BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79395_g1_i1 len=1434 path=[1:0-1433]

Length=1434
                                                                      Score     E

ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    615   0.0      
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    613   0.0      
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    612   0.0      
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    610   0.0      
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    610   0.0      
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    608   0.0      
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    600   0.0      
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    600   0.0      
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    598   0.0      
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    598   0.0      
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    597   0.0      
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    596   0.0      
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    579   0.0      
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    568   0.0      
ref|XP_002517567.1|  conserved hypothetical protein                     560   0.0      Ricinus communis
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    554   0.0      
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                554   0.0      
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    553   0.0      
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                552   0.0      
emb|CBI36253.3|  unnamed protein product                                552   0.0      
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 547   0.0      
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    546   0.0      
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    545   0.0      
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    540   0.0      Vitis vinifera
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    539   0.0      
emb|CDO98109.1|  unnamed protein product                                536   0.0      
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    535   0.0      
gb|AGV54541.1|  hypothetical protein                                    535   0.0      
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             533   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             532   0.0      
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             532   0.0      
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    532   0.0      
gb|KHN44154.1|  hypothetical protein glysoja_031815                     532   0.0      
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    533   0.0      
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    531   0.0      
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    531   0.0      
ref|XP_002515557.1|  conserved hypothetical protein                     529   0.0      Ricinus communis
gb|KHG10708.1|  Allergen Act d 3                                        527   0.0      
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    527   0.0      
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    526   0.0      
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    526   0.0      
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             526   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         525   0.0      
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             525   0.0      
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    525   0.0      
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         522   2e-180   
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    522   2e-180   
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    521   3e-180   
gb|KHN06654.1|  hypothetical protein glysoja_037506                     521   4e-180   
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             520   1e-179   
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             519   2e-179   
gb|KHG06895.1|  Agmatine deiminase                                      519   4e-179   
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    521   5e-179   
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    518   6e-179   
ref|XP_004302947.1|  PREDICTED: uncharacterized protein LOC101306247    518   8e-179   
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    518   8e-179   
gb|KHN47787.1|  hypothetical protein glysoja_029205                     518   9e-179   
emb|CDO98108.1|  unnamed protein product                                518   1e-178   
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    516   3e-178   
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  517   3e-178   
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    515   9e-178   
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    513   4e-177   
ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    512   1e-176   
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    512   2e-176   
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    511   4e-176   
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    510   1e-175   
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    509   1e-175   
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    508   4e-175   
gb|KHG29602.1|  Allergen Act d 3                                        508   4e-175   
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    506   3e-174   
gb|AAB41813.1|  unknown protein                                         506   4e-174   Medicago sativa [alfalfa]
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    506   6e-174   
ref|XP_010088264.1|  hypothetical protein L484_005140                   506   9e-174   
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    505   1e-173   
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             504   4e-173   Populus trichocarpa [western balsam poplar]
ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    503   4e-173   
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  503   5e-173   
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    503   5e-173   
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    503   8e-173   
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    504   1e-172   
gb|ABK94923.1|  unknown                                                 502   2e-172   Populus trichocarpa [western balsam poplar]
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    501   2e-172   
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    501   4e-172   
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    500   8e-172   
gb|AES58962.2|  plant/F18G18-200 protein                                500   1e-171   
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             501   1e-171   Populus trichocarpa [western balsam poplar]
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    499   1e-171   
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  501   2e-171   
gb|ACJ84308.1|  unknown                                                 499   2e-171   Medicago truncatula
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    497   5e-171   
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    497   1e-170   
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             497   1e-170   
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    497   1e-170   
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             496   4e-170   
gb|AAM63507.1|  unknown                                                 495   7e-170   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196703.1|  uncharacterized protein                               495   1e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    494   1e-169   
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    494   1e-169   
gb|AAN31807.1|  unknown protein                                         493   3e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             493   8e-169   
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    492   9e-169   
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    492   1e-168   
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    491   2e-168   
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    491   4e-168   
emb|CDX85713.1|  BnaA02g01000D                                          490   7e-168   
dbj|BAE98407.1|  hypothetical protein                                   490   8e-168   Arabidopsis thaliana [mouse-ear cress]
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               490   9e-168   
ref|NP_567894.1|  uncharacterized protein                               489   1e-167   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    489   2e-167   
gb|KHG21630.1|  Adenosylhomocysteinase                                  489   4e-167   
emb|CDX91217.1|  BnaC02g03800D                                          488   4e-167   
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    488   5e-167   
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    487   9e-167   
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             486   2e-166   
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    486   3e-166   
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    486   3e-166   
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             486   4e-166   
emb|CDX68849.1|  BnaC01g06040D                                          486   4e-166   
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             486   4e-166   
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             484   4e-166   
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    486   5e-166   
emb|CDX97108.1|  BnaC09g45170D                                          485   5e-166   
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    485   5e-166   
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    485   7e-166   
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    485   7e-166   
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    483   8e-166   
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     485   8e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             484   1e-165   
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    484   2e-165   
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    483   3e-165   
emb|CDP04798.1|  unnamed protein product                                483   4e-165   
gb|AAM61720.1|  unknown                                                 483   5e-165   Arabidopsis thaliana [mouse-ear cress]
gb|AAL06839.1|  AT5g25460/F18G18_200                                    482   9e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    482   1e-164   
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    482   2e-164   
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    480   5e-164   
emb|CDY19801.1|  BnaA09g04540D                                          480   5e-164   
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    479   2e-163   
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    478   3e-163   
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    477   1e-162   
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    474   8e-162   
emb|CDY54909.1|  BnaC02g48660D                                          472   3e-161   
dbj|BAK03126.1|  predicted protein                                      469   1e-159   
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               468   1e-159   
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     469   1e-159   
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             467   6e-159   
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  464   1e-158   
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          465   4e-158   Sorghum bicolor [broomcorn]
ref|XP_010110340.1|  GTP-binding nuclear protein                        473   6e-158   
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    464   1e-157   
gb|EPS73289.1|  hypothetical protein M569_01466                         462   5e-157   
gb|KHN07098.1|  hypothetical protein glysoja_023281                     459   3e-156   
emb|CAA22573.1|  putative protein                                       459   3e-156   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          459   3e-156   
emb|CDX69757.1|  BnaA10g21060D                                          486   3e-155   
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  456   5e-155   
gb|KHN07099.1|  hypothetical protein glysoja_023282                     456   8e-155   
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             453   4e-154   
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             452   6e-153   
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    451   3e-152   
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             450   6e-152   
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    449   7e-152   
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    449   3e-151   
ref|XP_007150706.1|  hypothetical protein PHAVU_005G1745000g            444   7e-151   
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               447   7e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    446   1e-150   
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    446   2e-150   
emb|CDY57694.1|  BnaA07g38340D                                          445   3e-150   
gb|EMT06486.1|  hypothetical protein F775_26416                         444   6e-150   
dbj|BAK03627.1|  predicted protein                                      444   8e-150   
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          444   8e-150   Sorghum bicolor [broomcorn]
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    443   1e-149   
gb|EEE56530.1|  hypothetical protein OsJ_05823                          443   3e-149   Oryza sativa Japonica Group [Japonica rice]
emb|CDY54317.1|  BnaC06g43150D                                          441   2e-148   
dbj|BAB21293.1|  unknown protein                                        439   5e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    439   7e-148   
ref|NP_001043549.2|  Os01g0611000                                       440   7e-148   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001140426.1|  hypothetical protein precursor                     437   5e-147   Zea mays [maize]
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    434   1e-146   
gb|EEC72709.1|  hypothetical protein OsI_06304                          436   1e-146   Oryza sativa Indica Group [Indian rice]
gb|KHG21629.1|  GTPase Der                                              432   3e-146   
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             434   8e-146   
ref|NP_001046247.2|  Os02g0205200                                       431   1e-144   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67378.1|  OSIGBa0159F11.2                                        428   2e-143   Oryza sativa [red rice]
gb|ACG40327.1|  hypothetical protein                                    422   5e-141   Zea mays [maize]
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         422   6e-141   
gb|EAY94676.1|  hypothetical protein OsI_16455                          421   2e-140   Oryza sativa Indica Group [Indian rice]
emb|CAE01677.2|  OSJNBb0091E11.19                                       420   3e-140   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001145978.1|  hypothetical protein                               421   8e-140   Zea mays [maize]
emb|CAH67292.1|  OSIGBa0103O01.10                                       419   8e-140   Oryza sativa [red rice]
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    419   9e-140   
emb|CAE01676.2|  OSJNBb0091E11.17                                       419   1e-139   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053189.1|  Os04g0494800                                       418   2e-139   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              417   3e-139   
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    417   7e-139   
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    416   7e-139   
ref|NP_001053188.1|  Os04g0494600                                       415   3e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    412   4e-137   
gb|EMT04285.1|  hypothetical protein F775_14657                         411   8e-137   
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    410   2e-136   
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    409   9e-136   
gb|EMT16005.1|  hypothetical protein F775_13621                         406   2e-135   
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          407   2e-135   Sorghum bicolor [broomcorn]
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          406   6e-135   
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       406   7e-135   
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          405   2e-134   Sorghum bicolor [broomcorn]
emb|CDY39990.1|  BnaC06g40680D                                          403   3e-134   
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    405   3e-134   
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    403   1e-133   
ref|XP_002446726.1|  hypothetical protein SORBIDRAFT_06g021300          403   2e-133   Sorghum bicolor [broomcorn]
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    399   4e-132   
ref|XP_006653558.1|  PREDICTED: uncharacterized protein LOC102719203    399   6e-132   
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    397   2e-131   
ref|NP_001141282.1|  hypothetical protein precursor                     397   3e-131   Zea mays [maize]
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    397   3e-131   
emb|CDX87297.1|  BnaA07g35760D                                          395   3e-131   
gb|EMS58461.1|  hypothetical protein TRIUR3_29087                       395   3e-131   
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    396   4e-131   
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    396   5e-131   
emb|CDP07813.1|  unnamed protein product                                396   6e-131   
emb|CAH67377.1|  OSIGBa0159F11.1                                        396   7e-131   Oryza sativa [red rice]
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              395   1e-130   
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    395   1e-130   
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    396   2e-130   
ref|XP_002446727.1|  hypothetical protein SORBIDRAFT_06g021310          395   2e-130   Sorghum bicolor [broomcorn]
emb|CAD41548.2|  OSJNBb0091E11.18                                       394   3e-130   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053190.1|  Os04g0494900                                       394   3e-130   Oryza sativa Japonica Group [Japonica rice]
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         392   1e-129   
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    392   1e-129   
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    392   1e-129   
dbj|BAJ96954.1|  predicted protein                                      392   2e-129   
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    392   2e-129   
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             391   5e-129   
ref|XP_002517797.1|  conserved hypothetical protein                     390   6e-129   Ricinus communis
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    391   6e-129   
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    390   7e-129   
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    390   1e-128   
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    389   2e-128   
gb|EAY74932.1|  hypothetical protein OsI_02826                          389   2e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    389   3e-128   
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             389   3e-128   
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          389   4e-128   Sorghum bicolor [broomcorn]
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    388   6e-128   
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    387   2e-127   
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    387   2e-127   
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    386   3e-127   
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    386   3e-127   
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             386   3e-127   Populus trichocarpa [western balsam poplar]
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    389   4e-127   
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    385   8e-127   
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    385   1e-126   
gb|ACU17881.1|  unknown                                                 381   1e-126   Glycine max [soybeans]
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    384   2e-126   
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          384   2e-126   
ref|XP_002532070.1|  conserved hypothetical protein                     384   4e-126   Ricinus communis
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             383   5e-126   Populus trichocarpa [western balsam poplar]
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             382   1e-125   Populus trichocarpa [western balsam poplar]
dbj|BAD52536.1|  unknown protein                                        379   1e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    382   2e-125   
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    380   5e-125   
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             380   8e-125   
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    380   9e-125   Vitis vinifera
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             380   1e-124   
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    379   2e-124   
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    379   2e-124   
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    379   2e-124   
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    379   2e-124   
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    379   3e-124   
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    379   3e-124   
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    379   3e-124   
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    378   6e-124   
ref|XP_007028767.1|  F17A17.37 protein                                  378   8e-124   
ref|XP_007052493.1|  F17A17.37 protein                                  378   9e-124   
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                377   9e-124   
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    377   9e-124   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    378   1e-123   Vitis vinifera
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    377   1e-123   
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             377   1e-123   Populus trichocarpa [western balsam poplar]
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    377   1e-123   
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             377   1e-123   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    377   1e-123   
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             377   2e-123   
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    377   2e-123   
emb|CDY28002.1|  BnaC05g44040D                                          377   2e-123   
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    377   2e-123   
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589    376   3e-123   
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    377   3e-123   
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    376   3e-123   
emb|CDY22149.1|  BnaC01g39520D                                          376   4e-123   
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    375   5e-123   
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   375   5e-123   
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    375   6e-123   
ref|NP_566328.1|  germination-related protein                           375   6e-123   
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    374   2e-122   
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    374   3e-122   
emb|CDX79912.1|  BnaA05g02440D                                          376   4e-122   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             373   6e-122   
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    380   7e-122   
gb|KHN11697.1|  hypothetical protein glysoja_006150                     372   7e-122   
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    372   7e-122   
gb|AFK39148.1|  unknown                                                 372   8e-122   
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             372   1e-121   
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             372   2e-121   
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             371   3e-121   
dbj|BAJ97095.1|  predicted protein                                      370   5e-121   
gb|AES87990.2|  DUF642 family protein                                   370   7e-121   
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  370   8e-121   
gb|AGV54808.1|  hypothetical protein                                    370   9e-121   
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    369   1e-120   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             370   1e-120   
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    369   2e-120   
gb|AFK34548.1|  unknown                                                 369   2e-120   
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              369   3e-120   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    368   4e-120   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             368   7e-120   
gb|KFK37021.1|  hypothetical protein AALP_AA4G201900                    367   1e-119   
gb|EPS66311.1|  hypothetical protein M569_08463                         366   1e-119   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    367   1e-119   
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         367   1e-119   
emb|CDY48765.1|  BnaC04g02180D                                          369   1e-119   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    367   2e-119   
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    366   2e-119   
ref|NP_001053191.2|  Os04g0495000                                       366   2e-119   
gb|EAY94679.1|  hypothetical protein OsI_16458                          366   2e-119   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    366   3e-119   
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262             366   3e-119   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                366   3e-119   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    366   4e-119   
ref|NP_181711.1|  uncharacterized protein                               365   4e-119   
ref|XP_003605795.1|  hypothetical protein MTR_4g039740                  365   5e-119   
dbj|BAD16016.1|  unknown protein                                        363   5e-119   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    365   7e-119   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    365   8e-119   
ref|NP_181712.1|  uncharacterized protein                               365   1e-118   
gb|KHG07966.1|  Imidazolonepropionase                                   365   1e-118   
gb|KHN45084.1|  hypothetical protein glysoja_040000                     364   1e-118   
ref|NP_001239749.1|  uncharacterized protein LOC100804119 precursor     364   2e-118   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     375   2e-118   
ref|NP_001241275.1|  uncharacterized protein LOC100796094 precursor     363   3e-118   
emb|CBI20999.3|  unnamed protein product                                358   4e-118   
ref|XP_002881799.1|  hypothetical protein ARALYDRAFT_483261             362   9e-118   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  362   1e-117   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             360   1e-117   
gb|KEH17090.1|  DUF642 family protein                                   361   2e-117   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    360   9e-117   
emb|CDY06908.1|  BnaA04g24070D                                          359   2e-116   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    359   2e-116   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    358   3e-116   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    358   4e-116   
gb|AFK39561.1|  unknown                                                 357   7e-116   
ref|NP_974254.1|  germination-related protein                           355   7e-116   
ref|XP_004976081.1|  PREDICTED: uncharacterized protein LOC101764801    358   8e-116   
emb|CDY14785.1|  BnaC04g47820D                                          357   1e-115   
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    357   1e-115   
ref|XP_010097437.1|  hypothetical protein L484_003208                   357   2e-115   
ref|XP_008669230.1|  PREDICTED: uncharacterized protein LOC103646278    357   2e-115   
gb|EMS51274.1|  hypothetical protein TRIUR3_06873                       356   3e-115   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    355   6e-115   
ref|XP_004506314.1|  PREDICTED: uncharacterized protein LOC101488216    355   6e-115   
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    355   8e-115   
gb|EEE61252.1|  hypothetical protein OsJ_15312                          363   9e-115   
dbj|BAJ89665.1|  predicted protein                                      351   3e-113   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    350   3e-113   
gb|EMT25742.1|  hypothetical protein F775_05959                         351   4e-113   
gb|EMT25156.1|  hypothetical protein F775_26385                         351   5e-113   
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              350   7e-113   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    349   1e-112   
ref|XP_004978107.1|  PREDICTED: uncharacterized protein LOC101761699    349   1e-112   
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     349   2e-112   
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          349   3e-112   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    348   3e-112   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    348   3e-112   
gb|EMS51275.1|  hypothetical protein TRIUR3_06876                       348   4e-112   
gb|AGV54847.1|  hypothetical protein                                    348   6e-112   
gb|AGV54803.1|  hypothetical protein                                    348   6e-112   
emb|CDP21696.1|  unnamed protein product                                347   7e-112   
ref|XP_003581665.1|  PREDICTED: uncharacterized protein LOC100833550    348   8e-112   
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             347   1e-111   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    346   2e-111   
gb|KDO83473.1|  hypothetical protein CISIN_1g017636mg                   341   2e-110   
ref|NP_001051644.1|  Os03g0807700                                       343   3e-110   
dbj|BAJ94417.1|  predicted protein                                      343   4e-110   
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          343   6e-110   
ref|XP_011085252.1|  PREDICTED: uncharacterized protein LOC105167296    343   6e-110   
gb|EYU43005.1|  hypothetical protein MIMGU_mgv1a011073mg                339   8e-110   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    342   8e-110   
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    342   9e-110   
gb|EYU33356.1|  hypothetical protein MIMGU_mgv1a007799mg                342   1e-109   
ref|XP_011096549.1|  PREDICTED: uncharacterized protein LOC105175704    342   1e-109   
ref|XP_007218161.1|  hypothetical protein PRUPE_ppa007461mg             338   2e-109   
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         342   2e-109   
ref|XP_006411449.1|  hypothetical protein EUTSA_v10017674mg             340   4e-109   
gb|EAY92272.1|  hypothetical protein OsI_13995                          339   6e-109   
ref|NP_180998.1|  uncharacterized protein                               340   6e-109   
ref|XP_003581384.1|  PREDICTED: uncharacterized protein LOC100823957    340   6e-109   
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    340   8e-109   
emb|CDP19178.1|  unnamed protein product                                339   1e-108   
gb|KFK36341.1|  hypothetical protein AALP_AA4G110000                    340   1e-108   
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    339   1e-108   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    339   1e-108   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             339   2e-108   
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             339   3e-108   
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          338   3e-108   
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             338   4e-108   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    338   4e-108   
emb|CDX84311.1|  BnaC04g10730D                                          338   6e-108   
emb|CDY17255.1|  BnaA05g09330D                                          338   7e-108   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    337   9e-108   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    337   9e-108   
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    337   1e-107   
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    336   2e-107   
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    337   2e-107   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             336   2e-107   
ref|XP_002519690.1|  conserved hypothetical protein                     336   3e-107   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    336   3e-107   
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                336   4e-107   
gb|ABK24630.1|  unknown                                                 336   4e-107   
gb|AFK48067.1|  unknown                                                 328   7e-107   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    334   1e-106   
emb|CDM84231.1|  unnamed protein product                                334   1e-106   
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    334   2e-106   
ref|XP_008663355.1|  PREDICTED: uncharacterized protein LOC103641799    334   2e-106   
gb|ACN40837.1|  unknown                                                 334   2e-106   
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  332   3e-106   
gb|AFK48735.1|  unknown                                                 333   3e-106   
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    333   3e-106   
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    333   4e-106   
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    333   6e-106   
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             333   8e-106   
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    332   8e-106   
emb|CBI30867.3|  unnamed protein product                                332   9e-106   
ref|XP_003580050.1|  PREDICTED: uncharacterized protein LOC100841598    331   1e-105   
gb|EMT04284.1|  hypothetical protein F775_14656                         330   2e-105   
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    332   2e-105   
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             332   2e-105   
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    331   2e-105   
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859    330   3e-105   
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859            330   3e-105   
gb|KHN47316.1|  hypothetical protein glysoja_020184                     330   4e-105   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    330   4e-105   
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    331   5e-105   
dbj|BAD93856.1|  hypothetical protein                                   324   6e-105   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    329   7e-105   
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    330   7e-105   
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    330   1e-104   
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    329   1e-104   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             328   2e-104   
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             328   4e-104   
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    328   6e-104   
gb|ACF86181.1|  unknown                                                 328   6e-104   
ref|NP_001044289.1|  Os01g0756600                                       327   9e-104   
ref|XP_010508665.1|  PREDICTED: uncharacterized protein LOC104785...    325   1e-103   
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    327   1e-103   
ref|XP_010056890.1|  PREDICTED: uncharacterized protein LOC104444833    327   1e-103   
ref|XP_006644728.1|  PREDICTED: uncharacterized protein LOC102722258    327   2e-103   
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          326   2e-103   
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    326   2e-103   
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  326   3e-103   
ref|NP_564344.1|  uncharacterized protein                               326   3e-103   
gb|EMS50963.1|  hypothetical protein TRIUR3_30516                       330   4e-103   
ref|XP_002893594.1|  predicted protein                                  325   5e-103   
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             326   5e-103   
emb|CDY26302.1|  BnaA09g26530D                                          326   5e-103   
ref|NP_973938.1|  uncharacterized protein                               324   6e-103   
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    325   8e-103   
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    326   1e-102   
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    324   2e-102   
gb|EMS51358.1|  hypothetical protein TRIUR3_26274                       321   3e-102   
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    323   3e-102   
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    323   3e-102   
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              324   5e-102   
gb|AFK49395.1|  unknown                                                 322   6e-102   
gb|EPS66859.1|  hypothetical protein M569_07917                         321   1e-101   
ref|XP_010665821.1|  PREDICTED: uncharacterized protein LOC104883071    321   2e-101   
gb|KHN32410.1|  hypothetical protein glysoja_026304                     317   5e-101   
ref|XP_010279657.1|  PREDICTED: uncharacterized protein LOC104613510    320   6e-101   
gb|KHG06200.1|  Periplasmic nitrate reductase                           319   8e-101   
gb|EEC71507.1|  hypothetical protein OsI_03789                          324   2e-100   
gb|ACN30906.1|  unknown                                                 318   2e-100   
ref|NP_001143645.1|  hypothetical protein precursor                     318   2e-100   
gb|ACG32132.1|  hypothetical protein                                    318   2e-100   
ref|XP_004134601.1|  PREDICTED: uncharacterized protein LOC101220961    318   4e-100   
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    318   4e-100   
ref|XP_003593942.1|  Glutamate-gated kainate-type ion channel rec...    324   4e-100   
ref|XP_010499517.1|  PREDICTED: uncharacterized protein LOC104777028    318   4e-100   
gb|EMS63053.1|  hypothetical protein TRIUR3_01734                       315   1e-99    
ref|XP_003581666.1|  PREDICTED: uncharacterized protein LOC100833858    317   1e-99    
ref|XP_008439641.1|  PREDICTED: uncharacterized protein LOC103484373    316   1e-99    
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 319   1e-99    
ref|XP_010110985.1|  hypothetical protein L484_021680                   318   2e-99    
gb|KHG28355.1|  putative metabolite transport                           314   1e-98    
gb|KHN33140.1|  La-related protein 7                                    323   6e-98    
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    312   7e-98    
gb|EMT19274.1|  hypothetical protein F775_14136                         309   6e-97    
gb|ABF99456.1|  expressed protein                                       303   6e-96    
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    305   3e-95    
gb|EMS52012.1|  hypothetical protein TRIUR3_31218                       294   6e-92    
emb|CDX99870.1|  BnaC05g22920D                                          292   3e-90    
gb|EEE54731.1|  hypothetical protein OsJ_02078                          293   4e-89    
ref|NP_001043243.2|  Os01g0531400                                       293   6e-89    



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/368 (79%), Positives = 326/368 (89%), Gaps = 1/368 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             I L LLCAT H V S   DG++ NGNFE GPK +QMKGT+VV+ HAIP+WEISGYVEYIK
Sbjct  6     IFLVLLCATIH-VCSSQKDGILPNGNFELGPKPSQMKGTKVVNRHAIPNWEISGYVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQ QGDMLL VP G YAVRLGEDA IKT VK  KG +YSLSF FARTCAQEE+LNVSVS
Sbjct  65    SGQTQGDMLLPVPVGDYAVRLGEDASIKTKVKVTKGVFYSLSFVFARTCAQEEKLNVSVS  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PNSEPNDWGMLP+QTMYSSDGWDSYSW FLAEA  +D+V+HNPA EKDPACGPLID VAL
Sbjct  125   PNSEPNDWGMLPMQTMYSSDGWDSYSWGFLAEANEIDVVIHNPAVEKDPACGPLIDFVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L  P+R +GNMLKNGNFEEGPYIF NTTWGVLIPPN+EDDH PL GW+IESLKAVKYI
Sbjct  185   KALKTPKRPKGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D++HF+VPEG+RAVELVAGRESA+AQVVRTRPGKVYDL FS+GDA+N+CEGSM+VEAFAG
Sbjct  245   DAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNSCEGSMLVEAFAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K+T+Q P++SKGKG   R++ RFTAIS RTRVRFLS++YHMKSDNSGSLCGPV+DDVRLV
Sbjct  305   KITMQFPYESKGKGGVKRSRLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLV  364

Query  289   SVRNPRIP  266
              VRNPR P
Sbjct  365   GVRNPRHP  372



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/368 (79%), Positives = 323/368 (88%), Gaps = 1/368 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             I   LLCAT H + S   DG++ NGNFE GPK +QMKGT+VVD HAIP WEISGYVEYIK
Sbjct  6     IFFVLLCATTH-IGSSQKDGILPNGNFELGPKASQMKGTKVVDRHAIPDWEISGYVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQ QGDMLL VP G YAVRLGEDA IKT VK  KG +YSLSF FARTCAQEE+LNVSVS
Sbjct  65    SGQTQGDMLLPVPVGDYAVRLGEDASIKTKVKVTKGVFYSLSFVFARTCAQEEKLNVSVS  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PNSEPNDWGMLP+QTMYSSDGWDSYSW FLAEA  +D+V+HNP  EKDPACGPLID VAL
Sbjct  125   PNSEPNDWGMLPMQTMYSSDGWDSYSWGFLAEANEIDVVIHNPVVEKDPACGPLIDFVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L  P+R +GNMLKNGNFEEGPYIF NTTWGVLIPPN+EDDH PL GW+IESLKAVKYI
Sbjct  185   KALKTPKRPKGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D++HF+VPEG+RAVELVAGRESA+AQVVRTRPGKVYDL FS+GDA+N+CEGSM+VEAFAG
Sbjct  245   DAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNSCEGSMLVEAFAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K+T+Q P++SKGKG   RA+ RFTAIS RTRVRFLS++YHMKSDNSGSLCGPV+DDVRLV
Sbjct  305   KITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLV  364

Query  289   SVRNPRIP  266
              VRNPR P
Sbjct  365   GVRNPRHP  372



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/368 (79%), Positives = 327/368 (89%), Gaps = 2/368 (1%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             ILL LL AT  +  S   DGL++NGNFE GPK +QMKGT+VVD HAIP+WEISGYVEYIK
Sbjct  7     ILLVLLFAT--VANSSQKDGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWEISGYVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQ QGDMLL VP+G YAVRLGEDA IKT VK  KG +YS+SF FARTCAQEE+LNVSVS
Sbjct  65    SGQTQGDMLLPVPQGDYAVRLGEDASIKTKVKVTKGIFYSISFVFARTCAQEEKLNVSVS  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PNSEPNDWGMLPLQTMYSS+GWDSYSW FLAEA+ +DIV+HNPA EKDPACGPLID VAL
Sbjct  125   PNSEPNDWGMLPLQTMYSSEGWDSYSWGFLAEADEIDIVIHNPAVEKDPACGPLIDFVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L  P+R RGNMLKNGNFEEGPYIF NTTWGVLIPPN+EDDH PL GW+IESLKAVKYI
Sbjct  185   KALKTPKRPRGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DS+HF VP+G+RAVELVAGRESA+AQVVRTRPGK+YDL FS+GDA+N+CEGSM+VEAFAG
Sbjct  245   DSEHFHVPQGKRAVELVAGRESAIAQVVRTRPGKIYDLLFSIGDASNSCEGSMLVEAFAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K+T+Q P++SKGKG   RA+ RFTAIS RTRVRFLS++YHMKSDNSGSLCGPV+DDVRLV
Sbjct  305   KITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLV  364

Query  289   SVRNPRIP  266
              +RNP +P
Sbjct  365   GLRNPHLP  372



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/368 (79%), Positives = 326/368 (89%), Gaps = 2/368 (1%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             ILL LL AT  +  S   DGL++NGNFE GPK +QMKGT+VVD HAIP+WEISGYVEYIK
Sbjct  6     ILLVLLFAT--VANSSQKDGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWEISGYVEYIK  63

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQ QGDMLL VP+G YAVRLGEDA IKT VK  KG +YS+SF FARTCAQEE+LNVSVS
Sbjct  64    SGQTQGDMLLPVPQGDYAVRLGEDASIKTKVKLTKGVFYSISFVFARTCAQEEKLNVSVS  123

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PNSEPNDWG+LPLQTMYSS+GWDSYSW FLAEA+ +DIV+HNPA EKDPACGPLID VAL
Sbjct  124   PNSEPNDWGILPLQTMYSSEGWDSYSWGFLAEADEIDIVIHNPAVEKDPACGPLIDFVAL  183

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L  P+R RGNMLKNGNFE GPYIF NTTWGVLIPPN+EDDH PL GW+IESLKAVKYI
Sbjct  184   KALKTPKRPRGNMLKNGNFEVGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYI  243

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DS+HF VPEG+RAVELVAGRESALAQVVRTRPGK+YDL FS+GDA+N+CEGSM+VEAFAG
Sbjct  244   DSEHFHVPEGKRAVELVAGRESALAQVVRTRPGKIYDLLFSIGDASNSCEGSMLVEAFAG  303

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K+T+Q P++SKGKG   RA+ RFTAIS RTRVRFLS++YHMKSDNSGSLCGPV+DDVRLV
Sbjct  304   KITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLV  363

Query  289   SVRNPRIP  266
              VRNP +P
Sbjct  364   GVRNPHLP  371



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/368 (79%), Positives = 322/368 (88%), Gaps = 2/368 (1%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             +L LLCAT  +  S   DGL+ NGNFEQGPK +QMK TRV+DPHAIPHWE+SGYVEYIKS
Sbjct  13    VLVLLCATLQVCSSLI-DGLLPNGNFEQGPKPSQMKHTRVMDPHAIPHWELSGYVEYIKS  71

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKT-TVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             GQ QGDMLL VP+G +AVRLGEDA +KT  V   KGT+Y+LSF FARTCAQEERLNVSV+
Sbjct  72    GQMQGDMLLPVPQGDFAVRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQEERLNVSVT  131

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P+ EP DWGMLPLQTMYSSDGWD+YSW FLAEA  V+IVLHNPA EKDPACGPLID VAL
Sbjct  132   PSKEPKDWGMLPLQTMYSSDGWDTYSWGFLAEANVVEIVLHNPAREKDPACGPLIDFVAL  191

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L  P R +GNMLKNGNFEEGPYIF NT WG+LIPPN+EDDHCPLPGWIIESLKAVKYI
Sbjct  192   KALKTPHRPKGNMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCPLPGWIIESLKAVKYI  251

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D++HF+VPEG+RAVELVAGRESALAQ V T+ GK+YDL F+VGDANN+CEGSM++EAFAG
Sbjct  252   DTEHFAVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNSCEGSMLIEAFAG  311

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K+ LQVP+ SKGKG   RAK RFTAIS RTRVRFLS+ YHMK+DNSGSLCGPVIDDVRLV
Sbjct  312   KVALQVPYMSKGKGGFKRAKFRFTAISRRTRVRFLSTNYHMKTDNSGSLCGPVIDDVRLV  371

Query  289   SVRNPRIP  266
             SVRNPRIP
Sbjct  372   SVRNPRIP  379



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/371 (78%), Positives = 323/371 (87%), Gaps = 3/371 (1%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +I+L +LCAT  +  S   DGL+ NGNFEQGPK +QMK TRV+DPHAIPHWE+SGYVEYI
Sbjct  11    VIVLVILCATLQIGSSLI-DGLLPNGNFEQGPKSSQMKNTRVIDPHAIPHWELSGYVEYI  69

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAV-KGTYYSLSFTFARTCAQEERLNVS  1016
             KSGQ QGDMLL VP+G YAVRLGE A +KT V +V KGT+YSLSF FARTCAQEERLNVS
Sbjct  70    KSGQMQGDMLLPVPQGDYAVRLGEGASLKTKVTSVTKGTFYSLSFVFARTCAQEERLNVS  129

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAA-EKDPACGPLIDS  839
             VSPNSEP DWGMLPLQTMYSSDGWD+YSW FLAEA  +DIVLHNP A EKDPACGPLID 
Sbjct  130   VSPNSEPKDWGMLPLQTMYSSDGWDTYSWGFLAEANEIDIVLHNPIAHEKDPACGPLIDF  189

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VALK+L    R + NMLKNGNFEEGPYIF NT+WGVLIPPN+EDDHCPLPGWI+ESLKAV
Sbjct  190   VALKALKTTHRPKDNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHCPLPGWIVESLKAV  249

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KY+D+DHF+VPEG+RA+ELVAGRESA+AQ V T+ G++YDL FSVGDANNACEGSMVVEA
Sbjct  250   KYVDADHFTVPEGKRAIELVAGRESAIAQQVITKTGRIYDLIFSVGDANNACEGSMVVEA  309

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAG + LQ  + SKGKG   RAK RFTA+S RTRVRFLSS+YHMKSDNSGSLCGPVIDDV
Sbjct  310   FAGNVALQFQYVSKGKGGFKRAKLRFTAMSQRTRVRFLSSYYHMKSDNSGSLCGPVIDDV  369

Query  298   RLVSVRNPRIP  266
             RLVSVRNPRIP
Sbjct  370   RLVSVRNPRIP  380



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/366 (77%), Positives = 323/366 (88%), Gaps = 2/366 (1%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             IL+ LLCAT  +V+S   DGL+ NGNFEQGPK +Q+KGTRV +PHAIPHWEISGYVEYIK
Sbjct  8     ILIVLLCATISVVLSVN-DGLLPNGNFEQGPKPSQLKGTRVTNPHAIPHWEISGYVEYIK  66

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKA-VKGTYYSLSFTFARTCAQEERLNVSV  1013
             SGQ QGDMLL VPEG +AVRLGEDA IKT +    KGT+YSLSF FARTCAQEE+LNVSV
Sbjct  67    SGQTQGDMLLPVPEGAFAVRLGEDASIKTRITNFTKGTFYSLSFNFARTCAQEEKLNVSV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             SPNSEPNDWGMLP+QTMYSSDGWDSYSW FLAEA  +DI+LHNPA EKDPACGPLID +A
Sbjct  127   SPNSEPNDWGMLPMQTMYSSDGWDSYSWGFLAEANEIDIMLHNPAIEKDPACGPLIDFIA  186

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             LK+L  P R +GNMLKNGNFEEGPYIF NT+WGVLIPPN+EDDH PLPGW+IESLKAVKY
Sbjct  187   LKALKNPHRPKGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKY  246

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             ID+ HF+VPEG+RA+ELVAGRESA+AQVV T  GKVYDL FSVGDA+N+C+GSM++EAFA
Sbjct  247   IDAAHFTVPEGKRAIELVAGRESAIAQVVITTKGKVYDLMFSVGDASNSCQGSMLIEAFA  306

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G++TL+VP++SKG G   RAK RF A+S RTRVRFLS++YHMKSD+SGSLCGPV+DDVRL
Sbjct  307   GQITLRVPYESKGSGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSGSLCGPVVDDVRL  366

Query  292   VSVRNP  275
             V VR+P
Sbjct  367   VGVRHP  372



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/368 (75%), Positives = 327/368 (89%), Gaps = 2/368 (1%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             GI+ + LL AT ++ +S   DGL+ NGNFEQGPK +QMKGT+V DPHAIPHWEISGYVEY
Sbjct  7     GILNIVLLFATINVALSVQ-DGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWEISGYVEY  65

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAV-KGTYYSLSFTFARTCAQEERLNV  1019
             I+SGQ QGDMLL VPEG +AVRLGEDA IKT V  V  G++YSLSF FARTCAQEE+LNV
Sbjct  66    IRSGQTQGDMLLPVPEGAFAVRLGEDASIKTRVTNVTSGSFYSLSFNFARTCAQEEKLNV  125

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SVSPN+EPNDWGMLP+QTMYSSDGWDSYSW FLA+A  ++I LHNPA EKDPACGPLID 
Sbjct  126   SVSPNTEPNDWGMLPMQTMYSSDGWDSYSWGFLAQANEIEITLHNPAVEKDPACGPLIDF  185

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             +ALK+L  P R+RGNMLKNGNFEEGPYIF NT+WGVLIPPN+EDDH PLPGW+IESLKAV
Sbjct  186   IALKALKNPHRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAV  245

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYID++HF+VPEG+RA+ELVAGRESA+AQ+VRT+ GKVYDL FSVGDA+N+C+GSM++EA
Sbjct  246   KYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNSCQGSMLIEA  305

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAGK+TL+VP++S GKG   RAK RFTA++ RTRVRFLS++YHMK+D+SGSLCGPV+DD+
Sbjct  306   FAGKITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKNDHSGSLCGPVVDDM  365

Query  298   RLVSVRNP  275
             RLV VR+P
Sbjct  366   RLVGVRHP  373



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/371 (77%), Positives = 320/371 (86%), Gaps = 3/371 (1%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +++L +LCA+  +  S   DGL+ NGNFEQGPK +QMK TRV+DPH IPHWE+SGYVEYI
Sbjct  11    VLVLMILCASLQIGSSLI-DGLLPNGNFEQGPKPSQMKKTRVIDPHGIPHWELSGYVEYI  69

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAV-KGTYYSLSFTFARTCAQEERLNVS  1016
             KSGQ QGDMLL VP+G YAVRLGEDA +KT V  V K T+YSLSF FARTCAQEERLNVS
Sbjct  70    KSGQMQGDMLLPVPQGDYAVRLGEDASLKTKVINVTKETFYSLSFVFARTCAQEERLNVS  129

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAA-EKDPACGPLIDS  839
             VSPNSEP DWGMLPLQTMYSSDGWD+YSW FLAEA  +DIVLHNP A EKDPACGPLID 
Sbjct  130   VSPNSEPKDWGMLPLQTMYSSDGWDTYSWGFLAEANEIDIVLHNPIAHEKDPACGPLIDF  189

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VALK+L    R + NMLKNGNFEEGPYIF NTTWGVLIPPN+EDDHCPLPGWI+ESLKAV
Sbjct  190   VALKALKTTHRPKDNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHCPLPGWIVESLKAV  249

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KY+D+DHF+VPEG+RA+ELVAGRESA+AQ V T+ G++YDL FSVGDANN+CEGSMVVEA
Sbjct  250   KYVDADHFTVPEGKRAIELVAGRESAIAQQVITKAGRIYDLTFSVGDANNSCEGSMVVEA  309

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAG + LQ  + SKGKG   RAK RFTA S RTRVRFLSS+YHMKSDNSGSLCGPV+DDV
Sbjct  310   FAGNVALQFKYVSKGKGGFKRAKLRFTATSQRTRVRFLSSYYHMKSDNSGSLCGPVVDDV  369

Query  298   RLVSVRNPRIP  266
             RLVSVRNPRIP
Sbjct  370   RLVSVRNPRIP  380



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/369 (77%), Positives = 319/369 (86%), Gaps = 2/369 (1%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             ILL LLCAT  +  S   DGL+ NGNFEQGPK +QMK T V++PHAIPHWE+SGYVEYIK
Sbjct  12    ILLVLLCATLQVGSSLI-DGLLPNGNFEQGPKPSQMKHTIVINPHAIPHWELSGYVEYIK  70

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKT-TVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             SGQ QGDMLL VP+G +AVRLGEDA +KT  V   KGT+Y+LSF FARTCAQEERLNVSV
Sbjct  71    SGQMQGDMLLPVPQGDFAVRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQEERLNVSV  130

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P+ EP DWGMLPLQTMYSSDGWD+YSW F AEA  ++IVLHNPA EKDPACGPLID VA
Sbjct  131   TPSKEPKDWGMLPLQTMYSSDGWDTYSWGFFAEANVIEIVLHNPAREKDPACGPLIDFVA  190

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             LK+L  P R +GNMLKNGNFEEGPYIF NT WG+LIPPN+EDDHCPLPGWIIESLKAVKY
Sbjct  191   LKALKTPHRPKGNMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCPLPGWIIESLKAVKY  250

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +D++HF+VPEG+RAVELVAGRESALAQ V T+ GK+YDL F+VGDANN+CEGSM++EAFA
Sbjct  251   VDAEHFTVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNSCEGSMLIEAFA  310

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK+ LQV + SKGKG   RAK RFTAIS RT VRFLS+ YHMKSDNSGSLCGPVIDDVRL
Sbjct  311   GKVALQVRYMSKGKGGFKRAKLRFTAISRRTGVRFLSTNYHMKSDNSGSLCGPVIDDVRL  370

Query  292   VSVRNPRIP  266
             VSVRNPRIP
Sbjct  371   VSVRNPRIP  379



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/366 (76%), Positives = 324/366 (89%), Gaps = 2/366 (1%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             IL+ LLCAT ++V+S   DGL+ NGNFEQGPK +Q+KGT+V +PHAIPHWEISGYVEYIK
Sbjct  8     ILIVLLCATINVVLSVD-DGLLPNGNFEQGPKPSQLKGTKVTEPHAIPHWEISGYVEYIK  66

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAV-KGTYYSLSFTFARTCAQEERLNVSV  1013
             SGQ QGDMLL VPEG +AVRLGEDA IKT +  V KGT+YSLSF FARTCAQEE+LNVSV
Sbjct  67    SGQTQGDMLLPVPEGAFAVRLGEDASIKTRITNVTKGTFYSLSFNFARTCAQEEKLNVSV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             SPN+EPNDWGMLP+QTMYSSDGWDSYSW FLA+A  +DI+LHNPA EKDPACGPLID +A
Sbjct  127   SPNNEPNDWGMLPMQTMYSSDGWDSYSWGFLAQATEIDIMLHNPAVEKDPACGPLIDYIA  186

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             LK+L  P R +GNMLKNGNFEEGPYIF NT+WGVLIPPN+EDDH PLPGW+IESLKAVKY
Sbjct  187   LKALKNPHRPKGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKY  246

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             ID+ HF+VPEG+RA+ELVAGRESA+AQ V T  GKVYDL FSVGDA+N+C+GSM++EAFA
Sbjct  247   IDAAHFAVPEGKRAIELVAGRESAIAQQVITTKGKVYDLMFSVGDASNSCQGSMLIEAFA  306

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G++TL+VP++SKG G   RAK RF A+S RTRVRFLS++YHMKSD+SGSLCGPV+DDVRL
Sbjct  307   GQITLRVPYESKGNGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSGSLCGPVVDDVRL  366

Query  292   VSVRNP  275
             V VR+P
Sbjct  367   VGVRHP  372



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/368 (75%), Positives = 325/368 (88%), Gaps = 2/368 (1%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             G++ + LL AT ++ +S   DGL+ NGNFEQGPK +QMKGT+V DPHAIPHWEISGYVEY
Sbjct  2     GLLNIVLLFATINVALSVQ-DGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWEISGYVEY  60

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAV-KGTYYSLSFTFARTCAQEERLNV  1019
             IK+GQ QGDMLL VPEG +AVRLGEDA+IKT V  V  GT+YSLSF FARTCAQEE+LNV
Sbjct  61    IKAGQTQGDMLLPVPEGAFAVRLGEDAYIKTRVTNVTNGTFYSLSFNFARTCAQEEKLNV  120

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SVSPN+EPNDW MLP+QTMYSSDGWDSYSW FLA+A  ++I+LHNPA EKDPACGPLID 
Sbjct  121   SVSPNNEPNDWAMLPMQTMYSSDGWDSYSWGFLAQANEIEIMLHNPAVEKDPACGPLIDF  180

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             +ALK+L  P R +GNMLKNGNFEEGPYIF NT+WGVLIPPN+EDDH PLPGW+IESLKAV
Sbjct  181   IALKALKTPHRPKGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAV  240

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYID++HF+VPEG+RA+ELVAGRESA+AQ+VRT+ GKVYDL FSVGDA+N+C+GSM++EA
Sbjct  241   KYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNSCQGSMLIEA  300

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAG +TL+VP++S GKG   RAK RFTA++ RTRVRFLS++YHMKSD+SGSLCGPV+DDV
Sbjct  301   FAGNITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKSDHSGSLCGPVVDDV  360

Query  298   RLVSVRNP  275
             RLV VR P
Sbjct  361   RLVGVRYP  368



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/368 (74%), Positives = 315/368 (86%), Gaps = 4/368 (1%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +++ LLCATFH+  S   DG + NGNFE GPK +QMKGT+V+DPH+IPHWE SG+VEYIK
Sbjct  4     LIVVLLCATFHIAFSLI-DGQLPNGNFEFGPKPSQMKGTKVMDPHSIPHWETSGFVEYIK  62

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VPEG  AVRLG++A IKT VK   G +YS+SF+ ARTCAQEE+LNVSVS
Sbjct  63    SGQKQGDMLLVVPEGASAVRLGDEASIKTKVKVKNGLFYSVSFSAARTCAQEEKLNVSVS  122

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PNSE  DWG+LP+QT+YSSDGWDSY W FLA++  ++IV+HNP  EKD ACGPLIDSVAL
Sbjct  123   PNSESMDWGILPMQTVYSSDGWDSYCWGFLAQSNEIEIVIHNPGVEKDKACGPLIDSVAL  182

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L  P+R+RGNMLKNGNFEEGPYIF NT+WGVLIPPN+EDDH PLPGW+IESLKAVKYI
Sbjct  183   KALYTPKRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYI  242

Query  649   DSDHFSVPEGRRAVELVA---GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             DSDHF VPEG+RAVELVA   GRE ALAQ VRT PGK YDL FS+GDA N+CEGSM+VEA
Sbjct  243   DSDHFGVPEGKRAVELVAVGKGRERALAQTVRTVPGKTYDLIFSIGDAKNSCEGSMMVEA  302

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
              AGK+ LQVP++SKG G   RAK RF AIS+RTR+RFLS++YHMKSDNSGSLCGPVIDDV
Sbjct  303   TAGKVILQVPYESKGAGGFKRAKLRFKAISTRTRIRFLSTYYHMKSDNSGSLCGPVIDDV  362

