLRLFFHDC  73



>ref|XP_004166427.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
Length=331

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R E QL ENFY S CPN+E IV Q V TKF+QTFVT+PATLRLFFHDC
Sbjct  26   RGEAQLVENFYGSNCPNLEQIVTQSVQTKFAQTFVTIPATLRLFFHDC  73



>ref|XP_006399923.1| hypothetical protein EUTSA_v10014070mg [Eutrema salsugineum]
 gb|ESQ41376.1| hypothetical protein EUTSA_v10014070mg [Eutrema salsugineum]
Length=334

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            ++ +L ENFYASTCPNVELIV+QVV+TK  QTF T PATLR+FFHDC
Sbjct  30   SDARLTENFYASTCPNVELIVRQVVSTKIEQTFTTAPATLRMFFHDC  76



>ref|XP_011097275.1| PREDICTED: peroxidase 51 [Sesamum indicum]
Length=326

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL ENFY+S+CPNVE IV+QVV TK +QTFVT+PATLRL+FHDC
Sbjct  22   GEAQLMENFYSSSCPNVEAIVRQVVRTKINQTFVTIPATLRLYFHDC  68



>emb|CDX91081.1| BnaC02g05160D [Brassica napus]
Length=332

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            ++ QL+ENFYASTCPNVELIV+Q V TK+ QT +T PATLR+FFHDC
Sbjct  28   SDAQLSENFYASTCPNVELIVRQAVTTKYQQTTITAPATLRMFFHDC  74



>emb|CDX85612.1| BnaA02g02010D [Brassica napus]
Length=397

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            ++ +L+ENFYASTCPNVELIV+Q VATK+ QT +T PATLR+FFHDC
Sbjct  28   SDAELSENFYASTCPNVELIVRQAVATKYQQTTITAPATLRMFFHDC  74



>ref|XP_010112376.1| Peroxidase 55 [Morus notabilis]
 gb|EXC33371.1| Peroxidase 55 [Morus notabilis]
Length=332

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            + QL ENFYA TCPNVE IV+Q V+TKF QTF T+P+TLRLFFHDC
Sbjct  29   DAQLTENFYAETCPNVEFIVKQSVSTKFIQTFTTIPSTLRLFFHDC  74



>ref|XP_010250695.1| PREDICTED: peroxidase 51 [Nelumbo nucifera]
Length=326

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R EGQL ENFY STCP VE IV + V TK  QT VT+PATLRLFFHDC
Sbjct  19   RGEGQLVENFYGSTCPKVEDIVSETVRTKIKQTNVTIPATLRLFFHDC  66



>ref|XP_010492211.1| PREDICTED: peroxidase 55-like [Camelina sativa]
Length=332

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +E QL+EN+Y+STCPNVE IVQQ V TKF QT  T PATLR+FFHDC
Sbjct  28   SEAQLSENYYSSTCPNVERIVQQAVTTKFQQTPTTAPATLRMFFHDC  74



>ref|XP_006288149.1| hypothetical protein CARUB_v10001386mg [Capsella rubella]
 gb|EOA21047.1| hypothetical protein CARUB_v10001386mg [Capsella rubella]
Length=335

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            ++ QL+EN+Y+STCPNVE IVQQ VATKF QT  T PATLR+FFHDC
Sbjct  31   SDAQLSENYYSSTCPNVESIVQQAVATKFQQTPTTAPATLRIFFHDC  77



>ref|XP_002873650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL+EN+YASTCPNVELIV+Q V TKF QT  T PATLR+FFHDC
Sbjct  28   SNAQLSENYYASTCPNVELIVKQAVTTKFQQTPTTAPATLRMFFHDC  74



>gb|KFK25644.1| hypothetical protein AALP_AA8G141400 [Arabis alpina]
Length=330

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            ++ QL+ENFYASTCPNVE IVQQ + TK+ +T +T PATLRLFFHDC
Sbjct  26   SDAQLSENFYASTCPNVERIVQQAITTKYQETRITAPATLRLFFHDC  72



>ref|XP_010679610.1| PREDICTED: peroxidase 51-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL +NFYASTCPNVE IV++ V  K SQTF+T+PATLRLFFHDC
Sbjct  21   AAAQLQQNFYASTCPNVERIVKKAVKKKLSQTFITIPATLRLFFHDC  67



>emb|CDY58408.1| BnaC09g54550D [Brassica napus]
Length=322

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL+ENFYASTCPNVELIV+Q V TK+ QT +T P TLR+FFHDC
Sbjct  18   SNAQLSENFYASTCPNVELIVRQAVTTKYQQTPITAPGTLRMFFHDC  64



>ref|XP_009121694.1| PREDICTED: peroxidase 55 [Brassica rapa]
Length=322

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL+ENFYASTCPNVELIV+Q V TK+ QT +T P TLR+FFHDC
Sbjct  18   SNAQLSENFYASTCPNVELIVRQAVTTKYQQTPITAPGTLRMFFHDC  64



>emb|CBI33713.3| unnamed protein product [Vitis vinifera]
Length=239

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL +N+YA+ CPNVE IV+ VV TKF QTFVTVPATLRLFFHDC
Sbjct  25   ASAQLKQNYYANICPNVENIVRGVVNTKFKQTFVTVPATLRLFFHDC  71



>ref|XP_006841967.1| hypothetical protein AMTR_s00144p00031900 [Amborella trichopoda]
 gb|ERN03642.1| hypothetical protein AMTR_s00144p00031900 [Amborella trichopoda]
Length=326

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL++NFYA  CPNVE IV+ VVA K  QTFVT+PATLRLFFHDC
Sbjct  24   ANAQLSQNFYAKICPNVESIVRNVVANKIKQTFVTIPATLRLFFHDC  70



>ref|XP_004138795.1| PREDICTED: peroxidase 55-like [Cucumis sativus]
 ref|XP_004166426.1| PREDICTED: peroxidase 55-like [Cucumis sativus]
Length=304

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             EGQL +NFY STCPNVE IV Q V  KFSQT +T+ ATLRLFFHDC
Sbjct  4    GEGQLVKNFYKSTCPNVEQIVTQAVRNKFSQTIITISATLRLFFHDC  50



>ref|NP_196917.1| peroxidase 55 [Arabidopsis thaliana]
 sp|Q96509.1|PER55_ARATH RecName: Full=Peroxidase 55; Short=Atperox P55; AltName: Full=ATP20a; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA67338.1| peroxidase [Arabidopsis thaliana]
 dbj|BAB08292.1| peroxidase ATP20a [Arabidopsis thaliana]
 gb|AAL14402.1| AT5g14130/MUA22_13 [Arabidopsis thaliana]
 gb|AAM70543.1| AT5g14130/MUA22_13 [Arabidopsis thaliana]
 gb|AED91991.1| peroxidase 55 [Arabidopsis thaliana]
Length=330

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL+EN+YASTCP+VELIV+Q V TKF QT  T PATLR+FFHDC
Sbjct  28   SNAQLSENYYASTCPSVELIVKQAVTTKFKQTVTTAPATLRMFFHDC  74



>ref|XP_008441329.1| PREDICTED: peroxidase 51-like [Cucumis melo]
Length=331

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R + QL ENFY S CPN+E IV Q V TK +QTFVT+PATLRLFFHDC
Sbjct  26   RGKAQLVENFYGSKCPNLEQIVTQSVQTKIAQTFVTIPATLRLFFHDC  73



>gb|ABK21900.1| unknown [Picea sitchensis]
Length=333

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +   QL ENFYA  CPNVE IV+  V+ KFSQTFVTVP TLRLFFHDC
Sbjct  28   KGSAQLKENFYAKICPNVESIVRNAVSQKFSQTFVTVPGTLRLFFHDC  75



>ref|XP_007031901.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY02827.1| Peroxidase superfamily protein [Theobroma cacao]
Length=587

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R EGQL+E FY +TCP +E IV++VV  K +QTFVTVPATLRLFFHDC
Sbjct  18   RGEGQLSETFYQTTCPKLESIVRKVVTQKINQTFVTVPATLRLFFHDC  65


 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             EG+L+++FY +TCP +E IV++VV  K +QTFVTVPATLRLFFHDC
Sbjct  317  GEGRLSQSFYNTTCPILESIVRKVVEEKVNQTFVTVPATLRLFFHDC  363



>ref|XP_002284278.1| PREDICTED: peroxidase 73 [Vitis vinifera]
Length=331

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL +N+YA+ CPNVE IV+ VV TKF QTFVTVPATLRLFFHDC
Sbjct  25   ASAQLKQNYYANICPNVENIVRGVVNTKFKQTFVTVPATLRLFFHDC  71



>ref|XP_004304524.1| PREDICTED: peroxidase 55-like [Fragaria vesca subsp. vesca]
Length=332

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R+E +L ENFY S+CPNV+ IV+Q V+TK SQT +T+P TLRLFFHDC
Sbjct  24   RSEARLVENFYRSSCPNVQAIVKQAVSTKLSQTPITIPGTLRLFFHDC  71



>gb|KGN63166.1| hypothetical protein Csa_2G406640 [Cucumis sativus]
Length=330

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             EGQL +NFY STCPNVE IV Q V  KFSQT +T+ ATLRLFFHDC
Sbjct  30   GEGQLVKNFYKSTCPNVEQIVTQAVRNKFSQTIITISATLRLFFHDC  76



>ref|XP_010033422.1| PREDICTED: peroxidase 51-like [Eucalyptus grandis]
 gb|KCW53058.1| hypothetical protein EUGRSUZ_J02352 [Eucalyptus grandis]
Length=326

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
               QL E FY  TCPNVE IV+Q V TKF QTF+T+P TLRLFFHDC
Sbjct  22   GRAQLTEGFYGQTCPNVESIVKQAVTTKFGQTFITIPGTLRLFFHDC  68