Query  298   RLVSVRNP  275
             +LV VR P
Sbjct  363   KLVGVRRP  370



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/364 (73%), Positives = 313/364 (86%), Gaps = 1/364 (0%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             LL +L +TF + +  T DGL+ NGNFE GPK +QMKGT+V+DPHAIP WEISG+VEYI S
Sbjct  36    LLLVLFSTFTIALCLT-DGLLPNGNFEYGPKPSQMKGTKVIDPHAIPSWEISGFVEYITS  94

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             G KQGDMLL+VPEG  AVRLG++A IKT VK   G +YSLSF+ ARTCAQEE+LNVSV P
Sbjct  95    GHKQGDMLLVVPEGASAVRLGDEASIKTKVKVTNGMFYSLSFSAARTCAQEEKLNVSVLP  154

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             N E  DWG+LP+QT+YSSDGWDSYSW FLA++  ++I++HNP  EKDPACGPLIDS+ALK
Sbjct  155   NKESKDWGILPIQTVYSSDGWDSYSWGFLAQSNDIEIMIHNPGKEKDPACGPLIDSIALK  214

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L  P+R+RGN+LKNGNFEEGPYIF NT++G+LIPPN+EDDH PLPGW+IESLKAVKY+D
Sbjct  215   ALPNPKRQRGNILKNGNFEEGPYIFPNTSYGILIPPNIEDDHSPLPGWMIESLKAVKYVD  274

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
             S+HF+VPEG+RAVELVAGRESALAQ VRT PGK Y+L FS+GDA N+CEGSM VEA AG+
Sbjct  275   SNHFAVPEGKRAVELVAGRESALAQTVRTVPGKTYNLIFSIGDAKNSCEGSMTVEANAGR  334

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
               LQVP++SKG G   RAK RF A+SSRTRVRFLS+FYH+KSDNSGSLCGP+IDDVRLVS
Sbjct  335   DILQVPYESKGNGGFKRAKLRFKAVSSRTRVRFLSTFYHIKSDNSGSLCGPIIDDVRLVS  394

Query  286   VRNP  275
             +R P
Sbjct  395   IRYP  398



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/366 (72%), Positives = 310/366 (85%), Gaps = 1/366 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LLALLC+TFH+  S T DGL+ NGNFE GPK  Q+KGT V   +AIP+WEISGYVEYIK
Sbjct  11    VLLALLCSTFHVAFSVT-DGLLPNGNFEYGPKPWQLKGTVVTAKNAIPNWEISGYVEYIK  69

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VP G +AVRLG +A IK  +   KG+YYS++F  ARTCAQEE+LNVSVS
Sbjct  70    SGQKQGDMLLVVPSGAFAVRLGNEASIKQKISVAKGSYYSITFNVARTCAQEEKLNVSVS  129

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PN E NDWG+LP+QTMYSS+GWDSY+WAF A+   ++I +HNP +E+DPACGPL+DSVAL
Sbjct  130   PNIEQNDWGILPMQTMYSSNGWDSYAWAFQADYPDIEISIHNPGSEEDPACGPLVDSVAL  189

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L+ P+R RGN+LKNGNFEEGPY+F NT WGVLIPP++EDDH PLPGWIIESLKAVKYI
Sbjct  190   KLLSNPKRTRGNLLKNGNFEEGPYVFPNTDWGVLIPPHIEDDHSPLPGWIIESLKAVKYI  249

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D DHF+VPEG+RA+ELVAG+ESALAQVV+T PGK Y L FSVGDANNACEGSM+VEA+AG
Sbjct  250   DLDHFAVPEGKRAIELVAGKESALAQVVKTIPGKTYVLTFSVGDANNACEGSMIVEAYAG  309

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K  +Q P+ SKGKG    AK +F A+S+ TR+ FLSSFY MKSDNSGSLCGPV+DDV+L+
Sbjct  310   KDKIQFPYVSKGKGGFKTAKLQFKAVSTHTRIMFLSSFYTMKSDNSGSLCGPVLDDVKLI  369

Query  289   SVRNPR  272
             SVR PR
Sbjct  370   SVRQPR  375



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/361 (73%), Positives = 305/361 (84%), Gaps = 1/361 (0%)
 Frame = -3

Query  1351  CATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQG  1172
             CAT H  +SFT +GL+ NGNFE GPK  +MKGT+V+   AIP WEISGYVEYIKSGQKQG
Sbjct  13    CATCHTAVSFT-NGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEISGYVEYIKSGQKQG  71

Query  1171  DMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPN  992
             DMLL+VPEG YAVRLG +A IK  VK VKG YYS++F+ ARTCAQEE LNVSV+PNSE N
Sbjct  72    DMLLIVPEGAYAVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAPNSEAN  131

Query  991   DWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPP  812
             DWGMLP+QTMYSS+GWDSY+W F A+ + + I +HNP   +DPACGPLIDSVALK+L PP
Sbjct  132   DWGMLPMQTMYSSNGWDSYAWGFQADDKEIAISIHNPGVAEDPACGPLIDSVALKALYPP  191

Query  811   RRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFS  632
             RR R N+LKNGNFEEGPY+F   +WGVLIPPN+EDDH PLPGW+IESLKAVKYIDSDHF+
Sbjct  192   RRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDHFA  251

Query  631   VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQV  452
             VPEG+R VELVAG+ESAL+QVV T P +VY L FSVGDANN+CEGSMVVEAFAG  T++V
Sbjct  252   VPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNSCEGSMVVEAFAGLDTVKV  311

Query  451   PFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             P++SKGKG   RAK RF AIS RTRV FLS++Y MK+DNSGSLCGPV+DDV+L+SVR  R
Sbjct  312   PYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSGSLCGPVLDDVKLLSVRKAR  371

Query  271   I  269
             +
Sbjct  372   V  372



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/366 (71%), Positives = 304/366 (83%), Gaps = 1/366 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             IL+ LL  +F + + FT DGL+ NGNFE GPK +Q+KGT+V DPH+IP WE+SGYVEYIK
Sbjct  6     ILVVLLFGSFSIALCFTTDGLLPNGNFEFGPKPSQLKGTKVTDPHSIPDWEVSGYVEYIK  65

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTT-VKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             SGQKQGDM+L+VP+G  AVRLG++A IKT  VK + G +YS+SF  ARTCAQEE+LNVS 
Sbjct  66    SGQKQGDMILVVPQGAAAVRLGDEASIKTKRVKVINGMFYSVSFGAARTCAQEEKLNVSF  125

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +PN E  DWG+LP+QT+YSSDGWD YSW FLA+++ + I  HNP  EKDPACGPLID+VA
Sbjct  126   APNKEEKDWGVLPIQTVYSSDGWDCYSWGFLAQSDEIVITFHNPGVEKDPACGPLIDNVA  185

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             LK L  P R+RGNMLKNGNFEEGPYIF NTT+G LIPPN+EDDH PLPGWIIESLKAVKY
Sbjct  186   LKVLRAPIRQRGNMLKNGNFEEGPYIFPNTTYGCLIPPNIEDDHSPLPGWIIESLKAVKY  245

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +DSDH+ VPEG+RAVELVAGRESALAQ+V+T PGK YDLYF +GDA N+CEG M VEA A
Sbjct  246   VDSDHYGVPEGKRAVELVAGRESALAQIVKTVPGKTYDLYFLLGDAKNSCEGMMTVEAAA  305

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK +LQ  ++SKG G   R+K RF A+S RTRVRFLS  YHMKSDN+GSLCGPVIDDVRL
Sbjct  306   GKNSLQFHYESKGAGGFQRSKLRFKAVSVRTRVRFLSMLYHMKSDNTGSLCGPVIDDVRL  365

Query  292   VSVRNP  275
             V VRNP
Sbjct  366   VGVRNP  371



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 312/368 (85%), Gaps = 1/368 (0%)
 Frame = -3

Query  1369  ILLALLCA-TFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +LL LLCA  FH+ +SF  DGL+ NGNFE GPK +++KGT V +P+AIP+WEISG+VEYI
Sbjct  7     VLLVLLCAANFHVTLSFVTDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEISGFVEYI  66

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSGQKQGDMLLLVPEG +AVRLG++A IK  +K  KG +YS++FT  RTC QEE+LNVSV
Sbjct  67    KSGQKQGDMLLLVPEGGFAVRLGKEALIKQKLKLTKGGFYSVTFTAGRTCGQEEKLNVSV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +PN E  DWG++P+QTMYSS+GWDSY+W F A+++ V++V+HNP  E+DPACGPLIDSVA
Sbjct  127   NPNVEEKDWGIMPIQTMYSSNGWDSYAWGFNADSDEVELVIHNPGGEEDPACGPLIDSVA  186

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             LK L PP+R R N+LKNGNFEEGPY+  NT+WGVLIPP++EDDH PLPGWIIESLKAVKY
Sbjct  187   LKLLEPPKRTRANLLKNGNFEEGPYVLPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKY  246

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDS HF VPEGR+A+ELV G+ESALAQVV T+PGK+Y L FSVGD+NNACEGS++VEAFA
Sbjct  247   IDSQHFFVPEGRKAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSLIVEAFA  306

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK TL+VP+QSKGKG   RA+  FTA+  RTR+ F S+FY M +D+SGSLCGP+IDDV+L
Sbjct  307   GKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGSLCGPIIDDVKL  366

Query  292   VSVRNPRI  269
             +SVR  R+
Sbjct  367   LSVRKVRV  374



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/366 (71%), Positives = 304/366 (83%), Gaps = 1/366 (0%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             IILL L  A FH+  S+T DGL+ NGNFE GPKR++MKGTRV++  +IP WE +G+VEYI
Sbjct  3     IILLLLSSAIFHIASSWT-DGLLPNGNFENGPKRSEMKGTRVINSRSIPFWETTGFVEYI  61

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KS QKQGDM L+VPEG  AVRLG+ A +KT VK   G +YS+SF+ +RTCAQEE+LN+S 
Sbjct  62    KSTQKQGDMQLVVPEGNSAVRLGDGAAVKTKVKVTNGKFYSVSFSASRTCAQEEKLNISA  121

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             SPNSEP DWGMLP+QT+YSSDGWDSY W FLA+++ ++I +HNP  EKDPACGPLIDSVA
Sbjct  122   SPNSEPKDWGMLPIQTVYSSDGWDSYCWGFLAQSDEIEIAIHNPGVEKDPACGPLIDSVA  181

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             LK+L+ PRR RGNMLKNGNFE GPYIF NT WGVLIPPN+EDDH PLPGW+IESLKAVKY
Sbjct  182   LKALHTPRRPRGNMLKNGNFEAGPYIFPNTKWGVLIPPNIEDDHSPLPGWMIESLKAVKY  241

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDSD+F VPEG+RAVELV GRES +AQVVRT P KVYDL FSVGD+NN CEGSM+V A+A
Sbjct  242   IDSDNFRVPEGKRAVELVGGRESVVAQVVRTEPEKVYDLVFSVGDSNNKCEGSMMVVAYA  301

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G   LQVP++SKG G    A+ RF A S+RTR+RF S +YHMKSDNSGSLCGPV+DDVRL
Sbjct  302   GVDILQVPYESKGHGGFKSARMRFKATSTRTRIRFSSEYYHMKSDNSGSLCGPVVDDVRL  361

Query  292   VSVRNP  275
             V +R P
Sbjct  362   VRIRYP  367



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/361 (73%), Positives = 304/361 (84%), Gaps = 1/361 (0%)
 Frame = -3

Query  1351  CATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQG  1172
             CAT H  +SFT +GL+ NGNFE GPK  +MKGT+V+   AIP WEISGYVEYIKSGQKQG
Sbjct  13    CATCHTAVSFT-NGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEISGYVEYIKSGQKQG  71

Query  1171  DMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPN  992
             DMLL+VPEG YAVRLG +A IK  VK VKG YYS++F+ ARTCAQEE LNVSV+PNSE N
Sbjct  72    DMLLIVPEGAYAVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAPNSEAN  131

Query  991   DWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPP  812
             DWGMLP+QTMYSS+GWDSY+W F A+ + + I +HNP   +DPACGPLIDSVALK+L PP
Sbjct  132   DWGMLPMQTMYSSNGWDSYAWGFQADDKEIAISIHNPGVAEDPACGPLIDSVALKALYPP  191

Query  811   RRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFS  632
             RR R N+LKNGNFEEGPY+F   +WGVLIPPN+EDDH PLPGW+IESLKAVKYIDSDHF+
Sbjct  192   RRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDHFA  251

Query  631   VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQV  452
             VPEG+R VELVAG+ESAL+QVV T P +VY L FSVGDANN+CEGSMVVEAFAG  T++V
Sbjct  252   VPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNSCEGSMVVEAFAGLDTVKV  311

Query  451   PFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             P++SKGKG   RAK RF AIS RTRV FLS++Y MK+DNSGSLCGPV+DDV+L+SVR  R
Sbjct  312   PYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSGSLCGPVLDDVKLLSVRKAR  371

Query  271   I  269
              
Sbjct  372   F  372



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/363 (72%), Positives = 306/363 (84%), Gaps = 1/363 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL L+CAT  +  S   DGL+ NGNFE GPK ++MKGT+VV P AIP+WEISG VEYIK
Sbjct  6     LLLLLICATCRIASSIK-DGLLPNGNFEYGPKPSEMKGTKVVSPKAIPNWEISGVVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VPEG +AVRLG DA IK T+K +KG +YSL+F+ ARTCAQEERLNVSVS
Sbjct  65    SGQKQGDMLLIVPEGAFAVRLGNDALIKQTMKVIKGMFYSLTFSAARTCAQEERLNVSVS  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PN E ND+G+ P+QTMYSS+GWDSY+WAF A+   ++I +HNP  E+D ACGPLIDSVAL
Sbjct  125   PNYEKNDYGLFPIQTMYSSNGWDSYAWAFQADEPLIEISIHNPGVEEDAACGPLIDSVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L PP+R   N+LKNGNFEEGPYIF NT+WGVLIPP++EDDH PLPGWIIESLKAVKYI
Sbjct  185   KTLYPPKRTPANLLKNGNFEEGPYIFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DS+HFSVPEG+RA+ELVAG+ESALAQVV+T  G+ Y L F+VGDANNACEGSMVVEAFAG
Sbjct  245   DSEHFSVPEGKRAIELVAGKESALAQVVKTTIGRSYVLSFTVGDANNACEGSMVVEAFAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K T++  +QSKGKG   RA   F A SSRTR+ F S+FY MKSDNSGSLCGPV+DDV+L+
Sbjct  305   KNTVKASYQSKGKGGFKRAILAFKAESSRTRIMFYSTFYTMKSDNSGSLCGPVLDDVKLL  364

Query  289   SVR  281
             SVR
Sbjct  365   SVR  367



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 309/368 (84%), Gaps = 1/368 (0%)
 Frame = -3

Query  1369  ILLALLCA-TFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +LL LLCA  FH+ +SF  DGL+ NGNFE GPK +++KGT V +P+AIP+WEISG+VEYI
Sbjct  7     VLLVLLCAANFHVTLSFVTDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEISGFVEYI  66

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSG+KQGDMLL+VP G +AVRLG++A IK  +K  KG +YS++FT  RTC QEE+LNVSV
Sbjct  67    KSGKKQGDMLLVVPAGGFAVRLGKEALIKQKLKLTKGGFYSITFTGGRTCGQEEKLNVSV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +PN E NDWG++P+QTMYS +GWDSY+W F A+ + V++V+HNP  E+DPACGPLIDSVA
Sbjct  127   NPNVEKNDWGIIPIQTMYSCNGWDSYAWGFNADFDEVELVIHNPGGEEDPACGPLIDSVA  186

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             LK L PP+R R N+LKNGNFEEGPY+  N +WGVLIPP++EDDH PLPGWIIESLKAVKY
Sbjct  187   LKLLEPPKRTRANLLKNGNFEEGPYVLPNASWGVLIPPHIEDDHSPLPGWIIESLKAVKY  246

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDS HF VPEGRRA+ELV G+ESALAQVV T+PGK+Y L FSVGD+NNACEGS++VEAFA
Sbjct  247   IDSKHFFVPEGRRAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSLIVEAFA  306

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK TL+VP+QSKGKG   RA+  FTA+  RTR+ F S+FY M +D+SGSLCGP+IDDV+L
Sbjct  307   GKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGSLCGPIIDDVKL  366

Query  292   VSVRNPRI  269
             +SVR  R+
Sbjct  367   LSVRKVRV  374



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/366 (70%), Positives = 307/366 (84%), Gaps = 6/366 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +L  LLCAT H+ ++   DGL+ NGNFE GPK +QMKGT V D HAIP WE++GYVEYIK
Sbjct  8     VLSVLLCATCHVSLALI-DGLLPNGNFEYGPKPSQMKGTLVTDAHAIPEWELTGYVEYIK  66

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VPEG YAVRLG +A IK  VK +KG YYS++F+ ARTCAQEERLNVSV+
Sbjct  67    SGQKQGDMLLVVPEGAYAVRLGNEASIKQKVKVIKGMYYSITFSAARTCAQEERLNVSVA  126

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P+S     G+LP+QTMYSS+GWDSY+WAF A+   V+IV+HNP  E+DPACGPLIDS+AL
Sbjct  127   PDS-----GILPMQTMYSSNGWDSYAWAFQADYPEVEIVIHNPGVEEDPACGPLIDSIAL  181

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L PPR    N+LKNGNFEEGPY+F NT+WGVL+PPN+EDDH PLPGW+IESLKAVKYI
Sbjct  182   KALYPPRPTGKNLLKNGNFEEGPYVFPNTSWGVLVPPNIEDDHSPLPGWMIESLKAVKYI  241

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D++HFSVPEG+RAVELVAG+ESA+AQV RT PGK Y L F+VGDANN CEGSMVVEAFAG
Sbjct  242   DAEHFSVPEGKRAVELVAGKESAIAQVARTVPGKAYALMFAVGDANNRCEGSMVVEAFAG  301

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             + T++VP++SKG G   RA  +FTA S RTR+ FLS+FY M+SD+  SLCGPV+DDV+L+
Sbjct  302   RDTVKVPYESKGTGGFKRAVLKFTAASPRTRIMFLSTFYTMRSDDMASLCGPVVDDVKLL  361

Query  289   SVRNPR  272
             S+RNPR
Sbjct  362   SIRNPR  367



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/365 (68%), Positives = 307/365 (84%), Gaps = 6/365 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
              LL LLCAT H+ +SFT DGL+ NGNFE GPK + MKGT V+ PHAIP WE SG++EYIK
Sbjct  6     FLLLLLCATCHIALSFT-DGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWETSGFIEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             +GQKQGDMLL+VPEG +AVRLG +A IK  VK +KG YYS++F+ ARTCAQEERLN+SV+
Sbjct  65    AGQKQGDMLLVVPEGAFAVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEERLNISVA  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P     DWG+LP+QT+YSS+GWDSY+WAF A+ + ++IV+HNP  E+DPACGPLIDSVA 
Sbjct  125   P-----DWGVLPMQTLYSSNGWDSYAWAFQADYDVIEIVIHNPGVEEDPACGPLIDSVAF  179

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             ++L PPR    N+LKNG FEEGPY+F NT+WGVLIPPN+EDDH PLPGW++ESLKAVKYI
Sbjct  180   RALYPPRPSSKNLLKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYI  239

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHFSVP+ +RAVELVAG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSMVVEAFAG
Sbjct  240   DSDHFSVPQEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDASNSCEGSMVVEAFAG  299

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             + T++VP++SKGKG   RA  RF A+S+RTR+ FLS+FY M+SD+  SLCGPV+DDV+L+
Sbjct  300   RDTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDYASLCGPVLDDVKLL  359

Query  289   SVRNP  275
             S+R P
Sbjct  360   SLRTP  364



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 308/368 (84%), Gaps = 1/368 (0%)
 Frame = -3

Query  1369  ILLALLCA-TFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +LL LLCA  FH  +SF  DGL+ NGNFE GPK++++KGT V +PHAIP+WEISG+VEYI
Sbjct  7     VLLVLLCAANFHATLSFVTDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYI  66

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSGQKQGDM+L+VPEG +AV+LG +A IK  +K  KG++YS +FT +RTC QE +LNVSV
Sbjct  67    KSGQKQGDMVLVVPEGGFAVKLGNEALIKQKLKLTKGSFYSTTFTASRTCGQEAKLNVSV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +PN E NDWG++P+QT+YS +GWDSY+W F A+ + V++V+HNP   +DPACGPLIDSVA
Sbjct  127   NPNLEENDWGIMPIQTIYSCNGWDSYAWGFNADFDDVELVIHNPGVVEDPACGPLIDSVA  186

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             LK L PP+R R N+LKNGNFEEGPY+  NT+WG LIPP++EDDH PLPGWIIESLKAVKY
Sbjct  187   LKLLEPPKRTRANLLKNGNFEEGPYVSPNTSWGTLIPPHIEDDHSPLPGWIIESLKAVKY  246

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDS+HF VPEGRRA+ELV G+ESAL QVV T+PGK+Y L FSVGD+NN+CEGS+VVEAFA
Sbjct  247   IDSEHFFVPEGRRAIELVTGKESALTQVVFTKPGKLYALTFSVGDSNNSCEGSLVVEAFA  306

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK TL+VP+QSKGKG   RA+  FTA+  RTR+ F S+FY M +D+SGSLCGP+IDDV+L
Sbjct  307   GKDTLKVPYQSKGKGGFKRARLIFTAVGPRTRIMFYSTFYTMVADHSGSLCGPIIDDVKL  366

Query  292   VSVRNPRI  269
             +SVR  R+
Sbjct  367   LSVRKVRV  374



>emb|CDO98109.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/331 (75%), Positives = 288/331 (87%), Gaps = 0/331 (0%)
 Frame = -3

Query  1264  MKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVK  1085
             MKG+RV+DPH+IPHWEI G+VEYI+SGQKQGDMLL+VPEG YAVRLG++A IKT VK  K
Sbjct  1     MKGSRVIDPHSIPHWEIWGFVEYIESGQKQGDMLLVVPEGRYAVRLGDEASIKTKVKVEK  60

Query  1084  GTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEA  905
               +YSLSF+ ARTCAQ+E LN+SVSPN EPNDWGMLP+QTMYSSDGWDSYSW FLA+++ 
Sbjct  61    DLFYSLSFSAARTCAQDEVLNLSVSPNKEPNDWGMLPMQTMYSSDGWDSYSWGFLADSDV  120

Query  904   VDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLI  725
             ++I +HNP  EKD  CGPLIDSVALK+L  P + RGN+LKNGNFEEGPYIF NTTWG LI
Sbjct  121   IEISIHNPGREKDATCGPLIDSVALKALRRPLKTRGNLLKNGNFEEGPYIFPNTTWGALI  180

Query  724   PPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKV  545
             PPN+EDDH PLPGWIIESLKAVKY+DS+HFSVPEG+RAVEL+AGRESA+AQ+V+T PG  
Sbjct  181   PPNIEDDHSPLPGWIIESLKAVKYVDSEHFSVPEGKRAVELIAGRESAIAQIVKTIPGWW  240

Query  544   YDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFL  365
             YDL FSVGDA N CEGSM++EA AGK+TLQVP+QS GKG  +RA HRF A+S RTRVRFL
Sbjct  241   YDLVFSVGDAKNGCEGSMLIEASAGKVTLQVPYQSSGKGKFIRATHRFRAVSRRTRVRFL  300

Query  364   SSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             S  YHM+SDN+G+LCGPVIDDVRL S+R  R
Sbjct  301   SINYHMRSDNTGTLCGPVIDDVRLYSLRKLR  331



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/366 (69%), Positives = 302/366 (83%), Gaps = 1/366 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL LLCAT H+V+S T DGL+ NGNFE GPKR+QMKGT V  P+AIP+W+ISGYVEYIK
Sbjct  6     VLLVLLCATCHVVLSVT-DGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SG KQGDMLL+VPEG +AVRLG +A IK  +K  KG +YS++F+ ARTCAQEE+LNVSVS
Sbjct  65    SGHKQGDMLLIVPEGAFAVRLGNEASIKQKIKVTKGRFYSMTFSAARTCAQEEKLNVSVS  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PN E NDW +LP+QTMYS++GWDSY+WAF+A+A+ V+I +HNP  E+DPACGPLIDSVAL
Sbjct  125   PNLETNDWAILPMQTMYSNNGWDSYAWAFVADADEVEITVHNPGVEEDPACGPLIDSVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L PP+R   NMLKNGNFEEGPY+F N +WGVLIPP +EDDH PLPGWIIESLKAVKYI
Sbjct  185   KVLYPPKRTGVNMLKNGNFEEGPYVFPNASWGVLIPPKIEDDHSPLPGWIIESLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D  HFSVPEGRRAVELVAG+ESAL QVV+T   K Y L F+VGDA N C G++ VEA+AG
Sbjct  245   DLKHFSVPEGRRAVELVAGKESALTQVVKTEVNKTYALSFAVGDAGNGCAGTLGVEAYAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             +  ++V + SKGKG   +A  RF A+S RTR+ FLS+FY+M+SD+SGSLCGPVIDDV+L+
Sbjct  305   RDNVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSGSLCGPVIDDVKLL  364

Query  289   SVRNPR  272
               R  R
Sbjct  365   VARKIR  370



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/358 (69%), Positives = 305/358 (85%), Gaps = 1/358 (0%)
 Frame = -3

Query  1345  TFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDM  1166
             TF  V SFT +GL+ NGNFE+GPK ++MKG+ V+  +AIP+W I+G VEYIKSGQKQGDM
Sbjct  18    TFQAVFSFT-NGLLPNGNFERGPKASEMKGSVVIGQNAIPNWTITGLVEYIKSGQKQGDM  76

Query  1165  LLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDW  986
             LL+VPEG YAVRLG++A IK  VK  +G +Y+++F  ARTCAQEE+LNVSV P +E  DW
Sbjct  77    LLVVPEGDYAVRLGDEASIKQKVKLNEGFFYAITFGAARTCAQEEKLNVSVVPTTEKRDW  136

Query  985   GMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRR  806
             G++P+QTMY S+GW+S++  F A+    +IV+HNP  E+DPACGPLIDSVALK L+PP+R
Sbjct  137   GIIPIQTMYGSNGWESFTCGFRADFPEAEIVIHNPGKEEDPACGPLIDSVALKVLDPPKR  196

Query  805   RRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVP  626
              R N+LKNGNFEEGPY+F N++WG LIPP++ED H PLPGWI+ESLKAVKYIDSDHF+VP
Sbjct  197   TRANLLKNGNFEEGPYLFPNSSWGALIPPHIEDAHSPLPGWIVESLKAVKYIDSDHFAVP  256

Query  625   EGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPF  446
             EG+RA+ELVAG+ESALAQVV T  G+VYDL F+VGDANNACEGSM+VEAFAG  T+Q+P+
Sbjct  257   EGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETVQIPY  316

Query  445   QSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             QSKGKG SVR K RF A+++RTR+RFLS+FY MKSDNSGSLCGPVIDDV+L+SVR PR
Sbjct  317   QSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLSVRYPR  374



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/366 (68%), Positives = 301/366 (82%), Gaps = 1/366 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL  LC T  +  S T DGL+ NG+FEQGP+ ++MKGT V   +AIP+WEISG++EYIK
Sbjct  6     VLLVTLCITSQIASSVT-DGLLPNGDFEQGPRPSEMKGTVVTAKNAIPNWEISGFIEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SG KQGDM+L+VP G YAVRLG +A IK  VK  +G +YSL+F  ARTCAQEE+LNVSVS
Sbjct  65    SGHKQGDMVLVVPAGAYAVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEEKLNVSVS  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PNSEP DWG+LP+QTMYSS+GWD+Y+WAF A+   V+I +HNP  E+D ACGPLIDSVAL
Sbjct  125   PNSEPRDWGILPMQTMYSSNGWDAYAWAFQADGPEVEISIHNPGVEEDAACGPLIDSVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L+ P+R + N+LKNGNFEEGPY+F N  WGVL+PPN+EDDHCPLPGW+++SLKAVKYI
Sbjct  185   KLLSNPKRPKDNLLKNGNFEEGPYVFPNADWGVLVPPNIEDDHCPLPGWMVDSLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHF+VPEG+RAVELVAG+ESA++QVV+T   K+Y L FSVGD +N+C GSMVVE +AG
Sbjct  245   DSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSMVVEVYAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K   QVP++S GKG    AK  F AIS+ TR+ FLSSFY MKSDNSGSLCGPV+DDV+LV
Sbjct  305   KDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLV  364

Query  289   SVRNPR  272
             SVRNPR
Sbjct  365   SVRNPR  370



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/356 (69%), Positives = 299/356 (84%), Gaps = 0/356 (0%)
 Frame = -3

Query  1348  ATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGD  1169
             A  H+ +S   DGL+ NGNFE GPK++ +KGT V  P+AIP+WE+SGYVEYIKSGQKQGD
Sbjct  16    ANCHITLSLVTDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVSGYVEYIKSGQKQGD  75

Query  1168  MLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPND  989
             MLL+VPEG +AVRLG +A IK  +K  KG +YS++F+ ARTC QEE LNVS+SPN E ND
Sbjct  76    MLLVVPEGGFAVRLGNEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNVSISPNLEKND  135

Query  988   WGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR  809
             WG+ P+QTMYSS+GWDSY+W F A ++ ++  +HNP AE D ACGPLIDSVALK L PP+
Sbjct  136   WGIFPIQTMYSSNGWDSYAWGFNANSDELEFRIHNPGAEDDAACGPLIDSVALKILAPPK  195

Query  808   RRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSV  629
             R R N+LKNGNFEEGP++F NT+WGVLIPP++EDDH PLPGWIIESLKAVKYIDS HF+V
Sbjct  196   RTRANLLKNGNFEEGPFVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSTHFAV  255

Query  628   PEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVP  449
             PEG+RA+ELVAG+ESALAQVV T+PG++Y L FSVGD+ NACEGS+VVEAFAGK TL+VP
Sbjct  256   PEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNACEGSLVVEAFAGKDTLKVP  315

Query  448   FQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
             ++SKGKG   RA+  FTA+ + TRV FLS+FY M +D+SGSLCGPVIDDV+L+SVR
Sbjct  316   YESKGKGGFKRARLLFTAVETHTRVMFLSTFYTMSADHSGSLCGPVIDDVKLLSVR  371



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/366 (68%), Positives = 301/366 (82%), Gaps = 1/366 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL LLCAT H+V+S T DGL+ NGNFE GPKR+QMKGT V  P+AIP+W+ISGYVEYIK
Sbjct  6     VLLVLLCATCHVVLSVT-DGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SG KQGDMLL+VPEG++AVRLG +A IK  +K  KG +YS++F+ ARTCAQEE+LNVSVS
Sbjct  65    SGHKQGDMLLIVPEGVFAVRLGNEASIKQNIKVTKGRFYSMTFSAARTCAQEEKLNVSVS  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PN E NDW +LP+QTMYS++GWDSY+WAF+A+AE V+I +HNP  E+DPACGPLIDSVAL
Sbjct  125   PNLETNDWAILPMQTMYSNNGWDSYAWAFVADAEEVEITIHNPGVEEDPACGPLIDSVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L PP+R   N+LKNGNFEEGPY+F N +WGVLIPP +EDDH PLPGWIIESLKAVKYI
Sbjct  185   KVLYPPKRTGVNILKNGNFEEGPYVFPNASWGVLIPPKIEDDHSPLPGWIIESLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D  HF VPEGRRA+ELVAG+ESAL QVV+T   K Y L F+VGDA N C G++ VEA+AG
Sbjct  245   DLKHFFVPEGRRAIELVAGKESALTQVVKTEVNKTYALSFAVGDAGNGCAGTLGVEAYAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             +  ++V + SKGKG   +A  RF A+S RTR+ FLS+FY+M+SD+SGSLCGPVIDDV+L+
Sbjct  305   RENVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSGSLCGPVIDDVKLL  364

Query  289   SVRNPR  272
                  R
Sbjct  365   VAHKIR  370



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/367 (68%), Positives = 307/367 (84%), Gaps = 1/367 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL +LCAT +   S   DGL+ NG+FE+GP+++Q+KGT V    AIP W ISGYVEYIK
Sbjct  6     LLLLILCATSYNATSLI-DGLLPNGDFEKGPEQSQLKGTVVTSKTAIPKWGISGYVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VPEG +AVRLG +A IK  VK  KGT+YS++F+ ARTCAQEE+LNVSV+
Sbjct  65    SGQKQGDMLLVVPEGEFAVRLGNEASIKQKVKVEKGTFYSVTFSAARTCAQEEKLNVSVT  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PN E +DWG+LP+QTMYSS+GWDSY W+F A+A  ++I +HNP  ++DPACGPLIDSVAL
Sbjct  125   PNHEAHDWGILPMQTMYSSNGWDSYCWSFRADAPEIEISIHNPGMDEDPACGPLIDSVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L  P+R   N++KNGNFEEGPY+   T+WGVLIPP++EDDH PLPGWIIESLKAVK++
Sbjct  185   KALYIPKRTNANLVKNGNFEEGPYVPPKTSWGVLIPPHIEDDHSPLPGWIIESLKAVKFV  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHF+VPEG+RAVELVAG+ESA+AQVV T+ GKVY L F+VGDA N+CEGSM VEA+AG
Sbjct  245   DSDHFAVPEGKRAVELVAGKESAIAQVVSTQRGKVYVLTFAVGDAKNSCEGSMAVEAYAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
               ++ VP+ S GKG  V AK RFTA S RTRVRFLSS+Y+M+SD+SGSLCGPVIDDVRLV
Sbjct  305   TASVTVPYTSTGKGGYVHAKLRFTATSDRTRVRFLSSYYNMQSDHSGSLCGPVIDDVRLV  364

Query  289   SVRNPRI  269
             SVRN ++
Sbjct  365   SVRNRKL  371



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/365 (69%), Positives = 302/365 (83%), Gaps = 1/365 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             ++L L  +T H V SFT DGL+ NGNFEQGPK +Q+KG+ V    AIP+W ISG+VEYIK
Sbjct  8     LVLFLSISTCHTVFSFT-DGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIK  66

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VPEG YAVRLG +A IK  +K +KG++YS++F+ ARTCAQEE+LNVSV 
Sbjct  67    SGQKQGDMLLVVPEGDYAVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVV  126

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P +E  DWG++P+QTMY S+GW+S++  F A+     IV+HNP  E+DPACGPLIDSVAL
Sbjct  127   PTTEKRDWGIIPIQTMYGSNGWESFTCGFRADFPEAQIVIHNPGKEEDPACGPLIDSVAL  186

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L PP+R R N+LKNGN EEGPYIF N++WG LIPP++ED H PLPGWI+ESLKAVKYI
Sbjct  187   KVLYPPKRTRANLLKNGNLEEGPYIFPNSSWGALIPPHIEDSHGPLPGWIVESLKAVKYI  246

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHF+VPEG+RA+ELVAG+ESALAQVV T  GK YDL F+VGDANN CE SM+VEAFAG
Sbjct  247   DSDHFAVPEGKRAIELVAGKESALAQVVITTIGKTYDLTFAVGDANNECEASMMVEAFAG  306

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
               T+QVP+QSKGKG  VR K RF A+S+RTR+RFLS+FY MKSDNSGSLCGPVIDDV+L+
Sbjct  307   ANTVQVPYQSKGKGGFVRGKLRFKAVSTRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLL  366

Query  289   SVRNP  275
              VR P
Sbjct  367   GVRYP  371



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/366 (68%), Positives = 300/366 (82%), Gaps = 1/366 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL  LC T  +  S T DGL+ NG+FEQGPK ++MKGT V    AIP+WEISG++EYIK
Sbjct  28    VLLVTLCITSQVASSVT-DGLLPNGDFEQGPKPSEMKGTVVTAKSAIPNWEISGFIEYIK  86

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SG KQGDM+L+VP G YAVRLG +A IK  VK  +G +YSL+F  ARTCAQEE+LNVSVS
Sbjct  87    SGHKQGDMVLVVPAGAYAVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEEKLNVSVS  146

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PNSEP DWG+LP+QTMYSS+GWD+Y+WAF A+   V I +HNP  E+D ACGPLIDSVAL
Sbjct  147   PNSEPRDWGILPMQTMYSSNGWDAYAWAFQADGPEVKISIHNPGVEEDAACGPLIDSVAL  206

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L+ P+R + N+LKNGNFEEGPY+F +T WGVL+PPN+EDDHCPLPGW+++SLKAVKYI
Sbjct  207   KLLSNPKRPKDNLLKNGNFEEGPYVFPSTDWGVLVPPNIEDDHCPLPGWMVDSLKAVKYI  266

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHF+VPEG+RAVELVAG+ESA++QVV+T   K+Y L FSVGD +N+C GSMVVE +AG
Sbjct  267   DSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSMVVEVYAG  326

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K   QVP++S GKG    AK  F AIS+ TR+ FLSSFY MKSDNSGSLCGPV+DDV+LV
Sbjct  327   KDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYSMKSDNSGSLCGPVLDDVKLV  386

Query  289   SVRNPR  272
             SVRNPR
Sbjct  387   SVRNPR  392



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/357 (69%), Positives = 299/357 (84%), Gaps = 0/357 (0%)
 Frame = -3

Query  1351  CATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQG  1172
              A FH+ +SF  DGL+ NGNFE GPK++++KGT V +PHAIP+WEISG+VEYIKSGQKQG
Sbjct  14    AANFHVTLSFVTDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQG  73

Query  1171  DMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPN  992
             DMLL+VPEG +AVRLG +A IK  +K  KG +YS++F+ ARTCAQEE LNVS++PN E  
Sbjct  74    DMLLVVPEGGFAVRLGNEALIKQKLKVKKGGFYSVTFSAARTCAQEETLNVSITPNLEKR  133

Query  991   DWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPP  812
              WG++P+QTMYSS GWDSY+W F A+ + +++V+HNP  E+D ACGPLIDSVALK L  P
Sbjct  134   HWGIMPIQTMYSSIGWDSYAWGFNADFDEIELVIHNPGVEEDAACGPLIDSVALKLLAFP  193

Query  811   RRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFS  632
             +R R N+LKNGNFEEGPY+F NT+WGVLIPP++EDDH PLPGWIIESLKAVKYIDS HFS
Sbjct  194   KRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKHFS  253

Query  631   VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQV  452
             VPEGRRA+ELVAG+ESALAQVV T PGK+Y L F+VGD+NNACEGS+ VEAFAGK TL+V
Sbjct  254   VPEGRRAIELVAGKESALAQVVFTLPGKLYALTFTVGDSNNACEGSLAVEAFAGKDTLKV  313

Query  451   PFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
              +QSKG+G   RA+  FTA+  RTRV F S FY M +D+SGSLCGPVIDDV+L+SVR
Sbjct  314   LYQSKGQGGFKRARFLFTAVGPRTRVMFYSMFYTMAADHSGSLCGPVIDDVKLLSVR  370



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/367 (68%), Positives = 308/367 (84%), Gaps = 7/367 (2%)
 Frame = -3

Query  1369  ILLALLCATF-HLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +L  LLCA++ HL ++   DGL+ NG+FE GPK + MKGT V++ HAIP WE+SG+VEYI
Sbjct  8     VLSVLLCASYCHLAVALI-DGLLPNGDFEYGPKPSDMKGTVVINRHAIPEWELSGFVEYI  66

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             K+GQKQGDMLL+VP G +AVRLG +A IK  VK +KG YYS++F+ ARTCAQEERLNVSV
Sbjct  67    KAGQKQGDMLLVVPAGEFAVRLGNEASIKQKVKVIKGMYYSITFSAARTCAQEERLNVSV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P+S     G+LP+QT YSS+GWDSY+WAF A+   V+IV+HNP  E+DPACGPLIDSVA
Sbjct  127   APDS-----GILPIQTTYSSNGWDSYAWAFQADYPEVEIVIHNPGVEEDPACGPLIDSVA  181

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             LK+L PPR    N+LKNG+FEEGPYIF NT+WGVL+PPN+EDDH PLPGW+IESLKAVKY
Sbjct  182   LKALYPPRPTNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPGWMIESLKAVKY  241

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             ID++HFSVP+GRRAVELVAG+ESA+AQ+ RT PGKVY L F+VGDANN CEGSMVVEAFA
Sbjct  242   IDAEHFSVPQGRRAVELVAGKESAIAQIARTIPGKVYTLTFAVGDANNKCEGSMVVEAFA  301

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
              + T++VP++SKG G   RA  RFTA+S+RTR+ FLS+FY M+SD+  SLCGPV+DDV+L
Sbjct  302   DRNTVKVPYESKGTGGFKRAVLRFTAVSTRTRIMFLSTFYTMRSDDMASLCGPVVDDVKL  361

Query  292   VSVRNPR  272
             +S+RNPR
Sbjct  362   LSIRNPR  368



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/367 (68%), Positives = 303/367 (83%), Gaps = 6/367 (2%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             GI+L  LL AT    +S   DGLV NGNFE  PK + MKGT+V+  +AIP WEISG+VEY
Sbjct  4     GILLSVLLLATCQFSLSIR-DGLVKNGNFELAPKPSDMKGTQVIGKNAIPEWEISGFVEY  62

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             IKSGQKQGDMLL+VPEG YAVRLG +A IK  ++ +KG YYS++F+ ARTCAQEE+LNVS
Sbjct  63    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRMRVIKGMYYSITFSAARTCAQEEKLNVS  122

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             VSP     DWG+LP+QTMYSS+GWDSY+WAF AE + VD+V+HNP  E+DPACGPLIDSV
Sbjct  123   VSP-----DWGVLPMQTMYSSNGWDSYAWAFQAEFQYVDLVIHNPGVEEDPACGPLIDSV  177

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+++L PPR    N+LKNG FEEGPY+F NT+WGVLIPPN+EDDH PLPGW++ESLKAVK
Sbjct  178   AIRALYPPRPTNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVK  237

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YID DHFSVP+GRRA+ELVAG+ESA+AQV RT  GK Y L F+VGDA+N+CEGSMVVEAF
Sbjct  238   YIDVDHFSVPQGRRAIELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAF  297

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK TL+VP++SKGKG   RA  RF A+++RTR+ F S+FY M+SD+  SLCGPV+DDV+
Sbjct  298   AGKDTLKVPYESKGKGGFKRAVLRFVAVANRTRIMFYSTFYTMRSDDFSSLCGPVLDDVK  357

Query  295   LVSVRNP  275
             L+SVR P
Sbjct  358   LLSVRKP  364



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/364 (68%), Positives = 304/364 (84%), Gaps = 2/364 (1%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             ++L L CAT  L  S   DGL+ NGNFE GPK +++KGT+V+ P AIP+WEISGYVEYIK
Sbjct  7     VVLFLFCATSQLASSLN-DGLLPNGNFEYGPKPSELKGTKVMSPKAIPNWEISGYVEYIK  65

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VPEG +AVRLG +A IK  +K +KG +YSL+F+ ARTCAQEE+LNVSVS
Sbjct  66    SGQKQGDMLLIVPEGGFAVRLGNEALIKQKIKVIKGMFYSLTFSAARTCAQEEKLNVSVS  125

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PN E ND+G+ P+QTMYSS+GWDSY+WAF A    ++I +HNP  E+D ACGPLIDSVAL
Sbjct  126   PNYEKNDFGLFPIQTMYSSNGWDSYAWAFQASESVIEISIHNPGVEEDAACGPLIDSVAL  185

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSN-TTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             K+L PP+R R N+LKNGNFEEGPYIFS   + GV+IPP++EDDH PLPGWII+SLKAVKY
Sbjct  186   KTLYPPKRTRVNLLKNGNFEEGPYIFSGPVSEGVIIPPHIEDDHSPLPGWIIDSLKAVKY  245

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDSDHF+VPEG+RA+EL+AG+ES+L+QVVRT  G+ Y L F++GDANNACEGSMVVEAFA
Sbjct  246   IDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGRDYVLSFTIGDANNACEGSMVVEAFA  305

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
              K T++V + SKGKG   +A+ RF A S+RTR+ F S+FY MK+DNSGSLCGPV+DDV+L
Sbjct  306   NKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSGSLCGPVVDDVKL  365

Query  292   VSVR  281
             VS+R
Sbjct  366   VSIR  369



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/356 (68%), Positives = 300/356 (84%), Gaps = 0/356 (0%)
 Frame = -3

Query  1348  ATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGD  1169
             A  H  +S   DGL+ NGNFE GPK++ +KGT V  P+AIP+WE+SGYVEYIKSGQKQGD
Sbjct  16    ANCHTTLSLDTDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVSGYVEYIKSGQKQGD  75

Query  1168  MLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPND  989
             MLL+VPEG +AVRLG++A IK  +K  KG +YS++F+ ARTC QEE LN+S++PN E ND
Sbjct  76    MLLVVPEGGFAVRLGKEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNLSINPNLEKND  135

Query  988   WGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR  809
             WG+ P+QTMYSS+GWDSY+W F A+++ ++  +HNP AE D ACGPLIDSVALK L PP+
Sbjct  136   WGIFPIQTMYSSNGWDSYAWGFNADSDELEFRIHNPGAEDDAACGPLIDSVALKVLAPPK  195

Query  808   RRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSV  629
             R R N+LKNG+FEEGPY+F NT+WGVLIPP++EDDH PLPGWIIESLKAVKYIDS+HF+V
Sbjct  196   RTRANLLKNGDFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSNHFAV  255

Query  628   PEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVP  449
             PEG+RA+ELVAG+ESALAQVV T+PG++Y L FSVGD+ N+CEGS+VVEAFAGK TL+VP
Sbjct  256   PEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNSCEGSLVVEAFAGKDTLKVP  315

Query  448   FQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
             ++S GKG   RA+  FTA+ + TRV FLSSFY M +D+SGSLCGPVIDDV+L+SVR
Sbjct  316   YESMGKGGFKRARLLFTAVETHTRVMFLSSFYTMSADHSGSLCGPVIDDVKLLSVR  371



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/365 (67%), Positives = 299/365 (82%), Gaps = 5/365 (1%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             I L ALLC T H +     DGL+ NGNFE GP+ + M GT V+  +AIP WEISG+VEYI
Sbjct  5     IFLSALLCFTCHHIAFSITDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWEISGFVEYI  64

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             +SGQKQGDMLL+VPEG +AVRLG +A +K  +K +KG YYS+SF FARTCAQEE LN+SV
Sbjct  65    RSGQKQGDMLLVVPEGAFAVRLGNEASVKQRIKVIKGNYYSISFNFARTCAQEESLNISV  124

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     +WG+LPLQT+YSS+GWD+Y+WAF A+    +IVLHNP  E+DPACGPLIDS+A
Sbjct  125   AP-----EWGVLPLQTLYSSNGWDTYAWAFQAKFNYAEIVLHNPGVEEDPACGPLIDSIA  179

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             ++ L PPR    N+LKNG FEEGPY+F NT+WGVLIPPN+EDDH PLPGW+IESLKAVKY
Sbjct  180   IRGLYPPRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKY  239

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDSDHFSVP+G+RA+ELVAG+ESA+AQ+ RT PGK Y L F+VGDANNAC GSMVVEAFA
Sbjct  240   IDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACAGSMVVEAFA  299

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK T++VP++SKGKG   RA  RF A+S+RTR+ FLS+FY M+SD+  SLCGPVIDDV+L
Sbjct  300   GKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKL  359