>ref|XP_008441332.1| PREDICTED: peroxidase 51-like [Cucumis melo]
Length=325

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A+ QL+ NFY S+CPNVE IV+Q V+ K SQTFVT+PATLRLFFHDC
Sbjct  22   AQAQLSFNFYNSSCPNVEQIVRQAVSLKISQTFVTIPATLRLFFHDC  68



>emb|CDP02994.1| unnamed protein product [Coffea canephora]
Length=326

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  NFY STCPNVE +V+  V TKFSQTFVT PATLRL+FHDC
Sbjct  21   ASAQLTANFYRSTCPNVETLVRNAVQTKFSQTFVTAPATLRLYFHDC  67



>ref|XP_010905285.1| PREDICTED: peroxidase 35-like [Elaeis guineensis]
Length=328

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             + QL +N+YA+TCPNVE IV++VV  KF QTFVTVPA LRLFFHDC
Sbjct  22   GDAQLQQNYYANTCPNVENIVREVVTKKFKQTFVTVPAVLRLFFHDC  68



>gb|KGN61954.1| hypothetical protein Csa_2G271470 [Cucumis sativus]
Length=361

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            E QL  +FYA  CPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  55   EAQLRRDFYADVCPNVESIVRSAVTKKFKQTFVTVPATLRLFFHDC  100



>ref|XP_007047481.1| Class III peroxidase [Theobroma cacao]
 gb|EOX91638.1| Class III peroxidase [Theobroma cacao]
Length=330

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  N+YA+ CPNVE IV+  VA KFSQTFVTVPAT+RLFFHDC
Sbjct  24   ASAQLKRNYYANICPNVENIVRGAVAKKFSQTFVTVPATIRLFFHDC  70



>gb|KHN28333.1| Peroxidase 73 [Glycine soja]
Length=325

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ N YA TCPN+E IV+Q VA KF QTFVTVPATLRLFFHDC
Sbjct  25   SAQLSPNHYAKTCPNLESIVRQAVAKKFQQTFVTVPATLRLFFHDC  70



>gb|EYU29643.1| hypothetical protein MIMGU_mgv1a014486mg [Erythranthe guttata]
Length=188

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL +NFY++TCP+VE IV++ V+ K SQTFVT+PAT+RLFFHDC
Sbjct  26   ASAQLRQNFYSNTCPDVESIVRRAVSAKVSQTFVTIPATIRLFFHDC  72



>ref|XP_010911693.1| PREDICTED: peroxidase 51-like, partial [Elaeis guineensis]
Length=118

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
               QL +N+YA+ CPNVE IV+ VV TKF +TFVTVPAT+RL FHDC
Sbjct  2    GSAQLRQNYYANICPNVESIVRNVVKTKFDETFVTVPATIRLLFHDC  48



>ref|XP_004513315.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 55-like [Cicer arietinum]
Length=318

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             EGQL ENFY STCPNVELIV Q V  KF+QT  T  ATLRLF HDC
Sbjct  21   GEGQLVENFYISTCPNVELIVSQAVTNKFTQTITTGQATLRLFLHDC  67



>gb|KDP35389.1| hypothetical protein JCGZ_10373 [Jatropha curcas]
Length=324

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL++NFY+ TCPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  20   NAQLSQNFYSKTCPNVESIVRSAVQQKFKQTFVTVPATLRLFFHDC  65



>gb|KHN40966.1| Peroxidase 55 [Glycine soja]
Length=233

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            + EGQL ENFY+S+CPNVE +V+Q V  KF++T  T  ATLRLFFHDC
Sbjct  22   KGEGQLVENFYSSSCPNVESMVKQAVTNKFTETITTGQATLRLFFHDC  69



>ref|XP_010094192.1| Peroxidase 45 [Morus notabilis]
 gb|EXB55368.1| Peroxidase 45 [Morus notabilis]
Length=332

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            + QL+ +FY +TCPNVE IV QVVA KF QTFVT PATLRL FHDC
Sbjct  26   QAQLSTDFYKNTCPNVESIVSQVVANKFQQTFVTAPATLRLLFHDC  71



>ref|NP_001130210.1| uncharacterized protein LOC100191304 precursor [Zea mays]
 gb|ACF78360.1| unknown [Zea mays]
 gb|ACR38436.1| unknown [Zea mays]
 tpg|DAA40491.1| TPA: hypothetical protein ZEAMMB73_961868 [Zea mays]
Length=335

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            AE +L+ ++Y STCP+VE IVQ VVA K ++TFVTVPATLRLFFHDC
Sbjct  28   AEAKLSPDYYRSTCPDVEAIVQAVVAKKVNETFVTVPATLRLFFHDC  74



>gb|ACG42971.1| peroxidase 73 precursor [Zea mays]
Length=335

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            AE +L+ ++Y STCP+VE IVQ VVA K ++TFVTVPATLRLFFHDC
Sbjct  28   AEAKLSPDYYRSTCPDVEAIVQAVVAKKVNETFVTVPATLRLFFHDC  74



>ref|XP_009344467.1| PREDICTED: peroxidase 50-like [Pyrus x bretschneideri]
 ref|XP_009344468.1| PREDICTED: peroxidase 50-like [Pyrus x bretschneideri]
Length=363

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -1

Query  136  GQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             QL  N+YA+ CP+VE IV+ VV  KF QTFVTVPATLRLFFHDC
Sbjct  25   AQLKTNYYANICPDVEKIVKNVVTNKFQQTFVTVPATLRLFFHDC  69



>ref|XP_006453319.1| hypothetical protein CICLE_v10010461mg [Citrus clementina]
 ref|XP_006474215.1| PREDICTED: peroxidase 16-like [Citrus sinensis]
 gb|ESR66559.1| hypothetical protein CICLE_v10010461mg [Citrus clementina]
Length=327

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL E+FY STCPNVE +V+  V  KF+QTFVT PATLRLFFHDC
Sbjct  22   ASAQLREDFYRSTCPNVESLVRSAVTKKFTQTFVTAPATLRLFFHDC  68



>gb|KDO61842.1| hypothetical protein CISIN_1g046044mg [Citrus sinensis]
Length=327

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL E+FY STCPNVE +V+  V  KF+QTFVT PATLRLFFHDC
Sbjct  22   ASAQLREDFYRSTCPNVESLVRSAVTKKFTQTFVTAPATLRLFFHDC  68



>ref|XP_009604475.1| PREDICTED: peroxidase 51-like [Nicotiana tomentosiformis]
Length=332

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  N+YA+TCPNVE IV+ VV  KF QTFVT+PA LRLFFHDC
Sbjct  26   ASAQLKTNYYANTCPNVESIVRNVVNQKFRQTFVTIPAVLRLFFHDC  72



>gb|EYU37318.1| hypothetical protein MIMGU_mgv1a009838mg [Erythranthe guttata]
Length=330

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  NFY++TCPNVE +V+  V TKF QTFVT PATLRLFFHDC
Sbjct  25   ANAQLRTNFYSATCPNVEALVRAAVQTKFRQTFVTAPATLRLFFHDC  71



>ref|XP_010277087.1| PREDICTED: peroxidase 51-like [Nelumbo nucifera]
Length=330

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
               QL  ++YA+TCPNVE IV+ VV  KF QTFVTVPATLRLFFHDC
Sbjct  24   GSAQLRRDYYANTCPNVETIVRNVVTQKFQQTFVTVPATLRLFFHDC  70



>ref|XP_009421098.1| PREDICTED: peroxidase 51 [Musa acuminata subsp. malaccensis]
Length=330

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL +N+YA+ CPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  24   ANAQLRQNYYANICPNVESIVRDAVTAKFRQTFVTVPATLRLFFHDC  70



>ref|XP_003550018.1| PREDICTED: peroxidase 50-like [Glycine max]
Length=325

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ N YA TCPN+E IV+Q V  KF QTFVTVPATLRLFFHDC
Sbjct  25   SAQLSPNHYAKTCPNLESIVRQAVTKKFQQTFVTVPATLRLFFHDC  70



>gb|ACU19256.1| unknown [Glycine max]
Length=325

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ N YA TCPN+E IV+Q V  KF QTFVTVPATLRLFFHDC
Sbjct  25   SAQLSPNHYAKTCPNLESIVRQAVTKKFQQTFVTVPATLRLFFHDC  70



>ref|XP_010531296.1| PREDICTED: peroxidase 50 [Tarenaya hassleriana]
Length=331

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  NFYA++CPNVE IV+ VV  K  QTFVT+PATLRLFFHDC
Sbjct  25   ASAQLRRNFYANSCPNVEQIVRNVVQQKIQQTFVTIPATLRLFFHDC  71



>ref|XP_010680021.1| PREDICTED: peroxidase 16-like [Beta vulgaris subsp. vulgaris]
Length=337

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL+ENFY ++CP VE IV+Q VA K+SQTF+T  ATLRLFFHDC
Sbjct  33   GEAQLSENFYTTSCPRVETIVRQAVAKKYSQTFITAQATLRLFFHDC  79



>gb|ACJ11763.1| class III peroxidase [Gossypium hirsutum]
Length=329

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL +NFYA++C NVE IV+  VA KFSQTFVTVPATLRLFFHDC
Sbjct  24   SAQLRQNFYANSCSNVEAIVRGEVAKKFSQTFVTVPATLRLFFHDC  69



>ref|XP_004234654.1| PREDICTED: peroxidase 51 [Solanum lycopersicum]
Length=331

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            + QL  NFYA TCPNVE IV+ VV  KF QTFVT+PA LRLFFHDC
Sbjct  26   DAQLKTNFYAQTCPNVESIVRNVVNQKFKQTFVTIPAVLRLFFHDC  71



>gb|EYU34812.1| hypothetical protein MIMGU_mgv1a025312mg, partial [Erythranthe 
guttata]
Length=266