Query  292   VSVRN  278
             +SVRN
Sbjct  360   LSVRN  364



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/358 (69%), Positives = 299/358 (84%), Gaps = 1/358 (0%)
 Frame = -3

Query  1348  ATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGD  1169
             +T H  +S+T DGL+ NG+FE GPK +++KG+ V     IP+W ISG+VEYIKSGQKQGD
Sbjct  13    STCHAALSYT-DGLLPNGDFEVGPKASELKGSVVTSHDGIPNWTISGFVEYIKSGQKQGD  71

Query  1168  MLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPND  989
             MLL+VPEG YAVRLG +A+IK  VK  KG++YS++F+ ARTCAQEE+LNVSV P +E  D
Sbjct  72    MLLIVPEGAYAVRLGNEAYIKQKVKLNKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRD  131

Query  988   WGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR  809
             +G++P+QTMY S+GW+S++  F A+ E  +IV+HN   E DPACGPLIDSVALK LNPPR
Sbjct  132   YGIIPIQTMYGSNGWESFACGFKADYEQGEIVIHNSGVEDDPACGPLIDSVALKVLNPPR  191

Query  808   RRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSV  629
             R R N+LKNGNFEEGPY+F N +WGVLIPP++ED H PLPGWI+ESLKAVKYIDS HF V
Sbjct  192   RTRANLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHGPLPGWIVESLKAVKYIDSKHFYV  251

Query  628   PEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVP  449
             PEG RA+ELVAG+ESALAQVV T  GKVYDL FSVGDANN+CEGSM VEAFAG  T+QVP
Sbjct  252   PEGNRAIELVAGKESALAQVVITTIGKVYDLTFSVGDANNSCEGSMTVEAFAGGDTVQVP  311

Query  448   FQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             ++SKGKG  VR K RFTA+S+RTR+RFLS+FY MK+DNSGSLCGPVIDDV+L+SVR P
Sbjct  312   YESKGKGGFVRGKLRFTALSTRTRIRFLSTFYTMKNDNSGSLCGPVIDDVKLLSVRYP  369



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/384 (65%), Positives = 306/384 (80%), Gaps = 1/384 (0%)
 Frame = -3

Query  1423  ISFSQLS*kkkkmkKTGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVV  1244
             ISF  LS  K        +LL  LC T+ + +S T DGL+ NG+FE GPK ++MKGT V 
Sbjct  4     ISFLPLSPCKLNAMYRATVLLVSLCITWQVALSVT-DGLLPNGDFEYGPKPSEMKGTVVT  62

Query  1243  DPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLS  1064
               +AIP+WEISG++EYIKSG KQGDMLL+VP G YAVRLG +A IK  VK  +G +YSL+
Sbjct  63    AKNAIPNWEISGFIEYIKSGHKQGDMLLVVPVGAYAVRLGNEASIKQKVKVTQGEFYSLT  122

Query  1063  FTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHN  884
             F  ARTCAQEE+LN+SVSPNSEP DWG+LP+QTMYSS+GWD+Y+WAF A+   V+I +HN
Sbjct  123   FNVARTCAQEEKLNLSVSPNSEPRDWGILPMQTMYSSNGWDAYAWAFHADGPEVEISIHN  182

Query  883   PAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDD  704
             P  E+D ACGPL+DSVALK L+ P+R R N+LKNGNFEEGPY+F NT WGVLIPP++EDD
Sbjct  183   PGVEEDAACGPLVDSVALKLLSNPKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHIEDD  242

Query  703   HCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSV  524
              CPLPGWI++SLKAVKYID +HF+VPEG+RAVELVAG+ESA++Q V+T   K+Y L F V
Sbjct  243   QCPLPGWIVDSLKAVKYIDREHFTVPEGKRAVELVAGKESAISQTVKTIINKIYVLTFYV  302

Query  523   GDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMK  344
             GD +N+C GSMVVE +AGK   QVP++S GKG   RAK  F A+S+ TR+ FLSSFY MK
Sbjct  303   GDTSNSCVGSMVVEVYAGKDRTQVPYESNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMK  362

Query  343   SDNSGSLCGPVIDDVRLVSVRNPR  272
             SDNSGSLCGPV+DDV+LVSVRNPR
Sbjct  363   SDNSGSLCGPVLDDVKLVSVRNPR  386



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/360 (68%), Positives = 300/360 (83%), Gaps = 1/360 (0%)
 Frame = -3

Query  1351  CATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQG  1172
             CAT H+ +S T DGL+ NG+FE GPK  QMKGT V   +AIP+WEISGYVEYIKSGQKQG
Sbjct  14    CATCHVALSVT-DGLLPNGDFEHGPKPWQMKGTVVTAKNAIPNWEISGYVEYIKSGQKQG  72

Query  1171  DMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPN  992
             DMLL+VP G +AVRLG +A IK  +   K +YYS++F  ARTCAQEE+LNVSVSPN EP 
Sbjct  73    DMLLVVPGGAFAVRLGNEASIKQKISVTKDSYYSITFNVARTCAQEEKLNVSVSPNLEPK  132

Query  991   DWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPP  812
             DWG+LP+QT+YSS+GWDSYSWAF A+A  V+I +HNP  E+DPACGPLIDSVA+K L+ P
Sbjct  133   DWGILPMQTVYSSNGWDSYSWAFQADASEVEISIHNPGVEEDPACGPLIDSVAVKFLSNP  192

Query  811   RRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFS  632
             +R R N+LKNG+FEEGPY+F NT WGVLIPP++EDDH PLPGWIIESLKAVKYI+S+HF 
Sbjct  193   KRTRDNLLKNGDFEEGPYVFPNTDWGVLIPPHIEDDHSPLPGWIIESLKAVKYINSEHFK  252

Query  631   VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQV  452
             VP+G+RA+ELVAG+ESAL+Q+V+T P K Y L F+VGDANN+CEGS+VVE +AG   +++
Sbjct  253   VPQGKRAIELVAGKESALSQIVKTIPKKSYVLTFNVGDANNSCEGSLVVEVYAGNDKIEI  312

Query  451   PFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             P+ SKGKG    A+ +F A+S+ TR+ FLSSFY MKSDNSGSLCGPVIDDV+L+SVR PR
Sbjct  313   PYVSKGKGGFKPARFQFQAVSTHTRLMFLSSFYTMKSDNSGSLCGPVIDDVKLLSVRRPR  372



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/365 (67%), Positives = 299/365 (82%), Gaps = 5/365 (1%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             I L ALLC T H +     DGL+ NGNFE GP+ + M GT V+  +AIP WEISG+VEYI
Sbjct  5     IFLSALLCFTCHHIAFSITDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWEISGFVEYI  64

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             +SGQKQGDMLL+VPEG +AVRLG +A +K  +K +KG YYS+SF FARTCAQEE LN+SV
Sbjct  65    RSGQKQGDMLLVVPEGAFAVRLGNEASVKQRIKVIKGNYYSISFNFARTCAQEESLNISV  124

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     +WG+LPLQT+YSS+GWD+Y+WAF A+    +IVLHNP  E+DPACGPLIDS+A
Sbjct  125   AP-----EWGVLPLQTLYSSNGWDTYAWAFQAKFNYAEIVLHNPGVEEDPACGPLIDSIA  179

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             ++ L PPR    N+LKNG FEEGPY+F NT+WGVLIPPN+EDDH PLPGW+IESLKAVKY
Sbjct  180   IRGLYPPRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKY  239

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDSDHFSVP+G+RA+ELVAG+ESA+AQ+ RT PGK Y L F+VGDANNAC GSMVVEAFA
Sbjct  240   IDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACAGSMVVEAFA  299

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK T++VP++SKGKG   RA  RF A+S+RTR+ FLS+FY M+SD+  SLCGPVIDDV+L
Sbjct  300   GKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKL  359

Query  292   VSVRN  278
             +SVR+
Sbjct  360   LSVRS  364



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/366 (67%), Positives = 301/366 (82%), Gaps = 1/366 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL  LC T+ L +S T DGL+ NG+FE GPK ++MKGT V   +AIP+WEISG++EYIK
Sbjct  6     VLLVSLCITWQLALSVT-DGLLPNGDFEYGPKPSEMKGTVVTAKNAIPNWEISGFIEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SG KQGDMLL+VP G YAVRLG +A IK  VK  +G +YSL+F  ARTCAQEE+LN+SVS
Sbjct  65    SGHKQGDMLLVVPVGAYAVRLGNEASIKQKVKVTQGKFYSLTFNVARTCAQEEKLNLSVS  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
              NSEP DWG+LP+QTMYSS+GWD+Y+WAF AE   V+I +HNP  E+D ACGPL+DSVAL
Sbjct  125   SNSEPRDWGILPMQTMYSSNGWDAYAWAFHAEGPEVEISIHNPGVEEDAACGPLVDSVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L+ P+R R N+LKNGNFEEGPY+F NT WGVLIPP+ EDD CPLPGWI++SLKAVKYI
Sbjct  185   KLLSNPKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHNEDDQCPLPGWIVDSLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DS+HF+VPEG+RAVEL+AG+ESA++Q+V+T   K+Y L F+VGD +N+C GSMVVE +AG
Sbjct  245   DSEHFTVPEGKRAVELIAGKESAISQIVKTIINKIYVLTFNVGDTSNSCVGSMVVEVYAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K   QVP++S GKG   RAK  F A+S+ TR+ FLSSFY MKSDNSGSLCGPV+DDV+LV
Sbjct  305   KDRTQVPYKSNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLV  364

Query  289   SVRNPR  272
             SVRNPR
Sbjct  365   SVRNPR  370



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   522 bits (1344),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 251/366 (69%), Positives = 299/366 (82%), Gaps = 6/366 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             I+L  LL A     +S   DGL+ NGNFE GPK++ + GT+V+  +AIP WEISG+VEYI
Sbjct  5     ILLSVLLLAACQFSVSIR-DGLIENGNFELGPKQSDLNGTKVLGRYAIPRWEISGFVEYI  63

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSGQKQGDMLL+VPEG YAVRLG +A IK  +K +KG YYS++F+ ARTCAQEE LNVSV
Sbjct  64    KSGQKQGDMLLVVPEGAYAVRLGNEASIKQKLKVIKGMYYSITFSAARTCAQEEALNVSV  123

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             SP+S     G+LP+QTMYSS+GWDSY+WAF AE   VD+V+HNP  E+DPACGPLIDSVA
Sbjct  124   SPDS-----GVLPMQTMYSSNGWDSYAWAFQAEYPVVDLVIHNPGVEEDPACGPLIDSVA  178

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             +++L PPR    N+LKNG FEEGPYIF NT+WGVLIPPN+EDDH PLPGW+IESLKAVKY
Sbjct  179   IRALYPPRPTNKNILKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKY  238

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDSDHFSVP+ RRAVELVAG+ESA+AQV RT  GK Y L F+VGDA+N+CEGSMVVEAFA
Sbjct  239   IDSDHFSVPQARRAVELVAGKESAIAQVARTVVGKTYTLSFAVGDASNSCEGSMVVEAFA  298

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK TL+VP++SKGKG   RA  RF A S+RTR+ F S+FY M+SD+  SLCGPVIDDV+L
Sbjct  299   GKDTLKVPYESKGKGGFKRAVLRFVAASNRTRIMFYSTFYTMRSDDFSSLCGPVIDDVKL  358

Query  292   VSVRNP  275
             +SVR P
Sbjct  359   LSVRKP  364



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   522 bits (1344),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 243/367 (66%), Positives = 302/367 (82%), Gaps = 7/367 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEY  1196
             + L  LLCATFH+  S T DGLVANGNFE GPK + +KGT V+   H+IP WEISG+VEY
Sbjct  6     MFLSVLLCATFHVSFSIT-DGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEISGFVEY  64

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             IKSGQKQGDMLL+VPEG YAVRLG +A IK  +K +KG YYS++F  ARTCAQEERLN+S
Sbjct  65    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNIS  124

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P     DWG++P+QT+Y+S GWD  ++ F AE E V++++HNP  E+DPACGPL+DSV
Sbjct  125   VTP-----DWGVIPIQTLYTSSGWDPIAFGFKAENETVEMLIHNPGKEEDPACGPLVDSV  179

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             AL++L PPR    N+LKNG FEEGPY+F N++WGV+IPPN+EDDH PLPGW++ESLKAVK
Sbjct  180   ALRTLYPPRATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVK  239

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDS HFSVP+G+RAVEL+AG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VEAF
Sbjct  240   YIDSGHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAF  299

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++VP++SKGKG   RA  +F A++ RTR+ FLS+FY M+SD+  SLCGPVIDDV+
Sbjct  300   AGKDTIKVPYESKGKGGFKRAALKFVAVTPRTRIMFLSTFYTMRSDDFSSLCGPVIDDVK  359

Query  295   LVSVRNP  275
             LVS+R P
Sbjct  360   LVSLRKP  366



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   521 bits (1343),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 243/367 (66%), Positives = 302/367 (82%), Gaps = 7/367 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEY  1196
             + L  LLCATFH+  S   DGLVANGNFE GPK + +KGT VV   H+IP WEISG+VEY
Sbjct  6     MFLSVLLCATFHVSFSII-DGLVANGNFELGPKPSALKGTVVVGGSHSIPEWEISGFVEY  64

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             IKSGQKQGDMLL+VPEG YAVRLG +A IK  +K +KG YYS++F  ARTCAQEERLN+S
Sbjct  65    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNIS  124

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P     DWG++P+QT+Y+S GWD  ++ F AE+E V++++HNP  E+DPACGPL+DSV
Sbjct  125   VTP-----DWGVIPIQTLYTSSGWDPIAFGFKAESETVEMLIHNPGKEEDPACGPLVDSV  179

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             AL++L PP+    N+LKNG FEEGPY+F N++WGV+IPPN+EDDH PLPGW++ESLKAVK
Sbjct  180   ALRTLYPPKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVK  239

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVP+G+RAVEL+AG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VEAF
Sbjct  240   YIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAF  299

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++VP++SKG G   RA  +F A++ RTRV FLS+FY M+SD+  SLCGPVIDDV+
Sbjct  300   AGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSSLCGPVIDDVK  359

Query  295   LVSVRNP  275
             LVS+R P
Sbjct  360   LVSLRKP  366



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   521 bits (1342),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 242/367 (66%), Positives = 302/367 (82%), Gaps = 7/367 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEY  1196
             + L  LLCATFH+  S   DGLVANGNFE GPK + +KGT V+   H+IP WEISG+VEY
Sbjct  6     MFLSVLLCATFHVSFSII-DGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEISGFVEY  64

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             IKSGQKQGDMLL+VPEG YAVRLG +A IK  +K +KG YYS++F  ARTCAQEERLN+S
Sbjct  65    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNIS  124

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P     DWG++P+QT+Y+S GWD  ++ F AE+E V++++HNP  E+DPACGPL+DSV
Sbjct  125   VTP-----DWGVIPIQTLYTSSGWDPIAFGFKAESETVEMLIHNPGKEEDPACGPLVDSV  179

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             AL++L PP+    N+LKNG FEEGPY+F N++WGV+IPPN+EDDH PLPGW++ESLKAVK
Sbjct  180   ALRTLYPPKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVK  239

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVP+G+RAVEL+AG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VEAF
Sbjct  240   YIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAF  299

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++VP++SKG G   RA  +F A++ RTRV FLS+FY M+SD+  SLCGPVIDDV+
Sbjct  300   AGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSSLCGPVIDDVK  359

Query  295   LVSVRNP  275
             LVS+R P
Sbjct  360   LVSLRKP  366



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   520 bits (1339),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 243/367 (66%), Positives = 301/367 (82%), Gaps = 7/367 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEY  1196
             I L  LLC+TFH+  S   DGLVANGNFE GPK + +KGT VV    +IP WEISG+VEY
Sbjct  6     IFLSVLLCSTFHVSFSII-DGLVANGNFELGPKASDLKGTVVVGGSKSIPEWEISGFVEY  64

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             IKSGQKQGDMLL+VPEG YAVRLG +A IK T+K +KG YYS++F  ARTCAQEER+N+S
Sbjct  65    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQTLKVMKGMYYSITFMVARTCAQEERINIS  124

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P     DWG++P+QT+Y+S GWD  ++ F AE+E V++++HNP  E+DPACGPLIDSV
Sbjct  125   VTP-----DWGVIPIQTLYTSSGWDPIAFGFRAESETVEMLIHNPGKEEDPACGPLIDSV  179

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             AL++L PP+    N+LKNG FEEGPY+F N++WGV+IPPN+EDDH PLPGW++ESLKAVK
Sbjct  180   ALRTLYPPKATNQNLLKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVK  239

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVP+G+RAVEL+AG+ESA+AQV RT PGK Y L FSVGDA+N CEGSM+VEAF
Sbjct  240   YIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNYCEGSMIVEAF  299

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++VP++SKGKG   RA  +F A+  RTRV FLS+FY M+SD+  SLCGPV+DDV+
Sbjct  300   AGKDTIKVPYESKGKGGFKRAALKFVAVGPRTRVMFLSTFYTMRSDDFSSLCGPVVDDVK  359

Query  295   LVSVRNP  275
             LVS+R P
Sbjct  360   LVSLRKP  366



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   519 bits (1337),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 240/369 (65%), Positives = 304/369 (82%), Gaps = 6/369 (2%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
               + L  LLCAT H  +S   DG + NGNFE+ PK + ++GT V+  +AIP WEISG+VE
Sbjct  4     VALFLSVLLCATCHSALSII-DGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEISGFVE  62

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YIKSGQKQGDMLL+VPEG YAVRLG +A IK  +K  KG YYS++F+ ARTCAQEERLN+
Sbjct  63    YIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNI  122

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P+S     G+LP+QT+YSS+GWDSY+WAF A+ E ++++LHNP  E+DPACGPLIDS
Sbjct  123   SVAPDS-----GVLPIQTVYSSNGWDSYAWAFQADYEQIELLLHNPGVEEDPACGPLIDS  177

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             +A+++L PPR    N+LKN  FEEGPY+F N +WGVLIPPN+EDDH PLPGW++ESLKAV
Sbjct  178   IAIRTLYPPRATNKNLLKNAGFEEGPYMFPNASWGVLIPPNIEDDHSPLPGWMVESLKAV  237

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYIDS+HFSVPEG+RAVELVAG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VEA
Sbjct  238   KYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEA  297

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAG+ T++VP++SKGKG   RA  +F A+S+RTRV FLS++Y M+SD+  SLCGPV+DDV
Sbjct  298   FAGRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDV  357

Query  298   RLVSVRNPR  272
             +L+S++NPR
Sbjct  358   KLLSLKNPR  366



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   519 bits (1336),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 245/365 (67%), Positives = 302/365 (83%), Gaps = 2/365 (1%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             + LL LLCAT  + +S   DGL+ NGNFE GPK ++++GT+V+   AIP+WEISGYVEYI
Sbjct  6     MFLLLLLCATSQIALS-VKDGLLPNGNFEYGPKASELEGTKVMSAKAIPNWEISGYVEYI  64

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSG KQGDMLL+VPEG +AVRLG +A IK  V+ VKG +YSL+F+ ARTCAQEERLNVSV
Sbjct  65    KSGHKQGDMLLIVPEGAFAVRLGNEALIKQKVEVVKGDFYSLTFSTARTCAQEERLNVSV  124

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             SPN+E ND+G+ P+QTMYSS+GWDSY+WAF A+A  ++I +HNP  E+D ACGPLIDSVA
Sbjct  125   SPNNEKNDFGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPGVEEDAACGPLIDSVA  184

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSN-TTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             LK+L  P+R R N+LKNGNFEEGPYIF   T+ GV+IPP++EDDH PLPGWIIESLKA+K
Sbjct  185   LKTLYNPKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIK  244

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDS+HFSVP+G+RA+EL+AG+ESA+AQ+V+T  G+ Y L F VGDANN CEG MVVEAF
Sbjct  245   YIDSEHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGCEGPMVVEAF  304

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++V + SKGKG    A+  F A S+RTR+ F S+FY MKSDNSGSLCGPV+DDV+
Sbjct  305   AGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVK  364

Query  295   LVSVR  281
             L+SVR
Sbjct  365   LLSVR  369



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   521 bits (1341),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 244/385 (63%), Positives = 305/385 (79%), Gaps = 6/385 (2%)
 Frame = -3

Query  1426  FISFSQLS*kkkkmkKTGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRV  1247
             F+S S  +          I L  LL A FH  +S   DG + NG+FE+GPK + M GT V
Sbjct  43    FLSISPYTELPTMHNAAVIFLSVLLSAAFHPALSLV-DGYLPNGDFERGPKASDMNGTVV  101

Query  1246  VDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSL  1067
               P+AIP WEISG+VEYIKSGQKQGDMLL+VPEG +AVRLG +A IK  +K VKG YYS+
Sbjct  102   KGPYAIPEWEISGFVEYIKSGQKQGDMLLVVPEGAFAVRLGNEASIKQKIKVVKGLYYSI  161

Query  1066  SFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLH  887
             +F+ ARTCAQEERLN+SV+P     DWG+LP+QT+Y+S+GWD Y+WAF AE++ V I++H
Sbjct  162   TFSAARTCAQEERLNISVAP-----DWGVLPMQTLYNSNGWDLYAWAFQAESDEVVILIH  216

Query  886   NPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVED  707
             NP  E+DPACGPLID++A+K+LNPP+    N++KNG+FE GPY+F N + GVL+PPN+ED
Sbjct  217   NPGEEEDPACGPLIDAIAIKTLNPPKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIED  276

Query  706   DHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFS  527
             DH P+PGW++ESLKAVKYIDSDHFSVP G+RAVELVAG+ESA+AQ+VRT PGK Y L F 
Sbjct  277   DHSPIPGWMVESLKAVKYIDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFV  336

Query  526   VGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHM  347
             VGDA+N+CEGSMVVEAFAGK TL+VP+QSKG G S  A  +F A S+RTR+ FLS+FY M
Sbjct  337   VGDASNSCEGSMVVEAFAGKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTM  396

Query  346   KSDNSGSLCGPVIDDVRLVSVRNPR  272
             +SD+  SLCGPV+D VRL+SVRNP+
Sbjct  397   RSDDFSSLCGPVLDKVRLLSVRNPK  421



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   518 bits (1334),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 239/369 (65%), Positives = 303/369 (82%), Gaps = 6/369 (2%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
               + L  LLCAT H  +S   DG + NGNFE+ PK + ++GT V+  +AIP WEISG+VE
Sbjct  4     VALFLSVLLCATCHSALSLI-DGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEISGFVE  62

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YIKSG KQGDMLL+VPEG YAVRLG +A IK  +K  KG YYS++F+ ARTCAQEERLN+
Sbjct  63    YIKSGHKQGDMLLVVPEGAYAVRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNI  122

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P+S     G+LP+QT+YSS+GWDSY+WAF ++ E +++VLHNP  E+DPACGPLIDS
Sbjct  123   SVAPDS-----GVLPIQTVYSSNGWDSYAWAFQSDYEQIELVLHNPGVEEDPACGPLIDS  177

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             +A+++L PPR    N+LKN  FEEGPY+F N +WGVLIPPN+EDDH PLPGW++ESLKAV
Sbjct  178   IAIRTLYPPRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAV  237

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYIDS+HFSVPEG+RAVELVAG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VEA
Sbjct  238   KYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEA  297

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAG+ T++VP++SKGKG   RA  +F A+S+RTRV FLS++Y M+SD+  SLCGPV+DDV
Sbjct  298   FAGRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDV  357

Query  298   RLVSVRNPR  272
             +L+S++NPR
Sbjct  358   KLLSLKNPR  366



>ref|XP_004302947.1| PREDICTED: uncharacterized protein LOC101306247 [Fragaria vesca 
subsp. vesca]
Length=373

 Score =   518 bits (1334),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 241/358 (67%), Positives = 296/358 (83%), Gaps = 1/358 (0%)
 Frame = -3

Query  1339  HLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLL  1160
             H  I+   DGL+ NGNFE GPK +QMKGT V   +AIP+WE SGYVEYIKSG KQGDMLL
Sbjct  16    HTSIAAPTDGLLPNGNFEYGPKPSQMKGTVVTAHNAIPNWETSGYVEYIKSGHKQGDMLL  75

Query  1159  LVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGM  980
             +VPEG +A+RLG +A IK  +K  KG +Y+++F+ ARTCAQEE LN+SV+PN E  D+G+
Sbjct  76    VVPEGGFAIRLGNEASIKQKIKVTKGGFYAITFSAARTCAQEEILNISVNPNVEKQDFGI  135

Query  979   LPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRR  800
             LP+QTMYSS GWDSY+W F A+A+ +++ +HNP  E+DPACGPLIDSVALK L  P+R R
Sbjct  136   LPIQTMYSSTGWDSYAWGFNADADEIELTIHNPGVEEDPACGPLIDSVALKVLEIPKRTR  195

Query  799   GNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEG  620
              N+LKNGNFEEGPY+F NT+WGVLIPP++EDDH PLPGWIIESLKAVKYIDS HF+VPEG
Sbjct  196   ANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKHFAVPEG  255

Query  619   RRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQS  440
             RRA+EL+AG+ESALAQVV T+PG+ Y L FSVGD NN CEGS+ +EAFAGK T++VP++S
Sbjct  256   RRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGNNGCEGSLFIEAFAGKETVKVPYES  315

Query  439   KGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN-PRI  269
             KGKG   +A+  FTA+S RTRV FLS+ Y M SD+SGSLCGPVIDDV+L+S+R  PR+
Sbjct  316   KGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHSGSLCGPVIDDVKLLSIRGRPRV  373



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   518 bits (1334),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 243/363 (67%), Positives = 301/363 (83%), Gaps = 1/363 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL L  AT H  +S T DGL+ NG+FE GPK +++KG+ V  P+ IPHW ISG VEYIK
Sbjct  8     LLLVLFFATCHSSLSIT-DGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWTISGMVEYIK  66

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDM+L+VP G YAVRLG +A IK  ++ VKG +YSL+F+ +RTCAQEE+LNVSV 
Sbjct  67    SGQKQGDMVLVVPHGTYAVRLGNEASIKQKIQVVKGMFYSLTFSASRTCAQEEKLNVSVV  126

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P++E +DWG+ P+QTMY S+G DSY+  F A+   V+IV+HNP  ++DPACGPLIDSVAL
Sbjct  127   PSNEKSDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVIHNPGVDEDPACGPLIDSVAL  186

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L+ P+R R N+LKNGNFEEGPY+F   +WGVLIPP++ED + PLPGW++ESLKAVKYI
Sbjct  187   KLLHSPKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSPLPGWMVESLKAVKYI  246

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHF+VPEG+RA+ELVAG+ESA+AQVV T  GKVYDL F VGDANN+CEGSMVVEAFAG
Sbjct  247   DSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCEGSMVVEAFAG  306

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K T+QV +QSKGKG  +R K RF A+S+RTR+RFLS+FY  KSDN+GSLCGP+IDD+RL+
Sbjct  307   KDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGSLCGPIIDDIRLL  366

Query  289   SVR  281
             SVR
Sbjct  367   SVR  369



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   518 bits (1334),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 243/363 (67%), Positives = 301/363 (83%), Gaps = 1/363 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL L  AT H  +S T DGL+ NG+FE GPK +++KG+ V  P+ IPHW ISG VEYIK
Sbjct  6     LLLVLFFATCHSSLSIT-DGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWTISGMVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDM+L+VP G YAVRLG +A IK  ++ VKG +YSL+F+ +RTCAQEE+LNVSV 
Sbjct  65    SGQKQGDMVLVVPHGTYAVRLGNEASIKQKIQVVKGMFYSLTFSASRTCAQEEKLNVSVV  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P++E +DWG+ P+QTMY S+G DSY+  F A+   V+IV+HNP  ++DPACGPLIDSVAL
Sbjct  125   PSNEKSDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVIHNPGVDEDPACGPLIDSVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L+ P+R R N+LKNGNFEEGPY+F   +WGVLIPP++ED + PLPGW++ESLKAVKYI
Sbjct  185   KLLHSPKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSPLPGWMVESLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHF+VPEG+RA+ELVAG+ESA+AQVV T  GKVYDL F VGDANN+CEGSMVVEAFAG
Sbjct  245   DSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCEGSMVVEAFAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K T+QV +QSKGKG  +R K RF A+S+RTR+RFLS+FY  KSDN+GSLCGP+IDD+RL+
Sbjct  305   KDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGSLCGPIIDDIRLL  364

Query  289   SVR  281
             SVR
Sbjct  365   SVR  367



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   518 bits (1333),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 243/362 (67%), Positives = 298/362 (82%), Gaps = 2/362 (1%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             ++L LLCA   + +SF  DGLV NG+FE+GPK  QM GT VVDPH++PHWE+SG+VEYIK
Sbjct  6     VVLVLLCAILPVALSFI-DGLVPNGDFEEGPKPWQMHGTEVVDPHSVPHWELSGFVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDM+L VP+G +A+RLG +A IKT V+  KG +YSLSF  ARTCAQ+E+LN+SVS
Sbjct  65    SGQKQGDMILPVPKGHFALRLGNEASIKTKVQVAKGLFYSLSFGAARTCAQQEQLNLSVS  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PNSEP DWGMLP+QTMYS++GWDS+SW FLAE+  V+++ H+P  ++D ACGP+ID VAL
Sbjct  125   PNSEPKDWGMLPMQTMYSTEGWDSFSWGFLAESNEVEVIFHHPQTQEDRACGPIIDLVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             KS   P++ R ++L+NGNFEEGPY+  NT+WG+LIPPNVEDDH PL GW++ESLKAV+YI
Sbjct  185   KSFTLPKKSR-DILQNGNFEEGPYVLPNTSWGILIPPNVEDDHSPLVGWMVESLKAVRYI  243

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHF+VPEG+RAVELVAGRES++AQVV+T PGK YDL F VGDA N CEGSM+VE  A 
Sbjct  244   DSDHFAVPEGKRAVELVAGRESSVAQVVKTVPGKDYDLEFYVGDARNMCEGSMLVEVNAS  303

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
               T  VP++SKGKG S  A  RF A + RTR+RFLSS+YHMKSD SGSLCGPV+D VRLV
Sbjct  304   NSTFYVPYESKGKGGSKLALLRFKAETGRTRIRFLSSYYHMKSDFSGSLCGPVVDGVRLV  363

Query  289   SV  284
              V
Sbjct  364   RV  365



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   516 bits (1330),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 244/367 (66%), Positives = 301/367 (82%), Gaps = 6/367 (2%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
              ++L  LL AT H   S   DG + NGNFE  PK + +KG+ V+  +AIP WEISG+VEY
Sbjct  5     AVLLSVLLFATCHSAFSLI-DGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEY  63

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             IKSGQKQGDMLL+VP+G YAVRLG +A IK ++K  KG YYS++F+ ARTCAQEERLNVS
Sbjct  64    IKSGQKQGDMLLVVPZGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVS  123

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P+S     G+LP+QT+YSS+GWDSY+WAF A+ E V++VLHNP  E+DPACGPLIDSV
Sbjct  124   VAPDS-----GVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGVEEDPACGPLIDSV  178

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+++L PPR    N+LKN  FEEGPY+F NT+WGVLIPPN+EDDH PLPGW++ESLKAVK
Sbjct  179   AIRTLYPPRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVK  238

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVPEG+RAVELVAG+ESA+AQVVRT PGK Y L FSVGDA+N+CEGSM+VEAF
Sbjct  239   YIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAF  298

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             A K T++VP++SKGKG   RA  +F A S+RTRV FLS++Y M+SD+  SLCGPV+DDV+
Sbjct  299   ADKNTVKVPYESKGKGGFKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVK  358

Query  295   LVSVRNP  275
             L+S+R P
Sbjct  359   LLSLRKP  365



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   517 bits (1331),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 247/365 (68%), Positives = 297/365 (81%), Gaps = 1/365 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL L  +     +S+T DGL+ NG+FE GPK + +KGT V    AIP+W +SGYVEYIK
Sbjct  6     VLLVLFLSVCQGALSYT-DGLLPNGDFEVGPKASNLKGTVVTTHDAIPNWTVSGYVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VPEG YAVRLG +A+IK  VK  KG+ YS++F+ ARTCAQEE+LNVSV 
Sbjct  65    SGQKQGDMLLVVPEGAYAVRLGNEAYIKQKVKLNKGSSYSITFSAARTCAQEEKLNVSVV  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P SE  D+G++P+QTMY S+GW+S++  F A+    +IV+HN   E DPACGPLIDSVAL
Sbjct  125   PTSEKRDYGIIPIQTMYGSNGWESFACGFRADYPEGEIVIHNSGVEDDPACGPLIDSVAL  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K LNPP R R N+LKNGNFEEGPY+F N +WGVLIPP++ED H PLPGWI+ESLKAVKYI
Sbjct  185   KVLNPPIRTRANLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHGPLPGWIVESLKAVKYI  244

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DS+HF+VPEG+RA+ELVAG+ESALAQ V T  GKVY L F+VGDANNACEGSM VEAFAG
Sbjct  245   DSEHFTVPEGKRAIELVAGKESALAQEVFTTIGKVYVLTFAVGDANNACEGSMTVEAFAG  304

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             + T+QVP+QSKGKG  VR K RF A + RTR+RFLS+FY MK+DNSGSLCGPVIDDV+L+
Sbjct  305   RDTVQVPYQSKGKGGFVRGKLRFKASTRRTRIRFLSTFYTMKNDNSGSLCGPVIDDVKLL  364

Query  289   SVRNP  275
             SVR P
Sbjct  365   SVRYP  369



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   515 bits (1327),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 300/368 (82%), Gaps = 6/368 (2%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
               ++L  LL AT H   S   DG + NGNFE  PK + +KG+ V+  +AIP WEISG+VE
Sbjct  8     VAVLLSVLLFATCHSAFSLI-DGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVE  66

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YIKSGQKQGDMLL+VPEG YAVRLG +A IK ++K  KG YYS++F+ ARTCAQEERLNV
Sbjct  67    YIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNV  126

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P+S     G+LP+QT+YSS+GWDSY+WAF A+ E V++VLHNP  E+DPACGPLIDS
Sbjct  127   SVAPDS-----GVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGVEEDPACGPLIDS  181

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+++L PPR    N+LKN  FEEGPY+F N +WGVLIPPN+EDDH PLPGW++ESLKAV
Sbjct  182   VAIRTLYPPRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAV  241

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYIDSDHFSVPEG+RAVELVAG+ESA+AQVVRT PGK Y L FSVGDA+N+CEGSM+VEA
Sbjct  242   KYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEA  301

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FA K T++VP++SKGKG   RA  +F A S+RTRV FLS++Y M+SD+  SLCGPV+DDV
Sbjct  302   FADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDV  361

Query  298   RLVSVRNP  275
             +L+S+R P
Sbjct  362   KLLSLRKP  369



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   513 bits (1322),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 300/368 (82%), Gaps = 6/368 (2%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
               ++L  +L AT H   S   DG + NGNFE  PK + +KG+ V+  +AIP WEISG+VE
Sbjct  4     VAVLLSVVLFATCHSAFSLI-DGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVE  62

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YIKSGQKQGDMLL+VPEG YAVRLG +A IK ++K  KG YYS++F+ ARTCAQEERLNV
Sbjct  63    YIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNV  122

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P+S     G+LP+QT+YSS+GWDSY+WAF A+ E V++VLHNP  E+DPACGPLIDS
Sbjct  123   SVAPDS-----GVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGVEEDPACGPLIDS  177

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+++L PPR    N+LKN  FEEGPY+F N +WGVLIPPN+EDDH PLPGW++ESLKAV
Sbjct  178   VAIRTLYPPRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAV  237

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYIDSDHFSVPEG+RAVELVAG+ESA+AQVVRT PGK Y L FSVGDA+N+CEGSM+VEA
Sbjct  238   KYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEA  297

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FA K T++VP++SKGKG   RA  +F A S+RTRV FLS++Y M+SD+  SLCGPV+DDV
Sbjct  298   FADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDV  357

Query  298   RLVSVRNP  275
             +L+S+R P
Sbjct  358   KLLSLRKP  365



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   512 bits (1319),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 236/367 (64%), Positives = 300/367 (82%), Gaps = 6/367 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +++L L+CA F++ +S T DGL+ NGNFE    +  + GT V+  +AIP W ISG+VEYI
Sbjct  10    LLVLVLMCAIFNISLSLT-DGLLKNGNFEMPLAKGNLNGTVVLKHNAIPEWSISGFVEYI  68

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             K+GQKQGDMLL+VPEG  AVRLG +A IK  +   KG YYSL+F+ ARTCAQEER+NVSV
Sbjct  69    KAGQKQGDMLLVVPEGYAAVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQEERINVSV  128

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     D+G+LP+QT+YSS GWDSY+WAF AE   V+++LHNP  E+DPACGPLIDS+A
Sbjct  129   TP-----DFGVLPIQTLYSSSGWDSYAWAFQAEFSQVEVLLHNPGVEEDPACGPLIDSIA  183

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             ++SL PPR    N+LKNG+FEEGPYIF NT+WGVL+PPN+EDDH PLP W++ESLKAVKY
Sbjct  184   IRSLYPPRATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKY  243

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +DSDHFSVP+G+RA+ELVAG+ESA+AQV RT  GK+Y+L F VGDA+N+CEGSM+VEAFA
Sbjct  244   LDSDHFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGSMIVEAFA  303

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G  TL+VP++SKGKG   RA  RF A ++RTR+ FLS++YH +SD+  SLCGPV+DDV+L
Sbjct  304   GMDTLKVPYESKGKGGYKRAVLRFKATANRTRIMFLSTYYHTRSDDFVSLCGPVVDDVKL  363

Query  292   VSVRNPR  272
             +SVRNPR
Sbjct  364   LSVRNPR  370



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   512 bits (1318),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 239/367 (65%), Positives = 298/367 (81%), Gaps = 6/367 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             I L  LL A FH  +S   DG + NG+FE+GP  + M GT V  P+AIP WEISG+VEYI
Sbjct  7     IFLSVLLSAAFHPALSLV-DGYLPNGDFERGPNASDMNGTVVKGPYAIPEWEISGFVEYI  65

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSGQKQGDMLL+VPEG +AVRLG +A IK  +K VKG YYS++F+ ARTCAQEERLN+SV
Sbjct  66    KSGQKQGDMLLVVPEGAFAVRLGNEASIKQKIKVVKGLYYSITFSAARTCAQEERLNISV  125

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     DWG+LP+QT+Y+S+GWD Y+WAF AE++ V I++HNP  E+DPACGPLID++A
Sbjct  126   AP-----DWGVLPMQTLYNSNGWDLYAWAFQAESDEVVILIHNPGEEEDPACGPLIDAIA  180

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             +K+L PP+    N++KNG+FE GPY+F N + GVL+PPN+EDDH P+PGW++ESLKAVKY
Sbjct  181   IKTLYPPKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSPIPGWMVESLKAVKY  240

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDSDHFSVP G+RAVELVAG+ESA+AQ+VRT PGK Y L F VGDA+N+CEGSMVVEAFA
Sbjct  241   IDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNSCEGSMVVEAFA  300

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK TL+VP+QSKG G S  A  +F A S+RTR+ FLS+FY M+SD+  SLCGPV+D VRL
Sbjct  301   GKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSSLCGPVLDKVRL  360

Query  292   VSVRNPR  272
             +SVRNP+
Sbjct  361   LSVRNPK  367



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   511 bits (1316),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 241/366 (66%), Positives = 297/366 (81%), Gaps = 6/366 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             ++ + L+ AT H V +FT DGL+ NG+FE+GPK + MKG+ V++ HAIP+WE+SG+VEYI
Sbjct  8     LVSVLLVFATCHFVSAFT-DGLLPNGDFEKGPKPSDMKGSEVLNRHAIPNWELSGFVEYI  66

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSGQKQGDMLL+VPEG +AVRLG +A IK  V   KG  Y+++F  ARTCAQEE+LNVSV
Sbjct  67    KSGQKQGDMLLVVPEGAFAVRLGNEASIKQRVSVTKGMNYAITFCAARTCAQEEQLNVSV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     +WG+LP+QT+YSS GWD Y+W F+A ++  +I++HNP  E+DPACGPLIDSVA
Sbjct  127   TP-----EWGVLPMQTLYSSSGWDCYAWGFVALSKVAEIMIHNPGVEEDPACGPLIDSVA  181

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             ++ L PP+R   N+LKNGNFEEGPYIF NT+WG LIPPN+ED H PLPGW+IESLKAVKY
Sbjct  182   MRVLYPPKRTGLNLLKNGNFEEGPYIFRNTSWGTLIPPNIEDAHSPLPGWMIESLKAVKY  241

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +DSDHF VP G+RA+ELVAG+ESA+AQVVRT PGK+Y L F+VGDANNAC GSMVVEAFA
Sbjct  242   LDSDHFFVPSGKRAIELVAGKESAIAQVVRTVPGKLYALTFTVGDANNACSGSMVVEAFA  301

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK T +VP+ SKGKG   RA  RF A  +RTR+ F S+FY M+SD+  SLCGPVIDDVRL
Sbjct  302   GKDTAKVPYNSKGKGGFKRAVLRFVATQTRTRIMFYSTFYSMRSDDFSSLCGPVIDDVRL  361

Query  292   VSVRNP  275
             VSVR P
Sbjct  362   VSVRRP  367



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   510 bits (1313),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 245/360 (68%), Positives = 291/360 (81%), Gaps = 8/360 (2%)
 Frame = -3

Query  1351  CATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQG  1172
             C+  H+  + T DGL+ NGNFE  PK ++M GT+V+  +AIP WEISG+VEYI+SG KQG
Sbjct  13    CSAVHIAFAMT-DGLLPNGNFEATPKASEMNGTQVLGRYAIPQWEISGFVEYIESGHKQG  71

Query  1171  DMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPN  992
             DMLL+VPEG YAVRLG +A IK  +  VKG YYS++F+ ARTCAQ+ERLNVSV+P+S   
Sbjct  72    DMLLVVPEGAYAVRLGNEASIKQKLTVVKGMYYSITFSAARTCAQDERLNVSVTPDS---  128

Query  991   DWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPP  812
               GMLP+QTMY S GWDSY+WAF A  E V +V+HNP  E+DPACGPLIDSVA+K+L PP
Sbjct  129   --GMLPIQTMYGSVGWDSYAWAFRALFEVVHLVIHNPGVEEDPACGPLIDSVAIKTLYPP  186

Query  811   RRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFS  632
             R  R N+LKN +FEEGPY+F NTTWGVLIPPN+EDDH PLPGW++ESLKAVKYIDSDHFS
Sbjct  187   RLTRDNLLKNRDFEEGPYVFPNTTWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHFS  246

Query  631   VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQV  452
             VP G+RAVELVAG+ESALAQV RT PGKVY L FSVGDA N C GSMVVEAFA + T+++
Sbjct  247   VPHGKRAVELVAGKESALAQVARTIPGKVYTLTFSVGDAGNGCVGSMVVEAFASRGTVKI  306

Query  451   PFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             P++SKG G   RA  RFTA   RTRV FLS+FYH K+D  GSLCGPV+DDV L+SVR+PR
Sbjct  307   PYESKGTGGYKRAVLRFTAAVERTRVVFLSTFYHTKTD--GSLCGPVVDDVSLLSVRSPR  364



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   509 bits (1311),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 234/346 (68%), Positives = 293/346 (85%), Gaps = 5/346 (1%)
 Frame = -3

Query  1312  GLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAV  1133
             G + NGNFE  PK + +KG+ V+  +AIP WEISG+VEYIKSGQKQGDMLL+VPEG YAV
Sbjct  5     GYLENGNFELPPKPSDLKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYAV  64

Query  1132  RLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSS  953
             RLG +A IK ++K +KG YYS++F+ ARTCAQEERLN+SV+P+S     G+LP+QT+YSS
Sbjct  65    RLGNEALIKQSIKVIKGLYYSITFSAARTCAQEERLNISVAPDS-----GVLPIQTVYSS  119

Query  952   DGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNF  773
             +GWDSY+WAF A+ E +++VLHNP  E+DPACGPLIDSVA ++L PPR    N++KN  F
Sbjct  120   NGWDSYAWAFQADYETIELVLHNPGVEEDPACGPLIDSVAFRTLYPPRATNKNLIKNAGF  179

Query  772   EEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAG  593
             EEGPY+F NT+WGVLIPPN+EDDH PLPGW++ESLKAVKYIDSDHFSVPEG+RAVELVAG
Sbjct  180   EEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHFSVPEGKRAVELVAG  239

Query  592   RESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRA  413
             +ESA+AQVVRT PGK Y L FSVGDA+N+CEGS++VEAFAGK T++VP++SKGKG   RA
Sbjct  240   KESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSLIVEAFAGKNTVKVPYESKGKGGFKRA  299

Query  412   KHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
               +F A+S+RTRV FLS++Y M+SD+  SLCGPV+DDV+L+S+R P
Sbjct  300   VLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLRKP  345



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   508 bits (1309),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 238/369 (64%), Positives = 301/369 (82%), Gaps = 8/369 (2%)
 Frame = -3

Query  1375  GIILLALL-CATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYV  1202
             G + L+LL CATFH+ +SF  DGLVANGNFE GPK + +KGT +     AIP WEISG+V
Sbjct  4     GFLFLSLLFCATFHVSLSFN-DGLVANGNFELGPKASDLKGTVITGGKTAIPEWEISGFV  62

Query  1201  EYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLN  1022
             EYIKSGQKQGDMLL+VPEG YAVRLG +A IK  +K +KG +YS++F  ARTCAQEER+N
Sbjct  63    EYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMHYSITFMVARTCAQEERIN  122

Query  1021  VSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLID  842
             +SV+P     D+G++P+QT+Y+S GWD   + F A+ + V++V+HNP  E+DPACGPLID
Sbjct  123   ISVAP-----DFGIIPIQTLYTSSGWDPIGYGFKAQYDVVEMVIHNPGVEEDPACGPLID  177

Query  841   SVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKA  662
             SVAL++L PP+    N+LKNG FEEGPYIF NT++GV+IPPN+ED+H PLPGW++ESLKA
Sbjct  178   SVALRTLYPPKATNKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSPLPGWMVESLKA  237

Query  661   VKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVE  482
             VKY+DS HFSVPEG RA+ELVAG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VE
Sbjct  238   VKYLDSSHFSVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVE  297

Query  481   AFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDD  302
             AFAG+ T++VP+QSKGKG   RA  +F A+ SRTR+ FLS+FY M++D+  SLCGPVIDD
Sbjct  298   AFAGRDTVKVPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLSSLCGPVIDD  357

Query  301   VRLVSVRNP  275
             V+L+S+R P
Sbjct  358   VKLLSLRKP  366



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   508 bits (1309),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 239/372 (64%), Positives = 302/372 (81%), Gaps = 10/372 (3%)
 Frame = -3

Query  1375  GIILLA-LLCATFHLVISFT----PDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEIS  1211
             G++LL+ LLCAT+H+ +S T     +GL+ NGNFEQ P  + MKGT VV  +AIP W   
Sbjct  3     GLVLLSVLLCATYHIALSATNVTVAEGLLDNGNFEQAPNASNMKGTVVVGRYAIPGWVNE  62

Query  1210  GYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEE  1031
             G+VEYIKSGQKQGDMLL+VPEG YAVRLG +A IK  +K VKG YYS++F+ ARTCAQEE
Sbjct  63    GFVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQEIKVVKGMYYSITFSAARTCAQEE  122

Query  1030  RLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGP  851
             RLNV+V+P+S     G++P+QT+YSS GWD+Y+WAF ++++AV +++HNP  E+DPACGP
Sbjct  123   RLNVTVAPDS-----GVMPIQTVYSSSGWDNYAWAFKSQSDAVMLIIHNPGVEEDPACGP  177

Query  850   LIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES  671
             LID+VA+K+L PPR    N++KNG FEEGPYIF NT WGVLIPPN+EDD+ PLP W++ES
Sbjct  178   LIDAVAIKALYPPRPTNKNIIKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSPLPAWVVES  237

Query  670   LKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSM  491
             LKAVKYIDS H+ VP+GRRAVELV G+ESA+AQ+ RT  GK Y L FSVGDANN+C GS+
Sbjct  238   LKAVKYIDSAHYFVPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSL  297

Query  490   VVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPV  311
             VVEAFAGK TL+VP++SKG G   RA  RF A+S+RTR+ FLS+FY M+SD+  SLCGPV
Sbjct  298   VVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPV  357

Query  310   IDDVRLVSVRNP  275
             +DDV+L+S+RNP
Sbjct  358   VDDVKLLSIRNP  369



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   506 bits (1303),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 238/362 (66%), Positives = 294/362 (81%), Gaps = 6/362 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT H   S   DGLV NGNFE GPK + +KGT ++  +A+P WEISG+VEYIK+
Sbjct  8     LSVLLLATCHFAFSIK-DGLVENGNFEVGPKPSDLKGTEMIGRYALPKWEISGFVEYIKA  66

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VPEG YAVRLG +A IK  +   KG YYS++F+ ARTCAQEE LN+S+SP
Sbjct  67    GQKQGDMLLVVPEGAYAVRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISP  126

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
                  +WG+LP+QTMYSS+GWDSY+WAF A  + V++V+HNP  E+DPACGPLIDSVA+K
Sbjct  127   -----EWGVLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGVEEDPACGPLIDSVAIK  181

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N++KNG FEEGPY+  NT+WGVLIPPN+ED H PLPGW++ESLKAVK+ID
Sbjct  182   ALYPPRPTNKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFID  241

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRA+ELVAG+ESA+AQVVRT  GK Y L F+VGDA+N+CEGSMVVEAFAGK
Sbjct  242   IEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSMVVEAFAGK  301

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++SKGKG   RA  +F A+SSRTRV F S+FY M+SD+  SLCGPV+DDV+L+S
Sbjct  302   DTLKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFSSLCGPVVDDVKLLS  361

Query  286   VR  281
             +R
Sbjct  362   LR  363



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   506 bits (1304),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 237/361 (66%), Positives = 295/361 (82%), Gaps = 7/361 (2%)
 Frame = -3

Query  1357  LLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEYIKSGQ  1181
             L C+TFH+ +S   DGLVANGNFE GPK +++KGT V    ++IP WEISG VEYIKSGQ
Sbjct  20    LFCSTFHVSLSLI-DGLVANGNFELGPKPSELKGTVVTGGKNSIPEWEISGLVEYIKSGQ  78

Query  1180  KQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNS  1001
             KQGDMLL+VPEG YAVRLG +A IK  +K +KG YYS++F  ARTCAQEER+N+SV+P  
Sbjct  79    KQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP--  136

Query  1000  EPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSL  821
                D+G++P+QT+Y+S GWD  ++ F AE + V++V+HNP  E+DPACGPLIDSVAL++L
Sbjct  137   ---DFGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGVEEDPACGPLIDSVALRTL  193

Query  820   NPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSD  641
              PP+    N+LKNG FEEGPYIF NT++GV+IPPN+EDDH PLPGW++ESLKAVKY+DS 
Sbjct  194   YPPKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSG  253

Query  640   HFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLT  461
             HFSVP+G RAVELVAG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VEAFAGK T
Sbjct  254   HFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDT  313

Query  460   LQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
             ++VP+ SKGKG   RA  +F A+ +RTRV FLS+FY M+SD+  SLCGPVIDDV+L+SVR
Sbjct  314   IKVPYSSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVR  373

Query  280   N  278
              
Sbjct  374   K  374



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   506 bits (1302),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 233/348 (67%), Positives = 290/348 (83%), Gaps = 5/348 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG + NGNFE  PK + +KGT V+  +AIP WEISG+VEYIKSGQKQGDMLL+VPEG YA
Sbjct  25    DGYLENGNFELAPKPSDLKGTEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYA  84

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  +   KG YYS++F+ ARTCAQEERLN+SV+P+S     G+LP+QT+YS
Sbjct  85    VRLGNEASIKQRINVTKGLYYSITFSAARTCAQEERLNISVAPDS-----GVLPIQTVYS  139

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+GWDSY+WAF A+   +++VLHNP  E+DPACGPLIDS+A+++L PPR    N+LKN  
Sbjct  140   SNGWDSYAWAFQADFPQIELVLHNPGVEEDPACGPLIDSIAIRTLYPPRATNKNLLKNAG  199

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPY+F NT+WGVLIPPN+EDDH PLPGW++ESLKAVKYIDSDHFSVPEG+RAVELVA
Sbjct  200   FEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHFSVPEGKRAVELVA  259

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQ+VRT PGK Y L FSVGDA+N+CEGSM+VEAFAG+ T++VP++SKGKG   R
Sbjct  260   GKESAIAQIVRTIPGKTYMLTFSVGDASNSCEGSMIVEAFAGRDTIKVPYESKGKGGFKR  319

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             A  +F A+  RTR+ FLS+FY M+SD+  SLCGPV+DDV+L+S+R PR
Sbjct  320   AVLKFRAVGPRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSLRRPR  367



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   506 bits (1302),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 236/365 (65%), Positives = 291/365 (80%), Gaps = 0/365 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             ++L LLCA  H   S   +GL+ NGNFE GPK ++MKGT V++  AIP+WEISG VEYIK
Sbjct  8     VVLVLLCAISHTAFSAVRNGLLPNGNFEYGPKPSEMKGTLVLNRKAIPNWEISGEVEYIK  67

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SG  QGDMLL+VPEG +AVRLG +A IK  V+ +K  +YSL+F+ ARTCAQEE+LNVSVS
Sbjct  68    SGHTQGDMLLVVPEGAFAVRLGNEASIKQKVRMIKDGFYSLTFSAARTCAQEEKLNVSVS  127

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
              + EPNDWG+LP+QTMYSS+GWDSYS+ F A+A  ++I++HNP  E+DPACGP+IDSVAL
Sbjct  128   RSLEPNDWGILPMQTMYSSNGWDSYSYGFKADASQIEIIIHNPGVEEDPACGPVIDSVAL  187

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L+ P+R R N+LKNGNFEEGPY+F N  WGVLIPP+++D H PLPGWII+SLKAVKYI
Sbjct  188   KLLSLPKRTRANLLKNGNFEEGPYVFPNAPWGVLIPPHIDDAHSPLPGWIIDSLKAVKYI  247

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHF VPEG+RA+ELV G+ES++AQ+VRT PGK Y L F+VGDA N+C GS+ +EAFAG
Sbjct  248   DSDHFHVPEGKRAIELVGGKESSIAQIVRTEPGKEYVLTFAVGDAKNSCVGSLGIEAFAG  307

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
               T +V + S G G   RAK RF A   RTRV F S+FY M SDNSG+LCGP +DDV+L+
Sbjct  308   NGTTKVVYVSTGSGGFKRAKLRFKATQWRTRVMFFSTFYTMTSDNSGTLCGPTLDDVKLI  367

Query  289   SVRNP  275
             SVR P
Sbjct  368   SVRTP  372



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   505 bits (1300),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 240/360 (67%), Positives = 296/360 (82%), Gaps = 6/360 (2%)
 Frame = -3

Query  1351  CATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQG  1172
             C    L  +FT DGL+ NGNFEQGPK  Q+KGT+V    AIP W+I+G+VEYI+ GQKQG
Sbjct  12    CVACQLAAAFT-DGLLPNGNFEQGPKPWQLKGTKVAGRDAIPRWQITGFVEYIQWGQKQG  70

Query  1171  DMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPN  992
             DMLL+VPEG YAVRLG DA IK +VK  KG  YSL+F+ ARTCAQEERLNVS SP S   
Sbjct  71    DMLLVVPEGSYAVRLGNDASIKQSVKVTKGVRYSLTFSAARTCAQEERLNVSASPES---  127

Query  991   DWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPP  812
               G+LP+QTMYSS+GWDSY+WA+LA+++ V++V+HN    +DPACGPLIDSVA+K L PP
Sbjct  128   --GVLPMQTMYSSNGWDSYAWAWLAKSDEVEVVIHNTGVSEDPACGPLIDSVAIKQLFPP  185

Query  811   RRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFS  632
             RR   N+LKNG+FEEGPYI  NTTWGVLIPP +EDDH PLPGW++ESLKAVKY+D++HFS
Sbjct  186   RRTNTNLLKNGDFEEGPYILPNTTWGVLIPPQIEDDHSPLPGWMVESLKAVKYLDAEHFS  245

Query  631   VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQV  452
             VP GRRAVEL+AG+ESA+AQVVRT PG+ Y L F+VGDA+NACEGS++VEAFAG+ T++V
Sbjct  246   VPRGRRAVELLAGKESAIAQVVRTVPGRRYALSFAVGDASNACEGSLLVEAFAGEHTIKV  305

Query  451   PFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             P++SKG+G S RA  +FTA ++RTRV F SS+Y+ +SD+  SLCGPV+DDV LVSVR P+
Sbjct  306   PYESKGRGGSKRAVLQFTATTARTRVVFWSSYYNTRSDDLSSLCGPVLDDVALVSVRYPK  365



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   504 bits (1299),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 240/365 (66%), Positives = 294/365 (81%), Gaps = 7/365 (2%)
 Frame = -3

Query  1372  IILLALLCAT-FHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             ++L  LL AT  H   SF  +GLV NGNFE  PK++ MKGT+++  +A+P WEISG+VEY
Sbjct  38    VLLSVLLFATNCHFAFSFI-EGLVENGNFELSPKQSDMKGTQMIGRYALPKWEISGFVEY  96

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             IK+GQKQGDMLL+VPEG YA+RLG +A IK  +   KG YYS++F+ ARTCAQEE LN+S
Sbjct  97    IKAGQKQGDMLLVVPEGAYAIRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNIS  156

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             VSP     +WG+LP+QTMYSS+GWDSY+WAF A    V+ V+HNP  E+DPACGPLIDSV
Sbjct  157   VSP-----EWGVLPMQTMYSSNGWDSYAWAFKALISPVEFVIHNPGVEEDPACGPLIDSV  211

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A  SL PPR    N+LKNG FEEGPY+F NTTWGVLIPPN+ED H PLPGW++ESLKAVK
Sbjct  212   AFTSLYPPRPTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSPLPGWMVESLKAVK  271

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YID +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDA+N+CEGSMVVEAF
Sbjct  272   YIDVEHFSVPQGRRAVELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAF  331

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK TL+VP++SKGKG   RA  +F A+S+RTR+ F S+FY M+SD+  SLCGPVIDD++
Sbjct  332   AGKDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSSLCGPVIDDIK  391

Query  295   LVSVR  281
             L+S+R
Sbjct  392   LLSLR  396



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   503 bits (1296),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 233/360 (65%), Positives = 295/360 (82%), Gaps = 6/360 (2%)
 Frame = -3

Query  1351  CATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQG  1172
             CA F++ ++ T DGL+ NGNFE    +  + GT V+  +AIP W ISG+VEYIK+GQKQG
Sbjct  17    CAIFNISLALT-DGLLKNGNFEMPLAKADLNGTVVLKHNAIPEWSISGFVEYIKAGQKQG  75

Query  1171  DMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPN  992
             DMLL+VPEG  AVRLG +A IK  +   KG YYSL+F+ ARTCAQEER+NVSV+P     
Sbjct  76    DMLLVVPEGYAAVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQEERINVSVTP-----  130

Query  991   DWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPP  812
             D+G+LP+QT+YSS GWDSY+WAF AE   V+++LHNP  E+DPACGPLIDSVA+++L PP
Sbjct  131   DFGVLPIQTLYSSSGWDSYAWAFQAEFSQVEVLLHNPGVEEDPACGPLIDSVAIRTLYPP  190

Query  811   RRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFS  632
             R    N+LKNG+FEEGPYIF NT+WGVL+PPN+EDDH PLP W++ESLKAVKY+DSDHFS
Sbjct  191   RATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDHFS  250

Query  631   VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQV  452
             VP+G+RA+ELVAG+ESA+AQV RT  GK+Y+L F VGDA+N+CEGSM+VEAFAG+ TL+V
Sbjct  251   VPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGSMIVEAFAGRDTLKV  310

Query  451   PFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             P++SKGKG   RA  RF A ++RTR+ FLS++YH +SD+  SLCGPV+DDV+L+SVRNPR
Sbjct  311   PYESKGKGGFKRAVLRFKANANRTRIMFLSTYYHTRSDDYVSLCGPVVDDVKLLSVRNPR  370



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   503 bits (1296),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 244/378 (65%), Positives = 296/378 (78%), Gaps = 16/378 (4%)
 Frame = -3

Query  1375  GIILLA-LLCATFHLVISFT----------PDGLVANGNFEQGPKRNQMKGTRVVDPHAI  1229
             G+IL++ LLCAT HL +S T           DGL+ NGNFE+ P    MKGT VV  +AI
Sbjct  3     GVILVSVLLCATCHLALSATNGTAERNGTVADGLLDNGNFERAPNATNMKGTVVVGRYAI  62

Query  1228  PHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFAR  1049
             P W   G+VEYIKSGQKQGDMLL+VPEG YAVRLG DA IK  +K + G YYS++F+ AR
Sbjct  63    PGWINEGFVEYIKSGQKQGDMLLVVPEGAYAVRLGNDASIKQAIKVIVGLYYSITFSAAR  122

Query  1048  TCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEK  869
             TCAQEERLNV+V+P+S     G+LP+QT+YSS+GWDSY+WAF A A  +++++HN   E+
Sbjct  123   TCAQEERLNVTVAPDS-----GVLPIQTVYSSNGWDSYAWAFKAIAAVIELIIHNTGKEE  177

Query  868   DPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLP  689
             DPACGPLID+VA+K+L PPR    N+LKN  FEEG YIF NT WGVLIPPN+EDDH PLP
Sbjct  178   DPACGPLIDAVAIKALYPPRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHSPLP  237

Query  688   GWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANN  509
             GW++ESLKAVKYIDSDH+ VP+GRRAVELVAG+ESA+AQV RT  GK Y L FSVGDANN
Sbjct  238   GWMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANN  297

Query  508   ACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSG  329
             +C GSMVVEAFAGK TL+VP++SKG G   RA   F A+S+RTR+ FLS+FY M+SD+  
Sbjct  298   SCAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFS  357

Query  328   SLCGPVIDDVRLVSVRNP  275
             SLCGPV+DDV+L+SVR P
Sbjct  358   SLCGPVVDDVKLLSVRKP  375



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   503 bits (1295),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 239/367 (65%), Positives = 297/367 (81%), Gaps = 6/367 (2%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             G  +L L+ + FH+   F  DGL+ NG+FE GP R+ MKGT+V++  AIP+WEISG+VEY
Sbjct  3     GFAVLVLIQSIFHVTFCFE-DGLLPNGDFEHGPSRSDMKGTQVMNSKAIPNWEISGFVEY  61

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             I SG KQGDMLL+VP+G +AVRLG +A IK +VK  KG+YY+++F+ ARTCAQ+ERLNVS
Sbjct  62    IPSGHKQGDMLLVVPKGSFAVRLGNEASIKQSVKVAKGSYYAITFSAARTCAQDERLNVS  121

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
              +P+      G+LP+QT+YSS GWD YSWAF A+AE V+IV+HNP  E+D ACGPLID V
Sbjct  122   AAPHH-----GVLPIQTVYSSSGWDLYSWAFKAQAEYVEIVIHNPGVEEDSACGPLIDGV  176

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+++L PPR    N+LKNG FEEGP++  N + GVLIPPN+EDDH PLPGWI+ESLKAVK
Sbjct  177   AMRALFPPRPTNKNILKNGGFEEGPWVLPNASSGVLIPPNIEDDHSPLPGWIVESLKAVK  236

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             +IDSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK Y L F+VGDA+NAC GSMVVEAF
Sbjct  237   FIDSDHFSVPQGRRAVELVAGKESAIAQVVRTIPGKTYVLSFAVGDASNACSGSMVVEAF  296

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++VP++SKGKG   RA  RF AIS+RTR+ F S+FY M+SD+  SLCGPVIDDV+
Sbjct  297   AGKDTVKVPYESKGKGGFKRASLRFVAISNRTRIMFFSTFYSMRSDDFSSLCGPVIDDVK  356

Query  295   LVSVRNP  275
             L+S R P
Sbjct  357   LLSARKP  363



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   503 bits (1294),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 243/367 (66%), Positives = 302/367 (82%), Gaps = 6/367 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             ++  LLCAT  L  +F  DGLV NGNFE  PK + MKGT V+  +AIP WEISG+VEYIK
Sbjct  8     VVAVLLCATCRLGCAFI-DGLVPNGNFELAPKPSDMKGTVVIGKYAIPKWEISGFVEYIK  66

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VPEG +AVRLG +A IK  ++  KG YYS++F+ ARTCAQEE+LN+SV+
Sbjct  67    SGQKQGDMLLVVPEGAFAVRLGNEASIKQRLRVQKGMYYSITFSAARTCAQEEKLNISVA  126

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P+S     G+LP+QT+YSS+GWDSY+WAF AE +  +IV+HNP  E+DPACGPLIDS+A+
Sbjct  127   PDS-----GVLPMQTLYSSNGWDSYAWAFQAELDVAEIVIHNPGVEEDPACGPLIDSIAI  181

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             ++L PPR    N+LKNG FEEGPYIF NT+WGVLIPPN+EDDH PLPGW++ESLKAVKYI
Sbjct  182   RALYPPRATNKNLLKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYI  241

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DS HFSVP G RA+ELVAG+ESA+AQV RT PGK Y L+F+VGDA+N+CEGSM+VEAFAG
Sbjct  242   DSAHFSVPGGYRAIELVAGKESAIAQVARTIPGKTYTLFFAVGDASNSCEGSMIVEAFAG  301

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             + T++VP++SKGKG   RA  RF A+S+RTR+ F S+FY M+SD+  SLCGPV+DDV L+
Sbjct  302   RDTIKVPYESKGKGGFKRAVLRFKAVSTRTRIMFYSTFYTMRSDDFSSLCGPVVDDVVLL  361

Query  289   SVRNPRI  269
             SVRNPR+
Sbjct  362   SVRNPRL  368



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   504 bits (1297),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 233/367 (63%), Positives = 296/367 (81%), Gaps = 6/367 (2%)
 Frame = -3

Query  1369  ILLALLC-ATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +L  LLC AT HL      DGL+ NGNFEQ PK +++ GT V+ PHA+P W+ISG+VEYI
Sbjct  41    VLSVLLCLATCHLPAFAFRDGLLDNGNFEQAPKSSELNGTIVLKPHAVPKWQISGFVEYI  100

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             K+GQKQGDMLL+VPEG  AVRLG +A IK  +   KG +YSL+F+ ARTCAQEER+NVSV
Sbjct  101   KAGQKQGDMLLVVPEGYAAVRLGNEASIKQLINVTKGMFYSLTFSAARTCAQEERVNVSV  160

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     D+G+LP+QT+YSS+GWDSY+WAF    +  +I++HNP  E+DPACGPLIDSVA
Sbjct  161   AP-----DYGVLPIQTLYSSNGWDSYAWAFRTSYDVAEILIHNPGVEEDPACGPLIDSVA  215

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             +++L PP+    N+LKNG+FEEG YIF NT+WGVLIPPN+EDD+ PLP W++ESLKAVKY
Sbjct  216   IRALYPPKPTNQNLLKNGDFEEGAYIFPNTSWGVLIPPNIEDDNSPLPAWMVESLKAVKY  275

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             ID+ HFSVP G+RA+ELV G+ESA+AQV RT  GK Y L F+VGDA+N+CEGSM+VEAFA
Sbjct  276   IDAAHFSVPHGQRAIELVGGKESAIAQVARTIVGKTYQLTFAVGDASNSCEGSMIVEAFA  335

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G+ T++VP++SKGKG   RA  RF A ++RTR+ FLS+FYHM+SD+  SLCGPV+DDV+L
Sbjct  336   GRDTVKVPYESKGKGGYKRAVLRFVATTTRTRIMFLSTFYHMRSDDYASLCGPVVDDVKL  395

Query  292   VSVRNPR  272
             +SVR PR
Sbjct  396   LSVRKPR  402



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   502 bits (1292),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/362 (65%), Positives = 294/362 (81%), Gaps = 6/362 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT H   S   DGLV NGNFE GPK +++KGT ++  +A+P WEISG+VEYIK+
Sbjct  8     LSVLLLATCHFAFSIR-DGLVENGNFEVGPKPSELKGTEMIGRYALPKWEISGFVEYIKA  66

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VPEG YAVRLG +A IK  +   KG YYS++F+ ARTCAQEE LN+S+SP
Sbjct  67    GQKQGDMLLVVPEGAYAVRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISP  126

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
                  +WG+LP+QTMYSS+GWDSY+WAF A  + V++V+HNP  E+DPACGPLIDSVA+K
Sbjct  127   -----EWGVLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGVEEDPACGPLIDSVAIK  181

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N++KNG FEEGPY+  NT+WGVLIPPN+ED H PLPGW++ESLKAVK+ID
Sbjct  182   ALYPPRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFID  241

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRA+ELVAG+ESA+AQVVRT  GK Y L F+VGDA+N+C+GSMVVEAFAGK
Sbjct  242   VEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCQGSMVVEAFAGK  301

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              T++VP++SKGKG   RA  +F A SSRTR+ F S+FY M+SD+  SLCGPV+DDV+L+S
Sbjct  302   DTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSSLCGPVVDDVKLLS  361

Query  286   VR  281
             +R
Sbjct  362   LR  363



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   501 bits (1291),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 230/367 (63%), Positives = 297/367 (81%), Gaps = 7/367 (2%)
 Frame = -3

Query  1369  ILLALLC-ATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +L   LC +T HLV +   DGL+ NGNFEQ PK +++ GT V+ P+AIP W +SG+VEYI
Sbjct  6     LLSVFLCLSTCHLVFALR-DGLLDNGNFEQAPKASELNGTIVLKPNAIPKWRVSGFVEYI  64

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             K+GQKQGDMLL+VPEG  AVRLG +A IK ++   KG YYSL+F+ ARTCAQEERLNVSV
Sbjct  65    KAGQKQGDMLLVVPEGYAAVRLGNEASIKQSLNVSKGMYYSLTFSAARTCAQEERLNVSV  124

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P      +G+LP+QT+YSS+GWDSY+WAF A     +I++HNP  E+DPACGPLIDS+A
Sbjct  125   APG-----FGVLPIQTLYSSNGWDSYAWAFQANHSVAEILIHNPGVEEDPACGPLIDSIA  179

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             +++L PP+  R N+LKNG+FEEGPY+F NT+WGVL+PPN+EDDH PLP WI+ESLKAVKY
Sbjct  180   IRALYPPKATRDNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSPLPAWIVESLKAVKY  239

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             ID+ HFSVP G+RA+ELV G+ESA+AQV RT  GK Y+L F++GDA+N+CEGSM+VEAFA
Sbjct  240   IDAAHFSVPHGQRAIELVGGKESAIAQVARTIIGKTYELTFAIGDASNSCEGSMIVEAFA  299

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G+ T++VP++SKGKG   RA  RF A ++RTR+ F S++YHM+SD+  SLCGPV+DDV+L
Sbjct  300   GRDTVKVPYESKGKGGYKRAVLRFAATAARTRIMFFSTYYHMRSDDFASLCGPVVDDVKL  359

Query  292   VSVRNPR  272
             +SV  PR
Sbjct  360   LSVHKPR  366



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   501 bits (1290),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 237/365 (65%), Positives = 294/365 (81%), Gaps = 7/365 (2%)
 Frame = -3

Query  1372  IILLALLCAT-FHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             ++L  LL AT  H   SF  +GLV NGNFE  P+++ MKGT+++  +A+P+WEISG+VEY
Sbjct  6     LLLSVLLFATNCHFAFSFI-EGLVENGNFENSPRQSDMKGTQMIGRYALPNWEISGFVEY  64

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             IK+GQKQGDMLL+VPEG YAVRLG +A IK  +   KG YYS++F+ ARTCAQEE LN+S
Sbjct  65    IKAGQKQGDMLLVVPEGAYAVRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNIS  124

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             VSP     +WG+LP+QT+YSS+GWDSY+WAF A    V+ V+HNP  E+DPACGPLIDSV
Sbjct  125   VSP-----EWGVLPMQTLYSSNGWDSYAWAFKALISPVEFVIHNPGVEEDPACGPLIDSV  179

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+ SL PPR    N+LKNG FEEGPY+F NTTWGVLIPPN+ED H  LPGW++ESLKAVK
Sbjct  180   AITSLYPPRLTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSTLPGWMVESLKAVK  239

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YID +HFSVP+GRRAVELVAG+ES +AQV RT  GK Y L F+VGDA+N+CEGSMVVEAF
Sbjct  240   YIDVEHFSVPQGRRAVELVAGKESTIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAF  299

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK TL+VP++SKGKG   RA  +F A+S+RTR+ F S+FY M+SD+  SLCGPVIDD++
Sbjct  300   AGKDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSSLCGPVIDDIK  359

Query  295   LVSVR  281
             L+S+R
Sbjct  360   LLSLR  364



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   500 bits (1288),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 238/364 (65%), Positives = 292/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT   V  FT DG++ NG+FE GPK + MKGTRV++ +AIP WE+SG+VEYIKS
Sbjct  10    LFVLLIATITSVCCFT-DGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKS  68

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +AVRLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  69    GQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  128

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID +A+K
Sbjct  129   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGIAIK  183

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPYI SN T GVLIPP +EDDH PLP W+IESLKAVKY+D
Sbjct  184   ALYPPRPTNKNILKNGGFEEGPYILSNATTGVLIPPFIEDDHSPLPAWMIESLKAVKYVD  243

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEAFAG+
Sbjct  244   VEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGR  303

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++S+GKG   RA  RF A+S+RTR+ F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  304   DTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLS  363

Query  286   VRNP  275
             VR P
Sbjct  364   VRKP  367



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   500 bits (1288),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/358 (66%), Positives = 291/358 (81%), Gaps = 7/358 (2%)
 Frame = -3

Query  1345  TFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEYIKSGQKQGD  1169
             TFH+  S   DGLVANGNFE GPK  ++KGT V    ++IP WEISG VEYIKSGQKQGD
Sbjct  25    TFHVSQSLI-DGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGD  83

Query  1168  MLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPND  989
             MLL+VPEG YAVRLG +A IK  +K +KG YYS++F  ARTCAQEER+N+SV+P     D
Sbjct  84    MLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP-----D  138

Query  988   WGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR  809
             +G++P+QT+Y+S GWD  ++ F AE + V++V+HNP  E+DPACGPLIDSVAL++L PP+
Sbjct  139   FGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGVEEDPACGPLIDSVALRTLYPPK  198

Query  808   RRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSV  629
                 N+LKNG FEEGPYIF NT++GV+IPPN+EDDH PLPGW++ESLKAVKY+DS HFSV
Sbjct  199   ASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSAHFSV  258

Query  628   PEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVP  449
             P+G RAVELVAG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VEAFAGK T++VP
Sbjct  259   PQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVP  318

Query  448   FQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             + SKGKG   RA  +F A+ +RTRV FLS+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  319   YTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVRKP  376



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   501 bits (1291),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/362 (65%), Positives = 294/362 (81%), Gaps = 6/362 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT H   S   DGLV NGNFE GPK +++KGT ++  +A+P WEISG+VEYIK+
Sbjct  58    LSVLLLATCHFAFSIR-DGLVENGNFEVGPKPSELKGTEMIGRYALPKWEISGFVEYIKA  116

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VPEG YAVRLG +A IK  +   KG YYS++F+ ARTCAQEE LN+S+SP
Sbjct  117   GQKQGDMLLVVPEGAYAVRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISP  176

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
                  +WG+LP+QTMYSS+GWDSY+WAF A  + V++V+HNP  E+DPACGPLIDSVA+K
Sbjct  177   -----EWGVLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGVEEDPACGPLIDSVAIK  231

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N++KNG FEEGPY+  NT+WGVLIPPN+ED H PLPGW++ESLKAVK+ID
Sbjct  232   ALYPPRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFID  291

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRA+ELVAG+ESA+AQVVRT  GK Y L F+VGDA+N+CEGSMVVEAFAGK
Sbjct  292   VEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCEGSMVVEAFAGK  351

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              T++VP++SKGKG   RA  +F A SSRTR+ F S+FY M+SD+  SLCGPV+DDV+L+S
Sbjct  352   DTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSSLCGPVVDDVKLLS  411

Query  286   VR  281
             +R
Sbjct  412   LR  413



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   499 bits (1286),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 238/364 (65%), Positives = 292/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT   V+ FT DG++ NG+FE GPK + MKGTRV++ +AIP WE+SG+VEYIKS
Sbjct  10    LFVLLIATITSVLCFT-DGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKS  68

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +AVRLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  69    GQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  128

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+K
Sbjct  129   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAIK  183

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPYI  N T GVLIPP +EDDH PLP W+IESLKAVKY+D
Sbjct  184   ALYPPRPTNKNILKNGGFEEGPYILPNATTGVLIPPYIEDDHSPLPAWMIESLKAVKYVD  243

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEAFAG+
Sbjct  244   VEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFAGR  303

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++S+GKG   RA  RF A+S+RTR+ F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  304   DTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLS  363

Query  286   VRNP  275
             VR P
Sbjct  364   VRKP  367



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   501 bits (1289),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/371 (65%), Positives = 290/371 (78%), Gaps = 15/371 (4%)
 Frame = -3

Query  1357  LLCATFHLVISFT----------PDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISG  1208
             LLCAT HL +S T           DGL+ NGNFE+ P    MKGT VV  +AIP W   G
Sbjct  47    LLCATCHLALSATNGTAERNGTVADGLLDNGNFERAPNATNMKGTVVVGRYAIPGWINEG  106

Query  1207  YVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEER  1028
             +VEYIKSGQKQGDMLL+VPEG YAVRLG DA IK  +K + G YYS++F+ ARTCAQEER
Sbjct  107   FVEYIKSGQKQGDMLLVVPEGAYAVRLGNDASIKQAIKVIVGLYYSITFSAARTCAQEER  166

Query  1027  LNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPL  848
             LNV+V+P+S     G+LP+QT+YSS+GWDSY+WAF A A  +++++HN   E+DPACGPL
Sbjct  167   LNVTVAPDS-----GVLPIQTVYSSNGWDSYAWAFKAIAAVIELIIHNTGKEEDPACGPL  221

Query  847   IDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESL  668
             ID+VA+K+L PPR    N+LKN  FEEG YIF NT WGVLIPPN+EDDH PLPGW++ESL
Sbjct  222   IDAVAIKALYPPRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHSPLPGWMVESL  281

Query  667   KAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMV  488
             KAVKYIDSDH+ VP+GRRAVELVAG+ESA+AQV RT  GK Y L FSVGDANN+C GSMV
Sbjct  282   KAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANNSCAGSMV  341

Query  487   VEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVI  308
             VEAFAGK TL+VP++SKG G   RA   F A+S+RTR+ FLS+FY M+SD+  SLCGPV+
Sbjct  342   VEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFSSLCGPVV  401

Query  307   DDVRLVSVRNP  275
             DDV+L+SVR P
Sbjct  402   DDVKLLSVRKP  412



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   499 bits (1286),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 235/358 (66%), Positives = 291/358 (81%), Gaps = 7/358 (2%)
 Frame = -3

Query  1345  TFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEYIKSGQKQGD  1169
             TFH+  S   DGLVANGNFE GPK  ++KGT V    ++IP WEISG VEY+KSGQKQGD
Sbjct  25    TFHVSQSLI-DGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYVKSGQKQGD  83

Query  1168  MLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPND  989
             MLL+VPEG YAVRLG +A IK  +K +KG YYS++F  ARTCAQEER+N+SV+P     D
Sbjct  84    MLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP-----D  138

Query  988   WGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR  809
             +G++P+QT+Y+S GWD  ++ F AE + V++V+HNP  E+DPACGPLIDSVAL++L PP+
Sbjct  139   FGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGVEEDPACGPLIDSVALRTLYPPK  198

Query  808   RRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSV  629
                 N+LKNG FEEGPYIF NT++GV+IPPN+EDDH PLPGW++ESLKAVKY+DS HFSV
Sbjct  199   ASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSAHFSV  258

Query  628   PEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVP  449
             P+G RAVELVAG+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VEAFAGK T++VP
Sbjct  259   PQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVP  318

Query  448   FQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             + SKGKG   RA  +F A+ +RTRV FLS+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  319   YTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVRKP  376



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   497 bits (1280),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 230/344 (67%), Positives = 286/344 (83%), Gaps = 5/344 (1%)
 Frame = -3

Query  1312  GLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAV  1133
             GLV NGNFE GPK + +KGT ++  +A+P WEISG+VEYIK+GQKQGDMLL+VPEG YAV
Sbjct  3     GLVENGNFEVGPKPSDLKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYAV  62

Query  1132  RLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSS  953
             RLG +A IK  +   KG YYS++F+ ARTCAQEE LN+S+SP     +WG+LP+QTMYSS
Sbjct  63    RLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISP-----EWGVLPMQTMYSS  117

Query  952   DGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNF  773
             +GWDSY+WAF A  + V++V+HNP  E+DPACGPLIDSVA+K+L PPR    N++KNG F
Sbjct  118   NGWDSYAWAFKALLDIVELVVHNPGVEEDPACGPLIDSVAIKALYPPRPTNKNLIKNGGF  177

Query  772   EEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAG  593
             EEGPY+  NT+WGVLIPPN+ED H PLPGW++ESLKAVK+ID +HFSVP+GRRA+ELVAG
Sbjct  178   EEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDIEHFSVPQGRRAIELVAG  237

Query  592   RESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRA  413
             +ESA+AQVVRT  GK Y L F+VGDA+N+CEGSMVVEAFAGK TL+VP++SKGKG   RA
Sbjct  238   KESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSMVVEAFAGKDTLKVPYESKGKGGFKRA  297

Query  412   KHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
               +F A+SSRTRV F S+FY M+SD+  SLCGPV+DDV+L+S+R
Sbjct  298   VLKFVAVSSRTRVMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLR  341



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   497 bits (1280),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 238/363 (66%), Positives = 288/363 (79%), Gaps = 8/363 (2%)
 Frame = -3

Query  1363  LALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSG  1184
             + LLC+   + ++ T DGL+ NGNFE  PK + + GT+V+  +AIP WEISG+VEYI+SG
Sbjct  11    ILLLCSAVPIALAIT-DGLLPNGNFEAKPKASDLNGTQVMSRYAIPQWEISGFVEYIESG  69

Query  1183  QKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPN  1004
              KQGDMLL+VPEG YAVRLG +A IK  +K VKG YYS++F+ ARTCAQ+ERLNVSV+P+
Sbjct  70    HKQGDMLLVVPEGAYAVRLGNEASIKQKLKVVKGMYYSITFSAARTCAQDERLNVSVTPD  129

Query  1003  SEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKS  824
             S     G+LP+QT Y SDGWDSY+WAF A  E V +V+HNP  E+DPACGPLIDSVA+K+
Sbjct  130   S-----GLLPIQTTYGSDGWDSYAWAFRATLEEVHLVIHNPGVEEDPACGPLIDSVAIKT  184

Query  823   LNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDS  644
             L PP+    N+LKN +FEEGPY+  NTTWGVLIPPN+EDDH PLPGW +ESLKAVKYIDS
Sbjct  185   LYPPKLTGDNLLKNRDFEEGPYVLPNTTWGVLIPPNIEDDHSPLPGWTVESLKAVKYIDS  244

Query  643   DHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKL  464
             DHFSVP G+RAVELVAG+ESALAQV RT PGKVY L FS+GDA N C GSMVVEAFAG+ 
Sbjct  245   DHFSVPRGKRAVELVAGKESALAQVARTVPGKVYALAFSIGDAGNGCVGSMVVEAFAGRG  304

Query  463   TLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
             T ++P++SKG G   R   RFTA++ RTRV F S+FYH K D  GSLCGP +DDV L+SV
Sbjct  305   TAKIPYESKGTGGYKRGVLRFTAVAERTRVVFFSTFYHTKVD--GSLCGPSLDDVSLLSV  362

Query  283   RNP  275
             R+P
Sbjct  363   RSP  365



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   497 bits (1280),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 234/364 (64%), Positives = 292/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             LL LL AT   V+ F+ DG+V NG+FE GPK + MKGT+V++ +AIP WE+SG+VEYIKS
Sbjct  9     LLVLLIATITSVLCFS-DGMVPNGDFELGPKPSDMKGTQVINKNAIPSWELSGFVEYIKS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +A+RLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+K
Sbjct  128   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPY+  N T GVL+PP +EDDH PLP W+IESLKA+KY+D
Sbjct  183   ALYPPRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMIESLKAIKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSM+VEAFAGK
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMIVEAFAGK  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++S+GKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLS  362

Query  286   VRNP  275
              R P
Sbjct  363   ARKP  366



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   497 bits (1279),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 236/364 (65%), Positives = 291/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT   V+ FT D ++ NG+FE GPK + MKGTRV++ +AIP WE+SG+VEYIKS
Sbjct  10    LFVLLIATITSVLCFT-DAMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKS  68

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +AVRLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  69    GQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  128

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+K
Sbjct  129   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAIK  183

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPYI  N T GVL+PP +EDDH PLP W+IESLKAVKY+D
Sbjct  184   ALYPPRPTNKNILKNGGFEEGPYILPNATTGVLVPPFIEDDHSPLPAWMIESLKAVKYVD  243

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEAFAG+
Sbjct  244   VEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFAGR  303

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++S+GKG   RA  RF A+S+RTR+ F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  304   DTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLS  363

Query  286   VRNP  275
             VR P
Sbjct  364   VRKP  367



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   496 bits (1277),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 234/364 (64%), Positives = 293/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT   V+ F  DG++ NG+FE+GPK + MKGT+V++  A+P WE+SG+VEYIKS
Sbjct  9     LFVLLIATVTSVLCFR-DGMLPNGDFERGPKPSDMKGTQVINKKALPSWELSGFVEYIKS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +AVRLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS+GWD Y+WAF AE++  +IV+HNP  E+DPACGPLID VA+K
Sbjct  128   DS-----GVIPIQTVYSSNGWDLYAWAFQAESDVAEIVIHNPGEEEDPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPY+  N T GVLIPP +EDDH PLP W+IESLKA+KY+D
Sbjct  183   ALYPPRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSM+VEAFAGK
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACQGSMIVEAFAGK  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++S+GKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLS  362

Query  286   VRNP  275
             VR P
Sbjct  363   VRKP  366



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   495 bits (1275),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 233/364 (64%), Positives = 290/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT   VI F+ DG++ NG+FE GPK + MKGT+V++  AIP WE+SG+VEYIKS
Sbjct  9     LFVLLIATITSVICFS-DGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +A+RLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+K
Sbjct  128   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPY+  N T GVL+PP +EDDH PLP W++ESLKA+KY+D
Sbjct  183   ALYPPRPTSKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEAFAGK
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGK  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++S+GKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLS  362

Query  286   VRNP  275
              R P
Sbjct  363   ARKP  366



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   495 bits (1274),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 233/364 (64%), Positives = 290/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT   VI F+ DG++ NG+FE GPK + MKGT+V++  AIP WE+SG+VEYIKS
Sbjct  9     LFVLLIATITSVICFS-DGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +A+RLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+K
Sbjct  128   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPY+  N T GVL+PP +EDDH PLP W++ESLKA+KY+D
Sbjct  183   ALYPPRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEAFAGK
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGK  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++S+GKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLS  362

Query  286   VRNP  275
              R P
Sbjct  363   ARKP  366



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   494 bits (1273),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 229/348 (66%), Positives = 282/348 (81%), Gaps = 5/348 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE  P +  + GT V+  +AIP W ISG+VEYIK+GQKQGDMLL+VPEG  A
Sbjct  26    DGLLKNGNFEIPPSKADLNGTEVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVVPEGYAA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  +   KG YYSL+F+ ARTCAQEER+NVSV+P     D+G+LP+QT+YS
Sbjct  86    VRLGNEASIKQILNVTKGMYYSLTFSAARTCAQEERINVSVTP-----DFGVLPIQTLYS  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWDSY+WAF AE   V+I+LHNP  E+DPACGPLIDS+A+++L PPR    N+LKNG+
Sbjct  141   SSGWDSYAWAFQAELHQVEILLHNPGVEEDPACGPLIDSIAIRTLYPPRATNQNLLKNGD  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPYIF NT+WGVL+PPN+EDDH PLP W++ESLKAVKY+DSDHFSVP G+RA+ELVA
Sbjct  201   FEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDHFSVPHGKRAIELVA  260

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQV RT  GK+Y L F VGDA+NACEGSM+VEAFAG+ TL+VP++S GKG   R
Sbjct  261   GKESAIAQVARTTIGKMYQLSFKVGDASNACEGSMIVEAFAGRDTLKVPYESMGKGGYKR  320

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             A  RF A +SRTR+ FLS++YH +SD+  SLCGPV+DDV L+SVR  R
Sbjct  321   AILRFKATASRTRIMFLSTYYHTRSDDFVSLCGPVVDDVTLLSVRTHR  368



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   494 bits (1273),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 231/360 (64%), Positives = 287/360 (80%), Gaps = 6/360 (2%)
 Frame = -3

Query  1351  CATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQG  1172
             CA   + I+   DGL+ NGNFE  P +  + GT V+  +AIP W ISG+VEYIK+GQKQG
Sbjct  15    CAISSISIAVI-DGLLKNGNFEMPPSKADLNGTEVLKHNAIPEWSISGFVEYIKAGQKQG  73

Query  1171  DMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPN  992
             DMLL+VPEG  AVRLG +A IK  +   KG YYSL+F+ ARTCAQEER+NVSV+P     
Sbjct  74    DMLLVVPEGYAAVRLGNEASIKQILNVTKGMYYSLTFSAARTCAQEERINVSVTP-----  128

Query  991   DWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPP  812
             D+G+LP+QT+YSS GWDSY+WAF AE   V+I+LHNP  E+DPACGPLIDS+A+++L PP
Sbjct  129   DFGVLPIQTLYSSSGWDSYAWAFQAEFPQVEILLHNPGVEEDPACGPLIDSIAIRTLYPP  188

Query  811   RRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFS  632
             R    N+LKNG+FEEGPY+F NT+WGVL+PPN+EDDH PLP W++ESLKAVKY+DSDHFS
Sbjct  189   RATNQNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDHFS  248

Query  631   VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQV  452
             VP G+RA+ELVAG+ESA+AQV RT  GK+Y L F VGDA+NACEGSM+VEAFAG+ TL+V
Sbjct  249   VPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASNACEGSMIVEAFAGRDTLKV  308

Query  451   PFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             P++S GKG   RA  RF A +SRTR+ FLS++YH +SD+  SLCGPV+DDV L+SVR  R
Sbjct  309   PYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFVSLCGPVVDDVTLLSVRTHR  368



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   493 bits (1270),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 232/364 (64%), Positives = 290/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL AT   VI F+ DG++ NG+FE GPK + MKGT+V++  AIP WE+SG+VEYIKS
Sbjct  9     LFVLLIATITSVICFS-DGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +A+RLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+K
Sbjct  128   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPY+  N T GVL+PP +EDDH PLP W++ESLKA+KY+D
Sbjct  183   ALYPPRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV +T  GK Y L F+VGDANNAC+GSMVVEAFAGK
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVAKTVVGKTYVLSFAVGDANNACQGSMVVEAFAGK  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++S+GKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLS  362

Query  286   VRNP  275
              R P
Sbjct  363   ARKP  366



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   493 bits (1268),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 233/365 (64%), Positives = 291/365 (80%), Gaps = 6/365 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             + + L+  T   V+ FT DG++ NG+FE GPK + +KGT+V+  +AIP WE+SG+VEYIK
Sbjct  9     LFVLLIATTITSVLCFT-DGMLPNGDFELGPKPSDLKGTQVISKNAIPSWELSGFVEYIK  67

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VP G +AVRLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+
Sbjct  68    SGQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVA  127

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P+S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+
Sbjct  128   PDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAI  182

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L PPR    N+LKNG FEEGPYI  N+T GVLIPP +EDDH PLP W+IESLKAVKY+
Sbjct  183   KALYPPRPTNKNILKNGGFEEGPYILPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKYV  242

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L FSVGDANNAC+GSMVVEAFAG
Sbjct  243   DVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFSVGDANNACQGSMVVEAFAG  302

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             + TL+VP++S+GKG   RA  RF A+S+RTR+ F S+FY M+SD+  SLCGPVIDDV+L+
Sbjct  303   RDTLKVPYESRGKGGFKRATMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLL  362

Query  289   SVRNP  275
              VR P
Sbjct  363   GVRKP  367



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   492 bits (1267),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 233/344 (68%), Positives = 288/344 (84%), Gaps = 4/344 (1%)
 Frame = -3

Query  1312  GLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAV  1133
             GL+ NGNFE GPK++++KGT V +PHAIP+WEISG+VEYIKSGQKQGDMLL+VPEG +AV
Sbjct  19    GLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMLLVVPEGGFAV  78

Query  1132  RLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSS  953
             RLG +A IK  +K  KG +YS++F+ ARTCAQEE LNVS++PN E    G++P+QTMYSS
Sbjct  79    RLGNEASIKQKLKVKKGEFYSITFSAARTCAQEETLNVSITPNLEKRHRGIMPIQTMYSS  138

Query  952   DGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNF  773
             +GWDSY+W F A+ + +++V+HNP  E+D ACGPLIDSVALK L  P+    N+LKNGN+
Sbjct  139   NGWDSYAWGFNADFDEIELVIHNPGVEEDAACGPLIDSVALKLLASPKP---NLLKNGNY  195

Query  772   EEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAG  593
             EEGPY+F NT+WGVLIPP++ED+H PLPGWIIESLKAVKYIDS HFSVPEG RA+ELV G
Sbjct  196   EEGPYVFPNTSWGVLIPPHIEDNHSPLPGWIIESLKAVKYIDSKHFSVPEGWRAIELV-G  254

Query  592   RESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRA  413
             +ESALAQVV T PGK+Y L F+VGD+NNACEGS+VVEAFAGK  L+VP+QSKG+G   R 
Sbjct  255   KESALAQVVFTLPGKLYALTFTVGDSNNACEGSLVVEAFAGKDILKVPYQSKGRGGFKRX  314