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             +GQL  NFY   CPNVE IV+Q V TK +QTFVT+PAT+RLFFHDC
Sbjct  21   GQGQLLLNFYGPRCPNVEGIVRQAVLTKINQTFVTIPATVRLFFHDC  67



>ref|XP_008441333.1| PREDICTED: peroxidase 51-like [Cucumis melo]
Length=325

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A+ QL+ NFY S+CPNVE IV+Q V+ K +QTFVT+P TLRLFFHDC
Sbjct  22   AQAQLSFNFYNSSCPNVEQIVRQAVSLKINQTFVTIPGTLRLFFHDC  68



>ref|XP_003553930.1| PREDICTED: peroxidase 55 [Glycine max]
Length=327

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            + EGQL ENFY+S+CPNVE +V+Q V  KF++T  T  ATLRLFFHDC
Sbjct  22   KGEGQLVENFYSSSCPNVESMVKQAVTNKFTETITTGQATLRLFFHDC  69



>gb|KHG21770.1| Peroxidase 51 -like protein [Gossypium arboreum]
Length=330

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL +N+YA TCPN E IV+  V  KF QTFVTVPAT+RLFFHDC
Sbjct  24   ASAQLRQNYYAKTCPNAESIVRNAVTKKFRQTFVTVPATIRLFFHDC  70



>ref|XP_003548517.2| PREDICTED: peroxidase 55-like [Glycine max]
Length=326

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            + EGQL ENFY+ +CPNVE IV+Q V  KF+QT  T  ATLRLFFHDC
Sbjct  21   KGEGQLVENFYSLSCPNVESIVKQAVTNKFTQTITTGQATLRLFFHDC  68



>gb|KHN09929.1| Peroxidase 55 [Glycine soja]
Length=322

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            + EGQL ENFY+ +CPNVE IV+Q V  KF+QT  T  ATLRLFFHDC
Sbjct  17   KGEGQLVENFYSLSCPNVESIVKQAVTNKFTQTITTGQATLRLFFHDC  64



>ref|XP_004147080.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
 ref|XP_004158397.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
Length=329

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            E QL  +FYA  CPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  23   EAQLRRDFYADVCPNVESIVRSAVTKKFKQTFVTVPATLRLFFHDC  68



>ref|XP_002866704.1| peroxidase 73 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42963.1| peroxidase 73 [Arabidopsis lyrata subsp. lyrata]
Length=329

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY  +CPNVE IV+QVV  K  QTFVT+PATLRLFFHDC
Sbjct  26   QLKTNFYGKSCPNVEKIVKQVVNQKIKQTFVTIPATLRLFFHDC  69



>ref|XP_008238250.1| PREDICTED: peroxidase 73-like [Prunus mume]
Length=329

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA+ CPNVE IV+ VV  KF QTFVTVPAT+RLFFHDC
Sbjct  26   QLKTNFYANVCPNVENIVKNVVTQKFQQTFVTVPATIRLFFHDC  69



>ref|XP_007205527.1| hypothetical protein PRUPE_ppa008489mg [Prunus persica]
 gb|EMJ06726.1| hypothetical protein PRUPE_ppa008489mg [Prunus persica]
Length=329

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA+ CPNVE IV+ VV  KF QTFVTVPAT+RLFFHDC
Sbjct  26   QLKTNFYANVCPNVENIVKNVVTQKFQQTFVTVPATIRLFFHDC  69



>gb|AAO45182.1| peroxidase 1 [Artemisia annua]
Length=328

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +N+YA+ CPNVE IVQ+ VA K  QTFVT+P TLRLFFHDC
Sbjct  25   QLKQNYYANICPNVESIVQKAVAAKVKQTFVTIPGTLRLFFHDC  68



>ref|XP_002462635.1| hypothetical protein SORBIDRAFT_02g029340 [Sorghum bicolor]
 gb|EER99156.1| hypothetical protein SORBIDRAFT_02g029340 [Sorghum bicolor]
Length=337

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            AE +L+ ++Y STCP+VE IV+ VVA K ++TFVTVPATLRLFFHDC
Sbjct  29   AEAKLSPDYYRSTCPDVEAIVRAVVAKKVNETFVTVPATLRLFFHDC  75



>ref|XP_006279521.1| hypothetical protein CARUB_v10027970mg [Capsella rubella]
 gb|EOA12419.1| hypothetical protein CARUB_v10027970mg [Capsella rubella]
Length=329

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY  +CPNVE IV++VV TK  QTFVT+PATLRLFFHDC
Sbjct  26   QLNTNFYGKSCPNVEQIVRKVVQTKVKQTFVTIPATLRLFFHDC  69



>gb|AFK33671.1| unknown [Lotus japonicus]
Length=322

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ N YASTCPN++ IV+ VV  KF QTFVTVPATLRLFFHDC
Sbjct  24   QLSPNHYASTCPNLQSIVKGVVQKKFQQTFVTVPATLRLFFHDC  67



>ref|NP_001275041.1| peroxidase 51-like precursor [Solanum tuberosum]
 emb|CAC42086.1| putative peroxidase [Solanum tuberosum]
Length=331

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA TCPNVE IV+ VV  KF QTFVT+PA LRLFFHDC
Sbjct  28   QLKTNFYAQTCPNVESIVRNVVNQKFKQTFVTIPAVLRLFFHDC  71



>ref|XP_004231908.1| PREDICTED: peroxidase 51 [Solanum lycopersicum]
Length=332

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  N+YA+ CPNVE IV+ VV  KF QTFVTVPA LRLFFHDC
Sbjct  26   ASAQLKTNYYANICPNVESIVRNVVNQKFKQTFVTVPAVLRLFFHDC  72



>gb|AFK48158.1| unknown [Lotus japonicus]
Length=322

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ N YASTCPN++ IV+ VV  KF QTFVTVPATLRLFFHDC
Sbjct  24   QLSPNHYASTCPNLQSIVKGVVQKKFQQTFVTVPATLRLFFHDC  67



>ref|XP_006404085.1| hypothetical protein EUTSA_v10010538mg [Eutrema salsugineum]
 gb|ESQ45538.1| hypothetical protein EUTSA_v10010538mg [Eutrema salsugineum]
Length=329

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ NFY+ TCPN+E IV+ VV  K  QTFVT+PATLRLFFHDC
Sbjct  26   QLSRNFYSKTCPNIEQIVRNVVQKKVKQTFVTIPATLRLFFHDC  69



>gb|EYU44477.1| hypothetical protein MIMGU_mgv1a026768mg [Erythranthe guttata]
Length=322

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -1

Query  151  EWRAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            E     QL +N+YA+TCPNVE IV+  V  KF QTFVTVPA +RLFFHDC
Sbjct  13   EGAVTAQLRQNYYANTCPNVESIVKTAVTKKFKQTFVTVPAVIRLFFHDC  62



>ref|XP_004138794.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
Length=323

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ NFY S+CPNVE IV+Q V+ K +QTFVT+PATLRLFFHDC
Sbjct  23   QLSFNFYNSSCPNVEQIVRQAVSLKINQTFVTIPATLRLFFHDC  66



>ref|XP_006339817.1| PREDICTED: peroxidase 51-like [Solanum tuberosum]
Length=332

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  N+YA+ CPNVE IV+ VV  KF QTFVTVPA LRLFFHDC
Sbjct  26   ASAQLKTNYYANICPNVESIVRNVVNQKFKQTFVTVPAVLRLFFHDC  72



>gb|KGN63167.1| hypothetical protein Csa_2G406650 [Cucumis sativus]
Length=326

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ NFY S+CPNVE IV+Q V+ K +QTFVT+PATLRLFFHDC
Sbjct  26   QLSFNFYNSSCPNVEQIVRQAVSLKINQTFVTIPATLRLFFHDC  69



>ref|XP_004166423.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
Length=330

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ NFY S+CPNVE IV+Q V+ K +QTFVT+PATLRLFFHDC
Sbjct  30   QLSFNFYNSSCPNVEQIVRQAVSLKINQTFVTIPATLRLFFHDC  73



>ref|XP_010272213.1| PREDICTED: peroxidase 73-like [Nelumbo nucifera]
Length=332

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
               QL  N+YA+ CPNVE IV+ VV  KF QTFVTVPATLRLFFHDC
Sbjct  26   GSAQLRRNYYANICPNVENIVRNVVRQKFQQTFVTVPATLRLFFHDC  72



>ref|XP_004509077.1| PREDICTED: peroxidase 73-like [Cicer arietinum]
Length=328

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ N YA TCPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  26   QLSTNHYAKTCPNVESIVRTAVQNKFKQTFVTVPATLRLFFHDC  69



>ref|XP_008787159.1| PREDICTED: peroxidase 50 [Phoenix dactylifera]
Length=328

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +N+YA +CPNVE IV++VV  KF QTFVTVPA LRLFFHDC
Sbjct  25   QLRKNYYAKSCPNVENIVRKVVEKKFKQTFVTVPAVLRLFFHDC  68



>ref|XP_008781029.1| PREDICTED: peroxidase 51-like [Phoenix dactylifera]
Length=328

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
               QL +N+YA+ CPNVE IV+ VV TKF +TFVTVPAT+RL FHDC
Sbjct  22   GSAQLRQNYYANVCPNVESIVRNVVKTKFDETFVTVPATIRLLFHDC  68



>ref|XP_010086957.1| Peroxidase 51 [Morus notabilis]
 gb|EXB25093.1| Peroxidase 51 [Morus notabilis]
Length=326

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA+TCPNVE +V+  V  KF QTFVTVPAT+RLFFHDC
Sbjct  27   QLKNNYYANTCPNVETLVRNAVQKKFQQTFVTVPATIRLFFHDC  70



>ref|XP_009396783.1| PREDICTED: peroxidase 55-like [Musa acuminata subsp. malaccensis]
Length=333

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL+ +FY   CPNVE IV+Q V  K SQTFVTVPATLRLFFHDC
Sbjct  34   GEAQLSPSFYQLACPNVESIVRQAVVKKLSQTFVTVPATLRLFFHDC  80



>ref|XP_007155845.1| hypothetical protein PHAVU_003G236500g [Phaseolus vulgaris]
 gb|ESW27839.1| hypothetical protein PHAVU_003G236500g [Phaseolus vulgaris]
Length=329

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ N YA+ CPN+E IV+Q V  KF QTFVTVPATLRLFFHDC
Sbjct  25   SAQLSPNHYANVCPNLESIVRQAVTNKFQQTFVTVPATLRLFFHDC  70



>ref|XP_009763998.1| PREDICTED: peroxidase 51-like [Nicotiana sylvestris]
Length=332

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA TCPNVE IV+ VV  KF QTFVT+PA LRLFFHDC
Sbjct  29   QLKTNYYAKTCPNVESIVRNVVNQKFQQTFVTIPAVLRLFFHDC  72



>ref|XP_007161721.1| hypothetical protein PHAVU_001G092900g [Phaseolus vulgaris]
 gb|ESW33715.1| hypothetical protein PHAVU_001G092900g [Phaseolus vulgaris]
Length=328

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            + E QL++NFY+S+CPNVE IV Q V  KF+QT  T  ATLRLFFHDC
Sbjct  23   KGEAQLSQNFYSSSCPNVESIVSQAVTNKFTQTLTTGQATLRLFFHDC  70



>ref|XP_011099352.1| PREDICTED: peroxidase 73 [Sesamum indicum]
 gb|ABB89209.1| peroxidase [Sesamum indicum]
 gb|AET09944.1| peroxidase [Sesamum indicum]
 gb|AET09945.1| peroxidase [Sesamum indicum]
Length=330

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +N+YA+ CP+VE IV+Q V  KF QTFVTVPATLRL+FHDC
Sbjct  27   QLKQNYYANICPDVENIVRQAVTAKFKQTFVTVPATLRLYFHDC  70



>ref|XP_008792666.1| PREDICTED: peroxidase 51-like [Phoenix dactylifera]
Length=328

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL  N+YA+ CPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  22   SSAQLRRNYYANICPNVESIVRNAVTKKFQQTFVTVPATLRLFFHDC  68



>gb|KHN06005.1| Peroxidase 73 [Glycine soja]
Length=325

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ N YA+ CPN+E IV+Q V  KF QTFVTVPATLRLFFHDC
Sbjct  25   SAQLSPNHYANICPNLESIVRQAVTNKFQQTFVTVPATLRLFFHDC  70



>ref|XP_008457736.1| PREDICTED: peroxidase 51-like [Cucumis melo]
Length=336

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            E QL  +FYA  CPNVE IV+  V  KF QTFVTVPAT+RLFFHDC
Sbjct  30   EAQLRRDFYADVCPNVESIVRSAVTKKFKQTFVTVPATVRLFFHDC  75



>ref|XP_004141876.1| PREDICTED: peroxidase 73-like [Cucumis sativus]
 ref|XP_004166165.1| PREDICTED: peroxidase 73-like [Cucumis sativus]
 gb|KGN48595.1| Class III peroxidase [Cucumis sativus]
Length=329

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +NFYA+ CPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  26   QLRQNFYANICPNVENIVRSEVTKKFQQTFVTVPATLRLFFHDC  69



>ref|XP_010547542.1| PREDICTED: peroxidase 35-like [Tarenaya hassleriana]
Length=329

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL+ NFY+ TCPN++ IV+ VV  K  QTFVT+PATLRLFFHDC
Sbjct  23   ATAQLSPNFYSKTCPNIQEIVRNVVKRKVKQTFVTIPATLRLFFHDC  69



>ref|XP_008440361.1| PREDICTED: peroxidase 73-like [Cucumis melo]
Length=329

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +NFYA+ CPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  26   QLRQNFYANICPNVENIVRSEVTKKFQQTFVTVPATLRLFFHDC  69



>ref|NP_201541.1| peroxidase 73 [Arabidopsis thaliana]
 sp|Q43873.1|PER73_ARATH RecName: Full=Peroxidase 73; Short=Atperox P73; AltName: Full=ATP10a; 
AltName: Full=PRXR11; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA66967.1| peroxidase [Arabidopsis thaliana]
 emb|CAA67428.1| peroxidase ATP10a [Arabidopsis thaliana]
 dbj|BAB09025.1| peroxidase [Arabidopsis thaliana]
 gb|ABO09891.1| At5g67400 [Arabidopsis thaliana]
 gb|AED98339.1| peroxidase 73 [Arabidopsis thaliana]
 dbj|BAP16473.1| peroxidase [Cloning vector pTACAtg1]
Length=329

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY ++CPNVE IV++VV  K  QTFVT+PATLRLFFHDC
Sbjct  26   QLKTNFYGNSCPNVEQIVKKVVQEKIKQTFVTIPATLRLFFHDC  69



>ref|XP_002525252.1| Peroxidase 73 precursor, putative [Ricinus communis]
 gb|EEF37080.1| Peroxidase 73 precursor, putative [Ricinus communis]
Length=334

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +N+YA+ CPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  31   QLRQNYYANICPNVESIVRSTVQKKFQQTFVTVPATLRLFFHDC  74



>ref|XP_004288471.1| PREDICTED: peroxidase 73-like [Fragaria vesca subsp. vesca]
Length=324

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL  NFYA+ CPNVE IV+  V  KF QTFVTVPAT+RLFFHDC
Sbjct  24   SAQLKTNFYANICPNVESIVKSAVTKKFQQTFVTVPATIRLFFHDC  69



>ref|XP_007156729.1| hypothetical protein PHAVU_002G012300g [Phaseolus vulgaris]
 gb|ESW28723.1| hypothetical protein PHAVU_002G012300g [Phaseolus vulgaris]
Length=328

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL+ + YA TCPNVE IV++ V  KF QTFVTVPATLRLFFHDC
Sbjct  23   SSAQLSRHHYAKTCPNVENIVREAVKKKFHQTFVTVPATLRLFFHDC  69



>gb|KDO78967.1| hypothetical protein CISIN_1g0211121mg, partial [Citrus sinensis]
Length=182

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +++YA TCPNVE IV+  V  KF QTFVTVPAT+RLFFHDC
Sbjct  30   QLKQDYYAKTCPNVEKIVRTQVEKKFRQTFVTVPATIRLFFHDC  73



>ref|XP_004957292.1| PREDICTED: peroxidase 73-like [Setaria italica]
Length=337

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E +L+ ++Y STCP+VE IV++ VA K ++TFVTVPATLRLFFHDC
Sbjct  26   GEAKLSPDYYRSTCPDVEAIVREAVAKKVNETFVTVPATLRLFFHDC  72



>ref|XP_010028113.1| PREDICTED: peroxidase 73-like [Eucalyptus grandis]
 gb|KCW54772.1| hypothetical protein EUGRSUZ_I00717 [Eucalyptus grandis]
Length=329

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL +NFYA+ CPNVE IV+  V  KF QTFVTVP TLRLFFHDC
Sbjct  24   SAQLRQNFYANVCPNVEGIVRNAVRQKFQQTFVTVPGTLRLFFHDC  69



>gb|AAX84669.1| secretory peroxidase PX3 [Manihot esculenta]
Length=355

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -1

Query  136  GQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             QL++NFY+ TCPNVE IV+  V  KF QTFVTVPATLRLF HDC
Sbjct  25   AQLSKNFYSGTCPNVESIVRSEVQKKFQQTFVTVPATLRLFAHDC  69



>ref|XP_010444652.1| PREDICTED: peroxidase 73 [Camelina sativa]
Length=329

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  NFY ++CPNVE IV+ VV  K  QTFVT+PATLRLFFHDC
Sbjct  23   ATAQLKTNFYGNSCPNVEQIVRTVVQQKVKQTFVTIPATLRLFFHDC  69



>ref|XP_010484504.1| PREDICTED: peroxidase 73-like [Camelina sativa]
Length=329

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  NFY ++CPNVE IV+ VV  K  QTFVT+PATLRLFFHDC
Sbjct  23   ATAQLKTNFYGNSCPNVEQIVRTVVQQKVKQTFVTIPATLRLFFHDC  69



>gb|EYU37317.1| hypothetical protein MIMGU_mgv1a009833mg [Erythranthe guttata]
Length=330

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  NFY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  25   ANAQLRTNFYNATCPNVEALVRAAVQAKFRQTFVTAPATLRLFFHDC  71



>ref|XP_011013593.1| PREDICTED: peroxidase 73-like [Populus euphratica]
Length=331

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +N+YAS+CP VE IV+ VV  K  QTFVT+PATLRLFFHDC
Sbjct  28   QLRQNYYASSCPKVESIVRGVVQNKIKQTFVTIPATLRLFFHDC  71



>ref|XP_006845692.1| hypothetical protein AMTR_s00019p00237230 [Amborella trichopoda]
 gb|ERN07367.1| hypothetical protein AMTR_s00019p00237230 [Amborella trichopoda]
Length=315

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY++TCPNVE IV+  V  K  QTFVT PATLRLFFHDC
Sbjct  19   QLRRNFYSATCPNVEFIVRNAVTRKLRQTFVTAPATLRLFFHDC  62



>ref|XP_003549343.1| PREDICTED: peroxidase 16 [Glycine max]
 gb|KHN17613.1| Peroxidase 16 [Glycine soja]
Length=324

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL+  FY +TCPNVE +V+  VA KF QTFVT PATLRLFFHDC
Sbjct  21   SSAQLSSGFYKNTCPNVEQLVRSAVAQKFQQTFVTAPATLRLFFHDC  67



>gb|ACU23164.1| unknown [Glycine max]
Length=324

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL+  FY +TCPNVE +V+  VA KF QTFVT PATLRLFFHDC
Sbjct  21   SSAQLSSGFYKNTCPNVEQLVRSAVAQKFQQTFVTAPATLRLFFHDC  67