Query  412   KHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
             +  FTA+  RTR+ F S+FY M +D+SGSLCGPVIDDV+L+SVR
Sbjct  315   RFLFTAVGPRTRIMFYSTFYTMAADHSGSLCGPVIDDVKLLSVR  358



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   492 bits (1267),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 235/364 (65%), Positives = 290/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1363  LALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSG  1184
             L LLCA   + ++FT DGL+ NGNFE GP  +Q++GT V+  +AIP WEISG VEYI  G
Sbjct  8     LLLLCAISPMAVAFT-DGLLPNGNFELGPASSQLRGTEVIGRNAIPRWEISGTVEYIPWG  66

Query  1183  QKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPN  1004
              KQGDMLL+VPEG YAVRLG +A IK  +K  +G  YSL+F+ ARTCAQEERLNVSV+P 
Sbjct  67    HKQGDMLLVVPEGSYAVRLGNEASIKQRIKVTRGMRYSLTFSAARTCAQEERLNVSVAPE  126

Query  1003  SEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKS  824
             S     G+LP+QTMYSS+GWDSY+WA+ A ++  +IV+HNP  E+DPACGPLIDSVA+K 
Sbjct  127   S-----GVLPMQTMYSSNGWDSYAWAWNARSDVAEIVVHNPGVEEDPACGPLIDSVAVKE  181

Query  823   LNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDS  644
             L+PPRR   N+LKNG+FEEGPYI  NTTWGVLIPP  EDDH PLPGW+++S KAVKY+DS
Sbjct  182   LHPPRRSNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSPLPGWMVDSPKAVKYLDS  241

Query  643   DHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKL  464
              HFSVP G RAVEL+AG+ESALAQ VRT PG+ Y L FSVGDA+NAC+G+M+VEAFAG+ 
Sbjct  242   THFSVPRGSRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACQGTMIVEAFAGEH  301

Query  463   TLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
             T++VP++SKG G + RA  RF A  +RTR+ F SS Y+ +SD+  SLCGPV+DDV LVS+
Sbjct  302   TVKVPYESKGAGGAKRAVLRFRASKARTRIVFFSSNYNTRSDDLSSLCGPVLDDVALVSI  361

Query  283   RNPR  272
             RNP+
Sbjct  362   RNPK  365



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   491 bits (1264),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 233/363 (64%), Positives = 290/363 (80%), Gaps = 6/363 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL +TF  +  F  DG++ NG+FE GPK + MKGT+V++ +AIP WE++G+VEYIKS
Sbjct  9     LFVLLISTFTSIFCFR-DGMLPNGDFELGPKPSDMKGTQVINKNAIPSWELTGFVEYIKS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +AVRLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+K
Sbjct  128   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPY+  N+T GVLIPP +EDDH PLP W+IESLKAVKY+D
Sbjct  183   ALYPPRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNACEGSM+VEAFAG+
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGR  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++SKGKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLS  362

Query  286   VRN  278
             V  
Sbjct  363   VHK  365



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   491 bits (1263),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 233/368 (63%), Positives = 296/368 (80%), Gaps = 6/368 (2%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
             T +I+L L+ + F++   F  DGL+ NG+FE GP+ + MKGT+V++  AIP+WE+SG+VE
Sbjct  4     TRVIVLLLIHSFFYVAFCFK-DGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVE  62

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YI SGQKQGDM+L+VP+G +AVRLG +A IK  +   KG+YYS++F+ ARTCAQ+ERLNV
Sbjct  63    YIPSGQKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNV  122

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P+       ++P+QT+YSS GWD YSWAF A+++  DIV+HNP  E+DPACGPLID 
Sbjct  123   SVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPACGPLIDG  177

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+++L PPR    N+LKNG FEEGP++  NTT GVLIPPN  DDH PLPGW++ESLKAV
Sbjct  178   VAMRALFPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAV  237

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYIDSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK Y L F+VGDA+NAC GSM+VEA
Sbjct  238   KYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEA  297

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAGK T++VP++SKGKG   RA  RF A+S RTRV F S+FY M++D+  SLCGPVIDDV
Sbjct  298   FAGKDTIKVPYESKGKGGFRRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCGPVIDDV  357

Query  298   RLVSVRNP  275
             +L+S R P
Sbjct  358   KLLSARRP  365



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   490 bits (1261),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 233/363 (64%), Positives = 288/363 (79%), Gaps = 6/363 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL +TF  +  F  DG++ NG+FE GPK   MKGT+V+  +AIP WE++G+VEYIKS
Sbjct  9     LFVLLISTFTSIFCFR-DGMLPNGDFELGPKPADMKGTQVIKKNAIPSWELTGFVEYIKS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +AVRLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+K
Sbjct  128   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPY+  N+T GVLIPP +EDDH PLP W+IESLKAVKY+D
Sbjct  183   ALYPPRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNACEGSM+VEAFAG+
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGR  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP++SKGKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLS  362

Query  286   VRN  278
             V  
Sbjct  363   VHK  365



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   490 bits (1261),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 232/367 (63%), Positives = 295/367 (80%), Gaps = 6/367 (2%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             G+I+L LL + F++   F  DGL+ NG+FE GP+ + MKGT+V++  AIP+WE+SG+VEY
Sbjct  5     GVIVLLLLHSFFYVAFCFN-DGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEY  63

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             I SG KQGDM+L+VP+G +AVRLG +A IK  +   KG+YYS++F+ ARTCAQ+ERLNVS
Sbjct  64    IPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVS  123

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P+       ++P+QT+YSS GWD YSWAF A+++  DIV+HNP  E+DPACGPLID V
Sbjct  124   VAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPACGPLIDGV  178

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+++L PPR    N+LKNG FEEGP++  N + GVLIPPN  DDH PLPGW++ESLKAVK
Sbjct  179   AMRALFPPRTTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVK  238

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK Y L FSVGDA+NAC GSM+VEAF
Sbjct  239   YIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAF  298

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++VP++SKGKG   R+  RF A+SSRTRV F S+FY M++D+  SLCGPVIDDV+
Sbjct  299   AGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVK  358

Query  295   LVSVRNP  275
             L+S R P
Sbjct  359   LLSARRP  365



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   490 bits (1262),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 232/366 (63%), Positives = 290/366 (79%), Gaps = 14/366 (4%)
 Frame = -3

Query  1351  CATFHLVISFT---------PDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
             CA+ H+ +S T          DGL+ NGNFE  P    MKGT VV  +AIP W   G+VE
Sbjct  12    CASCHISLSLTNSTAGNGTVADGLLENGNFENAPNATNMKGTVVVGRYAIPGWVNEGFVE  71

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YIKSGQKQGDMLL+VPEG YAVRLG +A IK  +K +KG YYS++F+ ARTCAQEERLNV
Sbjct  72    YIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNV  131

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             +V+P+S     G+LP+QT+YSS GWD+Y+WAF A  E  ++++HNP  E+DPACGPLID+
Sbjct  132   TVAPDS-----GVLPIQTVYSSSGWDNYAWAFKAIYEVAELIIHNPGVEEDPACGPLIDA  186

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+K+L PPR    N +KNG FEEGPY+F NT WGVLIPPN+EDDH PLP WI+ESLKAV
Sbjct  187   VAIKALYPPRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSPLPAWIVESLKAV  246

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYIDS H+ VP+GRRAVELVAG+ESA+AQ+VRT  GK+Y L F+VGDANN+C GS+VVEA
Sbjct  247   KYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEA  306

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAGK TL+VP++SKGKG   RA+ +F A+S+RTR+ FLS+FY M+SD+  SLCGPV+DDV
Sbjct  307   FAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV  366

Query  298   RLVSVR  281
             +L+S++
Sbjct  367   KLLSIQ  372



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   489 bits (1259),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 232/367 (63%), Positives = 295/367 (80%), Gaps = 6/367 (2%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             G+I+L LL + F++   F  DGL+ NG+FE GP+ + MKGT+V++  AIP+WE+SG+VEY
Sbjct  5     GVIVLLLLHSFFYVAFCFN-DGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEY  63

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             I SG KQGDM+L+VP+G +AVRLG +A IK  +   KG+YYS++F+ ARTCAQ+ERLNVS
Sbjct  64    IPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVS  123

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P+       ++P+QT+YSS GWD YSWAF A+++  DIV+HNP  E+DPACGPLID V
Sbjct  124   VAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPACGPLIDGV  178

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+++L PPR    N+LKNG FEEGP++  N + GVLIPPN  DDH PLPGW++ESLKAVK
Sbjct  179   AMRALFPPRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVK  238

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK Y L FSVGDA+NAC GSM+VEAF
Sbjct  239   YIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAF  298

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++VP++SKGKG   R+  RF A+SSRTRV F S+FY M++D+  SLCGPVIDDV+
Sbjct  299   AGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVK  358

Query  295   LVSVRNP  275
             L+S R P
Sbjct  359   LLSARRP  365



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   489 bits (1259),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 231/366 (63%), Positives = 292/366 (80%), Gaps = 6/366 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             + LL +  A    V+SF  DG++ NG+FE GPK++ MKGT V++  AIP+WE+SG+VEYI
Sbjct  11    LFLLLIATANSAAVVSFR-DGMLPNGDFELGPKQSDMKGTEVLNKLAIPNWEVSGFVEYI  69

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
              SG KQGDM+L+VP G +AVRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+SV
Sbjct  70    SSGHKQGDMILVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISV  129

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             SP+S     G++P+QT+YSS GWD Y+WAF AE++  ++V+HNP  E+DPACGPLID VA
Sbjct  130   SPDS-----GVIPVQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGEEEDPACGPLIDGVA  184

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             ++SL PPR    N+LKNG FEEGP +    T GVLIPP +EDDH PLPGW++ESLKAVKY
Sbjct  185   MRSLYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKY  244

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +D++HFSVP+GRRA+ELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEAFA
Sbjct  245   VDTEHFSVPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFA  304

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK TL+VP++S+G G   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L
Sbjct  305   GKETLKVPYESRGTGGFKRASVRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKL  364

Query  292   VSVRNP  275
             +SVR P
Sbjct  365   LSVRKP  370



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   489 bits (1258),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 226/364 (62%), Positives = 289/364 (79%), Gaps = 1/364 (0%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             + + LL  T   + S   DGL+ NGNFEQGPK +++KGT+V+   +IP+WEI GYVEYIK
Sbjct  6     VFVLLLVGTTSQIASSVKDGLLPNGNFEQGPKASELKGTKVMSGKSIPNWEICGYVEYIK  65

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQ DMLL+VP+G +AVRLG  A IK  ++ +K  +YSL+F+ +RTCAQEERLNVSVS
Sbjct  66    SGQKQDDMLLIVPQGAFAVRLGNGALIKQKIRVIKDMFYSLTFSASRTCAQEERLNVSVS  125

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             PN+E ND G+ P+QTMYSS+GWDSY+WAF A+A  ++I +HNP+ E+D  CGP+IDS+AL
Sbjct  126   PNNEQNDSGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPSVEEDAVCGPIIDSIAL  185

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFS-NTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             K+L  P+R R N+LKNGNFEEGPYIF   T+ GV+IPP +EDDH PLPGWIIESLKA+K+
Sbjct  186   KTLYYPKRTRANLLKNGNFEEGPYIFPIPTSEGVIIPPEIEDDHSPLPGWIIESLKAIKH  245

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDS+HFSVP+G+RA+EL+AG+ES + Q+V+T  G+ Y L F VGDANN CEG M+VEAFA
Sbjct  246   IDSEHFSVPQGKRAIELIAGKESTVVQIVKTSIGRNYLLSFVVGDANNGCEGPMMVEAFA  305

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK  + V + SKGKG    A+  F A S+RTR+ F S+ Y +KSDNSGSLCGPV+DDV+L
Sbjct  306   GKNMVMVSYNSKGKGGFKAARLAFRAESTRTRITFYSTIYTIKSDNSGSLCGPVLDDVKL  365

Query  292   VSVR  281
             +SVR
Sbjct  366   LSVR  369



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   488 bits (1257),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 231/363 (64%), Positives = 289/363 (80%), Gaps = 6/363 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL +T   +  F  DG++ NG+FE GPK + MKGT+V++ +AIP WE++G+VEYI+S
Sbjct  9     LFVLLISTVTSIFCFR-DGMLPNGDFELGPKPSDMKGTQVINKNAIPSWELTGFVEYIQS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +AVRLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS GWD Y+WAF AE+   +IV+HNP  E+DPACGPLID VA+K
Sbjct  128   DS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPY+  N+T GVLIPP +EDDH PLP W++ESLKAVKY+D
Sbjct  183   ALYPPRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMVESLKAVKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNACEGSM+VEAFAG+
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGR  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+VP+QSKGKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVPYQSKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLS  362

Query  286   VRN  278
             V  
Sbjct  363   VHK  365



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   488 bits (1255),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 233/370 (63%), Positives = 287/370 (78%), Gaps = 9/370 (2%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVE  1199
             G++   L+   FH+  SFT DG +AN  FE GPK   MKGT V   PHAIP WEISG++E
Sbjct  2     GMLSFLLVFCCFHVTFSFT-DGSIANAEFEFGPKPQDMKGTVVTGGPHAIPGWEISGFIE  60

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             Y+KSGQKQGDMLL+VP G YAVRLG  A IK  +K VKG YYS++F  ARTCAQEE+LNV
Sbjct  61    YLKSGQKQGDMLLVVPNGAYAVRLGNGASIKQKIKVVKGMYYSITFMVARTCAQEEKLNV  120

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P     DW +LP+QT+YS +GWD+Y+W+F A+   VD+  H+P  E+DPACGP+IDS
Sbjct  121   SVAP-----DWVVLPMQTLYSGNGWDAYAWSFQADYSLVDMAFHHPGKEEDPACGPIIDS  175

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVED--DHCPLPGWIIESLK  665
             +ALK+L PPR    N+LKNG FEEGPY+F NTT GVLIPPN+ D  DH PLPGWI+ESLK
Sbjct  176   IALKALYPPRPTNKNVLKNGGFEEGPYVFPNTTSGVLIPPNIVDLSDHSPLPGWIVESLK  235

Query  664   AVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVV  485
             AVKYIDSDHFSVP G+ AVEL+ G+ESA+AQV RT PGK Y L F+VGDA N+CEGS+ V
Sbjct  236   AVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGNSCEGSLSV  295

Query  484   EAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVID  305
             EA+ GK +++VP++SKGKG   RA  +F A+S+RTR+ FLS+FY M+SD+  SLCGPVID
Sbjct  296   EAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDFASLCGPVID  355

Query  304   DVRLVSVRNP  275
             DV L+S+R P
Sbjct  356   DVTLISLRKP  365



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   487 bits (1254),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 230/368 (63%), Positives = 296/368 (80%), Gaps = 6/368 (2%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
             T +I+L L+ + F++   F  DGL+ NG+FE GP+ + MKGT+V++  +IP+WE+SG+VE
Sbjct  4     TRVIVLLLIHSFFYVAFCFK-DGLLPNGDFELGPRHSDMKGTQVINKTSIPNWELSGFVE  62

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YI SG+KQGDM+L+VP+G +AVRLG +A IK  +   KG+YYS++F+ ARTCAQ+ERLNV
Sbjct  63    YIPSGKKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNV  122

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P+       ++P+QT+YSS GWD YSWAF A+++  DIV+HNP  E+DPACGPLID 
Sbjct  123   SVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPACGPLIDG  177

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+++L PPR    N+LKNG FEEGP++  NTT GVLIPPN  DDH PLPGW++ESLKAV
Sbjct  178   VAMRALFPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAV  237

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KY+DSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK Y L F+VGDA+NAC GSM+VEA
Sbjct  238   KYLDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEA  297

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAGK T++VP++SKGKG   RA  RF A+S RTRV F S+FY M++D+  SLCGPVIDDV
Sbjct  298   FAGKDTIKVPYESKGKGGFKRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCGPVIDDV  357

Query  298   RLVSVRNP  275
             +L+S R P
Sbjct  358   KLLSARRP  365



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   486 bits (1252),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 230/367 (63%), Positives = 295/367 (80%), Gaps = 6/367 (2%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             G+I+L LL + F++ + F  DGL+ NG+FE GP+ + MKGT+V++  AIP+WE+SG+VEY
Sbjct  5     GVIVLLLLHSFFYVSLCFN-DGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEY  63

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             I SG KQGDM+L+VP+G +AVRLG +A IK  +   KG+YYS++F+ ARTCAQ+ERLNVS
Sbjct  64    IPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVS  123

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P+       ++P+QT+YSS GWD YSWAF A+++  DIV+HNP  E+DPACGPLID V
Sbjct  124   VAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPACGPLIDGV  178

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+++L PPR    N+LKNG FEEGP++  N + GVLIPPN  DDH PLPGW++ESLKAVK
Sbjct  179   AMRALFPPRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVK  238

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK Y L F+VGDA+NAC GSM+VEAF
Sbjct  239   YIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAF  298

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++VP++SKGKG   R+  RF A+S RTRV F S+FY M++D+  SLCGPVIDDV+
Sbjct  299   AGKDTIKVPYESKGKGGFKRSSLRFVAVSDRTRVMFYSTFYAMRNDDFSSLCGPVIDDVK  358

Query  295   LVSVRNP  275
             L+S R P
Sbjct  359   LLSARRP  365



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   486 bits (1251),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 228/347 (66%), Positives = 283/347 (82%), Gaps = 5/347 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG + NG+FE GPK + MKGT+VV+  AIP+WE+SG+VEYIKSGQKQGDMLL+VP G +A
Sbjct  24    DGQLPNGDFELGPKPSDMKGTQVVNKTAIPNWELSGFVEYIKSGQKQGDMLLVVPAGKFA  83

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  ++ VKG YYSL+F+ ARTCAQ+ERLN+S SP     DWG++P+QT+YS
Sbjct  84    VRLGNEASIKQRLRLVKGMYYSLTFSAARTCAQDERLNISASP-----DWGVIPIQTVYS  138

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE+E VD+V+HNP  E+DPACGPLID+VA+++L PPR    N+LKNG 
Sbjct  139   SYGWDLYAWAFQAESELVDVVIHNPGEEEDPACGPLIDAVAMRALYPPRPTNKNILKNGG  198

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +  N T GVLIPP +EDDH PLPGW++ESLKAVKYID +HFSVP+GRRAVELVA
Sbjct  199   FEEGPLVLPNATTGVLIPPFIEDDHSPLPGWMVESLKAVKYIDVEHFSVPQGRRAVELVA  258

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQV RT  GK Y L F+VGDANNAC+GSM+VEAFAG+ T++VP++S+G G   R
Sbjct  259   GKESAIAQVARTVVGKTYVLSFAVGDANNACKGSMIVEAFAGRDTIKVPYESRGTGGFKR  318

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RF A S RTR+ F S+FY M+SD+  SLCGPV+DDV+L+SVR P
Sbjct  319   AALRFVAASDRTRIMFYSTFYSMRSDDFSSLCGPVVDDVKLLSVRKP  365



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   486 bits (1250),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 233/364 (64%), Positives = 289/364 (79%), Gaps = 6/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL +T   V  F  DG++ NG FE+GPK + +KGTRV++ +AIP+WE+SG++EYIKS
Sbjct  9     LFVLLISTVTSVFCFR-DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWELSGFIEYIKS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +AVRLG +A IK  V   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAVRLGNEASIKQRVNVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS+GWD Y+WA  A+++  +IV+HNP  E+ PACGPLID VA+K
Sbjct  128   DS-----GVIPIQTLYSSNGWDLYAWALQAQSDVAEIVIHNPGEEEHPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPYI  N T GVLIPP +EDDH PLP WIIESLKAVKY+D
Sbjct  183   ALYPPRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSM+VEAFAGK
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGK  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+V ++SKGKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLS  362

Query  286   VRNP  275
             V  P
Sbjct  363   VGKP  366



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   486 bits (1250),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 230/367 (63%), Positives = 289/367 (79%), Gaps = 5/367 (1%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
             T + +  L+ AT +    +  DG++ NG+FE GPK + MKGT V++  AIP WE++G+VE
Sbjct  5     TVVSIFLLIIATANSAAVYFRDGMLPNGDFELGPKPSDMKGTEVLNKMAIPKWEVTGFVE  64

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YI SG KQGDMLL+VP G +AVRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+
Sbjct  65    YISSGHKQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNI  124

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SVSP+S     G++P+QT+YSS GWD Y+WAF AE+E  DIV+HNP  E+DPACGPLID 
Sbjct  125   SVSPDS-----GVIPVQTVYSSSGWDLYAWAFQAESEIADIVIHNPGVEEDPACGPLIDG  179

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+++L PPR    N+LKNG FEEGP +    T GVLIPP +EDDH PLPGW++ESLKAV
Sbjct  180   VAMRALYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAV  239

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KY+D++HFSVP+GRRA+ELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEA
Sbjct  240   KYVDTEHFSVPQGRRAIELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACKGSMVVEA  299

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAGK TL+VP++S+G G   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV
Sbjct  300   FAGKDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDV  359

Query  298   RLVSVRN  278
             +L+SVR 
Sbjct  360   KLLSVRK  366



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   486 bits (1250),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 227/365 (62%), Positives = 290/365 (79%), Gaps = 6/365 (2%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             G+I+  LL + F+    F  DGL+ NG+FE GP    MKGT+V++  AIP WE+SG+VEY
Sbjct  5     GVIVFLLLHSIFYTAFCFK-DGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWELSGFVEY  63

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             I SG KQGDM+L+VP+G +AVRLG +A IK  +   KG+YYS++F+ ARTCAQ+ERLNVS
Sbjct  64    IPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVS  123

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P+      G++P+QT+YSS GWD YSWAF A+ +  ++V+HNP  E+DPACGPLID V
Sbjct  124   VAPHH-----GVMPIQTVYSSSGWDLYSWAFKAQGDYAEVVIHNPGVEEDPACGPLIDGV  178

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+++L PPR    N+LKNG FEEGP++  NT+ GVLIPPN  DDH PLPGW++ESLKAVK
Sbjct  179   AMRALFPPRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWMVESLKAVK  238

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVP+GRRAVEL+AG+ESA+AQVVRT PGK+Y L F+VGDA+NAC GSM+VEAF
Sbjct  239   YIDSDHFSVPQGRRAVELIAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAF  298

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK TL+VP++SKGKG   RA  +F A+S RTR+ F S+FY M++D+  SLCGPVIDDV+
Sbjct  299   AGKDTLKVPYESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCGPVIDDVK  358

Query  295   LVSVR  281
             L+S R
Sbjct  359   LLSAR  363



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   486 bits (1250),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 229/366 (63%), Positives = 291/366 (80%), Gaps = 6/366 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             ++L+    A    V SF  DG++ NG+FE GPK + MKGT V++  AIP+WE+SG+VEYI
Sbjct  11    LLLITTATAAPKSVFSFR-DGMLPNGDFELGPKPSDMKGTEVLNKLAIPNWEVSGFVEYI  69

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSG KQGDMLL+VP G +AVRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+SV
Sbjct  70    KSGHKQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISV  129

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P+S     G++P+QT+YSS GWD Y+WAF AE++  ++V+HNP  E+DPACGPLID VA
Sbjct  130   APDS-----GVIPVQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGVEEDPACGPLIDGVA  184

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             ++SL PPR    N+LKNG FEEGP +    T GVLIPP +EDDH PLPGW++ESLKAVKY
Sbjct  185   MRSLYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKY  244

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +D +HFSVP+GRRA+ELVAG+ESA+AQ+VRT  GK Y L F+VGDANNAC+GSMVVEAFA
Sbjct  245   VDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFA  304

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             GK TL+VP++S+G G   RA  RF A+S+R+R+ F S+FY M+SD+  SLCGPVIDDV+L
Sbjct  305   GKETLKVPYESRGTGGFKRASIRFVAVSNRSRIMFYSTFYSMRSDDFSSLCGPVIDDVKL  364

Query  292   VSVRNP  275
             +SVR P
Sbjct  365   ISVRKP  370



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   484 bits (1247),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 283/345 (82%), Gaps = 5/345 (1%)
 Frame = -3

Query  1309  LVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVR  1130
             ++ NG+FE+GPK + MKGT+V++  A+P WE+SG+VEYIKSGQKQGDMLL+VP G +AVR
Sbjct  1     MLPNGDFERGPKPSDMKGTQVINKKALPSWELSGFVEYIKSGQKQGDMLLVVPAGKFAVR  60

Query  1129  LGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSD  950
             LG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P+S     G++P+QT+YSS+
Sbjct  61    LGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPIQTVYSSN  115

Query  949   GWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFE  770
             GWD Y+WAF AE++  +IV+HNP  E+DPACGPLID VA+K+L PPR    N+LKNG FE
Sbjct  116   GWDLYAWAFQAESDVAEIVIHNPGEEEDPACGPLIDGVAIKALYPPRPTNKNILKNGGFE  175

Query  769   EGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGR  590
             EGPY+  N T GVLIPP +EDDH PLP W+IESLKA+KY+D +HFSVP+GRRAVELVAG+
Sbjct  176   EGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVEHFSVPQGRRAVELVAGK  235

Query  589   ESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAK  410
             ESA+AQV RT  GK Y L F+VGDANNAC+GSM+VEAFAGK TL+VP++S+GKG   RA 
Sbjct  236   ESAIAQVARTIIGKTYVLSFAVGDANNACQGSMIVEAFAGKDTLKVPYESRGKGGFKRAS  295

Query  409   HRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
              RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  296   MRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  340



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   486 bits (1250),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 232/364 (64%), Positives = 290/364 (80%), Gaps = 6/364 (2%)
 Frame = -3

Query  1363  LALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSG  1184
             L LLCA   + ++FT DGL+ NGNFE GP  ++++GT V+  +AIP WEISG VEYI  G
Sbjct  9     LFLLCAISPMAVAFT-DGLLPNGNFELGPASSKLRGTEVIGRNAIPRWEISGTVEYIPWG  67

Query  1183  QKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPN  1004
              KQGDMLL+VPEG YAVRLG +A IK  +K  +G  YSL+F+ ARTCAQ+ERLNVSV+P 
Sbjct  68    HKQGDMLLVVPEGSYAVRLGNEASIKQRIKVTRGVRYSLTFSAARTCAQDERLNVSVAPE  127

Query  1003  SEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKS  824
             S     G++P+QTMYSS+GWDSY+WA+ A+++  ++V+HNP  E+DPACGPLIDSVA+K+
Sbjct  128   S-----GVVPMQTMYSSNGWDSYAWAWNAKSDVAEVVIHNPGVEEDPACGPLIDSVAVKA  182

Query  823   LNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDS  644
             L+PP R   N+LKNG+FEEGPYI  NTTWGVLIPP  EDDH PLPGW+++S KAVKY+DS
Sbjct  183   LHPPSRTNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSPLPGWMVDSPKAVKYLDS  242

Query  643   DHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKL  464
              HF VP GRRAVEL+AG+ESALAQ VRT PG+ Y L FSVGDA+NACEGSM+VEAFAG+ 
Sbjct  243   AHFFVPHGRRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACEGSMIVEAFAGEH  302

Query  463   TLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
             T++VP++SKG G + RA  RF A  +RTR+ FLSS Y  + D+  SLCGPV+DDV LVS+
Sbjct  303   TVKVPYESKGAGGAKRAVLRFRASKARTRIVFLSSNYSTRRDDLSSLCGPVLDDVALVSI  362

Query  283   RNPR  272
             RNP+
Sbjct  363   RNPK  366



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   485 bits (1249),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 233/361 (65%), Positives = 287/361 (80%), Gaps = 6/361 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LL +T   V  F  DG++ NG FE+GPK + MKGTRV++ +AIP+WE+SG++EYIKS
Sbjct  9     LFILLISTITSVFCFR-DGMLPNGGFERGPKPSDMKGTRVINKNAIPNWELSGFIEYIKS  67

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL+VP G +AVRLG +A IK  +   KG YYSL+F+ ARTCAQ+ERLN+SV+P
Sbjct  68    GQKQGDMLLVVPAGKFAVRLGNEASIKQRINVTKGMYYSLTFSAARTCAQDERLNISVAP  127

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S     G++P+QT+YSS+GWD Y+WAF A+ +  +IV+HNP  E+ PACGPLID VA+K
Sbjct  128   DS-----GVIPIQTLYSSNGWDLYAWAFQAQNDVAEIVIHNPGEEEHPACGPLIDGVAIK  182

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L PPR    N+LKNG FEEGPYI  N T GVLIPP +EDDH PLP WIIESLKAVKY+D
Sbjct  183   ALYPPRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKYVD  242

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
              +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSM+VEAFAGK
Sbjct  243   VEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGK  302

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
              TL+V ++S GKG   RA  RF A+SSRTRV F S+FY M+SD+  SLCGPVIDDV+L+S
Sbjct  303   DTLKVAYESNGKGGFKRAALRFVAVSSRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLS  362

Query  286   V  284
             V
Sbjct  363   V  363



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   485 bits (1249),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 228/358 (64%), Positives = 287/358 (80%), Gaps = 6/358 (2%)
 Frame = -3

Query  1348  ATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGD  1169
             AT   V+ FT DG++ NG+FE GPK + +KGT+V+  +AIP WE++G+VEYIKSGQKQGD
Sbjct  16    ATVTSVLCFT-DGMLPNGDFELGPKPSDIKGTKVLKKNAIPSWEVTGFVEYIKSGQKQGD  74

Query  1168  MLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPND  989
             MLL+VP G +AVRLG +A IK T+   KG YYSL+F+ ARTCAQ+ERLN+SV+P+S    
Sbjct  75    MLLVVPAGKFAVRLGNEASIKQTLNVTKGMYYSLTFSAARTCAQDERLNISVAPDS----  130

Query  988   WGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR  809
              G++P+QT+YSS GWD Y+WAF AE+   +I++HNP  E+DPACGPLID VA+K+L PPR
Sbjct  131   -GVIPIQTVYSSSGWDLYAWAFQAESSVAEILIHNPGEEEDPACGPLIDGVAIKALYPPR  189

Query  808   RRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSV  629
                 N+LKNG FEEGPY+  N T GVLIPP +EDDH PLP W+IESLKA+KY+D +HFSV
Sbjct  190   PTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVEHFSV  249

Query  628   PEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVP  449
             P+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNACEGSM+VEAFAG+ TL+VP
Sbjct  250   PQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLKVP  309

Query  448   FQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             ++S GKG   RA  RF A+S+RTR+ F S+FY M+SD+  SLCGPVIDDV+L++ R P
Sbjct  310   YKSLGKGGFKRASLRFIAVSTRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLTARKP  367



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   485 bits (1249),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 283/347 (82%), Gaps = 5/347 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG++ NG+FE GPK + MKGT VV+  AIP+WE++G+VEYIKSG KQGDMLL+VP G +A
Sbjct  28    DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  ++ VKG YYSL+F+ ARTCAQ+ERLN+SVSP+S     G++P+QT+YS
Sbjct  88    VRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDERLNISVSPDS-----GVIPIQTVYS  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE+E  ++V+HNP  E+DPACGPLID VA++SL PPR    N+LKNG 
Sbjct  143   SSGWDLYAWAFQAESEVAEVVIHNPGVEEDPACGPLIDGVAMRSLYPPRPTNKNILKNGG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +    T GVLIPP +EDDH PLPGW++ESLKAVKY+D +HFSVP+GRRA+ELVA
Sbjct  203   FEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHFSVPQGRRAIELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQ+VRT  GK Y L F+VGDANNAC+GSMVVEAFAGK TL+VP++S+G G   R
Sbjct  263   GKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPYESRGTGGFKR  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RF A+S+R+RV F S+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  323   ASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   485 bits (1248),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 228/365 (62%), Positives = 290/365 (79%), Gaps = 6/365 (2%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             G+I+  LL + F+    F  DGL+ NG+FE GP    MKGT+V++  AIP WE+SG+VEY
Sbjct  5     GVIVFLLLHSIFYTAFCFK-DGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWELSGFVEY  63

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             I SG KQGDM+L+VP+G +AVRLG +A IK  +   KG+YYS++F+ ARTCAQ+ERLNVS
Sbjct  64    IPSGHKQGDMILVVPKGAFAVRLGNEASIKQKINVKKGSYYSITFSAARTCAQDERLNVS  123

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P+      G++P+QT+YSS GWD YSWAF A+++  ++V+HNP  E+DPACGPLID V
Sbjct  124   VAPHH-----GVMPIQTVYSSSGWDLYSWAFKAQSDYAEVVIHNPGVEEDPACGPLIDGV  178

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+++L PPR    N+LKNG FEEGP++  NT+ GVLIPPN  DDH PLPGW++ESLKAVK
Sbjct  179   AMRALYPPRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWMVESLKAVK  238

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK+Y L F+VGDA+NAC GSM+VEAF
Sbjct  239   YIDSDHFSVPQGRRAVELVAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAF  298

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK TL+VP +SKGKG   RA  +F A+S RTR+ F S+FY M++D+  SLCGPVIDDV+
Sbjct  299   AGKDTLKVPHESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCGPVIDDVK  358

Query  295   LVSVR  281
             L+S R
Sbjct  359   LLSAR  363



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   483 bits (1243),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 225/330 (68%), Positives = 277/330 (84%), Gaps = 5/330 (2%)
 Frame = -3

Query  1264  MKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVK  1085
             M+GT VV  +A+P WEISG+VEYIKSGQKQGDMLL+VP G +AVRLG +A IK  +   +
Sbjct  1     MRGTVVVGRYAVPKWEISGFVEYIKSGQKQGDMLLVVPAGAFAVRLGNEASIKQRLPVAR  60

Query  1084  GTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEA  905
             G YYSL+F+ ARTCAQEE+LNVSV+P     DWG+LP+QT+YSS+GWDSY+WAF A+ + 
Sbjct  61    GMYYSLTFSAARTCAQEEKLNVSVAP-----DWGVLPMQTLYSSNGWDSYAWAFRADQDV  115

Query  904   VDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLI  725
              +IV+HNP  E+DPACGPLIDSVA+++L PP+    N+LKNG+FEEGPY+F NT+WGVLI
Sbjct  116   AEIVIHNPGVEEDPACGPLIDSVAIRALYPPKASNRNLLKNGDFEEGPYVFPNTSWGVLI  175

Query  724   PPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKV  545
             PPN+EDDH PLPGW++ESLKAVKYIDS HFSVPEG+RAVELVAG+ESA+AQV RT PGK 
Sbjct  176   PPNIEDDHSPLPGWMVESLKAVKYIDSGHFSVPEGKRAVELVAGKESAIAQVARTIPGKT  235

Query  544   YDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFL  365
             Y L F+VGDA+N+CEGSMVVEAFAGK T++VP++SKGKG   RA  RF A+S RTR+ F 
Sbjct  236   YVLSFAVGDASNSCEGSMVVEAFAGKDTVKVPYESKGKGGYKRAVLRFKAVSVRTRIMFY  295

Query  364   SSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             S+FY M+SD+  SLCGPV+DDV+L+SVR P
Sbjct  296   STFYTMRSDDFSSLCGPVLDDVKLLSVRFP  325



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   485 bits (1248),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 224/347 (65%), Positives = 284/347 (82%), Gaps = 5/347 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG++ NG+FE GPK + MKGT +++  AIP+WE++G+VEYIKSG KQGDMLL+VP G +A
Sbjct  28    DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+SV+P+S     G++P+QT+YS
Sbjct  88    VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPIQTVYS  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE++  ++V+HNP  E+DPACGPLID VA++SL PPR    N+LKNG 
Sbjct  143   SSGWDLYAWAFQAESDVAEVVIHNPGVEEDPACGPLIDGVAMRSLYPPRPTNKNILKNGG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +   +T GVLIPP +EDDH PLPGW++ESLKAVKY+D +HFSVP+GRRA+ELVA
Sbjct  203   FEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHFSVPQGRRAIELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQVVRT  GK Y L F+VGDANNAC+GSMVVEAFAGK TL+VP++SKG G   R
Sbjct  263   GKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLKVPYESKGTGGFKR  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RF A+S+R+R+ F S+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  323   ASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   484 bits (1247),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 225/347 (65%), Positives = 283/347 (82%), Gaps = 5/347 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG++ NG+FE GPK + MKGT +++  AIP+WE++G+VEYIKSG KQGDMLL+VP G +A
Sbjct  28    DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+SV+P+S     G++P+QT+YS
Sbjct  88    VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPVQTVYS  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE+E  ++V+HNP  E+DPACGPLID VA++SL PPR    N+LKNG 
Sbjct  143   SSGWDLYAWAFQAESEVAEVVIHNPGVEEDPACGPLIDGVAMRSLYPPRPTNKNILKNGG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +    T GVLIPP +EDDH PLPGW++ESLKAVKY+D +HFSVP+GRRA+ELVA
Sbjct  203   FEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDIEHFSVPQGRRAIELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQVVRT  GK Y L F+VGDANNAC+GSMVVEAFAGK TL+VP++S+G G   R
Sbjct  263   GKESAIAQVVRTIIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPYESQGTGGFKR  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RF A+SSR+R+ F S+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  323   ASIRFVAVSSRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   484 bits (1246),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 229/347 (66%), Positives = 276/347 (80%), Gaps = 7/347 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+GP R+Q+ GT+V   +AIP WEISG VEYI+SG KQGDMLL VPEG+YA
Sbjct  24    DGLLPNGNFEKGPSRSQLNGTQVTSRYAIPEWEISGVVEYIESGHKQGDMLLPVPEGVYA  83

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A +K  +K  KG YYS++F  ARTCAQEERLNVSV+P+S     G+LP+QTMYS
Sbjct  84    VRLGNEASVKQNLKVTKGMYYSITFCAARTCAQEERLNVSVTPDS-----GVLPMQTMYS  138

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF A    V++V+HNP  E+DPACGPLIDSVA+K+L PPR    N+LKN +
Sbjct  139   SSGWDCYAWAFKALFAQVELVIHNPGVEEDPACGPLIDSVAIKTLYPPRLTNKNLLKNAD  198

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPYI  NTTWG L+PPN+EDDH PLPGW++ESLKAV YIDS HF VP+G+RAVELV 
Sbjct  199   FEEGPYILPNTTWGALVPPNIEDDHSPLPGWMVESLKAVNYIDSAHFKVPQGKRAVELVG  258

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESALAQV RT  G+VY L F VGDA NAC G MVVEAFA + T++VP+ SKG G   R
Sbjct  259   GKESALAQVARTVVGRVYTLSFLVGDAGNACTGPMVVEAFAARSTVKVPYDSKGTGGFKR  318

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RFTA++ RTRV FLS++Y+ ++D  GSLCGPV+DDV L+SVRNP
Sbjct  319   AVLRFTAVAERTRVVFLSTYYNTRTD--GSLCGPVVDDVTLLSVRNP  363



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   483 bits (1244),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 225/347 (65%), Positives = 283/347 (82%), Gaps = 5/347 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG++ NG+FE GPK + MKGT VV+  AIP+WE++G+VEYIKSG KQGDMLL+VP G +A
Sbjct  28    DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  ++ VKG YYSL+F+ ARTCAQ+ERLN+SVSP+S     G++P+QT+YS
Sbjct  88    VRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDERLNISVSPDS-----GVIPIQTVYS  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE++  ++V+HNP  E+DPACGPLID VA++SL PPR    N+LKNG 
Sbjct  143   SSGWDLYAWAFQAESDVAEVVIHNPGVEEDPACGPLIDGVAMRSLYPPRPTNKNILKNGG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +    T GVLIPP +EDDH PLPGW++ESLKAVKY+D +HFSVP+GRRA+ELVA
Sbjct  203   FEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHFSVPQGRRAIELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQ+VRT  GK Y L F+VGDANNAC+GSMVVEAFAGK TL+VP++S+G G   R
Sbjct  263   GKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPYESRGTGGFKR  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RF A+S+R+RV F S+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  323   ASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  369



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   483 bits (1244),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 223/369 (60%), Positives = 288/369 (78%), Gaps = 6/369 (2%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
             T   +  ++  TFH+ I+   DGL+ NGNFE  PK + + GT V+  +A+P W  SG+VE
Sbjct  6     TAATIFMVVLGTFHIAIAIK-DGLMENGNFEIAPKDSDLNGTVVLRQNAVPGWITSGFVE  64

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YIK+GQKQGDM+L+VPEG  A+RLG +A IK  +   KG YYS++F+ ARTCAQEE+LNV
Sbjct  65    YIKAGQKQGDMILVVPEGHAAIRLGNEASIKQKINVTKGMYYSITFSAARTCAQEEQLNV  124

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P     D+G+LP+QT+YSS GWDSY+WAF A    V I++HNP  E+DPACGPLIDS
Sbjct  125   SVAP-----DFGVLPMQTLYSSSGWDSYAWAFQAMYTVVYIIIHNPGVEEDPACGPLIDS  179

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             +A+++L PP+    N++KNG+FEEGPYIF NT+WGVLIPPN+EDDH PLPGW+IESLKAV
Sbjct  180   IAIRTLYPPKATSENLVKNGDFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAV  239

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYID+ HFSVP   RAVELVAG+ESA+AQV RT  GK Y L F VGDA+N+CEGSM+VEA
Sbjct  240   KYIDAAHFSVPHNSRAVELVAGKESAIAQVARTIIGKTYTLTFLVGDASNSCEGSMIVEA  299

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             +AG +T+++P+ S+GKG    A   F A ++RTR+ F S++YH +SD++ SLCGPVIDDV
Sbjct  300   YAGIVTVKIPYTSQGKGGYKPAVLHFVATTNRTRIMFFSTYYHTRSDDNASLCGPVIDDV  359

Query  298   RLVSVRNPR  272
             +L+SVRNPR
Sbjct  360   KLLSVRNPR  368



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   483 bits (1243),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 284/347 (82%), Gaps = 5/347 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG++ NG+FE GPK + MKGT +++  AIP+WE++G+VEYIKSG KQGDMLL+VP G +A
Sbjct  28    DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+SV+P+S     G++P+QT+YS
Sbjct  88    VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPIQTVYS  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE++  ++V+HNP  E+DPACGPLID VA++SL PPR    N+LKNG 
Sbjct  143   SSGWDLYAWAFQAESDVAEVVIHNPGVEEDPACGPLIDGVAMRSLYPPRPTNKNILKNGG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +   +T GVLIPP +EDDH PLPGW++ESLKAVKY+D +HFSVP+GRRA+ELVA
Sbjct  203   FEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHFSVPQGRRAIELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQVVRT  GK Y L F+VGDANNAC+GSMVVE+FAGK TL+VP++SKG G   R
Sbjct  263   GKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVESFAGKDTLKVPYESKGTGGFKR  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RF A+S+R+R+ F S+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  323   ASIRFVAVSTRSRMMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   482 bits (1241),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 283/347 (82%), Gaps = 5/347 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG++ NG+FE GPK + MKGT +++  AIP+WE++G+VEYIKSG KQGDMLL+VP G +A
Sbjct  28    DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+SV+P+S     G++P+QT+YS
Sbjct  88    VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPIQTVYS  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE++  ++V+HNP  E+DPACGPLID VA++SL PPR    N+LKNG 
Sbjct  143   SSGWDLYAWAFQAESDVAEVVIHNPGVEEDPACGPLIDGVAMRSLYPPRPTNKNILKNGG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +   +T GVLIPP +EDDH PLPGW++ESLKAVKY+D +HFSVP+GRRA+ELVA
Sbjct  203   FEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHFSVPQGRRAIELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQVVRT  GK Y L F+VGDANNAC+GSMVVEAFAGK TL+VP++SKG G   R
Sbjct  263   GKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDTLKVPYESKGTGGFKR  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RF A+ +R+R+ F S+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  323   ASIRFVAVLTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVRKP  369



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   482 bits (1240),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 229/369 (62%), Positives = 288/369 (78%), Gaps = 10/369 (3%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEYI  1193
              LL L C  FH+  SFT  G V NG FE GPK   MKGT V   PH+IP WEISG++EYI
Sbjct  6     FLLVLFCC-FHVAFSFT-HGAVINGEFELGPKPQDMKGTVVTGGPHSIPGWEISGFIEYI  63

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSGQKQ DMLL+VP G YAVRLG +A IK  +K VKG YYS++F  ARTCAQEE+LNVS 
Sbjct  64    KSGQKQDDMLLVVPNGAYAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSA  123

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     DW +LP+QT+Y  +GWD+Y+W+F A+  +VD+V HNP  E+DPACGP+IDS+A
Sbjct  124   AP-----DWVVLPMQTVYGGNGWDAYAWSFRADYPSVDMVFHNPGKEEDPACGPIIDSIA  178

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVED--DHCPLPGWIIESLKAV  659
             ++ L PPR    N+LKNG FEEGPY+F NT+ GVLIPPN+ D  +H PLPGW++ESLKAV
Sbjct  179   IQPLYPPRLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAV  238

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             +YIDSDHFSVP+G+RAVEL+ G+ESA+AQV RT PGK Y L+F+VGDA N+CEGS+ VEA
Sbjct  239   RYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSCEGSLSVEA  298

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             + GK +++VP++SKGKG   RA  +F A+S+RTR+ FLS+FY+M+SD+  SLCGPVIDDV
Sbjct  299   YVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLASLCGPVIDDV  358

Query  298   RLVSVRNPR  272
              L+S+R P 
Sbjct  359   TLISLRKPH  367



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   482 bits (1240),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 225/347 (65%), Positives = 282/347 (81%), Gaps = 5/347 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG++ NG+FE GPK + MKGT VV+  AIP+WE++G+VEYIKSG KQGDMLL+VP G +A
Sbjct  29    DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  88

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  ++ VKG YYSL+F+ ARTCAQ+E LN+SVSP+S     G++P+QT+YS
Sbjct  89    VRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDEMLNISVSPDS-----GVIPIQTVYS  143

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE+E  ++V+HNP  E+DPACGPLID VA++SL PPR    N+LKNG 
Sbjct  144   SSGWDLYAWAFQAESEVAEVVIHNPGVEEDPACGPLIDGVAMRSLYPPRPTNKNILKNGG  203

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +    T GVLIPP +EDDH PLPGW++ESLKAVKY+D +HFSVP+GRRA+ELVA
Sbjct  204   FEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHFSVPQGRRAIELVA  263

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQ+VRT  GK Y L F+VGDANNAC+GSMVVEAFAGK TL+VP++S+G G   R
Sbjct  264   GKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPYESRGTGGFKR  323

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RF A+S+R+RV F S+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  324   ASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVRKP  370



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   480 bits (1236),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 222/347 (64%), Positives = 283/347 (82%), Gaps = 5/347 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG++ NG+FE GPK + MKGT+V++  AIP+WE+SG+VEYIKSGQKQGDMLL+VP G +A
Sbjct  23    DGMLPNGDFELGPKPSDMKGTQVINRSAIPNWELSGFVEYIKSGQKQGDMLLVVPAGKFA  82

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             +RLG +A IK  ++ +KG YYSL+F+ ARTCAQ+ERLN+S +P     DWG++P+QT+YS
Sbjct  83    IRLGNEASIKQRLRLIKGMYYSLTFSAARTCAQDERLNISAAP-----DWGVIPIQTVYS  137

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE E V++V+HNP  E+DPACGPLID+VA+++L PPR    N+LKNG 
Sbjct  138   SYGWDLYAWAFQAETEVVEVVIHNPGVEEDPACGPLIDAVAMRALYPPRPTNKNVLKNGG  197

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +  N+T GVLIPP +EDDH PLPGW++ESLKAVKYID +HFSVP+GRRA+ELVA
Sbjct  198   FEEGPLVLPNSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYIDIEHFSVPQGRRAIELVA  257

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQV     GK Y L F+VGDA+NAC+GSM+VEAFAG+ TL+VP++S+G G   R
Sbjct  258   GKESAIAQVAPAIAGKTYVLSFAVGDASNACKGSMIVEAFAGRDTLKVPYESRGTGGFKR  317

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  RF A S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  318   AAMRFVATSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRKP  364



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   480 bits (1236),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 228/368 (62%), Positives = 291/368 (79%), Gaps = 8/368 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             + LL +  A    V+SF  DG++ NG+FE GPK + +KGT V++  AIP+WE++G+VEYI
Sbjct  9     LFLLLITTAANSAVVSFR-DGILPNGDFELGPKPSDIKGTEVLNKMAIPNWEVTGFVEYI  67

Query  1192  KS--GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
              S  G KQGDMLL+VP G +AVRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+
Sbjct  68    SSASGHKQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNI  127

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P+S     G++P+QT+YSS GWD Y+WAF AE+E  ++V+HNP  E+DPACGPLID 
Sbjct  128   SVAPDS-----GVIPVQTVYSSSGWDLYAWAFQAESEVAEVVIHNPGQEEDPACGPLIDG  182

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA++SL PPR    N+LKNG FEEGP +    T GVLIPP +EDDH PLPGW++ESLKAV
Sbjct  183   VAMRSLYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAV  242

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KY+D++HFS+P+GRRA+ELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEA
Sbjct  243   KYVDTEHFSIPQGRRAIELVAGKESAIAQVARTVIGKTYVLSFAVGDANNACKGSMVVEA  302

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FAG+ TL+VP++S+G G   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV
Sbjct  303   FAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDV  362

Query  298   RLVSVRNP  275
             +L+SVR P
Sbjct  363   KLLSVRKP  370



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   479 bits (1232),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/364 (62%), Positives = 287/364 (79%), Gaps = 6/364 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             + L L+       +SF  DG++ NG+FE GPK + MKGT V++  AIP+WE++G+VEYI 
Sbjct  9     LFLLLITTANSAGVSFR-DGMLPNGDFELGPKPSDMKGTEVLNKMAIPNWEVTGFVEYIS  67

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SG  QGDMLL+VP G +AVRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+SV+
Sbjct  68    SGHTQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVA  127

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P+S     G++P+QT+YSS GWD YSWAF AE+E  +IV+HNP  E+DPACGPLID +A+
Sbjct  128   PDS-----GVIPVQTVYSSSGWDLYSWAFQAESEIAEIVIHNPGEEEDPACGPLIDGIAM  182

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L PPR    N+LKNG FEEGP +   +T GVLIPP +EDDH PLPGW++ESLKAVKY+
Sbjct  183   KALYPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYV  242

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D++HFS+P+GRRA+ELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEAFAG
Sbjct  243   DTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAG  302

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             + TL+VP++S+G G   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+
Sbjct  303   RDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLI  362

Query  289   SVRN  278
             S R 
Sbjct  363   SARK  366



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   478 bits (1231),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 282/346 (82%), Gaps = 5/346 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DG++ NG+FE GPK + MKGT V++  AIP+WE++G+VEYI SG KQGDMLL+VP G +A
Sbjct  26    DGILPNGDFELGPKPSDMKGTEVINKMAIPNWEVTGFVEYISSGHKQGDMLLVVPAGKFA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+SV+P+S     G++P+QT+YS
Sbjct  86    VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPVQTVYS  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWD Y+WAF AE+E  +IV+HNP  E+DPACGPLID VA+++L PPR    N+LKNG 
Sbjct  141   SSGWDLYAWAFQAESEVAEIVIHNPGEEEDPACGPLIDGVAMRALYPPRPTNKNILKNGG  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP +   +T GVLIPP +EDDH PLPGW++ESLKAVKY+D++HFS+P+GRRA+ELVA
Sbjct  201   FEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHFSIPQGRRAIELVA  260

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEAFAG+ TL+VP++S+G G   R
Sbjct  261   GKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLKVPYESRGTGGFKR  320

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
             A  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+SVR 
Sbjct  321   ASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVRK  366



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   477 bits (1227),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 277/345 (80%), Gaps = 7/345 (2%)
 Frame = -3

Query  1309  LVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVR  1130
             L+ NGNFE+GP R+Q+ GT+V+  +AIP WEI+G+VEYI+SG KQGDMLL VPEG++AVR
Sbjct  32    LLPNGNFEKGPSRSQLNGTQVIGRYAIPEWEITGFVEYIESGHKQGDMLLPVPEGVHAVR  91

Query  1129  LGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSD  950
             LG +A IK  +K  KG YYS++F  ARTCAQEERLNVSV+P+S     G+LP+QTMYSS 
Sbjct  92    LGNEASIKQKLKVTKGMYYSITFCAARTCAQEERLNVSVTPDS-----GVLPMQTMYSSS  146

Query  949   GWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFE  770
             GWD Y+WAF A    V++V+HNP  E+DPACGPLIDSVA+K+L PPR    N+LKN +FE
Sbjct  147   GWDCYAWAFQALFPQVELVIHNPGVEEDPACGPLIDSVAIKTLYPPRLTNKNLLKNADFE  206

Query  769   EGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGR  590
             EGPYI  NTTWGVL+PPN+EDDH PLP W++ESLKAV YIDS HF VP+G+RAVELV G+
Sbjct  207   EGPYILPNTTWGVLVPPNIEDDHSPLPSWMVESLKAVNYIDSAHFKVPQGKRAVELVGGK  266

Query  589   ESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAK  410
             ESALAQVVRT  G+VY L FSVGDA NAC G+M+VEAFA + T++VP+ SKG G   RA 
Sbjct  267   ESALAQVVRTVVGRVYTLSFSVGDAGNACAGTMMVEAFAARSTVKVPYDSKGTGGFKRAV  326

Query  409   HRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
              RFTA + RTRV FLS++Y+ ++D  GSLCGPV+DDV L+SVR P
Sbjct  327   LRFTAEAERTRVVFLSTYYNTRTD--GSLCGPVVDDVTLLSVRKP  369



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   474 bits (1221),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 229/365 (63%), Positives = 280/365 (77%), Gaps = 6/365 (2%)
 Frame = -3

Query  1363  LALLCATFHLVISF-TPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L LL   F   +S    DGL+ NGNFE GPK +Q+KG  V D  AIP WEISGYVEYIK+
Sbjct  5     LVLLAFLFSNAVSVPIRDGLLPNGNFELGPKSSQLKGVLVTDRAAIPKWEISGYVEYIKA  64

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQ QGDMLL+VPEG  AVRLG +A I+  +    G +YS++F+ ARTCAQEERLN+SV+ 
Sbjct  65    GQTQGDMLLVVPEGSSAVRLGNEASIRQKISVRTGQFYSITFSAARTCAQEERLNISVTH  124

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
              S     G++P+QTMYSS+GWDSY+WAF A    +++ +HNP  E+DPACGPLIDS+A+K
Sbjct  125   ES-----GIIPIQTMYSSNGWDSYAWAFKAGGPDIEVRIHNPGLEEDPACGPLIDSLAIK  179

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
             +L+PPR  R NM+KNGNFEEGPY+F N  WGVLIPP +EDD+  LPGWI+ESLKAVKY+D
Sbjct  180   ALSPPRFLRNNMIKNGNFEEGPYVFPNVKWGVLIPPFIEDDNSALPGWIVESLKAVKYVD  239

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
               HF+VPEG RA+ELV G+ES++AQ+VRT P K Y L F+VGDA N+CEG M VEAFAG+
Sbjct  240   KAHFAVPEGHRAIELVGGKESSVAQIVRTTPNKFYKLTFAVGDAGNSCEGPMAVEAFAGR  299

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
               + V + S GKG S  A+  F AIS+RTRV FLS+FYH KSD+SGSLCGPVIDDVRLV 
Sbjct  300   GRISVDYVSSGKGGSKPARLMFKAISARTRVTFLSTFYHTKSDHSGSLCGPVIDDVRLVP  359

Query  286   VRNPR  272
             VR+ R
Sbjct  360   VRSLR  364



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   472 bits (1215),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 220/344 (64%), Positives = 278/344 (81%), Gaps = 5/344 (1%)
 Frame = -3

Query  1309  LVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVR  1130
             ++ NG+FE GPK + MKGT V++  AIP+WEI+G+VEYI SG  QGDMLL+VP G +AVR
Sbjct  1     MLPNGDFELGPKPSDMKGTEVLNRMAIPNWEITGFVEYISSGHTQGDMLLVVPAGKFAVR  60

Query  1129  LGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSD  950
             LG +A IK  +K VKG YYSL+F+ ARTCAQ+ERLN+SV+P+S     G++P+QT+YSS 
Sbjct  61    LGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPVQTVYSSS  115

Query  949   GWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFE  770
             GWD YSWAF AE+E  +IV+HNP  E+DPACGPLID +A+K+L PPR    N+LKNG FE
Sbjct  116   GWDLYSWAFQAESEIAEIVIHNPGEEEDPACGPLIDGIAMKALYPPRPTNKNILKNGGFE  175

Query  769   EGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGR  590
             EGP +   +T GVLIPP +EDDH PLPGW++ESLKAVKY+D++HFS+P+GRRA+ELVAG+
Sbjct  176   EGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHFSIPQGRRAIELVAGK  235

Query  589   ESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAK  410
             ESA+AQV RT  GK Y L F+VGDANNAC+GSMVVEAFAG+ TL+VP++S+G G   RA 
Sbjct  236   ESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLKVPYESRGTGGFKRAS  295

Query  409   HRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
              RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+S R 
Sbjct  296   IRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLISARK  339



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   469 bits (1208),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/368 (63%), Positives = 288/368 (78%), Gaps = 9/368 (2%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
             +G++LL LLCAT  L +  T DGL+ANGNFE+GP+ +Q++GT+VV   +IP W  SG+VE
Sbjct  7     SGLVLL-LLCATCRLALGIT-DGLLANGNFERGPQPSQLRGTQVVGASSIPSWRTSGFVE  64

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVK-AVKGTYYSLSFTFARTCAQEERLN  1022
             YI SGQKQGDM+L+VPEG YAVRLG +A I   ++ AV G  YSL+F+ ARTCAQ ERLN
Sbjct  65    YIPSGQKQGDMVLVVPEGAYAVRLGNEASIAQRLRGAVPGARYSLTFSAARTCAQAERLN  124

Query  1021  VSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLID  842
             VS S  S     G+L +QTMYSS+GWDSYSWA+ A A+ V++V+HNP   +DPACGPLID
Sbjct  125   VSASGQS-----GVLVMQTMYSSNGWDSYSWAWDASADEVEVVVHNPGVTEDPACGPLID  179

Query  841   SVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKA  662
             SVA+K+L PPRR   N++KNG+FEEGPYI   T WGVLIP    D+H PLPGW++ESLKA
Sbjct  180   SVAIKTLTPPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRTVDEHSPLPGWMVESLKA  239

Query  661   VKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVE  482
             VKYIDSDHF+VP GRRAVEL+AGRESA+AQV+RT PGK Y L FSVGDA+N C GS++VE
Sbjct  240   VKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNTCRGSLMVE  299

Query  481   AFAGKLTLQVPFQSKGK-GVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVID  305
             A+AG+ + +VP++S G+ G + RA   F A S RTRV F SSFY+ ++D+  SLCGPVID
Sbjct  300   AYAGRESAKVPYESAGQGGAAKRAVLPFRATSPRTRVVFFSSFYNTRTDDMSSLCGPVID  359

Query  304   DVRLVSVR  281
             DV +VSVR
Sbjct  360   DVAVVSVR  367



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   468 bits (1204),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 212/337 (63%), Positives = 273/337 (81%), Gaps = 5/337 (1%)
 Frame = -3

Query  1282  GPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKT  1103
              P ++ + GT V+ PHAIP W+ISG+VEYIK+GQKQGDMLL+VPEG  AVRLG +A +K 
Sbjct  2     APAKSDLNGTIVLKPHAIPKWQISGFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASVKQ  61

Query  1102  TVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAF  923
              V   KG YYS++F+ ARTCAQEE +NVSV+P     D+G+LP+QT+YSS+GWDSY+WAF
Sbjct  62    YVNVTKGMYYSITFSAARTCAQEEMVNVSVAP-----DFGVLPIQTLYSSNGWDSYAWAF  116

Query  922   LAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNT  743
                +   +I++HNP  E+DPACGPLID++A+++L PPR  R N+LKNG+FEEG YI   T
Sbjct  117   RTSSSVAEILIHNPGVEEDPACGPLIDAIAIRALYPPRPTRDNLLKNGDFEEGAYILPKT  176

Query  742   TWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVR  563
             +WGVLIPPN+EDD+ PLP W++ESLKAVKYID  HFSVP G RA+ELV G+ESA+AQV R
Sbjct  177   SWGVLIPPNIEDDNSPLPAWMVESLKAVKYIDRAHFSVPHGERAIELVGGKESAIAQVAR  236

Query  562   TRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSR  383
             T  GK Y L F+VGDA+N+CEGSM+VEAFAG+ T++VP++S+GKG   RA  RF A ++R
Sbjct  237   TIAGKTYQLTFAVGDASNSCEGSMIVEAFAGRDTVKVPYESRGKGGYKRAVLRFVAPTNR  296

Query  382   TRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             TR+ FLS++YHM+SD+  SLCGPV+DDV+L+SVRNPR
Sbjct  297   TRIMFLSTYYHMRSDDYASLCGPVVDDVKLLSVRNPR  333



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   469 bits (1207),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/369 (61%), Positives = 284/369 (77%), Gaps = 12/369 (3%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEYI  1193
              LL L C  FH+  SFT    V NG FE GPK   MKGT V   PH+IP WEISG++EYI
Sbjct  6     FLLVLFCC-FHVAFSFTH---VINGEFELGPKPQDMKGTVVTGGPHSIPGWEISGFIEYI  61

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSGQKQ DMLL+VP G YAVRLG +A IK  +K VKG YYS++F  ARTCAQEE+LNVS 
Sbjct  62    KSGQKQDDMLLVVPNGAYAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSA  121

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     DW +LP+QT+Y  +GWD+Y+W+F A+  +VD+V HNP  E+DPACGP+IDS+A
Sbjct  122   AP-----DWVVLPMQTVYGGNGWDAYAWSFRADYPSVDMVFHNPGKEEDPACGPIIDSIA  176

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVED--DHCPLPGWIIESLKAV  659
             ++ L PPR    N+LKNG FEEG Y+F NT+ GVLIPPN+ D  +H PLPGW++ESLKAV
Sbjct  177   IQPLYPPRLTNKNVLKNGGFEEGLYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAV  236

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             +YIDSDHFSVP+G+RAVEL+ G+ESA+AQV RT PGK Y L+F+VGDA N+ EGS+ VEA
Sbjct  237   RYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSSEGSLSVEA  296

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             + GK +++VP++SKGKG   RA  +F A+S+RT + FLS+FY+M+SD+  SLCGPVIDDV
Sbjct  297   YVGKESVKVPYESKGKGGFKRATLKFVAVSTRTHILFLSTFYNMRSDDLASLCGPVIDDV  356

Query  298   RLVSVRNPR  272
              L+S+R P 
Sbjct  357   TLISLRKPH  365



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   467 bits (1201),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 226/367 (62%), Positives = 285/367 (78%), Gaps = 17/367 (5%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             G+I+L LL + F++   F  DGL+ NG+FE GP+ + MKGT+V++  AIP+WE+SG+VEY
Sbjct  5     GVIVLLLLHSFFYVAFCFK-DGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEY  63

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             I SGQKQGDM+L+VP+G +AVRLG +A IK  +   KG+YYS++F+ ARTCAQ+ERLNVS
Sbjct  64    IPSGQKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVS  123

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P+       ++P+QT+YSS GWD            +  V+HNP  E+DPACGPLID V
Sbjct  124   VAPHH-----AVMPIQTVYSSSGWDR-----------IGAVIHNPGVEEDPACGPLIDGV  167

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVK  656
             A+++L PPR    N+LKNG FEEGP++  NTT GVLIPPN  DDH PLPGW++ESLKAVK
Sbjct  168   AMRALFPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVK  227

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             YIDSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK Y L F+VGDA+NAC GSM+VEAF
Sbjct  228   YIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAF  287

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AGK T++VP++SKGKG   RA  RF A S RTRV F S+FY M++D+  SLCGPVIDDV+
Sbjct  288   AGKDTIKVPYESKGKGGFKRASLRFVAASGRTRVMFYSTFYAMRNDDFSSLCGPVIDDVK  347

Query  295   LVSVRNP  275
             L+S R P
Sbjct  348   LLSARRP  354



>gb|KDO52908.1| hypothetical protein CISIN_1g0399092mg, partial [Citrus sinensis]
Length=315

 Score =   464 bits (1195),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/315 (68%), Positives = 259/315 (82%), Gaps = 0/315 (0%)
 Frame = -3

Query  1309  LVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVR  1130
             L+ NGNFE GPKR+QMKGT V  P+AIP+W+ISGYVEYIKSG KQGDMLL+VPEG++AVR
Sbjct  1     LLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLIVPEGVFAVR  60

Query  1129  LGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSD  950
             LG +A IK  +K  KG +YS++F+ ARTCAQEE+LNVSVSPN E NDW +LP+QTMYS++
Sbjct  61    LGNEASIKQNIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLETNDWAILPMQTMYSNN  120

Query  949   GWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFE  770
             GWDSY+WAF+A+AE V+I +HNP  E+DPACGPLIDSVALK L PP+R   N+LKNGNFE
Sbjct  121   GWDSYAWAFVADAEEVEITIHNPGVEEDPACGPLIDSVALKVLYPPKRTGVNILKNGNFE  180

Query  769   EGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGR  590
             EGPY+F N +WGVLIPP +EDDH PLPGWIIESLKAVKYID  HF VPEGRRA+ELVAG+
Sbjct  181   EGPYVFPNASWGVLIPPKIEDDHSPLPGWIIESLKAVKYIDLKHFFVPEGRRAIELVAGK  240

Query  589   ESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAK  410
             ESAL QVV+T   K Y L F+VGDA N C G++ VEA+AG+  ++V + SKGKG   +A 
Sbjct  241   ESALTQVVKTEVNKTYALSFAVGDAGNGCAGTLGVEAYAGRDNVKVTYASKGKGGFKKAL  300

Query  409   HRFTAISSRTRVRFL  365
              RF A+S RTR+ FL
Sbjct  301   LRFKAVSPRTRIMFL  315



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   465 bits (1196),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 225/367 (61%), Positives = 286/367 (78%), Gaps = 10/367 (3%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             ++L LLCAT  L +  T DGL+ NGNFE+GP  +Q++GTRV+   AIP W+ SG+VEYI 
Sbjct  5     VMLLLLCATCRLALGIT-DGLLPNGNFERGPAPSQLRGTRVMGSSAIPAWQTSGFVEYIP  63

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVK-AVKGTYYSLSFTFARTCAQEERLNVSV  1013
             SG+KQGDM+L+VPEG YAVRLG +A I+  +  A +G  YSL+F+ ARTCAQ E+LNVS 
Sbjct  64    SGRKQGDMVLVVPEGAYAVRLGNEASIRQRLHGAARGARYSLTFSAARTCAQAEQLNVSA  123

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             S  S     G+L +QTMYSS+GWDSY+WA++A+A+ VD+V+HNP    DPACGPLIDSVA
Sbjct  124   SGQS-----GLLAMQTMYSSNGWDSYAWAWVADADEVDVVIHNPG---DPACGPLIDSVA  175

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             +K+LNPPRR   N++KNG+FEEGPYI   T WGVLIP  V DDH PLPGW++ESLKA+KY
Sbjct  176   IKTLNPPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRVVDDHSPLPGWMVESLKAIKY  235

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDSD F+VP GRRAVEL+AGRESA+AQV+RT PG+ Y L F+VGDA+NAC GS++VEA+A
Sbjct  236   IDSDSFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNACRGSLMVEAYA  295

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G+ + +V ++S GKG   RA   F A S+RTR+ F SSFY  +SD+  SLCGPV+DDV +
Sbjct  296   GRESTKVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSSLCGPVLDDVAV  355

Query  292   VSVRNPR  272
             VSVR  +
Sbjct  356   VSVRTTK  362



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   473 bits (1216),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 229/365 (63%), Positives = 282/365 (77%), Gaps = 7/365 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +L  LL AT H       DGL+ NGNFE  PK + + GT V   +AIP WEISG+VEYIK
Sbjct  6     LLSVLLLATCHFSFC-VKDGLLENGNFELAPKASDLNGTEVKGRYAIPEWEISGFVEYIK  64

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             +GQKQGDMLL+VPEG  AVRLG +A IK  +   KG +Y+L+F  ARTCAQEERLNVSV 
Sbjct  65    AGQKQGDMLLVVPEGACAVRLGNEASIKQRLNVTKGMFYALTFCAARTCAQEERLNVSVP  124

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P+S     G+LP+QT+Y S+GWD YSWAFLA    V+I++HNP  E+DPACGPLIDS+A+
Sbjct  125   PDS-----GLLPIQTLYGSNGWDCYSWAFLAPLSLVEIIIHNPGVEEDPACGPLIDSIAI  179

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K L  P+    N+++N +FE GPY+F NTT GVLIPPN+EDDH PLP W++ESLKAVKYI
Sbjct  180   KELVNPKPTSENLIRNPSFEYGPYVF-NTTTGVLIPPNIEDDHSPLPYWMVESLKAVKYI  238

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             DSDHFSVP G+RAVELVAG+ESA+AQVVRT  GK Y L FSVGDA+N+CEGSM+VEAFAG
Sbjct  239   DSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNSCEGSMIVEAFAG  298

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             + T++VP++SKGKG   R    F A  +RTR+ FLS+FY M+SD+  SLCGPV+DD++L+
Sbjct  299   RATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSSLCGPVLDDIKLL  358

Query  289   SVRNP  275
             SVR P
Sbjct  359   SVRKP  363



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   464 bits (1194),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 220/365 (60%), Positives = 283/365 (78%), Gaps = 6/365 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISF-TPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             I+LALLC + ++V+S    DGL+ NGNFE GPK +Q+KG+ +    A+P+W+I+G+VEYI
Sbjct  7     IILALLCLSSNVVVSAPIRDGLLPNGNFEMGPKPSQLKGSIIKGRTAVPNWDITGFVEYI  66

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             K+GQ+Q DM+L+VPEG  AVRLG +A I   +    G  YS++F+ ARTCAQ+ERLN+SV
Sbjct  67    KAGQRQEDMVLVVPEGASAVRLGNEASISQKITVQSGRLYSITFSAARTCAQDERLNISV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +  S     G++P+QTMY SDGWDSYSWAF A    ++I +HNP  E+DPACGPLID+VA
Sbjct  127   THES-----GVIPIQTMYGSDGWDSYSWAFKAGGPEIEIRVHNPGHEEDPACGPLIDAVA  181

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             +K+L PPR    N++KNGNFEEGPY+F    WGVLIPP +EDD+ PLPGWIIESLKAVKY
Sbjct  182   IKALFPPRFIGNNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKY  241

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +D  HF+VPEG RA+ELVAG+ESA++Q+VRT   + Y L F+VGDA + CEG M+VEAFA
Sbjct  242   VDKAHFAVPEGHRAIELVAGKESAISQIVRTSLNQFYALTFNVGDARDTCEGPMIVEAFA  301

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G+  + V + SKGKG   + K  F A+S+RTRV FLS+FYHMKSD+SGSLCGPVIDDVRL
Sbjct  302   GRSKIMVDYVSKGKGGFTQGKLVFKAVSTRTRVTFLSTFYHMKSDHSGSLCGPVIDDVRL  361

Query  292   VSVRN  278
             V++R 
Sbjct  362   VAIRK  366



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   462 bits (1188),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 276/353 (78%), Gaps = 6/353 (2%)
 Frame = -3

Query  1324  FTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEG  1145
             F   G + NGNFEQ P    + G+ +   +AIP WEISG+VEYIK+GQKQGDMLL+VPEG
Sbjct  1     FVAAGPLDNGNFEQPPDPKDLNGSVIKTRYAIPKWEISGFVEYIKAGQKQGDMLLVVPEG  60

Query  1144  IYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQT  965
               A+RLG +A IK ++    G YYSL+F+ ARTCAQEE+LN+SV+P     D G+LP+QT
Sbjct  61    YAAIRLGNEASIKQSLNVTPGLYYSLTFSAARTCAQEEKLNISVAP-----DNGVLPVQT  115

Query  964   MYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLK  785
             +YSS+GWDSY+WAF A     D+++HNP  E+DPACGPLIDSVA+++L PP+    N+LK
Sbjct  116   LYSSNGWDSYAWAFRAVYGVADVLIHNPGVEEDPACGPLIDSVAIRALYPPKPTNQNILK  175

Query  784   NGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVE  605
             NG+FEEG YIF NT+WGVLIPPN+EDD+ PLP W++ESLKAV+YIDS HFSVP GRRA+E
Sbjct  176   NGDFEEGAYIFPNTSWGVLIPPNIEDDNSPLPAWMVESLKAVRYIDSAHFSVPRGRRAIE  235

Query  604   LVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGV  425
             LV GRESA+AQV RT  GK Y L F+VGDA+N+CEGSMVVEAFAG  ++++P++S G+G 
Sbjct  236   LVGGRESAIAQVARTAAGKFYRLTFAVGDASNSCEGSMVVEAFAGGSSVRIPYESSGRGG  295

Query  424   SVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR-NPRI  269
               RA  +F A S RTR+ F S++YHM+SD+  SLCGPV+DDV L+SVR  PR+
Sbjct  296   YKRAILQFVAASDRTRIMFTSTYYHMRSDDYASLCGPVVDDVELLSVRETPRL  348



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   459 bits (1181),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 217/333 (65%), Positives = 266/333 (80%), Gaps = 8/333 (2%)
 Frame = -3

Query  1264  MKGTRVVD-PHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAV  1088
             MKGT V   PHAIP WEISG++EY+KSGQKQGDMLL+VP G YAVRLG  A IK  +K V
Sbjct  1     MKGTVVTGGPHAIPGWEISGFIEYLKSGQKQGDMLLVVPNGAYAVRLGNGASIKQKIKVV  60

Query  1087  KGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAE  908
             KG YYS++F  ARTCAQEE+LNVSV+P     DW +LP+QT+YS +GWD+Y+W+F A+  
Sbjct  61    KGMYYSITFMVARTCAQEEKLNVSVAP-----DWVVLPMQTLYSGNGWDAYAWSFQADYS  115

Query  907   AVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVL  728
              VD+  H+P  E+DPACGP+IDS+ALK+L PPR    N+LKNG FEEGPY+F NTT GVL
Sbjct  116   LVDMAFHHPGKEEDPACGPIIDSIALKALYPPRPTNKNVLKNGGFEEGPYVFPNTTSGVL  175

Query  727   IPPNVED--DHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRP  554
             IPPN+ D  DH PLPGWI+ESLKAVKYIDSDHFSVP G+ AVEL+ G+ESA+AQV RT P
Sbjct  176   IPPNIVDLSDHSPLPGWIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIP  235

Query  553   GKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRV  374
             GK Y L F+VGDA N+CEGS+ VEA+ GK +++VP++SKGKG   RA  +F A+S+RTR+
Sbjct  236   GKTYTLSFAVGDAGNSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRI  295

Query  373   RFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
              FLS+FY M+SD+  SLCGPVIDDV L+S+R P
Sbjct  296   LFLSTFYTMRSDDFASLCGPVIDDVTLISLRKP  328



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   459 bits (1181),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 216/330 (65%), Positives = 270/330 (82%), Gaps = 5/330 (2%)
 Frame = -3

Query  1264  MKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVK  1085
             MKGT+V++  AIP+WE+SG+VEYI SG KQGDM+L+VP+G +AVRLG +A IK  +   K
Sbjct  1     MKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKK  60

Query  1084  GTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEA  905
             G+YYS++F+ ARTCAQ+ERLNVSV+P+       ++P+QT+YSS GWD YSWAF A+++ 
Sbjct  61    GSYYSITFSAARTCAQDERLNVSVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDY  115

Query  904   VDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLI  725
              DIV+HNP  E+DPACGPLID VA+++L PPR    N+LKNG FEEGP++  N + GVLI
Sbjct  116   ADIVIHNPGVEEDPACGPLIDGVAMRALFPPRPTNKNILKNGGFEEGPWVLPNISSGVLI  175

Query  724   PPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKV  545
             PPN  DDH PLPGW++ESLKAVKYIDSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK 
Sbjct  176   PPNSIDDHSPLPGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKT  235

Query  544   YDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFL  365
             Y L FSVGDA+NAC GSM+VEAFAGK T++VP++SKGKG   R+  RF A+SSRTRV F 
Sbjct  236   YVLSFSVGDASNACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFY  295

Query  364   SSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             S+FY M++D+  SLCGPVIDDV+L+S R P
Sbjct  296   STFYAMRNDDFSSLCGPVIDDVKLLSARRP  325



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   459 bits (1181),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 267/332 (80%), Gaps = 6/332 (2%)
 Frame = -3

Query  1264  MKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVK  1085
             M GT V D +AIP WEI G+VEYI +G KQGDMLL+VPEG  AVRLG +A+I+ +V    
Sbjct  1     MNGTVVRDHYAIPGWEIGGFVEYITAGHKQGDMLLVVPEGACAVRLGNEAYIRQSVAVAT  60

Query  1084  GTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEA  905
             G YY+++F+ ARTCAQEER+N++V P ++     + P+QT+YSS GWDSYSWAF A +  
Sbjct  61    GMYYAITFSAARTCAQEERINITVPPETD-----VFPVQTLYSSSGWDSYSWAFKATSAV  115

Query  904   VDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLI  725
               I +HNP  E+D ACGPLIDSVA+K+L PPR    N+LKNGNFEEGPYIF N +WGVL+
Sbjct  116   AHIFIHNPGVEEDAACGPLIDSVAIKALYPPRATNKNLLKNGNFEEGPYIFPNASWGVLV  175

Query  724   PPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKV  545
             PPN+ED++ PLPGW++ESLKAVKYIDS+HFSVPEG+RAVELVAG+ESA+AQV RT PGK+
Sbjct  176   PPNIEDENSPLPGWMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKL  235

Query  544   YDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFL  365
             Y L F+VGDA+NAC GSMVVEAFAG+ TL+VP++SKG G   RA  RFTA+S RTRV FL
Sbjct  236   YALTFAVGDASNACTGSMVVEAFAGRDTLKVPYESKGTGGFKRAVLRFTAVSERTRVVFL  295

Query  364   SSFYHMKSDNSGSLCGPVIDDVRLVSVRN-PR  272
             S+FY M+SD+  SLCGPVIDDV+L+SV   PR
Sbjct  296   STFYSMRSDDFSSLCGPVIDDVKLLSVHGAPR  327



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   486 bits (1252),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 233/362 (64%), Positives = 289/362 (80%), Gaps = 6/362 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
              L  LL +T   V  F  DG++ NG FE+GPK + +KGTRV++ +AIP+WE+SG++EYIK
Sbjct  8     FLFVLLISTVTSVFCFR-DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWELSGFIEYIK  66

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQKQGDMLL+VP G +AVRLG +A IK  V   KG YYSL+F+ ARTCAQ+ERLN+SV+
Sbjct  67    SGQKQGDMLLVVPAGKFAVRLGNEASIKQRVNVTKGMYYSLTFSAARTCAQDERLNISVA  126

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P+S     G++P+QT+YSS+GWD Y+WAF A+++  +IV+HNP  E+ PACGPLID VA+
Sbjct  127   PDS-----GVIPIQTLYSSNGWDLYAWAFQAQSDVAEIVIHNPGEEEHPACGPLIDGVAI  181

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYI  650
             K+L PPR    N+LKNG FEEGPYI  N T GVLIPP +EDDH PLP WIIESLKAVKY+
Sbjct  182   KALYPPRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKYV  241

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D +HFSVP+GRRAVELVAG+ESA+AQV RT  GK Y L F+VGDANNAC+GSM+VEAFAG
Sbjct  242   DVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAG  301

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             K TL+V ++SKGKG   RA  RF A+S+RTRV F S+FY M+SD+  SLCGPVIDDV+L+
Sbjct  302   KDTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLL  361

Query  289   SV  284
             SV
Sbjct  362   SV  363



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   456 bits (1172),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 220/347 (63%), Positives = 267/347 (77%), Gaps = 28/347 (8%)
 Frame = -3

Query  1312  GLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             GLVANGNFE GPK  ++KGT V    ++IP WEISG VEYIKSGQKQGDMLL+VPEG YA
Sbjct  7     GLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLLVVPEGAYA  66

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A IK  +K +KG YYS++F  ARTCAQEER+N+SV+P+                
Sbjct  67    VRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPD----------------  110

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
                         AE + V++V+HNP  E+DPACGPLIDSVAL++L PP+    N+LKNG 
Sbjct  111   -----------FAEYDVVEMVIHNPGVEEDPACGPLIDSVALRTLYPPKASNKNILKNGG  159

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPYIF NT++GV+IPPN+EDDH PLPGW++ESLKAVKY+DS HFSVP+G RAVELVA
Sbjct  160   FEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSAHFSVPQGTRAVELVA  219

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQV RT PGK Y L FSVGDA+N+CEGSM+VEAFAGK T++VP+ SKGKG   R
Sbjct  220   GKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVPYTSKGKGGFKR  279

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             A  +F A+ +RTRV FLS+FY M+SD+  SLCGPVIDDV+L+SVR P
Sbjct  280   AALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVRKP  326



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   456 bits (1174),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 220/369 (60%), Positives = 281/369 (76%), Gaps = 23/369 (6%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEYI  1193
              LL L C  FH+  SFT            G +R   +GT V   PH+IP WEISG++EYI
Sbjct  6     FLLVLFCC-FHVAFSFT-----------HGHER---QGTVVTGGPHSIPGWEISGFIEYI  50

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSGQKQ DMLL+VP G YAVRLG +A IK  +K VKG YYS++F  ARTCAQEE+LNVS 
Sbjct  51    KSGQKQDDMLLVVPNGAYAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSA  110

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     DW +LP+QT+Y  +GWD+Y+W+F A+  +VD+V HNP  E+DPACGP+IDS+A
Sbjct  111   AP-----DWVVLPMQTVYGGNGWDAYAWSFRADYPSVDMVFHNPGKEEDPACGPIIDSIA  165

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVED--DHCPLPGWIIESLKAV  659
             ++ L PPR    N+LKNG FEEGPY+F NT+ GVLIPPN+ D  +H PLPGW++ESLKAV
Sbjct  166   IQPLYPPRLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAV  225

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             +YIDSDHFSVP+G+RAVEL+ G+ESA+AQV RT PGK Y L+F+VGDA N+CEGS+ VEA
Sbjct  226   RYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSCEGSLSVEA  285

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             + GK +++VP++SKGKG   RA  +F A+S+RTR+ FLS+FY+M+SD+  SLCGPVIDDV
Sbjct  286   YVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLASLCGPVIDDV  345

Query  298   RLVSVRNPR  272
              L+S+R P 
Sbjct  346   TLISLRKPH  354



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   453 bits (1166),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 213/330 (65%), Positives = 267/330 (81%), Gaps = 5/330 (2%)
 Frame = -3

Query  1264  MKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVK  1085
             MKGT+V++  AIP WE+SG+VEYI SG KQGDM+L+VP+G +AVRLG +A IK  +   K
Sbjct  1     MKGTQVMNKTAIPKWELSGFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKINVKK  60

Query  1084  GTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEA  905
             G+YY+++F+ ARTCAQ+E+LNVSV+P       G++P+QT+YSS GWD YSWAF A  + 
Sbjct  61    GSYYAITFSAARTCAQDEQLNVSVAPRH-----GVMPIQTVYSSSGWDLYSWAFKAHNDY  115

Query  904   VDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLI  725
              +IV+HNP  E+DPACGPLID VA+++L PPR    N+LKNG FEEGP++  N++ GVLI
Sbjct  116   AEIVIHNPGVEEDPACGPLIDGVAIRALYPPRPTNKNILKNGGFEEGPWVLPNSSSGVLI  175

Query  724   PPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKV  545
             PPN  DDH PLPGW++ESLKAVKYIDSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK 
Sbjct  176   PPNSIDDHSPLPGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKT  235

Query  544   YDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFL  365
             Y L F+VGDA+NAC GSM+VEAFAGK T++VP++SKGKG   RA  RF A+S+RTRV F 
Sbjct  236   YVLSFAVGDASNACAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAVSARTRVMFY  295

Query  364   SSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             S+FY M+ D+  SLCGPVIDDV+L+S R P
Sbjct  296   STFYAMREDDFSSLCGPVIDDVKLLSARRP  325



>ref|XP_006301335.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
 gb|EOA34233.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
Length=378

 Score =   452 bits (1164),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 213/348 (61%), Positives = 268/348 (77%), Gaps = 5/348 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE GPK +Q+KG+ V +  A+P+W+I+G+VEYIKSGQKQ DM+L+VP+G  A
Sbjct  35    DGLLPNGNFEMGPKPSQLKGSVVKERSAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  94

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A +   +  + G  YS++F+ ARTCAQEERLN+SV+  S     G++P+QTMY 
Sbjct  95    VRLGNEASVSQKISVIPGRLYSITFSAARTCAQEERLNISVTHES-----GVIPIQTMYG  149

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             SDGWDSYSWAF A    ++I  HNP  E+ PACGPLID+VA+K+L PPR    N++KNGN
Sbjct  150   SDGWDSYSWAFKAGGPKIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRFSGNNLIKNGN  209

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPY+F    WGVLIPP +EDD+ PLPGWIIESLKAVKY+D  HF VPEG+RA+ELV 
Sbjct  210   FEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFYVPEGQRAIELVG  269

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA++Q+VRT    +Y L F+VGDA + CEG M+VEAFAG   + V + SKGKG   R
Sbjct  270   GKESAISQIVRTSVNNLYSLTFNVGDARDGCEGPMMVEAFAGGRKIMVDYASKGKGGFKR  329

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
              +  F A S+RTRV FLS+FYHMKSD+SGS+CGPVIDDVRLV+VR  R
Sbjct  330   GRLVFKAASARTRVTFLSTFYHMKSDHSGSMCGPVIDDVRLVAVRKLR  377



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   451 bits (1159),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 219/373 (59%), Positives = 281/373 (75%), Gaps = 10/373 (3%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
              G ++L LLC    L +  T DGL+ NGNFE+GP  +Q++GTRV+   +IP W+ SG+VE
Sbjct  7     AGPVILLLLCTMCRLALGIT-DGLLPNGNFERGPLPSQLRGTRVLGSSSIPSWQTSGFVE  65

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVK-AVKGTYYSLSFTFARTCAQEERLN  1022
             YI SGQKQGDMLL+VPEG YAVRLG +A I+  ++ A  G  YSL+F+ ARTCAQ ERLN
Sbjct  66    YIPSGQKQGDMLLVVPEGAYAVRLGNEASIRQRLRGAAPGARYSLTFSAARTCAQAERLN  125

Query  1021  VSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEA---VDIVLHNPAAEKDPACGP  851
             +S S  S     G+L +QT YSS+GWDSY+WA++A  ++   V++ +HNP    DPACGP
Sbjct  126   ISASGQS-----GLLAIQTTYSSNGWDSYAWAWVAAVDSSGEVEVSIHNPGVADDPACGP  180

Query  850   LIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES  671
             LIDSVA+K+LNPPRR   N++KNG+FEEGPYI   T WGVLIP  V DDH PLPGW++ES
Sbjct  181   LIDSVAVKALNPPRRTNRNLVKNGDFEEGPYILPGTKWGVLIPSRVVDDHSPLPGWMVES  240

Query  670   LKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSM  491
             LKAV+Y+D   F+VP GRRAVEL+AGRE A+AQVVRT PG+ Y L F+VGDA NAC GS+
Sbjct  241   LKAVRYVDGGSFAVPRGRRAVELLAGREGAVAQVVRTVPGRRYALSFTVGDAGNACRGSL  300

Query  490   VVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPV  311
             VVEA+AG+ +++V ++S+GKG + RA   F A ++RTR+ F SSFY  +SD+  SLCGPV
Sbjct  301   VVEAYAGRESVKVAYESEGKGGARRAVLPFRAAAARTRIVFFSSFYSTRSDDLSSLCGPV  360

Query  310   IDDVRLVSVRNPR  272
             +DDV +VSVR  R
Sbjct  361   LDDVAVVSVRAKR  373



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   450 bits (1157),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 218/367 (59%), Positives = 279/367 (76%), Gaps = 6/367 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISF-TPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +L+ALL  + ++V+S    DGL+ NGNFE GPK +Q+KG+ V +  A+P+W+I+G+VEYI
Sbjct  9     LLVALLFVSSNVVVSAPIRDGLLPNGNFELGPKPSQLKGSVVKERTAVPNWDITGFVEYI  68

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             KSGQKQ DM+L+VP+G  AVRLG +A I   +  + G  YS++F+ ARTCAQ+E+LN+SV
Sbjct  69    KSGQKQDDMVLVVPQGSSAVRLGNEASISQKISVLPGRLYSITFSAARTCAQDEKLNISV  128

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +  S     G++P+QTMY SDGWDSY+WAF A    + I  HNP  E+ PACGPLID+VA
Sbjct  129   THES-----GVIPIQTMYGSDGWDSYAWAFKAGGPEIHIRFHNPGVEEHPACGPLIDAVA  183

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             +K+L PPR    N++KNGNFEEGPY+F     GVLIPP +EDD+ PLPGW+IESLKAVKY
Sbjct  184   IKALFPPRFSGYNLIKNGNFEEGPYVFPTAKSGVLIPPFIEDDNSPLPGWMIESLKAVKY  243

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +D  HF+VPEG RA+ELV G+ESA++Q+VRT   K Y L FSVGDA + CEG M VEAFA
Sbjct  244   VDKAHFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFSVGDARDGCEGPMTVEAFA  303

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G+  + V + SKGKG   R +  F A+S+RTRV FLS+FYHMKSD+SGSLCGPVIDDVRL
Sbjct  304   GQGKVMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRL  363

Query  292   VSVRNPR  272
             V+VR  R
Sbjct  364   VAVRKLR  370



>ref|XP_010417734.1| PREDICTED: uncharacterized protein LOC104703420 [Camelina sativa]
Length=369

 Score =   449 bits (1156),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 213/348 (61%), Positives = 266/348 (76%), Gaps = 5/348 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE GPK +Q+KG+ + +  A+P+W+I+G+VEYIKSGQKQ DM+L+VP+G  A
Sbjct  26    DGLLPNGNFELGPKLSQLKGSMIKERTAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I   +  + G  YS++F+ ARTCAQ+ERLN+SV+  S     G++P+QTMY 
Sbjct  86    VRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQTMYG  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             SDGWDSYSWAF A    ++I  HNP  E+ PACGPLID+VA+K+L PPR    N++KNGN
Sbjct  141   SDGWDSYSWAFKAGGPKIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRFSSNNLIKNGN  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPY+F    WGVLIPP +EDD+ PLPGWIIESLKAVKY+D  HF+VPEG RA+ELVA
Sbjct  201   FEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFAVPEGHRAIELVA  260

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA++Q+VRT   K Y L F+VGDA + CEG M VEA AG+    V + SKGKG   R
Sbjct  261   GKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMTVEALAGRGKAMVDYASKGKGGFKR  320

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
              +  F A S+RTRV FLS+FYHMKSD+SGSLCGPVIDDVRLV+V   R
Sbjct  321   GRLVFKAASARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAVGKLR  368


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 81/182 (45%), Gaps = 22/182 (12%)
 Frame = -3

Query  802  RGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW----IIESLKAVKYIDSDHF  635
            R  +L NGNFE GP +  +   G +I      +   +P W     +E +K+ +  D    
Sbjct  25   RDGLLPNGNFELGPKL--SQLKGSMI-----KERTAVPNWDITGFVEYIKSGQKQDDMVL  77

Query  634  SVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEG-SMVVEAFAGKLTL  458
             VP+G  AV L  G E++++Q +   PG++Y + FS        E  ++ V   +G + +
Sbjct  78   VVPQGSSAVRL--GNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHESGVIPI  135

Query  457  QVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
            Q  + S G      A   F A   +  +RF     H         CGP+ID V + ++  
Sbjct  136  QTMYGSDGWDSYSWA---FKAGGPKIEIRF-----HNPGVEEHPACGPLIDAVAIKALFP  187

Query  277  PR  272
            PR
Sbjct  188  PR  189



>ref|XP_009104452.1| PREDICTED: uncharacterized protein LOC103830427 [Brassica rapa]
Length=404

 Score =   449 bits (1155),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 215/361 (60%), Positives = 274/361 (76%), Gaps = 6/361 (2%)
 Frame = -3

Query  1351  CATFHLVISF-TPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQ  1175
             C + ++ +S    DGL+ NGNFE GPK +Q+KG+ V + +A+ HW+++G+VEYIK+GQKQ
Sbjct  13    CVSSNVAVSAPIRDGLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQ  72

Query  1174  GDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEP  995
              DM+L+VPEG  AVRLG +A I   +    G  YS++F+ ARTCAQ+ERLN+SV+  S  
Sbjct  73    DDMVLVVPEGSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES--  130

Query  994   NDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNP  815
                G++P+QTMY SDGWDSYSWAF A    + I +HNP  E+ PACGPLID+VA+K+L P
Sbjct  131   ---GVIPIQTMYGSDGWDSYSWAFKAGGPEIVIRIHNPGREEQPACGPLIDAVAIKALFP  187

Query  814   PRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHF  635
             PR    N++KNGNFEEGPY+FS   WGVLIPP +EDD+ PLPGWIIESLKAVKY+D  HF
Sbjct  188   PRFSGYNLIKNGNFEEGPYVFSTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHF  247

Query  634   SVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQ  455
              VPEG RA+ELV G+ESA++Q+VRT P K Y L F+VGDA + CEG M VEAFAG+    
Sbjct  248   FVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDGCEGPMAVEAFAGRGKTL  307

Query  454   VPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
             V + SKGKG   R +  F A+S+RTRV FLS+FYHMK+D+SGSLCGPV+DDVRLV+V+  
Sbjct  308   VEYVSKGKGGFKRGRLVFKAVSARTRVTFLSTFYHMKNDHSGSLCGPVVDDVRLVAVKTL  367

Query  274   R  272
             R
Sbjct  368   R  368



>ref|XP_007150706.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
 gb|ESW22700.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
Length=294

 Score =   444 bits (1142),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 204/292 (70%), Positives = 250/292 (86%), Gaps = 0/292 (0%)
 Frame = -3