>ref|XP_010679607.1| PREDICTED: peroxidase 50-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679608.1| PREDICTED: peroxidase 50-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679609.1| PREDICTED: peroxidase 50-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=326

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  130  LAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            L++N+YA TCPNVE IV+Q V  K  QTFVT+P TLRLFFHDC
Sbjct  24   LSQNYYAKTCPNVEKIVRQAVQKKIQQTFVTIPGTLRLFFHDC  66



>gb|AFY97684.1| peroxidase 1 [Pyrus pyrifolia]
Length=325

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA+ CPNVE IV+  V  KF QTFVTVP TLRLFFHDC
Sbjct  26   QLKTNYYANICPNVESIVKDAVTKKFQQTFVTVPGTLRLFFHDC  69



>gb|AAB41812.1| peroxidase, partial [Medicago sativa]
Length=325

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R   QL+ + Y ++CPNVE IV+Q V  KF QTF TVPATLRLFFHDC
Sbjct  19   RTHAQLSRHHYKNSCPNVENIVRQAVKKKFHQTFTTVPATLRLFFHDC  66



>emb|CAN64129.1| hypothetical protein VITISV_039161 [Vitis vinifera]
Length=379

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL ++FY  TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  21   ASAQLRQDFYKDTCPNVESLVRSAVQKKFLQTFVTAPATLRLFFHDC  67



>ref|XP_002324463.1| Peroxidase 16 precursor family protein [Populus trichocarpa]
 gb|EEF03028.1| Peroxidase 16 precursor family protein [Populus trichocarpa]
 gb|AHL39194.1| class III peroxidase [Populus trichocarpa]
Length=328

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +NFY + CPNVE +V+  V TKFSQTFVT PATLRL FHDC
Sbjct  26   QLRQNFYQNICPNVESLVRSAVQTKFSQTFVTAPATLRLLFHDC  69



>ref|XP_004242911.1| PREDICTED: peroxidase 16 [Solanum lycopersicum]
Length=329

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  136  GQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            GQL  +FY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  26   GQLKTDFYKNTCPNVESLVRSAVRLKFQQTFVTAPATLRLFFHDC  70



>ref|XP_006344534.1| PREDICTED: peroxidase 45-like [Solanum tuberosum]
Length=329

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  136  GQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            GQL  +FY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  26   GQLKTDFYKNTCPNVESLVRSAVRLKFQQTFVTAPATLRLFFHDC  70



>ref|XP_006380636.1| Peroxidase 50 precursor family protein [Populus trichocarpa]
 gb|ERP58433.1| Peroxidase 50 precursor family protein [Populus trichocarpa]
 gb|AHL39155.1| class III peroxidase [Populus trichocarpa]
Length=331

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +N+YAS+CP VE IV+ VV  K  QTFVT+PATLRLFFHDC
Sbjct  28   QLRQNYYASSCPRVESIVRGVVQNKIKQTFVTIPATLRLFFHDC  71



>ref|XP_008340941.1| PREDICTED: peroxidase 51-like [Malus domestica]
Length=325

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA+ CPNVE IV+  V  KF QTFVTVP TLRLFFHDC
Sbjct  26   QLKTNYYANICPNVESIVRDAVTKKFQQTFVTVPGTLRLFFHDC  69



>emb|CDP02582.1| unnamed protein product [Coffea canephora]
Length=333

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL  N+YA+ CPNVE IV+  V  KF QTFVTVP TLRLFFHDC
Sbjct  28   SAQLKRNYYANICPNVESIVRNAVTQKFQQTFVTVPGTLRLFFHDC  73



>ref|XP_010906276.1| PREDICTED: peroxidase 51-like [Elaeis guineensis]
Length=328

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL  N+Y+  CPNVE IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  22   SSAQLRRNYYSKICPNVESIVRNAVTKKFQQTFVTVPATLRLFFHDC  68



>ref|XP_002532803.1| Peroxidase 16 precursor, putative [Ricinus communis]
 gb|EEF29581.1| Peroxidase 16 precursor, putative [Ricinus communis]
Length=329

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL +NFY+ TCP+VE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  25   SAQLTQNFYSKTCPSVESIVRSAVQKKFQQTFVTAPATLRLFFHDC  70



>ref|XP_004511856.1| PREDICTED: peroxidase 51-like [Cicer arietinum]
Length=328

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ + YA++CPNVE IV++ V  KF QTFVTVPATLRLFFHDC
Sbjct  26   QLSRHHYANSCPNVENIVREAVKKKFHQTFVTVPATLRLFFHDC  69



>gb|KHN15314.1| Peroxidase 16 [Glycine soja]
Length=328

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            + GQL   FY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  23   SSGQLTRGFYLNTCPNVEQLVRSAVEQKFQQTFVTAPATLRLFFHDC  69



>ref|XP_008223742.1| PREDICTED: peroxidase 16-like [Prunus mume]
Length=326

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY  TCPNVE +V   V TKF QTFVT PATLRLFFHDC
Sbjct  24   QLRTNFYQGTCPNVESLVTSAVKTKFQQTFVTAPATLRLFFHDC  67



>ref|XP_006573655.1| PREDICTED: peroxidase 51 [Glycine max]
 gb|KHN36287.1| Peroxidase 51 [Glycine soja]
Length=328

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ + YA TCPNVE IV++ V  KF QTFVTVPAT+RLFFHDC
Sbjct  24   SAQLSRHHYAKTCPNVENIVREAVKKKFHQTFVTVPATIRLFFHDC  69



>ref|XP_008223743.1| PREDICTED: peroxidase 16 [Prunus mume]
Length=326

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  136  GQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             QL  NFY  TCPNVE +V   V TKF QTFVT PATLRLFFHDC
Sbjct  23   AQLRTNFYQGTCPNVESLVTSAVKTKFQQTFVTAPATLRLFFHDC  67



>ref|XP_006466484.1| PREDICTED: peroxidase 51-like [Citrus sinensis]
Length=329

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +++YA TCPNVE IV+  V  KF QTFVTVPAT+RLFFHDC
Sbjct  28   QLKQDYYAKTCPNVEKIVRTQVEKKFRQTFVTVPATIRLFFHDC  71



>ref|NP_001241630.1| uncharacterized protein LOC100804350 precursor [Glycine max]
 gb|ACU23656.1| unknown [Glycine max]
Length=328

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ + YA TCPNVE IV++ V  KF QTFVTVPAT+RLFFHDC
Sbjct  24   SAQLSRHHYAKTCPNVENIVREAVKKKFHQTFVTVPATIRLFFHDC  69



>gb|KHN12986.1| Peroxidase 51 [Glycine soja]
Length=328

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ + YA TCPNVE IV++ V  KF QTFVTVPAT+RLFFHDC
Sbjct  24   SAQLSRHHYAKTCPNVENIVREAVKKKFHQTFVTVPATIRLFFHDC  69



>ref|XP_002877713.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53972.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=329

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+  FY+ TCPNVE IV+  V  K  QTFVTVPATLRLFFHDC
Sbjct  26   QLSRGFYSKTCPNVEQIVRNAVQKKIKQTFVTVPATLRLFFHDC  69



>ref|XP_006426061.1| hypothetical protein CICLE_v10026050mg [Citrus clementina]
 gb|ESR39301.1| hypothetical protein CICLE_v10026050mg [Citrus clementina]
Length=331

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL +++YA TCPNVE IV+  V  KF QTFVTVPAT+RLFFHDC
Sbjct  30   QLKQDYYAKTCPNVEKIVRTQVEKKFRQTFVTVPATIRLFFHDC  73



>ref|XP_004296463.1| PREDICTED: peroxidase 45-like [Fragaria vesca subsp. vesca]
Length=326

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL  +FY  TCPNVE +V   V+ KF QTFVTVPATLRLFFHDC
Sbjct  22   SAQLRTDFYKGTCPNVESLVSSAVSKKFQQTFVTVPATLRLFFHDC  67



>ref|XP_010432051.1| PREDICTED: peroxidase 50-like [Camelina sativa]
Length=329

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  23   ASAQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  69



>ref|XP_010437219.1| PREDICTED: peroxidase 50 [Camelina sativa]
Length=329

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  23   ASAQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  69



>ref|XP_010927767.1| PREDICTED: peroxidase 55-like [Elaeis guineensis]
Length=325

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL+ NFY S+CPNVE IV+Q +  K SQT VTV ATLRLFFHDC
Sbjct  20   GEAQLSPNFYQSSCPNVESIVRQAIQQKLSQTSVTVAATLRLFFHDC  66



>emb|CAA07352.1| peroxidase [Arabidopsis thaliana]
Length=197

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  5    SSAQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  51



>ref|XP_003608472.1| Peroxidase [Medicago truncatula]
Length=202

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ N YA+ CPNV+ IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  26   QLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLFFHDC  69



>ref|XP_010489449.1| PREDICTED: peroxidase 16-like [Camelina sativa]
Length=323

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL  NFY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  22   SAQLQTNFYRNSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDC  67



>ref|XP_009342775.1| PREDICTED: peroxidase 73-like [Pyrus x bretschneideri]
Length=325

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA+ CPNVE +V+  V  KF QTFVTVP TLRLFFHDC
Sbjct  26   QLKTNYYANICPNVESLVKDAVTKKFQQTFVTVPGTLRLFFHDC  69



>gb|AAN60320.1| unknown [Arabidopsis thaliana]
Length=206

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  26   QLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  69



>ref|XP_010467737.1| PREDICTED: peroxidase 16 [Camelina sativa]
Length=323

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL  NFY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  22   SAQLQTNFYRNSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDC  67



>ref|XP_002268127.1| PREDICTED: peroxidase 16 [Vitis vinifera]
 emb|CBI17859.3| unnamed protein product [Vitis vinifera]
Length=326