Query  1147  GIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQ  968
             G YAVRLG++A IK  VK  +G +Y+++F  ARTCAQEE+LNVSV P +E  DWG++P+Q
Sbjct  1     GDYAVRLGDEASIKQKVKLNEGFFYAITFGAARTCAQEEKLNVSVVPTTEKRDWGIIPIQ  60

Query  967   TMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNML  788
             TMY S+GW+S++  F A+    +IV+HNP  E+DPACGPLIDSVALK L+PP+R R N+L
Sbjct  61    TMYGSNGWESFTCGFRADFPEAEIVIHNPGKEEDPACGPLIDSVALKVLDPPKRTRANLL  120

Query  787   KNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAV  608
             KNGNFEEGPY+F N++WG LIPP++ED H PLPGWI+ESLKAVKYIDSDHF+VPEG+RA+
Sbjct  121   KNGNFEEGPYLFPNSSWGALIPPHIEDAHSPLPGWIVESLKAVKYIDSDHFAVPEGKRAI  180

Query  607   ELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKG  428
             ELVAG+ESALAQVV T  G+VYDL F+VGDANNACEGSM+VEAFAG  T+Q+P+QSKGKG
Sbjct  181   ELVAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETVQIPYQSKGKG  240

Query  427   VSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
              SVR K RF A+++RTR+RFLS+FY MKSDNSGSLCGPVIDDV+L+SVR PR
Sbjct  241   GSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLSVRYPR  292



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   447 bits (1149),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 213/348 (61%), Positives = 267/348 (77%), Gaps = 5/348 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE GPK +QMKG+ V +  A+P+W I G+VE+IKSGQKQ DM+L+VP+G  A
Sbjct  27    DGLLPNGNFELGPKPSQMKGSVVKERTAVPNWNIIGFVEFIKSGQKQDDMVLVVPQGSSA  86

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I   +  + G  YS++F+ ARTCAQ+ERLN+SV+  S     G++P+QTMY 
Sbjct  87    VRLGNEASISQKISVLPGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQTMYG  141

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             SDGWDSYSWAF A    ++I  HNP  E+ PACGPLID+VA+K+L PPR    N++KNGN
Sbjct  142   SDGWDSYSWAFKAGGPEIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRFSGYNLIKNGN  201

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPY+F    WGVLIPP +EDD+ PLPGW+IESLKAVKY+D  HF+VPEG RA+ELV 
Sbjct  202   FEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWMIESLKAVKYVDKAHFAVPEGHRAIELVG  261

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA++Q+VRT   K Y L F+VGDA + CEG M+VEAFAG+  + V + SKGKG   R
Sbjct  262   GKESAISQIVRTSLNKFYALTFNVGDARDGCEGPMIVEAFAGQGKVMVDYASKGKGGFRR  321

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
              +  F A+S+RTRV FLS+FYHMKSD+SGSLCGPVIDDVRLV+V   R
Sbjct  322   GRLVFKAVSARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAVGKLR  369



>ref|XP_010472958.1| PREDICTED: uncharacterized protein LOC104752499 [Camelina sativa]
Length=369

 Score =   446 bits (1148),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 212/348 (61%), Positives = 265/348 (76%), Gaps = 5/348 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE GP+ +Q+KG+ V +  A+P+W+I+G+VEYIKSGQKQ DM+L+VP+G  A
Sbjct  26    DGLLPNGNFELGPRPSQLKGSLVKERTAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I   +  + G  YS++F+ ARTCAQ+ERLN+SV+  S     G++P+QTMY 
Sbjct  86    VRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQTMYG  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             SDGWDSYSWAF A    ++I  HNP  E+ PACGPLID+VA+K+L PPR    N++KNGN
Sbjct  141   SDGWDSYSWAFKAGGPKIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRFSGNNLIKNGN  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPY+F    WGVLIPP +EDD+ PLPGWIIESLKAVKY+D  HF+VPEG RA+ELV 
Sbjct  201   FEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFAVPEGHRAIELVG  260

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA++Q+VRT   K Y L F+VGDA + CEG M+VEA AG+    V + SKGKG   R
Sbjct  261   GKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMIVEALAGRGKTMVDYASKGKGGFKR  320

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
              +  F A S+RTRV FLS+FYHMKSD+SGSLCGPVIDDVRLV V   R
Sbjct  321   GRLVFKAASARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVVVGKLR  368



>ref|XP_004969140.1| PREDICTED: uncharacterized protein LOC101755969 [Setaria italica]
Length=372

 Score =   446 bits (1147),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 211/347 (61%), Positives = 266/347 (77%), Gaps = 8/347 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQM-KGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             DGL+ NGNFE+GP ++ +  GT V   +AIP WE SG+VEYI+SG KQGDMLL+VP+G +
Sbjct  23    DGLLPNGNFEEGPPKSALVNGTVVRGANAIPLWETSGFVEYIESGHKQGDMLLVVPQGAH  82

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG +A I+  +   +G YY+++F+ ARTCAQ ERLNVSVSP     +WG+LP+QT+Y
Sbjct  83    AVRLGNEASIRQRLAVTRGAYYAITFSAARTCAQAERLNVSVSP-----EWGVLPMQTIY  137

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
              S+GWDSY+WAF A+ + V +V+HNP  E+DPACGPLID VA+++L PP   RGNMLKNG
Sbjct  138   GSNGWDSYAWAFKAKFDTVTLVIHNPGVEEDPACGPLIDGVAIRALYPPTLVRGNMLKNG  197

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
              FEEGPY   N +WGVL+PPN+EDDH PLP W+I S KAVKY+D+ HF VP+G RAVELV
Sbjct  198   GFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAAHFKVPQGARAVELV  257

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
              GRESAL Q VRT PG  Y L F+VGDA + C GSMV EAFA + T++VP++SKG G   
Sbjct  258   GGRESALVQEVRTVPGWSYRLSFAVGDAGDGCTGSMVAEAFAARATVKVPYESKGTGGYK  317

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
             RA   FTAI++RTRV F S+FYHMK+D  G+LCGP++DD  LV +R 
Sbjct  318   RAVLDFTAIANRTRVVFQSTFYHMKAD--GTLCGPLVDDASLVGLRK  362



>emb|CDY57694.1| BnaA07g38340D [Brassica napus]
Length=370

 Score =   445 bits (1145),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 212/346 (61%), Positives = 267/346 (77%), Gaps = 5/346 (1%)
 Frame = -3

Query  1309  LVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVR  1130
             L+ NGNFE GPK +Q+KG+ V + +A+ HW+++G+VEYIK+GQKQ DM+L+VPEG  AVR
Sbjct  29    LLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLVVPEGSSAVR  88

Query  1129  LGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSD  950
             LG +A I   +    G  YS++F+ ARTCAQ+ERLN+SV+  S     G++P+QTMY SD
Sbjct  89    LGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQTMYGSD  143

Query  949   GWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFE  770
             GWDSYSWAF A    + I +HNP  E+ PACGPLID+VA+K+L PPR    N++KNGNFE
Sbjct  144   GWDSYSWAFKAGGPEIVIRIHNPGREEHPACGPLIDAVAIKALFPPRFSGYNLIKNGNFE  203

Query  769   EGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGR  590
             EGPY+FS   WGVLIPP +EDD+ PLPGWIIESLKAVKY+D  HF VPEG RA+ELV G+
Sbjct  204   EGPYVFSTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFFVPEGHRAIELVGGK  263

Query  589   ESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAK  410
             ESA++Q+VRT P K Y L F+VGDA +ACEG M VEAFAG+    V + SKGKG   R +
Sbjct  264   ESAVSQIVRTSPNKFYALTFNVGDARDACEGPMAVEAFAGRGKTLVEYVSKGKGGFKRGR  323

Query  409   HRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
               F A+S+RTRV FLS+FYHMK+D+SGSLCGPV+DDVRLV+V+  R
Sbjct  324   LVFKAVSARTRVTFLSTFYHMKNDHSGSLCGPVVDDVRLVAVKTLR  369



>gb|EMT06486.1| hypothetical protein F775_26416 [Aegilops tauschii]
Length=370

 Score =   444 bits (1143),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 210/347 (61%), Positives = 264/347 (76%), Gaps = 8/347 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQM-KGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             DGL+ NGNFE GP ++++  GT V    AIP WE SG+VEYI+SG KQGDMLL+VP+G Y
Sbjct  22    DGLLPNGNFESGPAKSELVNGTVVKGGKAIPKWETSGFVEYIESGHKQGDMLLVVPQGAY  81

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG DA I   +   +G+YY+++F+ ARTCAQ ERLNVSVSP S     G+LP+QT+Y
Sbjct  82    AVRLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSPES-----GVLPMQTIY  136

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
              S+GWDSY+WAF A+ + V++V+HNP  E+DPACGPLID+VA+++L PP   +GNMLKNG
Sbjct  137   GSNGWDSYAWAFKAKLDVVELVIHNPGVEEDPACGPLIDAVAIRTLYPPTLSKGNMLKNG  196

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
              FEEGPY   N +WGVL+PPN+EDDH PLP W+I S KAVKY+D+ HF VPEG RAVELV
Sbjct  197   GFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFKVPEGARAVELV  256

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
              G+ESAL Q VRT PG  Y L F+VGD+ + C+GSMV EA+A + TL+VP++S G G   
Sbjct  257   GGKESALVQEVRTVPGWAYRLSFAVGDSADGCKGSMVAEAYAARSTLKVPYESNGAGGYK  316

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
             RA   F A+  RTRV F S+FYHMK+D  G+LCGPVIDD +LV +R 
Sbjct  317   RAVLDFVAVRDRTRVVFQSAFYHMKAD--GTLCGPVIDDAKLVGLRK  361



>dbj|BAK03627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   444 bits (1142),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 212/347 (61%), Positives = 265/347 (76%), Gaps = 8/347 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQM-KGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             DGL+ NGNFE  P ++++  GT V    AIP WE SG+VEYI+SG KQGDMLL+VP+G Y
Sbjct  23    DGLLPNGNFELDPAKSELVNGTVVKGGKAIPKWETSGFVEYIESGHKQGDMLLVVPQGAY  82

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG DA I   +   +G+YY+++F+ ARTCAQ ERLNVSVSP S     G+LP+QT+Y
Sbjct  83    AVRLGNDASILQRIPVARGSYYAVTFSAARTCAQAERLNVSVSPES-----GVLPMQTIY  137

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
              S+GWDSY+WAF A+ + V++V+HNP  E+DPACGPLID+VA+++L PP   +GNMLKNG
Sbjct  138   GSNGWDSYAWAFKAKLDVVELVIHNPGVEEDPACGPLIDAVAIRTLYPPTLSKGNMLKNG  197

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
              FEEGPY   N +WGVLIPPN+EDDH PLP W+I S KAVKY+D+ HFSVPEG RAVELV
Sbjct  198   GFEEGPYFLPNASWGVLIPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFSVPEGARAVELV  257

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
              G+ESAL Q VRT PG  Y L F+VGD+ + C+GSMV EA+A + TL+VP++SKG G   
Sbjct  258   GGKESALVQEVRTVPGWAYRLSFAVGDSGHDCKGSMVAEAYAARSTLKVPYESKGAGGYK  317

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
             RA   F A+  RTRV F S+FYHMK+D  G+LCGPVIDD +LV +R 
Sbjct  318   RAVLDFVAVRDRTRVVFQSAFYHMKAD--GTLCGPVIDDAKLVGLRK  362



>ref|XP_002455939.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
 gb|EES01059.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
Length=375

 Score =   444 bits (1143),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 265/347 (76%), Gaps = 8/347 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQM-KGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             DGL+ NGNFE GP ++ +  GT V   +AIP WE SG+VEYI+SG KQGDMLL+VP+G +
Sbjct  23    DGLLPNGNFEDGPPKSALVNGTVVSGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGAH  82

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG +A I+  +   +G YY+++F+ ARTCAQ E LNVSVSP     +WG+LP+QT+Y
Sbjct  83    AVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAEALNVSVSP-----EWGVLPMQTIY  137

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
              S+GWDSY+WAF A+   V +V+HNP  E+DPACGPLID VA+++L PP   RGNMLKNG
Sbjct  138   GSNGWDSYAWAFKAKLSTVTLVIHNPGVEEDPACGPLIDGVAIRALYPPTLARGNMLKNG  197

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
              FEEGPY   N +WGVL+PPN+EDDH PLPGW+I S KAVKY+D+ HF+VP+G RAVELV
Sbjct  198   GFEEGPYFLPNASWGVLVPPNIEDDHSPLPGWMIASSKAVKYVDAAHFAVPQGARAVELV  257

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
              GRESAL Q VRT PG  Y L F+VGD+ + C GSMV EA+A + T++VP++SKG G   
Sbjct  258   GGRESALVQEVRTVPGWSYRLAFAVGDSGDGCTGSMVAEAYAARATVKVPYESKGTGGYK  317

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
             RA   FTA+++RTRV F S+FYHMK+D  G+LCGP++DD  +V +R 
Sbjct  318   RAVLDFTAVANRTRVVFQSTFYHMKAD--GTLCGPLVDDASVVGLRK  362



>ref|XP_010429991.1| PREDICTED: uncharacterized protein LOC104714356 [Camelina sativa]
Length=369

 Score =   443 bits (1140),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 211/348 (61%), Positives = 264/348 (76%), Gaps = 5/348 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE GP+ +Q+KG+ V +  A+P W+I+G+VEYIKSGQKQ DM+L+VP+G  A
Sbjct  26    DGLLPNGNFELGPRPSQLKGSLVKERTAVPDWDITGFVEYIKSGQKQDDMVLVVPQGSSA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I   +  + G  YS++F+ ARTCAQ+ERLN+SV+  S     G++P+QTMY 
Sbjct  86    VRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQTMYG  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             SDGWDSYSWAF A    ++I  HNP  E+ PACGPLID+VA+K+L PPR    N++KNGN
Sbjct  141   SDGWDSYSWAFKAGGPKIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRFSGNNLIKNGN  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPY+F    WGVLIPP +EDD+ PLPGWIIESLKAVKY+D  HF+VPEG RA+ELV 
Sbjct  201   FEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFAVPEGHRAIELVG  260

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA++Q+VRT   K Y L F+VGDA + CEG M+VEA AG+    V + SKGKG   R
Sbjct  261   GKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMIVEALAGRGKTMVDYASKGKGGFKR  320

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
              +  F A S+RTRV FLS+FYHMKSD+SGSLCGPVID VRLV+V   R
Sbjct  321   GRLVFKAASARTRVTFLSTFYHMKSDHSGSLCGPVIDGVRLVAVGKLR  368



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 222/370 (60%), Positives = 281/370 (76%), Gaps = 8/370 (2%)
 Frame = -3

Query  1372  IILLALLCATFH-LVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             ++L+ +LCAT     ++   DGL+ANGNFE+GP  +Q++GTRVV   AIP W  SG+VEY
Sbjct  9     LLLMVVLCATSSGTALAAITDGLLANGNFERGPAPSQLRGTRVVGASAIPSWRTSGFVEY  68

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYS-LSFTFARTCAQEERLNV  1019
             I SG+KQGDM+L+VPEG +AVRLG +A I+  +          L+F+ ARTCAQ ERLNV
Sbjct  69    IPSGRKQGDMVLVVPEGSHAVRLGNEASIRQRLAGAARGARYALTFSAARTCAQAERLNV  128

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             S S       W +LP+QTMYSS+GWDSY+WA+ A A+A D+V+HNP   +DPACGPLIDS
Sbjct  129   SAS-----GQWAVLPMQTMYSSNGWDSYAWAWDAAADAFDVVIHNPGVTEDPACGPLIDS  183

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+++LNPPRR   N++KNG+FEEGPYI   T WGVLIP  V D+H PLPGW++ESLKAV
Sbjct  184   VAIRTLNPPRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAV  243

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYIDSDHF+VP GRRAVEL+AGRESA+AQV+RT PG+ Y L F+VGDA+N CEGS+VVEA
Sbjct  244   KYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEA  303

Query  478   FAGKLTLQVPFQSKGK-GVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDD  302
             +AG+ + +V  +S G+ G + RA   F A ++RTRV F SSFY  +SD+  SLCGPVIDD
Sbjct  304   YAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDD  363

Query  301   VRLVSVRNPR  272
             V +VSVR  R
Sbjct  364   VAVVSVRARR  373



>emb|CDY54317.1| BnaC06g43150D [Brassica napus]
Length=370

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 209/343 (61%), Positives = 265/343 (77%), Gaps = 5/343 (1%)
 Frame = -3

Query  1309  LVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVR  1130
             L+ NGNFE GPK +Q+KG+ V + +A+ HW+++G+VEYIK+GQKQ DM+L+VPEG  AVR
Sbjct  29    LLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLVVPEGSSAVR  88

Query  1129  LGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSD  950
             LG +A I   +    G  YS++F+ ARTCAQ+ERLN+SV+  S     G++P+QTMY SD
Sbjct  89    LGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQTMYGSD  143

Query  949   GWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFE  770
             GWDSYSWAF A    + I +HNP  E+ PACGPLID+VA+K+L PPR    N++KNGNFE
Sbjct  144   GWDSYSWAFKAGGPQIVIRIHNPGHEEHPACGPLIDAVAIKALFPPRFSGYNLIKNGNFE  203

Query  769   EGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGR  590
             EGPY+F    WGVLIPP +EDD+ PLPGWIIESLKAVKY+D  HF VPEG RA+ELV G+
Sbjct  204   EGPYVFPTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFFVPEGHRAIELVGGK  263

Query  589   ESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAK  410
             ESA++Q+VRT P K Y L F+VGDA +ACEG M VEAFAG+    V + SKGKG   + +
Sbjct  264   ESAVSQIVRTSPNKFYALTFNVGDARDACEGPMAVEAFAGRGNTLVDYMSKGKGGFKQGR  323

Query  409   HRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
               F A+S+RTRV FLS+FYHMK+D+SGSLCGPV+DDVRLV+V+
Sbjct  324   LVFKAVSARTRVTFLSTFYHMKNDHSGSLCGPVVDDVRLVAVK  366


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 81/180 (45%), Gaps = 14/180 (8%)
 Frame = -3

Query  805  RRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVP  626
            R G++L NGNFE GP    +   G ++       H  + G++ E +KA +  D     VP
Sbjct  25   RDGSLLPNGNFEIGPK--PSQLKGSVVKERNAVAHWDMTGFV-EYIKAGQKQDDMVLVVP  81

Query  625  EGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEG-SMVVEAFAGKLTLQVP  449
            EG  AV L  G E++++Q +  R G++Y + FS        E  ++ V   +G + +Q  
Sbjct  82   EGSSAVRL--GNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTM  139

Query  448  FQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPRI  269
            + S G      A   F A   +  +R      H         CGP+ID V + ++  PR 
Sbjct  140  YGSDGWDSYSWA---FKAGGPQIVIRI-----HNPGHEEHPACGPLIDAVAIKALFPPRF  191



>dbj|BAB21293.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB93263.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ12659.1| hypothetical protein OsJ_02574 [Oryza sativa Japonica Group]
 dbj|BAG93001.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87537.1| unnamed protein product [Oryza sativa Japonica Group]
Length=373

 Score =   439 bits (1130),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 264/347 (76%), Gaps = 8/347 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGP-KRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             DGL+ NGNFE+GP K + + GT V   +AIP WE SG+VEYI+SG KQGDMLL+VP+G +
Sbjct  25    DGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGAH  84

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG +A I+  +   +G YY+++F+ ARTCAQ E+LNVSVSP     +WG+LP+QT+Y
Sbjct  85    AVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSP-----EWGVLPMQTIY  139

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
              S+GWDSY+WAF A+ + V +V+HNP  E+DPACGPLID VA+++L PP   +GNMLKNG
Sbjct  140   GSNGWDSYAWAFKAKMDEVALVIHNPGVEEDPACGPLIDGVAIRALYPPTLAKGNMLKNG  199

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
              FEEGPY   N +WGVL+PPN+EDDH PLP W+I S KAVKY+D+ HF+VP+G RAVELV
Sbjct  200   GFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFAVPQGARAVELV  259

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
              G+ESAL Q VRT PG  Y L F+VGDA + C GSMV EA+A + +++VP++SKG G   
Sbjct  260   GGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIKVPYESKGTGGYK  319

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
             RA   F AI++RTRV F S+FYH  +D  GSLCGPVIDD  LV +R 
Sbjct  320   RAVLEFAAIANRTRVVFQSTFYHTMTD--GSLCGPVIDDASLVGLRK  364



>ref|XP_003569339.1| PREDICTED: uncharacterized protein LOC100821501 [Brachypodium 
distachyon]
Length=370

 Score =   439 bits (1130),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 210/365 (58%), Positives = 271/365 (74%), Gaps = 9/365 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGP-KRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +LL L+C T     +   DGL+ NGNFE GP K + + GT V   +AIP+WE SG+VEYI
Sbjct  5     VLLLLVC-TAARAAAVVTDGLLPNGNFEAGPPKTDLVNGTVVKGGNAIPNWETSGFVEYI  63

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             +SG KQGDMLL+VP+G +AVRLG +A I+  +   +G+YY+++F+ ARTCAQ ER+N+SV
Sbjct  64    ESGHKQGDMLLVVPQGAHAVRLGNEASIRQKLAVARGSYYAITFSAARTCAQAERINISV  123

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             SP S     G+LP+QT+Y S+GWDSY+WAF A+ + V +VLHN   E+DPACGPL+D+VA
Sbjct  124   SPES-----GVLPMQTIYGSNGWDSYAWAFKAKLDVVQLVLHNVGIEEDPACGPLVDAVA  178

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             +++L PP   +GNMLKNG FEEGPY   N +WGVL+PPN+EDDH PLP W+I S KAVKY
Sbjct  179   IRTLYPPTLSKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKY  238

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +DS HF VPEG RAVELV G+ESAL Q VRT PG  Y L F+VGDA + C GSMV EA+A
Sbjct  239   VDSAHFRVPEGTRAVELVGGKESALVQEVRTVPGWTYRLTFAVGDAADGCTGSMVAEAYA  298

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
              +  ++VP+ SKG G   RA   F A+ +RTR+ F S+FYHMK+D  G+LCGPVIDD +L
Sbjct  299   ARAIVKVPYDSKGAGGFKRAVLDFAAVGNRTRIVFQSTFYHMKAD--GTLCGPVIDDAKL  356

Query  292   VSVRN  278
             V ++ 
Sbjct  357   VGLKK  361



>ref|NP_001043549.2| Os01g0611000 [Oryza sativa Japonica Group]
 dbj|BAF05463.2| Os01g0611000, partial [Oryza sativa Japonica Group]
Length=399

 Score =   440 bits (1132),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 264/347 (76%), Gaps = 8/347 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGP-KRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             DGL+ NGNFE+GP K + + GT V   +AIP WE SG+VEYI+SG KQGDMLL+VP+G +
Sbjct  51    DGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGAH  110

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG +A I+  +   +G YY+++F+ ARTCAQ E+LNVSVSP     +WG+LP+QT+Y
Sbjct  111   AVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSP-----EWGVLPMQTIY  165

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
              S+GWDSY+WAF A+ + V +V+HNP  E+DPACGPLID VA+++L PP   +GNMLKNG
Sbjct  166   GSNGWDSYAWAFKAKMDEVALVIHNPGVEEDPACGPLIDGVAIRALYPPTLAKGNMLKNG  225

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
              FEEGPY   N +WGVL+PPN+EDDH PLP W+I S KAVKY+D+ HF+VP+G RAVELV
Sbjct  226   GFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFAVPQGARAVELV  285

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
              G+ESAL Q VRT PG  Y L F+VGDA + C GSMV EA+A + +++VP++SKG G   
Sbjct  286   GGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIKVPYESKGTGGYK  345

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
             RA   F AI++RTRV F S+FYH  +D  GSLCGPVIDD  LV +R 
Sbjct  346   RAVLEFAAIANRTRVVFQSTFYHTMTD--GSLCGPVIDDASLVGLRK  390



>ref|NP_001140426.1| hypothetical protein precursor [Zea mays]
 gb|ACF83808.1| unknown [Zea mays]
 gb|ACR34644.1| unknown [Zea mays]
 gb|AFW70605.1| hypothetical protein ZEAMMB73_168025 [Zea mays]
Length=371

 Score =   437 bits (1124),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 263/335 (79%), Gaps = 6/335 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+ P  +Q++GTRVV   AIP W+ SG+VEYI SGQKQGDM+L+VPEG YA
Sbjct  27    DGLLPNGNFERSPLPSQLRGTRVVGASAIPSWQTSGFVEYISSGQKQGDMVLVVPEGAYA  86

Query  1135  VRLGEDAWIKTTVK-AVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             VRLG +A I+  ++ A +G  YSL+F+ ARTCAQ E+LNVS S  S     G+L +QTMY
Sbjct  87    VRLGNEASIRQRLRGAARGARYSLTFSAARTCAQAEQLNVSASGQS-----GLLAMQTMY  141

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
             SS+GWDSY+WA++A A+ VDIV+HNP   +DPACGPLIDSVA+K+LNPPRR   N++KNG
Sbjct  142   SSNGWDSYAWAWVANADEVDIVIHNPGVTEDPACGPLIDSVAIKTLNPPRRTNKNLVKNG  201

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
             +FEEGPYI   T WGVLIP  V +DH PLPGW++ESLKA+KYID + F+VP GRRAVEL+
Sbjct  202   DFEEGPYIIPGTKWGVLIPSRVVEDHSPLPGWMVESLKAIKYIDGESFAVPRGRRAVELL  261

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             AGRESA+AQV+RT PG+ Y L F++GDA+NAC GS++VEA+AG+ + +V ++S GKG   
Sbjct  262   AGRESAIAQVIRTVPGRQYVLSFTIGDASNACRGSLMVEAYAGRESTKVAYESAGKGGVK  321

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGP  314
             RA   F A S+RTR+ F SSFY  +SD+  SLCGP
Sbjct  322   RAVLPFRAASARTRLVFFSSFYSTRSDDLSSLCGP  356



>ref|XP_010445004.1| PREDICTED: uncharacterized protein LOC104727612, partial [Camelina 
sativa]
Length=325

 Score =   434 bits (1117),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 263/327 (80%), Gaps = 6/327 (2%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
             T +I+L L+ + F++   F  DGL+ NG+FE GP+ + MKGT+V++  AIP+WE+SG+VE
Sbjct  4     TRVIVLLLIHSFFYVAFCFK-DGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVE  62

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YI SGQKQGDM+L+VP+G +AVRLG +A IK  +   KG+YYS++F+ ARTCAQ+ERLNV
Sbjct  63    YIPSGQKQGDMILVVPKGAFAVRLGNEASIKQKIIVKKGSYYSITFSAARTCAQDERLNV  122

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+P+       ++P+QT+YSS GWD YSWAF A+++  DIV+HNP  E+DPACGPLID 
Sbjct  123   SVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPACGPLIDG  177

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+++L PPR    N+LKNG FEEGP++  NTT GVLIPPN  DDH PLPGW++ESLKAV
Sbjct  178   VAMRALFPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAV  237

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KY+DSDHFSVP+GRRAVELVAG+ESA+AQVVRT PGK Y L F+VGDA+NAC GSM+VEA
Sbjct  238   KYLDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEA  297

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFT  398
             FAGK T++VP++SKGKG   RA  RF 
Sbjct  298   FAGKDTIKVPYESKGKGGFKRASLRFV  324



>gb|EEC72709.1| hypothetical protein OsI_06304 [Oryza sativa Indica Group]
Length=379

 Score =   436 bits (1122),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/370 (60%), Positives = 278/370 (75%), Gaps = 8/370 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFT-PDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             ++L+ +LCA           DGL+ANGNFE+GP  +Q++GTRVV   AIP W  SG+VEY
Sbjct  9     LLLMVVLCAAASGTALAAITDGLLANGNFERGPAPSQLRGTRVVGASAIPSWRTSGFVEY  68

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYS-LSFTFARTCAQEERLNV  1019
             I SG+KQGDM+L+VPEG +AVRLG +A I+  +          L+F+ ARTCAQ ERLNV
Sbjct  69    IPSGRKQGDMVLVVPEGSHAVRLGNEASIRQRLAGAARGARYALTFSAARTCAQAERLNV  128

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             S S       W +LP+QTMYSS+GWDSY+WA+ A A+A D+V+HNP   +DPACGPLIDS
Sbjct  129   SAS-----GQWAVLPMQTMYSSNGWDSYAWAWDAAADAFDVVIHNPGVTEDPACGPLIDS  183

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+++LNPPRR   N++KNG+FEEGPYI   T WGVLIP  V D+H PLPGW++ESLKAV
Sbjct  184   VAIRTLNPPRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAV  243

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYIDSDHF+VP GRRAVEL+AGRESA+AQV+RT PG+ Y L F+VGDA+N CEGS+VVEA
Sbjct  244   KYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEA  303

Query  478   FAGKLTLQVPFQSKGK-GVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDD  302
             +AG+ + +V  +S G+ G + RA   F A ++RTRV F SSFY  +SD+  SLCGPVIDD
Sbjct  304   YAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDD  363

Query  301   VRLVSVRNPR  272
             V +VSVR  R
Sbjct  364   VAVVSVRARR  373



>gb|KHG21629.1| GTPase Der [Gossypium arboreum]
Length=302

 Score =   432 bits (1111),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 203/297 (68%), Positives = 249/297 (84%), Gaps = 1/297 (0%)
 Frame = -3

Query  1168  MLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPND  989
             MLL+VPEG +AVRLG +A IK  V+ VKG +YSL+F+ ARTCAQEERLNVSVSPN+E ND
Sbjct  1     MLLIVPEGAFAVRLGNEALIKQKVEVVKGDFYSLTFSTARTCAQEERLNVSVSPNNEKND  60

Query  988   WGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR  809
             +G+ P+QTMYSS+GWDSY+WAF A+A  ++I +HNP  E+D ACGPLIDSVALK+L  P+
Sbjct  61    FGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPGVEEDAACGPLIDSVALKTLYNPK  120

Query  808   RRRGNMLKNGNFEEGPYIFSN-TTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFS  632
             R R N+LKNGNFEEGPYIF   T+ GV+IPP++EDDH PLPGWIIESLKA+KYIDS+HFS
Sbjct  121   RTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEHFS  180

Query  631   VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQV  452
             VP+G+RA+EL+AG+ESA+AQ+V+T  G+ Y L F VGDANN CEG MVVEAFAGK T++V
Sbjct  181   VPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTVKV  240

Query  451   PFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
              + SKGKG    A+  F A S+RTR+ F S+FY MKSDNSGSLCGPV+DDV+L+SVR
Sbjct  241   SYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSVR  297



>ref|XP_006389772.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
 gb|ESQ27058.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
Length=372

 Score =   434 bits (1116),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 267/348 (77%), Gaps = 5/348 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+GPK +Q+KG+ V +  A+P+W+++G VEYIK+GQKQ DM+L+VPEG  A
Sbjct  29    DGLLPNGNFEKGPKPSQLKGSVVKERSAVPNWDMTGLVEYIKAGQKQDDMVLVVPEGSSA  88

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I   +    G  YS++F+ ARTCAQ+ERLN+SV+  S     G++P+QT+Y 
Sbjct  89    VRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQTLYG  143

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             SDGWDSYSWAF A    ++I +HNP  E+ PACGPLID+VA+K+L PPR  R N++KNG 
Sbjct  144   SDGWDSYSWAFKAGGPEIEIRIHNPGHEEHPACGPLIDAVAIKALFPPRFSRYNLIKNGK  203

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPY+F    WGVLIPP +ED++ PLPGW+IESLKAVKY+D  HF VPEG RA+ELV 
Sbjct  204   FEEGPYVFPKAKWGVLIPPFIEDENSPLPGWMIESLKAVKYVDKAHFFVPEGHRAIELVG  263

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESAL+Q+VRT   K Y L F+VGDA +ACEG M VEAFAG+  + V + SKG+G   R
Sbjct  264   GKESALSQIVRTSLNKFYALTFNVGDARDACEGPMAVEAFAGRSKVMVEYASKGRGGFRR  323

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
              +  F A+S RTRV F+S+FYH KSD+SGSLCGP+IDDVRLV+VR  R
Sbjct  324   GRLVFKAVSPRTRVTFISTFYHTKSDHSGSLCGPIIDDVRLVAVRTLR  371



>ref|NP_001046247.2| Os02g0205200 [Oryza sativa Japonica Group]
 dbj|BAF08161.2| Os02g0205200, partial [Oryza sativa Japonica Group]
Length=365

 Score =   431 bits (1108),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 269/349 (77%), Gaps = 7/349 (2%)
 Frame = -3

Query  1312  GLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAV  1133
             GL+ANGNFE+GP  +Q++GTRVV   AIP W  SG+VEYI SG+KQGDM+L+VPEG +AV
Sbjct  16    GLLANGNFERGPAPSQLRGTRVVGASAIPSWRTSGFVEYIPSGRKQGDMVLVVPEGSHAV  75

Query  1132  RLGEDAWIKTTVKAVKGTYYS-LSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             RLG +A I+  +          L+F+ ARTCAQ ERLNVS S       W +LP+QTMYS
Sbjct  76    RLGNEASIRQRLAGAARGARYALTFSAARTCAQAERLNVSAS-----GQWAVLPMQTMYS  130

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+GWDSY+WA+ A A+A D+V+HNP   +DPACGPLIDSVA+++LNPPRR   N++KNG+
Sbjct  131   SNGWDSYAWAWDAAADAFDVVIHNPGVTEDPACGPLIDSVAIRTLNPPRRTNKNLVKNGD  190

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPYI   T WGVLIP  V D+H PLPGW++ESLKAVKYIDSDHF+VP GRRAVEL+A
Sbjct  191   FEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDSDHFAVPRGRRAVELLA  250

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGK-GVSV  419
             GRESA+AQV+RT PG+ Y L F+VGDA+N CEGS+VVEA+AG+ + +V  +S G+ G + 
Sbjct  251   GRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRESTRVAHESAGRGGAAK  310

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             RA   F A ++RTRV F SSFY  +SD+  SLCGPVIDDV +VSVR  R
Sbjct  311   RAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVRARR  359



>emb|CAH67378.1| OSIGBa0159F11.2 [Oryza sativa Indica Group]
 emb|CAH67294.1| OSIGBa0103O01.12 [Oryza sativa Indica Group]
 gb|EAY94678.1| hypothetical protein OsI_16457 [Oryza sativa Indica Group]
Length=372

 Score =   428 bits (1101),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 206/366 (56%), Positives = 269/366 (73%), Gaps = 8/366 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             + LL LL  +     S   DGL+ NGNFE GP ++Q+ GT V   +AIP+WEISG+VEYI
Sbjct  9     VALLFLLVGSAARADSTVTDGLLPNGNFEDGPDKSQLNGTVVTGRYAIPNWEISGFVEYI  68

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             +SG ++ DM+L VPEG  AVRLG DA I+  +   +  YYS++F+ ARTCAQ+E+LNVSV
Sbjct  69    ESGHREQDMILAVPEGARAVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNVSV  128

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     ++G+LP+QT+Y+S GWDSYSWAF A+   V + +HNP  E+DPACGPLIDS+A
Sbjct  129   TP-----EFGVLPIQTVYTSSGWDSYSWAFRAKHSVVWLSIHNPGEEEDPACGPLIDSIA  183

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVK  656
             +K+L PPRR +GNML+NG+ EEGPYIF + TWGVL+PP  ED+H PLPGW+I S  K +K
Sbjct  184   IKNLYPPRRTKGNMLRNGDLEEGPYIFPDATWGVLVPPIFEDEHSPLPGWMIMSDTKVIK  243

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             Y+DS H  VP+G RAVELVAGRE+AL Q V T PG+ Y L FSVGDA N C+ S+ VEA+
Sbjct  244   YVDSPHHRVPQGARAVELVAGRETALVQEVATVPGRSYRLSFSVGDAGNGCKDSLAVEAY  303

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             A + T +VP++S+G G   RA+  F A+++ TRV F S  YH K D  G+LCGP++DD+ 
Sbjct  304   AARATAKVPYESQGTGGHKRAQLEFAAVANLTRVVFQSFNYHTKPD--GTLCGPLVDDIS  361

Query  295   LVSVRN  278
             LVSVR 
Sbjct  362   LVSVRK  367



>gb|ACG40327.1| hypothetical protein [Zea mays]
Length=381

 Score =   422 bits (1085),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 209/355 (59%), Positives = 266/355 (75%), Gaps = 14/355 (4%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQM-KGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             DGL+ NGNFE GP ++ +  GT V   HAIP WE SG+VEYI+SG KQGDMLL+VP+G +
Sbjct  25    DGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGAH  84

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEER--LNVSVSPNSEPNDWGMLPLQT  965
             AVRLG +A I+  +   +G YY+++F+ ARTCAQ ER  LNVSVSP     +WG+LP+QT
Sbjct  85    AVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERXRLNVSVSP-----EWGVLPMQT  139

Query  964   MYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR--RRRG--  797
             +Y S+GWDSY+WAF A+ +AV +V+HNP  E+DPACGPLID VA+++L PP   RR G  
Sbjct  140   IYGSNGWDSYAWAFKAKMDAVTLVIHNPGVEEDPACGPLIDGVAIRALYPPALARRAGGN  199

Query  796   NMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGR  617
             N+LKNG FEEGPY     +WGVL+PPN+EDDH PLP W+I S KAVKY+D+ HF+VP+G 
Sbjct  200   NLLKNGGFEEGPYFLPGASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAAHFAVPQGA  259

Query  616   RAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSK  437
             RAVELV GRESAL Q VRT PG  Y L F+VGD+ + C GSM  EA+A + T++VP+QS+
Sbjct  260   RAVELVGGRESALVQEVRTVPGWTYRLAFAVGDSGDGCAGSMAAEAYAARATVKVPYQSR  319

Query  436   GKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             G G   RA   FTAI++RTRV F S+FYHMK D  G+LCGP++DD  LV +R  +
Sbjct  320   GTGGYKRAVLDFTAIANRTRVVFQSTFYHMKPD--GTLCGPLVDDASLVGLRKKK  372



>ref|XP_008672703.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF84649.1| unknown [Zea mays]
 gb|ACF87605.1| unknown [Zea mays]
 gb|ACF87824.1| unknown [Zea mays]
 tpg|DAA58942.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=381

 Score =   422 bits (1085),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 209/355 (59%), Positives = 266/355 (75%), Gaps = 14/355 (4%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQM-KGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             DGL+ NGNFE GP ++ +  GT V   HAIP WE SG+VEYI+SG KQGDMLL+VP+G +
Sbjct  25    DGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGAH  84

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEER--LNVSVSPNSEPNDWGMLPLQT  965
             AVRLG +A I+  +   +G YY+++F+ ARTCAQ ER  LNVSVSP     +WG+LP+QT
Sbjct  85    AVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSP-----EWGVLPMQT  139

Query  964   MYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR--RRRG--  797
             +Y S+GWDSY+WAF A+ +AV +V+HNP  E+DPACGPLID VA+++L PP   RR G  
Sbjct  140   IYGSNGWDSYAWAFKAKMDAVTLVIHNPGVEEDPACGPLIDGVAIRALYPPALARRAGGN  199

Query  796   NMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGR  617
             N+LKNG FEEGPY     +WGVL+PPN+EDDH PLP W+I S KAVKY+D+ HF+VP+G 
Sbjct  200   NLLKNGGFEEGPYFLPGASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAAHFAVPQGA  259

Query  616   RAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSK  437
             RAVELV GRESAL Q VRT PG  Y L F+VGD+ + C GSM  EA+A + T++VP+QS+
Sbjct  260   RAVELVGGRESALVQEVRTVPGWTYRLAFAVGDSGDGCAGSMAAEAYAARATVKVPYQSR  319

Query  436   GKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             G G   RA   FTAI++RTRV F S+FYHMK D  G+LCGP++DD  LV +R  +
Sbjct  320   GTGGYKRAVLDFTAIANRTRVVFQSTFYHMKPD--GTLCGPLVDDASLVGLRKKK  372



>gb|EAY94676.1| hypothetical protein OsI_16455 [Oryza sativa Indica Group]
Length=379

 Score =   421 bits (1081),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 264/369 (72%), Gaps = 9/369 (2%)
 Frame = -3

Query  1372  IILLALLCATFHL-VISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             + LL L+   F     S   DGL+ NGNFE+ P ++QM GTRV   +AIP WEISG+VEY
Sbjct  14    VALLLLVGVAFAARSASAITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEY  73

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             I SGQKQGDMLL VPEG YAVRLG +A I+  +   +G +YS++F+ ARTCAQ E LN++
Sbjct  74    IGSGQKQGDMLLPVPEGAYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNIT  133

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             ++P S     G +P+QT+Y+S GWDSYSWAF A+   V  ++HNP    D ACGPLIDS 
Sbjct  134   ITPES-----GEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGVSDDEACGPLIDSF  188

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAV  659
             A+K+LNPP+R +GNMLKNG FEEGPYIF NT+WGVL+PP  EDD+ PL  W I+ + K+V
Sbjct  189   AIKTLNPPQRTKGNMLKNGGFEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTILSTTKSV  248

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYID+ H++VP G RAVELV+G E+A+ Q V T PG+ Y L FSVGDA + C GS+ V+A
Sbjct  249   KYIDAAHYAVPGGARAVELVSGMETAMLQEVSTVPGRSYRLEFSVGDAGDGCSGSLTVQA  308

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             +A + +++V +QS+G G   R    FTA   RTRV F+S  Y  KSD  G+LCGPVIDD 
Sbjct  309   YASRGSVKVTYQSQGTGGYKRGLLEFTATEKRTRVVFVSMAYTTKSD--GTLCGPVIDDA  366

Query  298   RLVSVRNPR  272
              LVSVR+ R
Sbjct  367   SLVSVRSHR  375



>emb|CAE01677.2| OSJNBb0091E11.19 [Oryza sativa Japonica Group]
Length=372

 Score =   420 bits (1079),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/366 (55%), Positives = 267/366 (73%), Gaps = 8/366 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             + LL LL  +     S   DGL+ NGNFE GP ++Q+ GT V   +AI +WEISG+VEYI
Sbjct  9     VALLFLLVGSAARADSAVTDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYI  68

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             +SG ++ DM+L VPEG  AVRLG DA I+  +   +  YYS++F+ ARTCAQ+E+LN+SV
Sbjct  69    ESGHREQDMILAVPEGARAVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSV  128

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P     ++G+LP+QT+Y+S GWDSYSWAF A+   V + +HNP  E+DPACGPLIDS+A
Sbjct  129   TP-----EFGVLPIQTVYTSSGWDSYSWAFRAKHSVVWLSIHNPGEEEDPACGPLIDSIA  183

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVK  656
             +K+L PP R +GNML+NG+ EEGPYIF + TWGVL+PP  ED+H PLPGW+I S  K +K
Sbjct  184   IKNLYPPPRTKGNMLRNGDLEEGPYIFPDATWGVLVPPIFEDEHSPLPGWMIMSDTKVIK  243

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             Y+DS H  VP+G RAVELVAGRE+AL Q V T PG+ Y L FSVGDA N C+ S+ VEA+
Sbjct  244   YVDSPHHRVPQGARAVELVAGRETALVQEVATVPGRSYRLSFSVGDAGNGCKDSLAVEAY  303

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             A + T +VP++S+G G   RA+  F A+++ TRV F S  YH K D  G+LCGP++DD+ 
Sbjct  304   AARATAKVPYESQGTGGHKRAQLEFAAVANLTRVVFQSFNYHTKPD--GTLCGPLVDDIS  361

Query  295   LVSVRN  278
             LVSVR 
Sbjct  362   LVSVRK  367



>ref|NP_001145978.1| hypothetical protein [Zea mays]
 gb|ACL52972.1| unknown [Zea mays]
 tpg|DAA58943.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=428

 Score =   421 bits (1082),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 208/354 (59%), Positives = 265/354 (75%), Gaps = 14/354 (4%)
 Frame = -3

Query  1312  GLVANGNFEQGPKRNQM-KGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             GL+ NGNFE GP ++ +  GT V   HAIP WE SG+VEYI+SG KQGDMLL+VP+G +A
Sbjct  73    GLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGAHA  132

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEER--LNVSVSPNSEPNDWGMLPLQTM  962
             VRLG +A I+  +   +G YY+++F+ ARTCAQ ER  LNVSVSP     +WG+LP+QT+
Sbjct  133   VRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSP-----EWGVLPMQTI  187

Query  961   YSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR--RRRG--N  794
             Y S+GWDSY+WAF A+ +AV +V+HNP  E+DPACGPLID VA+++L PP   RR G  N
Sbjct  188   YGSNGWDSYAWAFKAKMDAVTLVIHNPGVEEDPACGPLIDGVAIRALYPPALARRAGGNN  247

Query  793   MLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRR  614
             +LKNG FEEGPY     +WGVL+PPN+EDDH PLP W+I S KAVKY+D+ HF+VP+G R
Sbjct  248   LLKNGGFEEGPYFLPGASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAAHFAVPQGAR  307

Query  613   AVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKG  434
             AVELV GRESAL Q VRT PG  Y L F+VGD+ + C GSM  EA+A + T++VP+QS+G
Sbjct  308   AVELVGGRESALVQEVRTVPGWTYRLAFAVGDSGDGCAGSMAAEAYAARATVKVPYQSRG  367

Query  433   KGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
              G   RA   FTAI++RTRV F S+FYHMK D  G+LCGP++DD  LV +R  +
Sbjct  368   TGGYKRAVLDFTAIANRTRVVFQSTFYHMKPD--GTLCGPLVDDASLVGLRKKK  419



>emb|CAH67292.1| OSIGBa0103O01.10 [Oryza sativa Indica Group]
Length=373

 Score =   419 bits (1076),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 202/349 (58%), Positives = 256/349 (73%), Gaps = 8/349 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+ P ++QM GTRV   +AIP WEISG+VEYI SGQKQGDMLL VPEG YA
Sbjct  28    DGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAYA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I+  +   +G +YS++F+ ARTCAQ E LN++++P S     G +P+QT+Y+
Sbjct  88    VRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPES-----GEIPIQTVYT  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWDSYSWAF A+   V  ++HNP    D ACGPLIDS A+K+LNPP+R +GNMLKNG 
Sbjct  143   SSGWDSYSWAFKAKHSVVLFIVHNPGVSDDEACGPLIDSFAIKTLNPPQRTKGNMLKNGG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKYIDSDHFSVPEGRRAVELV  599
             FEEGPYIF NT+WGVL+PP  EDD+ PL  W I+ + K+VKYID+ H++VP G RAVELV
Sbjct  203   FEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTILSTTKSVKYIDAAHYAVPGGARAVELV  262

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             +G E+A+ Q V T PG+ Y L FSVGDA + C GS+ V+A+A   +++V +QS+G G   
Sbjct  263   SGMETAMLQEVSTVPGRSYRLEFSVGDAGDGCSGSLTVQAYASCGSVKVTYQSQGTGGYK  322

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             R    FTA   RTRV F+S  Y  KSD  G+LCGPVIDD  LVSVR+ R
Sbjct  323   RGLLEFTATEKRTRVVFVSMAYTTKSD--GTLCGPVIDDASLVSVRSHR  369



>ref|XP_006652463.1| PREDICTED: uncharacterized protein LOC102714172 [Oryza brachyantha]
Length=378