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL ++FY  TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  21   ASAQLRQDFYKDTCPNVESLVRSAVQKKFLQTFVTAPATLRLFFHDC  67



>ref|XP_008379105.1| PREDICTED: peroxidase 55-like [Malus domestica]
Length=326

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +EGQL ENFY++ CPNVE IV Q V+ K  QT +T+ ATLRLF HDC
Sbjct  22   SEGQLVENFYSAXCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDC  68



>emb|CDY29561.1| BnaA03g54060D [Brassica napus]
Length=326

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  23   QLSRNFYAGSCPNVEQIVRNAVQQKIQQTFTTIPATLRLYFHDC  66



>ref|XP_007014305.1| Peroxidase family protein [Theobroma cacao]
 gb|EOY31924.1| Peroxidase family protein [Theobroma cacao]
Length=327

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A+ +L  +FY +TCPNVE IV+  V TKF QTFVT P TLRLFFHDC
Sbjct  23   AQTRLRPDFYRTTCPNVESIVRSAVQTKFQQTFVTAPGTLRLFFHDC  69



>gb|ACI42310.2| peroxidase 5 [Litchi chinensis]
Length=329

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA+ CPNVE IV+  V  KF QTFVTVPAT+RLFFHDC
Sbjct  26   QLRRNYYANICPNVEQIVRNEVNKKFRQTFVTVPATIRLFFHDC  69



>ref|XP_009130545.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 73 [Brassica rapa]
Length=329

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY  +CPNVE IV+++V  K  +TFVT+PATLRLFFHDC
Sbjct  26   QLNXNFYGKSCPNVEAIVRKIVQQKVKETFVTIPATLRLFFHDC  69



>ref|XP_009347014.1| PREDICTED: peroxidase 16-like [Pyrus x bretschneideri]
Length=326

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY  TCPN+E IV   V TKF QTFVT PATLRLFFHDC
Sbjct  24   QLRTDFYKGTCPNLESIVSSAVKTKFQQTFVTAPATLRLFFHDC  67



>ref|NP_001242402.1| uncharacterized protein LOC100817540 precursor [Glycine max]
 gb|ACU21352.1| unknown [Glycine max]
Length=325

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ N YA+ CPN+E IV+Q V  K  QTFVTVPATLRLFFHDC
Sbjct  25   SAQLSPNHYANICPNLESIVRQAVTNKSQQTFVTVPATLRLFFHDC  70



>ref|XP_008390952.1| PREDICTED: peroxidase 16-like [Malus domestica]
Length=326

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY  TCPN+E IV   V TKF QTFVT PATLRLFFHDC
Sbjct  24   QLRTDFYKGTCPNLESIVSSAVKTKFQQTFVTAPATLRLFFHDC  67



>emb|CAA70034.1| peroxidase ATP22a [Arabidopsis thaliana]
Length=322

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY  +CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  23   QLQTNFYRKSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDC  66



>ref|XP_004488001.1| PREDICTED: peroxidase 16-like [Cicer arietinum]
Length=329

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  145  RAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            R+  +L + FY++TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  23   RSSTELTKGFYSNTCPNVEQLVRSAVELKFQQTFVTAPATLRLFFHDC  70



>gb|KDP32054.1| hypothetical protein JCGZ_12515 [Jatropha curcas]
Length=328

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA+ CPNVE IV+  V  KF QTFVTVP T+RLFFHDC
Sbjct  25   QLRRNYYANICPNVESIVRNAVQKKFQQTFVTVPGTIRLFFHDC  68



>ref|XP_010550341.1| PREDICTED: peroxidase 35-like [Tarenaya hassleriana]
Length=329

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  136  GQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             QL   FYA TCPNVE IV+ VV  K  QTFV++PATLRLFFHDC
Sbjct  25   AQLMPKFYAKTCPNVEQIVRNVVKRKVKQTFVSIPATLRLFFHDC  69



>ref|XP_010426527.1| PREDICTED: peroxidase 35-like [Camelina sativa]
Length=329

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+  FY+ TCPNVE IV+  V  K  QTFVT+PATLRLFFHDC
Sbjct  26   QLSRGFYSKTCPNVEQIVRNAVQKKVKQTFVTIPATLRLFFHDC  69



>ref|NP_179488.1| peroxidase 16 [Arabidopsis thaliana]
 sp|Q96518.2|PER16_ARATH RecName: Full=Peroxidase 16; Short=Atperox P16; AltName: Full=ATP22a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC09031.1| peroxidase (ATP22a) [Arabidopsis thaliana]
 gb|AAO23647.1| At2g18980 [Arabidopsis thaliana]
 dbj|BAE99626.1| peroxidase [Arabidopsis thaliana]
 gb|AEC06835.1| peroxidase 16 [Arabidopsis thaliana]
Length=323

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY  +CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  24   QLQTNFYRKSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDC  67



>ref|XP_010515362.1| PREDICTED: peroxidase 35 [Camelina sativa]
Length=329

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+  FY+ TCPNVE IV+  V  K  QTFVT+PATLRLFFHDC
Sbjct  26   QLSRGFYSKTCPNVEQIVRNAVQKKVKQTFVTIPATLRLFFHDC  69



>ref|XP_010503665.1| PREDICTED: peroxidase 35-like [Camelina sativa]
Length=329

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+  FY+ TCPNVE IV+  V  K  QTFVT+PATLRLFFHDC
Sbjct  26   QLSRGFYSKTCPNVEQIVRNAVQKKVKQTFVTIPATLRLFFHDC  69



>ref|XP_006290363.1| hypothetical protein CARUB_v10017623mg [Capsella rubella]
 gb|EOA23261.1| hypothetical protein CARUB_v10017623mg [Capsella rubella]
Length=329

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+  FY+ TCPNVE IV+  V  K  QTFVT+PATLRLFFHDC
Sbjct  26   QLSRGFYSKTCPNVEQIVRNAVQKKVKQTFVTIPATLRLFFHDC  69



>ref|XP_006656422.1| PREDICTED: peroxidase 16-like [Oryza brachyantha]
Length=334

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  148  WRAEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            W A  QL++N+Y STCPNVE +V+  VA K  +TF   P TLRLFFHDC
Sbjct  24   WCAAAQLSQNYYVSTCPNVETLVRGAVAQKLKETFNAAPGTLRLFFHDC  72



>ref|XP_006300101.1| hypothetical protein CARUB_v10016330mg [Capsella rubella]
 gb|EOA32999.1| hypothetical protein CARUB_v10016330mg [Capsella rubella]
Length=323

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY ++CPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  24   QLRANFYRNSCPNVETVVRNAVRQKFQQTFVTAPATLRLFFHDC  67



>ref|XP_010464099.1| PREDICTED: peroxidase 73-like [Camelina sativa]
Length=329

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY   CPNVE IV+ VV  K  QTFVT+PATLRLFFHDC
Sbjct  26   QLKTNFYGKVCPNVEQIVRTVVQQKVKQTFVTIPATLRLFFHDC  69



>ref|XP_009402171.1| PREDICTED: peroxidase 51-like [Musa acuminata subsp. malaccensis]
Length=323

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL  NFY  +CPNVE IV++ V  K +QT VTVPATLRLFFHDC
Sbjct  20   GEAQLNPNFYQVSCPNVESIVRRAVLKKLNQTIVTVPATLRLFFHDC  66



>ref|XP_003608471.1| Peroxidase [Medicago truncatula]
 gb|AES90668.1| class III peroxidase [Medicago truncatula]
Length=323

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ N YA+ CPNV+ IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  26   QLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLFFHDC  69



>emb|CAC38106.1| peroxidase2 [Medicago sativa]
Length=323

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ N YA+ CPNV+ IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  26   QLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLFFHDC  69



>ref|XP_007222667.1| hypothetical protein PRUPE_ppa008569mg [Prunus persica]
 gb|EMJ23866.1| hypothetical protein PRUPE_ppa008569mg [Prunus persica]
Length=326

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY  TCPNVE +V   V TKF QTFVT PATLRLFFHDC
Sbjct  24   QLRTDFYKGTCPNVESLVTSAVKTKFQQTFVTAPATLRLFFHDC  67



>emb|CAA62228.1| peroxidase2 [Medicago sativa]
Length=323

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ N YA+ CPNV+ IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  26   QLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLFFHDC  69



>emb|CAA09881.1| peroxidase [Trifolium repens]
Length=329

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+ N YA+ CPNV+ IV+  V  KF QTFVTVPATLRLFFHDC
Sbjct  27   QLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLFFHDC  70



>ref|XP_009784349.1| PREDICTED: peroxidase 51-like [Nicotiana sylvestris]
Length=330

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  N+YA TCPNVE IV+ VV  K  QT +TVPA LRLFFHDC
Sbjct  24   ASAQLRTNYYAKTCPNVESIVRNVVNQKIQQTIITVPAVLRLFFHDC  70



>ref|XP_010550209.1| PREDICTED: peroxidase 55 [Tarenaya hassleriana]
Length=333

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL E FY + CPNVE IV++ V+ KF QTFVT P+TLRLFFHDC
Sbjct  32   QLREQFYGTRCPNVEEIVKEAVSLKFQQTFVTAPSTLRLFFHDC  75



>emb|CAA67362.1| peroxidase ATP9a [Arabidopsis thaliana]
Length=312

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  6    SSAQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  52



>ref|XP_009408351.1| PREDICTED: peroxidase 55-like [Musa acuminata subsp. malaccensis]
Length=325

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            E QL  NFY  TCP VE IV+Q V  K  QTFVTVPATLRLFFHDC
Sbjct  23   EAQLRPNFYQFTCPKVESIVRQAVLKKVRQTFVTVPATLRLFFHDC  68



>gb|KEH22009.1| peroxidase family protein [Medicago truncatula]
Length=320

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL ENFY S+CPNVEL+V Q V  KF+QT  T  ATLRLF HDC
Sbjct  21   GECQLVENFYVSSCPNVELVVAQAVTNKFTQTITTGQATLRLFLHDC  67



>gb|AFK49058.1| unknown [Medicago truncatula]
Length=320

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL ENFY S+CPNVEL+V Q V  KF+QT  T  ATLRLF HDC
Sbjct  21   GECQLVENFYVSSCPNVELVVAQAVTNKFTQTITTGQATLRLFLHDC  67



>ref|XP_009135008.1| PREDICTED: peroxidase 50 [Brassica rapa]
 emb|CDX75661.1| BnaA01g00410D [Brassica napus]
Length=326

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  23   QLRSNFYAGSCPNVEKIVRDAVQKKVQQTFTTIPATLRLYFHDC  66



>ref|XP_008790752.1| PREDICTED: peroxidase 55 [Phoenix dactylifera]
Length=323

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL+  FY  TCPNVE +V++ V  K SQTF TVPATLRLFFHDC
Sbjct  20   GEAQLSPTFYQWTCPNVESMVREAVQKKLSQTFATVPATLRLFFHDC  66



>emb|CDX69313.1| BnaC01g01400D [Brassica napus]
Length=326

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  23   QLRRNFYAGSCPNVEQIVRDAVQKKVQQTFTTIPATLRLYFHDC  66



>gb|KHN22682.1| Peroxidase 16 [Glycine soja]
Length=324

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL+  FY +TCPNVE +V+  VA KF QTFVT PATLRLFFHDC
Sbjct  21   SSAQLSRVFYRNTCPNVEQLVRSSVAQKFQQTFVTAPATLRLFFHDC  67



>ref|NP_001078508.1| peroxidase 51 [Arabidopsis thaliana]
 gb|AEE86807.1| peroxidase 51 [Arabidopsis thaliana]
Length=282

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL  +FYA TCPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  23   SSAQLRGDFYAGTCPNVEQIVRNAVQKKIQQTFTTIPATLRLYFHDC  69



>dbj|BAH56994.1| AT4G37530 [Arabidopsis thaliana]
Length=281

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL  +FYA TCPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  23   SSAQLRGDFYAGTCPNVEQIVRNAVQKKIQQTFTTIPATLRLYFHDC  69



>emb|CAA71495.1| peroxidase [Spinacia oleracea]
Length=329

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  130  LAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            L+  +YA TCPNVE IV+Q V  K  QTFVT+PATLRLFFHDC
Sbjct  27   LSTTYYAKTCPNVEKIVRQAVQKKIQQTFVTIPATLRLFFHDC  69



>gb|ACU20973.1| unknown [Glycine max]
Length=262

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL   FY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  23   SSAQLTRGFYLNTCPNVEQLVRSAVEQKFQQTFVTAPATLRLFFHDC  69



>ref|NP_001190944.1| peroxidase 50 [Arabidopsis thaliana]
 gb|AEE86805.1| peroxidase 50 [Arabidopsis thaliana]
Length=326

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  26   QLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  69



>ref|NP_195468.1| peroxidase 50 [Arabidopsis thaliana]
 sp|Q43731.1|PER50_ARATH RecName: Full=Peroxidase 50; Short=Atperox P50; AltName: Full=ATP9a; 
AltName: Full=PRXR2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA66958.1| peroxidase [Arabidopsis thaliana]
 emb|CAB38291.1| peroxidase, prxr2 [Arabidopsis thaliana]
 emb|CAB80417.1| peroxidase, prxr2 [Arabidopsis thaliana]
 gb|AAL32894.1| peroxidase, prxr2 [Arabidopsis thaliana]
 gb|AAM10139.1| peroxidase, prxr2 [Arabidopsis thaliana]
 gb|AEE86804.1| peroxidase 50 [Arabidopsis thaliana]
Length=329

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  26   QLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  69



>gb|KFK30370.1| hypothetical protein AALP_AA7G252300 [Arabis alpina]
Length=328

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL  NFYA TCP+VE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  22   SSAQLRRNFYAGTCPDVEKIVRNAVQLKIQQTFTTIPATLRLYFHDC  68



>gb|AAM63630.1| peroxidase, prxr2 [Arabidopsis thaliana]
Length=329

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  26   QLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  69



>ref|XP_006411878.1| hypothetical protein EUTSA_v10025695mg [Eutrema salsugineum]
 dbj|BAJ34486.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53331.1| hypothetical protein EUTSA_v10025695mg [Eutrema salsugineum]
Length=328

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  25   QLRRNFYAGSCPNVEQIVRSAVQQKIQQTFTTIPATLRLYFHDC  68



>ref|XP_008466661.1| PREDICTED: peroxidase 45-like, partial [Cucumis melo]
Length=329

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  27   QLHLNFYQNSCPNVESIVRAAVKQKFEQTFVTAPATLRLFFHDC  70



>ref|XP_004136312.1| PREDICTED: peroxidase 45-like [Cucumis sativus]
 ref|XP_004168486.1| PREDICTED: peroxidase 45-like [Cucumis sativus]
 gb|KGN60168.1| hypothetical protein Csa_3G881810 [Cucumis sativus]
Length=323

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  21   QLHLNFYQNSCPNVESIVRAAVKQKFEQTFVTAPATLRLFFHDC  64



>ref|XP_003597106.1| Peroxidase [Medicago truncatula]
Length=226

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ + Y ++CPNVE IV++ V  KF QTF TVPATLRLFFHDC
Sbjct  24   HAQLSRHHYKNSCPNVENIVREAVKKKFHQTFTTVPATLRLFFHDC  69



>ref|XP_009387951.1| PREDICTED: peroxidase 51-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=320

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL  NFY  +CP+VE IV+Q V  K  QT VTVPATLRLFFHDC
Sbjct  20   GEAQLNPNFYQVSCPSVESIVRQAVLKKLKQTIVTVPATLRLFFHDC  66



>ref|XP_009387950.1| PREDICTED: peroxidase 51-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=323

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             E QL  NFY  +CP+VE IV+Q V  K  QT VTVPATLRLFFHDC
Sbjct  20   GEAQLNPNFYQVSCPSVESIVRQAVLKKLKQTIVTVPATLRLFFHDC  66



>gb|AFF57838.1| peroxidase [Phaseolus vulgaris]
Length=324

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY + CPNVE +V+  VA KF QTFVT PATLRLFFHDC
Sbjct  24   QLTRSFYKNVCPNVEQLVRSAVAQKFQQTFVTAPATLRLFFHDC  67



>gb|KFK29573.1| peroxidase atp8a [Arabis alpina]
Length=326

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL   FY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  27   QLRTGFYGNSCPNVETIVRDAVRQKFQQTFVTAPATLRLFFHDC  70



>ref|XP_003533723.1| PREDICTED: peroxidase 16-like [Glycine max]
 gb|KHN35785.1| Peroxidase 16 [Glycine soja]
Length=328

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL   FY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  23   SSAQLTRGFYRNTCPNVEQLVRSAVEQKFQQTFVTAPATLRLFFHDC  69



>ref|XP_008352559.1| PREDICTED: peroxidase 50-like [Malus domestica]
Length=200

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA+ CP+VE IV+  V  KF QTFVTV ATLRLFFHDC
Sbjct  30   QLKTNYYANICPDVEKIVKNAVNNKFQQTFVTVXATLRLFFHDC  73



>ref|XP_007154738.1| hypothetical protein PHAVU_003G143400g [Phaseolus vulgaris]
 gb|ESW26732.1| hypothetical protein PHAVU_003G143400g [Phaseolus vulgaris]
Length=324

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY + CPNVE +V+  VA KF QTFVT PATLRLFFHDC
Sbjct  24   QLTRSFYKNVCPNVEQLVRSAVAQKFQQTFVTAPATLRLFFHDC  67



>ref|NP_195469.1| peroxidase 51 [Arabidopsis thaliana]
 sp|Q9SZE7.1|PER51_ARATH RecName: Full=Peroxidase 51; Short=Atperox P51; AltName: Full=ATP37; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL79842.1|AF469928_1 peroxidase ATP37 [Arabidopsis thaliana]
 emb|CAB38292.1| peroxidase-like protein [Arabidopsis thaliana]
 emb|CAB80418.1| peroxidase-like protein [Arabidopsis thaliana]
 gb|AAN13031.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEE86806.1| peroxidase 51 [Arabidopsis thaliana]
Length=329

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL  +FYA TCPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  23   SSAQLRGDFYAGTCPNVEQIVRNAVQKKIQQTFTTIPATLRLYFHDC  69



>ref|XP_009783800.1| PREDICTED: peroxidase 16-like [Nicotiana sylvestris]
Length=329

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  27   QLRSDFYKNTCPNVESLVRAAVRQKFQQTFVTAPATLRLFFHDC  70



>ref|XP_009600643.1| PREDICTED: peroxidase 16-like [Nicotiana tomentosiformis]
Length=329

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  27   QLRSDFYKNTCPNVESLVRAAVRQKFQQTFVTAPATLRLFFHDC  70



>ref|XP_011069927.1| PREDICTED: peroxidase 16 [Sesamum indicum]
Length=336

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  34   QLTTDFYRTTCPNVESLVRSAVQAKFRQTFVTAPATLRLFFHDC  77



>ref|XP_003546418.1| PREDICTED: peroxidase 16 [Glycine max]
Length=328

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +  QL   FY +TCPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  23   SSAQLTRGFYLNTCPNVEQLVRSAVEQKFQQTFVTAPATLRLFFHDC  69



>ref|XP_002459236.1| hypothetical protein SORBIDRAFT_02g001130 [Sorghum bicolor]
 gb|EER95757.1| hypothetical protein SORBIDRAFT_02g001130 [Sorghum bicolor]
Length=167

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YAS CPNVE IV+  VA+K+ +TF+TV AT+ LFFHDC
Sbjct  36   QLRRNYYASVCPNVESIVRDAVASKYRETFITVGATVHLFFHDC  79



>ref|XP_006393941.1| hypothetical protein EUTSA_v10004576mg [Eutrema salsugineum]
 gb|ESQ31227.1| hypothetical protein EUTSA_v10004576mg [Eutrema salsugineum]
Length=329

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY S+CPNVE  V+ VV  K  QTFVT+PATLRLFFHDC
Sbjct  26   QLKTDFYKSSCPNVERTVRTVVQQKVKQTFVTIPATLRLFFHDC  69



>ref|NP_194746.1| peroxidase 45 [Arabidopsis thaliana]
 sp|Q96522.1|PER45_ARATH RecName: Full=Peroxidase 45; Short=Atperox P45; AltName: Full=ATP8a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK44099.1|AF370284_1 putative peroxidase ATP8a [Arabidopsis thaliana]
 emb|CAA67361.1| peroxidase ATP8a [Arabidopsis thaliana]
 emb|CAB52461.1| peroxidase ATP8a [Arabidopsis thaliana]
 emb|CAB81010.1| peroxidase ATP8a [Arabidopsis thaliana]
 gb|AAL34225.1| putative peroxidase ATP8a [Arabidopsis thaliana]
 gb|AAM62676.1| peroxidase ATP8a [Arabidopsis thaliana]
 gb|AEE85729.1| peroxidase 45 [Arabidopsis thaliana]
Length=325

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL   FY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  26   QLRTGFYQNSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDC  69



>ref|XP_003597105.1| Peroxidase [Medicago truncatula]
 ref|XP_003611621.1| Peroxidase [Medicago truncatula]
 gb|AES94579.1| peroxidase family protein [Medicago truncatula]
Length=328

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL+ + Y ++CPNVE IV++ V  KF QTF TVPATLRLFFHDC
Sbjct  24   HAQLSRHHYKNSCPNVENIVREAVKKKFHQTFTTVPATLRLFFHDC  69



>ref|XP_006284112.1| hypothetical protein CARUB_v10005246mg [Capsella rubella]
 gb|EOA17010.1| hypothetical protein CARUB_v10005246mg [Capsella rubella]
Length=323

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL  NFYA +CPNVE IV+  V  K  Q+ +T+PATLRL+FHDC
Sbjct  23   ASAQLRRNFYAGSCPNVEQIVRNAVQKKAQQSIITIPATLRLYFHDC  69



>ref|XP_002868984.1| peroxidase ATP9a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45243.1| peroxidase ATP9a [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  NFYA  CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  24   QLRRNFYAGICPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  67



>ref|XP_006658226.1| PREDICTED: peroxidase 51-like [Oryza brachyantha]
Length=324

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA  CPNVE +V+  V+ KF QTFVTV AT+RLFFHDC
Sbjct  25   QLRRNYYAGVCPNVESVVRDAVSKKFQQTFVTVGATVRLFFHDC  68



>gb|EAZ09688.1| hypothetical protein OsI_31971 [Oryza sativa Indica Group]
Length=108

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +L+   Y STCP VE +V+ VVA K  +TFVTVPATLRLFFHDC
Sbjct  32   RLSPEHYRSTCPGVESVVRSVVARKVKETFVTVPATLRLFFHDC  75



>emb|CDP16702.1| unnamed protein product [Coffea canephora]
Length=323

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFS--QTFVTVPATLRLFFHDC  2
             E +L ENFY+S+CPNVE IV Q V  K +  QTF  +PATLRLFFHDC
Sbjct  17   GEAELKENFYSSSCPNVESIVLQAVNAKLAETQTFTPIPATLRLFFHDC  65



>ref|XP_002869392.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45651.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=325

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL   FY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  26   QLRTGFYQNSCPNVEGIVRNAVRQKFQQTFVTAPATLRLFFHDC  69



>gb|ACJ11759.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +L  N+Y  TCPNVE IV+  V  KF QTFVT PAT+RLFFHDC
Sbjct  27   KLRRNYYHKTCPNVENIVRAAVTKKFQQTFVTAPATIRLFFHDC  70



>ref|XP_009137893.1| PREDICTED: peroxidase 45 [Brassica rapa]
Length=325

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL   FY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  26   QLRTGFYQNSCPNVESIVRNAVRQKFQQTFVTAPATLRLFFHDC  69



>ref|NP_190565.1| peroxidase 35 [Arabidopsis thaliana]
 sp|Q96510.1|PER35_ARATH RecName: Full=Peroxidase 35; Short=Atperox P35; AltName: Full=ATP21a; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA67339.1| peroxidase [Arabidopsis thaliana]
 emb|CAB62104.1| peroxidase ATP21a [Arabidopsis thaliana]
 dbj|BAE99565.1| peroxidase ATP21a [Arabidopsis thaliana]
 gb|AEE78611.1| peroxidase 35 [Arabidopsis thaliana]
Length=329

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL+  FY+ TCPNVE IV+  V  K  +TFV VPATLRLFFHDC
Sbjct  26   QLSRGFYSKTCPNVEQIVRNAVQKKIKKTFVAVPATLRLFFHDC  69



>emb|CDX72214.1| BnaC07g42360D [Brassica napus]
Length=325

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL   FY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  26   QLRTGFYQNSCPNVESIVRNAVRQKFQQTFVTAPATLRLFFHDC  69



>ref|XP_006282666.1| hypothetical protein CARUB_v10005222mg [Capsella rubella]
 gb|EOA15564.1| hypothetical protein CARUB_v10005222mg [Capsella rubella]
Length=330

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
               QL  +FYA +CPNVE IV+  V  K  QTF T+PATLRL+FHDC
Sbjct  24   GSAQLRRDFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDC  70



>gb|ADD54643.1| peroxidase [Bruguiera gymnorhiza]
Length=328

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            +L+ NFY +TCPNVE +V+  V  KF QT VT P TLRLFFHDC
Sbjct  26   KLSRNFYRNTCPNVESLVRSAVQKKFQQTIVTAPGTLRLFFHDC  69



>ref|XP_010526357.1| PREDICTED: peroxidase 16 [Tarenaya hassleriana]
Length=327

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY ++CPNVE +V+  V  KF QTFVT PATLRLFFHDC
Sbjct  28   QLRTDFYRNSCPNVETLVRNAVRQKFQQTFVTAPATLRLFFHDC  71



>emb|CDY37853.1| BnaAnng05140D [Brassica napus]
Length=335

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  124  ENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             NFY  +CPNVE IV+++V  K  +TFVT+PATLRLFFHDC
Sbjct  35   HNFYGKSCPNVEAIVRKIVQQKVKETFVTIPATLRLFFHDC  75



>ref|XP_006412738.1| hypothetical protein EUTSA_v10025699mg [Eutrema salsugineum]
 gb|ESQ54191.1| hypothetical protein EUTSA_v10025699mg [Eutrema salsugineum]
Length=327

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL   FY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  28   QLRTGFYRNSCPNVENIVRNAVRQKFQQTFVTAPATLRLFFHDC  71



>ref|XP_007227473.1| hypothetical protein PRUPE_ppa008550mg [Prunus persica]
 gb|EMJ28672.1| hypothetical protein PRUPE_ppa008550mg [Prunus persica]
Length=327

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL    Y S+CPNVE IV   V  KF QTFVT PATLRLFFHDC
Sbjct  22   AHAQLHVEHYRSSCPNVEAIVHAAVKQKFEQTFVTAPATLRLFFHDC  68



>ref|XP_010048567.1| PREDICTED: peroxidase 16-like [Eucalyptus grandis]
 gb|KCW80848.1| hypothetical protein EUGRSUZ_C02212 [Eucalyptus grandis]
Length=325

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  +FY +TCPNVE +V+  V  KF QTFVT PATLRL FHDC
Sbjct  23   QLRTDFYKNTCPNVESLVRSAVTKKFQQTFVTAPATLRLLFHDC  66



>gb|ACN60160.1| peroxidase [Tamarix hispida]
Length=328

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
             + QL+  FY+STCP+VE IV+  V  KF QTFVT  ATLRLFFHDC
Sbjct  22   GQAQLSTRFYSSTCPDVETIVRTAVDNKFRQTFVTAQATLRLFFHDC  68



>emb|CDY51649.1| BnaAnng10890D [Brassica napus]
Length=381

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL   FY ++CPNVE IV+  V  KF QTFVT PATLRLFFHDC
Sbjct  24   SAQLRTGFYQNSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDC  69



>ref|XP_008350315.1| PREDICTED: peroxidase 51-like [Malus domestica]
Length=329

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  QLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            QL  N+YA+ CP+VE IV+  V  KF QTFVTV ATLRLFFHDC
Sbjct  30   QLKTNYYANICPDVEKIVKNAVNNKFQQTFVTVXATLRLFFHDC  73



>ref|XP_008219934.1| PREDICTED: peroxidase 16-like [Prunus mume]
Length=327

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  142  AEGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
            A  QL    Y S+CPNVE IV   V  KF QTFVT PATLRLFFHDC
Sbjct  22   AHAQLHVEHYRSSCPNVEAIVHAAVKQKFEQTFVTAPATLRLFFHDC  68



>ref|XP_010048668.1| PREDICTED: peroxidase 16 [Eucalyptus grandis]
 gb|KCW81015.1| hypothetical protein EUGRSUZ_C02389 [Eucalyptus grandis]
Length=325

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  139  EGQLAENFYASTCPNVELIVQQVVATKFSQTFVTVPATLRLFFHDC  2
              QL  +FY +TCPNVE +V+  V  KF QTFVT PATLRL FHDC
Sbjct  21   SAQLRTDFYKNTCPNVESLVRSAVTKKFQQTFVTAPATLRLLFHDC  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522148051722