 Score =   419 bits (1076),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 202/351 (58%), Positives = 258/351 (74%), Gaps = 6/351 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE  P ++QM GTRV+  +AIP+W+++G+VEYI SGQKQGDMLL VPEG +A
Sbjct  26    DGLLQNGNFEYSPNKSQMNGTRVMGEYAIPYWKVTGFVEYIASGQKQGDMLLTVPEGAHA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I+  +   +G YYS++F+ ARTCAQ E+LNVSV+P  E    G LP+QT+Y+
Sbjct  86    VRLGNEASIQQQISVTRGMYYSITFSAARTCAQSEKLNVSVAPGPES---GELPIQTVYT  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWDSY+WAF A+   V +++HN   + DPACGPLIDSVA+K+L PP+  + NMLKNG+
Sbjct  143   SSGWDSYAWAFKAKRGLVSLIIHNHGEDDDPACGPLIDSVAIKTLYPPQATQNNMLKNGD  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESL-KAVKYIDSDHFSVPEGRRAVELV  599
             FEEGPY+F N  WGVL+PPN ED+H PLPGW++ S  KAVKY+DS HF+VP G RAVELV
Sbjct  203   FEEGPYVFPNARWGVLLPPNTEDEHSPLPGWMVLSYTKAVKYVDSAHFAVPHGARAVELV  262

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             +G E+AL Q V T PG+ Y L FSVGDA ++C GS+ V A+AG+    VP+ S+G G   
Sbjct  263   SGLETALMQEVPTVPGRSYRLEFSVGDAGDSCVGSLQVRAYAGEGCTTVPYNSQGTGGHT  322

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPRIP  266
             RA   F A++  TRV F+SS Y  K D  G+LCGPV+DDV LV V     P
Sbjct  323   RASLEFAAVADVTRVVFVSSSYITKWD--GTLCGPVVDDVSLVCVSQQAPP  371



>emb|CAE01676.2| OSJNBb0091E11.17 [Oryza sativa Japonica Group]
 gb|EAZ31210.1| hypothetical protein OsJ_15310 [Oryza sativa Japonica Group]
Length=373

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/349 (58%), Positives = 256/349 (73%), Gaps = 8/349 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+ P ++QM GTRV   +AIP WEISG+VEYI SGQKQGDMLL VPEG YA
Sbjct  28    DGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAYA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I+  +   +G +YS++F+ ARTCAQ E LN++++P S     G +P+QT+Y+
Sbjct  88    VRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPES-----GEIPIQTVYT  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWDSYSWAF A+   V  ++HNP    D ACGPLIDS A+K+LNPP+R +GNMLKNG 
Sbjct  143   SSGWDSYSWAFKAKHSVVLFIVHNPGVSDDEACGPLIDSFAIKTLNPPQRTKGNMLKNGG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKYIDSDHFSVPEGRRAVELV  599
             FEEGPYIF NT+WGVL+PP  EDD+ PL  W I+ + K+VKYID+ H++VP G RAVELV
Sbjct  203   FEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTILSTTKSVKYIDAAHYAVPGGARAVELV  262

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             +G E+A+ Q V T PG+ Y L FSVGDA + C GS+ V+A+A + +++V +QS+G G   
Sbjct  263   SGMETAMLQEVSTVPGRSYRLEFSVGDAGDGCSGSLTVQAYASRGSVKVTYQSQGTGGYK  322

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             R    FTA   RTRV F+S  Y  KSD  G+LCGPVIDD  LVSV + R
Sbjct  323   RGLLEFTATEKRTRVVFVSMAYTTKSD--GTLCGPVIDDASLVSVHSHR  369



>ref|NP_001053189.1| Os04g0494800 [Oryza sativa Japonica Group]
 dbj|BAF15103.1| Os04g0494800 [Oryza sativa Japonica Group]
Length=379

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/369 (56%), Positives = 263/369 (71%), Gaps = 9/369 (2%)
 Frame = -3

Query  1372  IILLALLCATFHL-VISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             + LL L+   F     S   DGL+ NGNFE+ P ++QM GTRV   +AIP WEISG+VEY
Sbjct  14    VALLLLVGVAFAARSASAITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEY  73

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVS  1016
             I SGQKQGDMLL VPEG YAVRLG +A I+  +   +G +YS++F+ ARTCAQ E LN++
Sbjct  74    IGSGQKQGDMLLPVPEGAYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNIT  133

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             ++P S     G +P+QT+Y+S GWDSYSWAF A+   V  ++HNP    D ACGPLIDS 
Sbjct  134   ITPES-----GEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGVSDDEACGPLIDSF  188

Query  835   ALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAV  659
             A+K+LNPP+R +GNMLKNG FEEGPYIF NT+WGVL+PP  EDD+ PL  W I+ + K+V
Sbjct  189   AIKTLNPPQRTKGNMLKNGGFEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTILSTTKSV  248

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYID+ H++VP G RAVELV+G E+A+ Q V T PG+ Y L FSVGDA + C GS+ V+A
Sbjct  249   KYIDAAHYAVPGGARAVELVSGMETAMLQEVSTVPGRSYRLEFSVGDAGDGCSGSLTVQA  308

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             +A + +++V +QS+G G   R    FTA   RTRV F+S  Y  KSD  G+LCGPVIDD 
Sbjct  309   YASRGSVKVTYQSQGTGGYKRGLLEFTATEKRTRVVFVSMAYTTKSD--GTLCGPVIDDA  366

Query  298   RLVSVRNPR  272
              LVSV + R
Sbjct  367   SLVSVHSHR  375



>tpg|DAA37152.1| TPA: hypothetical protein ZEAMMB73_071426 [Zea mays]
Length=379

 Score =   417 bits (1073),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/376 (55%), Positives = 266/376 (71%), Gaps = 15/376 (4%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             LL ++C       S   DGL+ NGNFE+ P ++Q+ GTRV+  +AIPHWEISGYVEYI S
Sbjct  16    LLLIVCLAAR-AASAIQDGLLPNGNFEEAPPKSQLNGTRVMGRNAIPHWEISGYVEYIGS  74

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQKQGDMLL VPEG YAVRLG +A I+  +    G  YS++F+ ARTCAQ E+LNV+V+P
Sbjct  75    GQKQGDMLLPVPEGAYAVRLGNEASIQQRLAVTPGARYSITFSAARTCAQAEQLNVTVAP  134

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
              S+     +LP+QT+Y+S GWDSYSWAF A    V +++HNP   +D ACGPLID  A+K
Sbjct  135   ESD-----VLPIQTVYTSSGWDSYSWAFQAAGSVVTLIVHNPGVAEDAACGPLIDLFAIK  189

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKYI  650
             ++  PR  + NMLKNG+FE+GPYIF NT WGVL+PP  EDD+ PL  W ++ S K+VKY+
Sbjct  190   TMPTPRSSKNNMLKNGDFEDGPYIFPNTQWGVLVPPMDEDDYSPLAPWMVLSSTKSVKYV  249

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D+ H +VP G RAVELV+G E+AL Q V T PG++Y L FS GDA N C GSM V+A+A 
Sbjct  250   DAPHHAVPHGARAVELVSGMETALVQNVATVPGQLYRLQFSAGDAGNGCVGSMTVQAYAA  309

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             + +++VP+QS+GKG   R    F A++ +TRV F+S  Y MK D  G+LCGPV+DDV LV
Sbjct  310   RGSVKVPYQSQGKGGHTRGVLDFAAVADQTRVVFVSMGYIMKPD--GTLCGPVVDDVSLV  367

Query  289   SVRNPRIP*THTPKRL  242
             S RN      H  +RL
Sbjct  368   STRN------HPARRL  377



>ref|XP_004978106.1| PREDICTED: uncharacterized protein LOC101761311 [Setaria italica]
Length=381

 Score =   417 bits (1071),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 199/364 (55%), Positives = 263/364 (72%), Gaps = 8/364 (2%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  L C       +  PDGL+ NGNFE+ P  +Q+ GTRV+  +AIPHWEISG+VEYI  
Sbjct  17    LFLLTCVVSARAAAAIPDGLLPNGNFEEAPATSQLNGTRVMGRYAIPHWEISGFVEYIGP  76

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
              QKQGDM+L VPEG YAVRLG +A I+  +   +  YYS++F+ ARTCAQ ERLNV+V+P
Sbjct  77    AQKQGDMILPVPEGAYAVRLGNEASIRQLLNVTRKAYYSITFSAARTCAQAERLNVTVAP  136

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
              S+     +LP+QT+Y+++GWDSYSWAF A   AV +++HNP   +D ACGPL+DS A+K
Sbjct  137   ESD-----VLPIQTVYTANGWDSYSWAFKARRSAVTLIVHNPGVTEDAACGPLLDSFAIK  191

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKYI  650
             +L  P+R + NMLKNG+FEEGPYIF +T WGVL+PP  EDD+ PL  W ++ S K+VKY+
Sbjct  192   TLQVPQRTKNNMLKNGDFEEGPYIFPDTPWGVLVPPLDEDDYSPLSPWMVLSSTKSVKYL  251

Query  649   DSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAG  470
             D+ H++VP G  AVELV+G E+AL Q VRT PG+ Y L FS GDA N C GS+ V+A+A 
Sbjct  252   DAAHYAVPRGAHAVELVSGLETALVQDVRTVPGRPYRLEFSAGDAGNGCVGSLAVQAYAA  311

Query  469   KLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             + +++V +QS+GKG   R    FTAI+++TRV F+S  Y MK+D  G+LCGPV+DD  LV
Sbjct  312   RGSVKVAYQSQGKGGYERGALEFTAIANQTRVVFVSMAYTMKND--GTLCGPVVDDASLV  369

Query  289   SVRN  278
               RN
Sbjct  370   GFRN  373



>ref|XP_003581385.1| PREDICTED: uncharacterized protein LOC100824265 [Brachypodium 
distachyon]
Length=373

 Score =   416 bits (1070),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 204/352 (58%), Positives = 260/352 (74%), Gaps = 8/352 (2%)
 Frame = -3

Query  1330  ISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVP  1151
             +S  PDGL+ NGNF+ GP ++Q+ GT V+  H+IP WE+SG+VEYI SGQKQG+M+L VP
Sbjct  21    VSAVPDGLLPNGNFKDGPGKSQLNGTIVMGSHSIPFWEVSGFVEYIGSGQKQGEMILPVP  80

Query  1150  EGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPL  971
             EG  AVRLG DA I+  +   + T+YS++F+ ARTCAQ E+LNVSV+     +D G+LP+
Sbjct  81    EGACAVRLGNDASIRQKLSVTRRTFYSITFSAARTCAQAEKLNVSVA-----SDSGLLPI  135

Query  970   QTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNM  791
             QT+Y+S GWDSYSWAF A    V + +HNP  E DPACGP+IDSVA+K+L PP+  + NM
Sbjct  136   QTVYASIGWDSYSWAFKAMHSVVSLAIHNPGVEDDPACGPMIDSVAIKTLKPPQHTKSNM  195

Query  790   LKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESL-KAVKYIDSDHFSVPEGRR  614
             LKNG+FEEGP++F ++ WGVL+PP  ED   PLPGW I S  KAVKYIDS HF VP+G  
Sbjct  196   LKNGDFEEGPHVFPDSPWGVLVPPMDEDATSPLPGWTIMSQSKAVKYIDSPHFVVPQGSY  255

Query  613   AVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKG  434
             AVELVAGRE+AL Q V T PG+ Y L+FSVGDA + C+  MVV+A+A +  LQ+ ++S G
Sbjct  256   AVELVAGREAALVQEVITVPGRSYRLFFSVGDAGDGCKDGMVVDAYAARENLQMRYESLG  315

Query  433   KGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
              G   RA+  F A+ +RTRV F S  YHMK D  G+LCGPV+DDV LVSVR 
Sbjct  316   VGGHRRAEVGFVAVGNRTRVVFQSLNYHMKPD--GTLCGPVLDDVSLVSVRK  365



>ref|NP_001053188.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAD41544.2| OSJNBb0091E11.14 [Oryza sativa Japonica Group]
 dbj|BAF15102.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAH67289.1| OSIGBa0103O01.7 [Oryza sativa Indica Group]
 gb|EAY94693.1| hypothetical protein OsI_16470 [Oryza sativa Indica Group]
 gb|EAZ31209.1| hypothetical protein OsJ_15309 [Oryza sativa Japonica Group]
 dbj|BAG99074.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   415 bits (1067),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/370 (55%), Positives = 264/370 (71%), Gaps = 9/370 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             ++ L LL +T         DGL+ NGNFE  P ++QM GTRV+  +AIP+W+I+G+VEYI
Sbjct  9     VVALLLLVST---AARAAGDGLLLNGNFEYQPSKSQMNGTRVMAEYAIPYWKITGFVEYI  65

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
              SGQKQGDMLL VPEG +AVRLG +A I+  +   +G YYS++F+ ARTCAQ E+LNVSV
Sbjct  66    SSGQKQGDMLLTVPEGAHAVRLGNEASIEQQISVTRGMYYSITFSAARTCAQSEKLNVSV  125

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P  E    G LP+QT+Y+S GWDSY+WAF A+   V +++HN   + DPACGPLIDSVA
Sbjct  126   APGPES---GELPIQTVYTSSGWDSYAWAFKAKRGLVSLIIHNHGEDDDPACGPLIDSVA  182

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVK  656
             +K+L PP+  + NML+NG+FEEGPY+F N  WGV++PP  EDDH PLPGW++ S  KAVK
Sbjct  183   IKTLYPPQATQNNMLRNGDFEEGPYMFPNAAWGVMVPPISEDDHSPLPGWMVMSDTKAVK  242

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
              +DS HF+VP G RAVELV+G E+AL Q VRT PG+ Y L FSVGDA++ C GSM V+ +
Sbjct  243   CVDSAHFTVPHGARAVELVSGLETALMQEVRTVPGRSYRLEFSVGDASDGCVGSMQVKGY  302

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             AG+    V + S+G G   RA   F A+++ TRV F+SS Y  K D  G+LCGPV+DD  
Sbjct  303   AGQGCTTVTYSSQGTGGHTRASLEFAAVANTTRVVFVSSTYITKWD--GTLCGPVVDDAS  360

Query  295   LVSVRNPRIP  266
             LV V   + P
Sbjct  361   LVCVSQQQPP  370



>ref|XP_004976082.1| PREDICTED: uncharacterized protein LOC101765204 [Setaria italica]
Length=375

 Score =   412 bits (1059),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/364 (56%), Positives = 260/364 (71%), Gaps = 9/364 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +L  +L      V + T DG++ NG+FEQGP ++QM GTRV+DP AIP+W+I G+VEYI 
Sbjct  9     VLFLVLGVAARAVFAVT-DGILPNGHFEQGPDKSQMNGTRVMDPDAIPYWKIYGFVEYIG  67

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SGQ+Q DM+L VPEG  AVRLG DA I+  +   + TYYS++F  ARTCAQ E+LNVSV+
Sbjct  68    SGQQQDDMILPVPEGEQAVRLGNDATIRQQLDVTRHTYYSITFGAARTCAQAEKLNVSVT  127

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
             P S     G+LP+QT+Y+S GWDSYSWAF A+   V + +HNP  E DPACGPLID++A+
Sbjct  128   PES-----GVLPIQTVYTSSGWDSYSWAFKAKHSTVWLSIHNPGHEDDPACGPLIDAIAI  182

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVKY  653
             K++  P   + NML+NG+FE+GPYIF NT WGVL+PP +EDDH PLPGW+I S  K VKY
Sbjct  183   KAIRRPHHVKNNMLRNGDFEDGPYIFPNTPWGVLVPPIMEDDHSPLPGWMIMSDTKVVKY  242

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +D+ H  VP G  AVELVAGRE AL Q VRT PG+ Y L FSVGDA N C G + V A+A
Sbjct  243   VDAAHHKVPHGSYAVELVAGRECALVQEVRTVPGRPYRLSFSVGDAANGCGGYLAVVAYA  302

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
              + TL VP++S G G S RA+  F A  + TRV F S+ ++MK D   +LCGP++DDV L
Sbjct  303   SRATLNVPYESHGAGGSKRAELEFVADHNLTRVVFQSANHYMKPD--ATLCGPIVDDVSL  360

Query  292   VSVR  281
             V V 
Sbjct  361   VPVH  364



>gb|EMT04285.1| hypothetical protein F775_14657 [Aegilops tauschii]
Length=375

 Score =   411 bits (1057),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 200/365 (55%), Positives = 262/365 (72%), Gaps = 8/365 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             + L +L       +S   DGL+ NGNF+ GP ++Q+ GT V+  H+IP+WEISG+VEYI+
Sbjct  10    MTLLVLVGVAARAVSAVTDGLLPNGNFKDGPAKSQLNGTVVMGRHSIPNWEISGFVEYIQ  69

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SG +QG M++ VPEG  AVRLG DA I+  ++  +  YYS++F+ ARTCAQ E+LNVSV+
Sbjct  70    SGHQQGGMVVAVPEGASAVRLGNDASIRQNIRVTRRAYYSITFSAARTCAQAEKLNVSVA  129

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
              +S     G+LP+QT+YSS GWDSYSWAF A+  AV + +HNP AE+DPACGP+ID++A+
Sbjct  130   ADS-----GVLPVQTVYSSGGWDSYSWAFRAKHSAVWLAIHNPGAEEDPACGPVIDAIAI  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKY  653
             K+L PP + +GNML+NG+FE+GPYIF +  WGVL+PP  ED   PLPGW I+ S K VKY
Sbjct  185   KTLQPPTKSKGNMLRNGDFEDGPYIFPDCPWGVLVPPMDEDSCSPLPGWMIMSSTKVVKY  244

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +D+  + VP G RAVELVAGRE+AL Q V T  G+ Y L F VGDA N C+ SMVVEA+ 
Sbjct  245   VDAPRYRVPHGARAVELVAGREAALVQEVATVAGRSYRLQFYVGDAANGCKESMVVEAYV  304

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
                +L+V +QS+G G   RA   F A+ + TRV F S  YHMK D  G+LCGPV+DD+ L
Sbjct  305   AAASLKVQYQSQGTGGYRRAMLDFVAVGNLTRVVFQSLHYHMKVD--GTLCGPVVDDISL  362

Query  292   VSVRN  278
             VSVR 
Sbjct  363   VSVRK  367



>ref|XP_010691193.1| PREDICTED: uncharacterized protein LOC104904598 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   410 bits (1053),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/371 (54%), Positives = 266/371 (72%), Gaps = 15/371 (4%)
 Frame = -3

Query  1378  TGIILLAL---LCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISG  1208
             TG ++L L   LC +           L+ NG+FE  P   Q+ GT+V   ++IP WE SG
Sbjct  5     TGFVVLLLASNLCVSL--------GALLPNGDFELSPSSTQLSGTKVEGKYSIPQWESSG  56

Query  1207  YVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEER  1028
             +VEYI SG KQ DM+L+VP+G +AVRLG +A I+  V A  G +Y+L+F+FARTC+QEE 
Sbjct  57    FVEYITSGTKQQDMVLVVPQGKHAVRLGTNASIRQKVAAQSGKFYALTFSFARTCSQEEV  116

Query  1027  LNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAE-KDPACGP  851
             LNV+++P+S+ +  G+LPLQT+YSS G+DSY+W F AEA  ++I LHNP    +D ACGP
Sbjct  117   LNVTITPSSKGHS-GILPLQTVYSSVGFDSYAWGFRAEANVIEISLHNPGQPGEDHACGP  175

Query  850   LIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES  671
             LID++AL  L+  +   GN++KNG+F EGPY+F +++WGVL+PPNVED H PLP W IES
Sbjct  176   LIDTIALTILDSVKPTGGNLVKNGDFGEGPYVFHSSSWGVLLPPNVEDSHSPLPAWRIES  235

Query  670   LKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSM  491
             LKAVKYIDS HF VPEG+RAVE+V G+ES +AQ +RT+PGK+Y L F VGDANN C G +
Sbjct  236   LKAVKYIDSLHFFVPEGQRAVEIVGGKESVIAQTIRTQPGKLYALTFIVGDANNGCVGPL  295

Query  490   VVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPV  311
              +EA+A K T++V + SKGKG   R K  F A    T +RFLSS Y M  D  GS+CGPV
Sbjct  296   AIEAYAAKATIRVTYNSKGKGGFTRGKLVFRAEKRTTSIRFLSSLYTMTID--GSMCGPV  353

Query  310   IDDVRLVSVRN  278
             +DDV+++ VR 
Sbjct  354   LDDVKVLHVRK  364



>ref|XP_006653557.1| PREDICTED: uncharacterized protein LOC102718925 [Oryza brachyantha]
Length=384

 Score =   409 bits (1051),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 209/383 (55%), Positives = 261/383 (68%), Gaps = 21/383 (5%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
             TG + L LL +      S    GL+ NGNFE+ P  +QM GTRV   +AIP WEISG+VE
Sbjct  5     TGCVRLLLLVSVAAQSASAISYGLLPNGNFEEAPDESQMNGTRVTGRYAIPKWEISGFVE  64

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YI SGQKQGDMLL VPEG YAVRLG +A I+  +   +G +YS++F+ ARTCAQ E LNV
Sbjct  65    YIGSGQKQGDMLLPVPEGAYAVRLGNEASIQQKLGLTRGMHYSITFSAARTCAQSEVLNV  124

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             +VSP S     G LP+QT+Y+S GWDSYSWAF A+   V +++HN     D ACGPLIDS
Sbjct  125   TVSPES-----GDLPIQTVYTSSGWDSYSWAFKAKHSVVTLIVHNVGVSDDAACGPLIDS  179

Query  838   VALKSLNPPRRRR-------------GNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHC  698
              A+K+L  P+R +             GNMLKNG FEEGPYIF NT+WGVL+PP  EDD+ 
Sbjct  180   FAIKTLQLPQRTKVQFMGAHRETNQPGNMLKNGGFEEGPYIFPNTSWGVLVPPRDEDDYS  239

Query  697   PLPGW-IIESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVG  521
             PL  W ++ S K+VK IDS H+SVP G RAVEL++G E+AL Q V T PG+ Y L FSVG
Sbjct  240   PLSPWAVLSSTKSVKCIDSAHYSVPGGARAVELLSGMETALVQEVSTVPGRSYRLEFSVG  299

Query  520   DANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKS  341
             DA + C GS+ V+A+A + +++VP+QS+G G   R    FTA   RTRV F+S  Y MK+
Sbjct  300   DAGDGCAGSLAVQAYASRGSVKVPYQSQGTGGHKRGVLEFTATEKRTRVVFVSMAYTMKT  359

Query  340   DNSGSLCGPVIDDVRLVSVRNPR  272
             D  G+LCGPVIDD  LV+VR  R
Sbjct  360   D--GTLCGPVIDDASLVTVRTHR  380



>gb|EMT16005.1| hypothetical protein F775_13621 [Aegilops tauschii]
Length=340

 Score =   406 bits (1044),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/367 (57%), Positives = 264/367 (72%), Gaps = 41/367 (11%)
 Frame = -3

Query  1378  TGIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
             +G++LL LLCAT  L +  T DGL+ANGNFE+GP+ +Q++GT+VV   +IP W  SG VE
Sbjct  7     SGLVLL-LLCATCRLALGIT-DGLLANGNFERGPQPSQLRGTQVVGASSIPSWRTSGCVE  64

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YI SG+KQGD +L+VPE                               AR   + ERLNV
Sbjct  65    YIPSGRKQGDRVLVVPE-------------------------------AR--GRAERLNV  91

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             S S  S     G+L +QTMYSS+GWDSYSWA+ A A+ V++V+HNP   +DPACGPLIDS
Sbjct  92    SASGQS-----GVLVMQTMYSSNGWDSYSWAWDATADEVEVVVHNPGVTEDPACGPLIDS  146

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+K+L PPRR   N++KNG+FEEGPYI   T WGVLIP  + D+H PLPGW++ESLKAV
Sbjct  147   VAIKTLTPPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSPLPGWMVESLKAV  206

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             KYIDSDHF+VP GRRAVEL+AGRESA+AQV+RT PG+ Y L FSVG+A+N C GS++VEA
Sbjct  207   KYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFSVGNASNTCRGSLMVEA  266

Query  478   FAGKLTLQVPFQSKGK-GVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDD  302
             +AG+ + +VP++S G+ G + RA   F A SSRTRV F SSFY+ ++D+  SLCGPVIDD
Sbjct  267   YAGRESTKVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMSSLCGPVIDD  326

Query  301   VRLVSVR  281
             V +VSVR
Sbjct  327   VAVVSVR  333



>ref|XP_002446724.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
 gb|EES11052.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
Length=379

 Score =   407 bits (1047),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/359 (56%), Positives = 257/359 (72%), Gaps = 14/359 (4%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+ P ++Q+KG+RV+  +AIPHWEISG+VEYI SGQKQGDMLL VPEG YA
Sbjct  32    DGLLPNGNFEEAPPKSQLKGSRVMGRNAIPHWEISGFVEYIGSGQKQGDMLLPVPEGAYA  91

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I+  +   +G +YS++F+ ARTCAQ E+LNV+V+P S+     +LP+QT+Y+
Sbjct  92    VRLGNEASIQQRLALTQGAHYSITFSAARTCAQAEQLNVTVAPESD-----ILPIQTVYT  146

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWDSYSWAF A +  V +++HNP   +D ACGPLID  A+K+L  P+  + N+LKNG+
Sbjct  147   SSGWDSYSWAFKATSSVVSLIIHNPGVAEDAACGPLIDLFAIKTLPTPQSSKNNLLKNGD  206

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKYIDSDHFSVPEGRRAVELV  599
             FEEGPYIF NT WGVL+PP  EDD+ PL  W I+ S K+VKY+D+ H  VP G RAVELV
Sbjct  207   FEEGPYIFPNTRWGVLVPPMDEDDYSPLSPWMILSSTKSVKYVDAPHHVVPHGARAVELV  266

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             +G E+AL Q   T PG  Y L FS GDA N C GSM V+A+AG  +++  FQS+GKG   
Sbjct  267   SGMETALVQNATTVPGLPYRLQFSAGDAGNGCVGSMAVQAYAGGKSVKAQFQSQGKGGHK  326

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPRIP*THTPKRL  242
             R    FTA + +TRV F+S  Y MK D  G+LCGPV+DDV LV  RN      H  +RL
Sbjct  327   RGVLDFTATADQTRVVFVSMGYIMKPD--GTLCGPVVDDVSLVCTRN------HPARRL  377



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   406 bits (1044),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 197/359 (55%), Positives = 263/359 (73%), Gaps = 4/359 (1%)
 Frame = -3

Query  1366  LLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKS  1187
             L  LLC  F  V +F+ DGL+ NGNFE+ P  + +KG+ V+  +++P WEI G VEY+KS
Sbjct  10    LGVLLC--FSCVSAFS-DGLLPNGNFEKAPSHSSLKGSVVIGKNSLPDWEIGGAVEYVKS  66

Query  1186  GQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSP  1007
             GQK GD++L++PEG  AVRLG DA+I+  V   KG  Y+L+ + ARTCA +E+LNV+VS 
Sbjct  67    GQKSGDLMLVIPEGFAAVRLGSDAFIRQRVSVNKGELYALTLSAARTCASDEKLNVTVST  126

Query  1006  NSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALK  827
             +S   D G++ +QT+Y++ GWDSY+WAFLAE+  + + + +P  ++DPACG ++D+VALK
Sbjct  127   DS-IRDSGLISVQTIYNAKGWDSYAWAFLAESSEIGVFIGDPGQDEDPACGSVVDAVALK  185

Query  826   SLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYID  647
              L+PP+  RGN+LKNG+FEEGPY   N   GVLIPPN  D + PLPGW I SLK+V+YID
Sbjct  186   VLHPPKANRGNLLKNGDFEEGPYFLPNNLDGVLIPPNQIDRNSPLPGWTILSLKSVRYID  245

Query  646   SDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGK  467
             S HFSVPEGR+AVEL+AG+ES ++Q   T P   Y L F VGDANN C+GSM VEA+AG+
Sbjct  246   SPHFSVPEGRKAVELLAGKESIISQTATTVPKAYYVLTFLVGDANNTCKGSMAVEAYAGR  305

Query  466   LTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
              +L+V ++SKG G   RAK  F A+   TR  F S+FY  ++D+  SLCGPVIDDVRLV
Sbjct  306   GSLKVDYESKGLGGFKRAKLVFVALEKVTRFVFYSTFYMTRTDDLSSLCGPVIDDVRLV  364



>gb|EMS63052.1| hypothetical protein TRIUR3_01733 [Triticum urartu]
Length=375

 Score =   406 bits (1044),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 198/365 (54%), Positives = 260/365 (71%), Gaps = 8/365 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             I L +L        S   DGL+ NGNF+ GP ++Q+ GT V+  H+IP+WEISG+VEYI+
Sbjct  10    ITLLVLVGVAARAASAVTDGLLPNGNFKDGPAKSQLNGTVVMGRHSIPNWEISGFVEYIQ  69

Query  1189  SGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVS  1010
             SG  Q DM++ VPEG  AVRLG DA I+  ++  +  YYS++F+ ARTCAQ E+LNVSV+
Sbjct  70    SGHTQDDMIVAVPEGASAVRLGNDASIRQNIRVTRRAYYSITFSAARTCAQAEKLNVSVA  129

Query  1009  PNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVAL  830
              +S     G+LP+QT+YSS GWDSYSWAF A+  AV + +HNP  E+DPACGP+ID++A+
Sbjct  130   ADS-----GVLPVQTVYSSGGWDSYSWAFRAKHSAVWLAIHNPGVEEDPACGPVIDAIAI  184

Query  829   KSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKY  653
             K+L PP + +GNML+NG+FE+GPYIF +  WGVL+PP  ED+  PLPGW ++ S K VKY
Sbjct  185   KTLQPPTKTKGNMLRNGDFEDGPYIFPDCPWGVLVPPMDEDNCSPLPGWMVMSSTKVVKY  244

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             +D+  + VP G RAVELVAGRE+AL Q V T  G+ Y L F VGDA N C+ SMVVEA+ 
Sbjct  245   VDAPRYRVPHGARAVELVAGRETALVQEVATVAGRSYRLQFYVGDAANGCKESMVVEAYV  304

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
                +L+V +QS+G G   RA   F A+ + TRV F S  +HMK D  G+LCGPV+DD+ L
Sbjct  305   AAASLKVQYQSQGTGGYRRAMLDFVAVGNLTRVVFQSLHHHMKVD--GTLCGPVVDDISL  362

Query  292   VSVRN  278
             VSVR 
Sbjct  363   VSVRK  367



>ref|XP_002446728.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
 gb|EES11056.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
Length=371

 Score =   405 bits (1040),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/369 (55%), Positives = 264/369 (72%), Gaps = 12/369 (3%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             +ILL  + A     I+   +GL+ NG+FEQGP +++M GTRV+  ++IPHWEISG++EYI
Sbjct  10    VILLIAVAARAVFAIT---EGLLPNGHFEQGPAKSEMNGTRVLGRYSIPHWEISGFLEYI  66

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             +SGQKQ DMLL VPEG  AVRLG DA I+  +   + TYYS++F+ +RTCAQ E+LNVSV
Sbjct  67    ESGQKQDDMLLQVPEGERAVRLGNDATIQQQLAVTRHTYYSITFSASRTCAQAEKLNVSV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +P S     G+LP+QT+Y+S GWDSYSWAF A    V + +HNP  E++PACGPLID VA
Sbjct  127   TPES-----GVLPIQTVYTSSGWDSYSWAFKARHSTVWLSIHNPGHEENPACGPLIDRVA  181

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVK  656
             +K+L  P   + NML+NG+FE+GPYIF++T WGVL+PP  ED+H PLPGW+I S  K VK
Sbjct  182   VKTLRSPHHVKNNMLRNGDFEDGPYIFADTPWGVLVPPITEDEHSPLPGWMIMSDTKVVK  241

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             Y+D+ H +VP G  AVELVAGRE AL Q VRT P + Y L F+VGDA N CEG++ V+  
Sbjct  242   YVDAPHHAVPRGAGAVELVAGRECALVQEVRTVPRRSYKLSFAVGDAANGCEGNLAVDVS  301

Query  475   AGKLT-LQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             AG+   L VP++S G G   RA+  F A  + TRV F S+ ++ KSD   +LCGP+IDDV
Sbjct  302   AGRAAKLNVPYESHGTGGYKRAELEFVATDNLTRVVFQSANHYTKSD--ATLCGPIIDDV  359

Query  298   RLVSVRNPR  272
             RLV V   R
Sbjct  360   RLVPVHARR  368



>emb|CDY39990.1| BnaC06g40680D [Brassica napus]
Length=341

 Score =   403 bits (1036),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/343 (57%), Positives = 246/343 (72%), Gaps = 34/343 (10%)
 Frame = -3

Query  1309  LVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVR  1130
             L+ANGNFE+GPK +Q+KG+ +    A+P+WEI+G+VEYIK+GQKQ DM+L+VPEG  AVR
Sbjct  29    LLANGNFEKGPKPSQLKGSVIKGRTAVPNWEITGFVEYIKAGQKQDDMVLVVPEGSSAVR  88

Query  1129  LGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSD  950
             LG +A I   +    G  YS++F+ ARTCAQ+ERLN+SV+  S     G++P+QTMY SD
Sbjct  89    LGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQTMYGSD  143

Query  949   GWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFE  770
             GWDSYSWAF A    ++I +HNP  E+ PACGPLID++A+K+L PPR    N++KNGNFE
Sbjct  144   GWDSYSWAFKAGGSEIEIRIHNPGREEHPACGPLIDAIAIKALFPPRFSGNNLIKNGNFE  203

Query  769   EGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGR  590
             EGPY+F    WGVLIPP +EDD+ PLPGW+IESLKAVKY+D  HF VPEG RA+ELV G+
Sbjct  204   EGPYVFPKAKWGVLIPPFIEDDNSPLPGWMIESLKAVKYVDKAHFFVPEGHRAIELVGGK  263

Query  589   ESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRAK  410
             ESA++Q+VRT   K Y L F+VGDA +ACEG M VEAFAG                    
Sbjct  264   ESAVSQIVRTSLNKFYALGFNVGDARDACEGPMAVEAFAG--------------------  303

Query  409   HRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
                       R   + +FYHMK+D+SGSLCGPVIDDVRLV+VR
Sbjct  304   ---------GRKILVDTFYHMKNDHSGSLCGPVIDDVRLVAVR  337


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 79/181 (44%), Gaps = 22/181 (12%)
 Frame = -3

Query  799  GNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW----IIESLKAVKYIDSDHFS  632
            G++L NGNFE+GP           +  +V      +P W     +E +KA +  D     
Sbjct  27   GSLLANGNFEKGPKPSQ-------LKGSVIKGRTAVPNWEITGFVEYIKAGQKQDDMVLV  79

Query  631  VPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEG-SMVVEAFAGKLTLQ  455
            VPEG  AV L  G E++++Q +  R G++Y + FS        E  ++ V   +G + +Q
Sbjct  80   VPEGSSAVRL--GNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQ  137

Query  454  VPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNP  275
              + S G      A   F A  S   +R      H         CGP+ID + + ++  P
Sbjct  138  TMYGSDGWDSYSWA---FKAGGSEIEIRI-----HNPGREEHPACGPLIDAIAIKALFPP  189

Query  274  R  272
            R
Sbjct  190  R  190



>ref|XP_008669229.1| PREDICTED: uncharacterized protein LOC103646276 [Zea mays]
Length=379

 Score =   405 bits (1040),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 254/356 (71%), Gaps = 8/356 (2%)
 Frame = -3

Query  1345  TFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDM  1166
             T  L      DGL+ NGNFE GP ++ + GTRV++ +++P+WEI G+VEYI SGQKQ DM
Sbjct  31    TARLASGVVSDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEILGFVEYIGSGQKQDDM  90

Query  1165  LLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDW  986
             +L VPEG  AVRLG DA I+  +  ++ T YS++F  ARTCAQ ERL VSV+  S     
Sbjct  91    ILPVPEGACAVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVAAES-----  145

Query  985   GMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRR  806
             G+LP+QT+Y+S+GWDSYS+AF A        +HNP  E DPACGPLIDSVA+K+LNPP  
Sbjct  146   GVLPIQTVYTSNGWDSYSYAFRARHSTAWFSIHNPGHEDDPACGPLIDSVAIKALNPPHL  205

Query  805   RRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVKYIDSDHFSV  629
              + NML+NG+FEEGP IF +T WGVL+PP  EDD  PLPGW++ S  K VKY+D+ H +V
Sbjct  206   TKDNMLRNGDFEEGPVIFPDTAWGVLVPPMSEDDVSPLPGWMVMSDTKVVKYVDAAHHAV  265

Query  628   PEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVP  449
             P G RAVELVAGRE+AL Q VRT PG+ Y L  +VGDA N CEG M VEA+A + TL+  
Sbjct  266   PRGARAVELVAGREAALVQEVRTVPGRHYRLSLAVGDAANGCEGPMAVEAYAARATLRTT  325

Query  448   FQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
             ++S+G G S RA   FTAI++ TRV   S  +HMK D  G+LCGPV+DDV LV +R
Sbjct  326   YESRGNGGSKRAVVDFTAIANLTRVVLQSYNHHMKPD--GTLCGPVVDDVSLVGLR  379



>ref|XP_008669227.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 ref|XP_008669228.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 tpg|DAA37148.1| TPA: hypothetical protein ZEAMMB73_528816 [Zea mays]
Length=380

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 199/356 (56%), Positives = 254/356 (71%), Gaps = 8/356 (2%)
 Frame = -3

Query  1345  TFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDM  1166
             T  L      DGL+ NGNFE GP ++ + GTRV++ +++P+WEI G+VEYI SGQKQ DM
Sbjct  32    TARLASGVVTDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEIFGFVEYIGSGQKQDDM  91

Query  1165  LLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDW  986
             +L VPEG  AVRLG DA I+  ++ ++ T YS++F  ARTCAQ ERLNVSV+  S     
Sbjct  92    ILAVPEGACAVRLGNDATIRQKLEVIRKTTYSITFCAARTCAQAERLNVSVAAES-----  146

Query  985   GMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRR  806
             G+LP+QT+Y+S GWDSY++AF A        +HNP  E +PACGPLID +A+K+LNPP  
Sbjct  147   GVLPIQTVYTSSGWDSYAYAFRARHSTAWFSIHNPGHEDNPACGPLIDFIAIKALNPPPL  206

Query  805   RRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVKYIDSDHFSV  629
              +GNML+NG+FEEGP+IF +T WGVL+PP  EDD  PLPGW++ S  K VKY+D+ H +V
Sbjct  207   AQGNMLRNGDFEEGPFIFPDTAWGVLVPPMSEDDVSPLPGWMVMSDTKVVKYVDAAHHAV  266

Query  628   PEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVP  449
             P G RAVELVAGRE+AL Q VRT PG+ Y L  SVGDA N CEG M VEA+A + TL+  
Sbjct  267   PRGARAVELVAGREAALVQDVRTVPGRRYRLSLSVGDAANGCEGPMAVEAYAARATLRTT  326

Query  448   FQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
             ++S GKG S RA   F A ++ TRV   S  +HMK D  G+LCGPV+DDV LV +R
Sbjct  327   YESLGKGGSRRAAVEFEATANLTRVVLQSYNHHMKPD--GTLCGPVVDDVSLVGLR  380



>ref|XP_002446726.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
 gb|EES11054.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
Length=378

 Score =   403 bits (1035),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 205/380 (54%), Positives = 273/380 (72%), Gaps = 15/380 (4%)
 Frame = -3

Query  1375  GIILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEY  1196
             G++L  L+      V S  PDGL+ NGNFEQGP ++QM G+RV+  ++IP WE SG+VEY
Sbjct  10    GVLLFLLVGVAAAGVASAIPDGLLPNGNFEQGPDKSQMNGSRVIGQNSIPCWETSGFVEY  69

Query  1195  IKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAV-KGTYYSLSFTFARTCAQEERLNV  1019
             I+ GQ+Q DM+L+VPEG  AVRLG DA I+  +  + +   YS++F+ ARTCAQ E+LNV
Sbjct  70    IEPGQQQNDMVLVVPEGARAVRLGNDATIRQQLPGLTRSMSYSITFSAARTCAQAEQLNV  129

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV+  S     G+LP+QT+Y+S GWDSYS+AF A   AV + +HNP  E+DPACGP+IDS
Sbjct  130   SVAAES-----GVLPVQTVYTSSGWDSYSYAFKARHTAVWLTIHNPGVEEDPACGPIIDS  184

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKA  662
             VA+K+L+PP R + NMLKNG+FEEGPY+F +  WGVL+PP  EDD  PLPGW+I S  KA
Sbjct  185   VAIKALHPPSRVKDNMLKNGDFEEGPYMFPDLAWGVLVPPMDEDDVSPLPGWMIMSDTKA  244

Query  661   VKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVE  482
             VKY+D+ HF+VP G  AVELVAG E+AL Q V+T+PG+ Y L FSVGDA N C  +++V+
Sbjct  245   VKYLDAAHFAVPHGAYAVELVAGTEAALVQEVQTKPGRSYKLSFSVGDAANGCASTLLVD  304

Query  481   AFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDD  302
             A+A +    V ++S G G  VR++  F A+++ TRV F S  ++MK D  G+LCGPV+DD
Sbjct  305   AYAARGRQPVSYESHGMGGCVRSELEFAAVANLTRVVFQSMGHYMKPD--GTLCGPVVDD  362

Query  301   VRLVSVRNPRIP*THTPKRL  242
             V LVS+  PR    H  +RL
Sbjct  363   VSLVSL--PR----HAARRL  376



>ref|XP_004978108.1| PREDICTED: uncharacterized protein LOC101762525 [Setaria italica]
Length=381

 Score =   399 bits (1026),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 202/359 (56%), Positives = 254/359 (71%), Gaps = 14/359 (4%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFEQGP +++M GTRV D  AI HWEI G+VEYI+SG  Q DM+L VPEG  A
Sbjct  34    DGLLPNGNFEQGPNKSEMNGTRVKDRDAILHWEIYGFVEYIESGHTQEDMILPVPEGDRA  93

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG DA I+  +   +  YYS++FT AR+CAQ E LNVSV+P     D+G+LP+QT+Y+
Sbjct  94    VRLGNDATIRQKLCVTRQAYYSITFTAARSCAQAEALNVSVTP-----DFGVLPIQTVYT  148

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWDSYSWAF A+  +V + +HNP  E +PACGPLIDS+A+K+L+PP     NML+NG+
Sbjct  149   SSGWDSYSWAFKAKHSSVWLSIHNPGHEDNPACGPLIDSIAIKNLHPPHHTPVNMLRNGD  208

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVKYIDSDHFSVPEGRRAVELV  599
             FEEGPYIF +  WGVL+PP  ED + PLPGW++ S  K VKY+D+ H +VP G RAVELV
Sbjct  209   FEEGPYIFPDVPWGVLVPPMSEDLYSPLPGWMVLSDTKVVKYVDAAHHAVPRGARAVELV  268

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             AG E AL Q VRT PG+ Y L FSVGD  N C GS+ V+A+AGK T +V ++S+G G   
Sbjct  269   AGMECALVQEVRTVPGRWYRLSFSVGDGANGCGGSLGVDAYAGKATTKVSYESRGTGGHR  328

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPRIP*THTPKRL  242
             R    F A  + TR+ F SS YHMK D  G+LCGPV+DDV LV+V        H  +RL
Sbjct  329   RVDLDFAAAENLTRIVFHSSNYHMKFD--GTLCGPVVDDVSLVAVHK------HAARRL  379



>ref|XP_006653558.1| PREDICTED: uncharacterized protein LOC102719203 [Oryza brachyantha]
Length=374

 Score =   399 bits (1024),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 204/368 (55%), Positives = 263/368 (71%), Gaps = 13/368 (4%)
 Frame = -3

Query  1366  LLALLCATFHL-----VISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYV  1202
             ++ALLC    L       S   DGL+ NGNFE GP ++Q+ GT V   ++IP+WEISG+V
Sbjct  8     VVALLCLLIGLPARAQADSAVNDGLLPNGNFEDGPDKSQLNGTVVTGRYSIPNWEISGFV  67

Query  1201  EYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLN  1022
             EYI+SG  + DM++ VPEG  AVRLG DA I+  +   +  YYS++F+ ARTCAQ+ERLN
Sbjct  68    EYIESGHNEKDMIVAVPEGARAVRLGNDATIRQKLSVTRRAYYSITFSAARTCAQKERLN  127

Query  1021  VSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLID  842
             VSV+P     ++G+LP+QT+Y+S GWDSYSWAF A+  AV +  HNP  E+DPACGPLID
Sbjct  128   VSVTP-----EFGVLPIQTVYTSSGWDSYSWAFKAKHSAVWLSFHNPGEEEDPACGPLID  182

Query  841   SVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LK  665
             SVA+K+L PPRR +GNMLKNG+ EEGPYIF +  WG L+PP  ED+H PLPGW+I S  K
Sbjct  183   SVAIKTLYPPRRTKGNMLKNGDLEEGPYIFPDAGWGGLVPPIFEDEHSPLPGWMIMSDTK  242

Query  664   AVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVV  485
             AVK +DS H +VP+G RAVELV GRE+AL Q V T PG+ Y L FSVGDA N C  S+ V
Sbjct  243   AVKCVDSAHHAVPQGARAVELVVGRETALVQEVATVPGRPYRLSFSVGDAGNGCRDSLAV  302

Query  484   EAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVID  305
             EA+A +  L+VP++S+G G    A+  F A+++ TRV F S  YH K D  G+LCGP++D
Sbjct  303   EAYAARAALKVPYESRGTGGHKLAQLEFAAVANLTRVVFRSFNYHTKPD--GTLCGPLVD  360

Query  304   DVRLVSVR  281
             D+ LV  R
Sbjct  361   DISLVRGR  368



>ref|XP_010067858.1| PREDICTED: uncharacterized protein LOC104454644 [Eucalyptus grandis]
 gb|KCW66091.1| hypothetical protein EUGRSUZ_G03366 [Eucalyptus grandis]
Length=369

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 245/342 (72%), Gaps = 5/342 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +GL+ NGNFE  PKR  +K T +   + +P WEI+G VEYI  G + G M   V  G++A
Sbjct  28    EGLLPNGNFEDPPKRTDLKKTVIQGKNGLPKWEINGLVEYISGGPQPGGMFFAVAHGVHA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG DA I  ++    G+ Y+L+F  +RTCAQ+E L VSV P +     G LPLQT+YS
Sbjct  88    VRLGNDASISQSIPVKPGSLYALTFGASRTCAQDEVLRVSVHPQT-----GDLPLQTLYS  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F A +    +V HNP  ++DPACGPL+D+VA+K L PPR  R N++KN  
Sbjct  143   SNGGDTYAWGFRAASNVAKVVFHNPGVQEDPACGPLLDAVAIKELFPPRPTRDNLVKNAG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP+   N++ GVL+PP  ED   PLPGWIIESLKAVK+ID  HF+VP G  AVELVA
Sbjct  203   FEEGPHRLINSSNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDKKHFNVPFGLAAVELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P K Y+L F+VGDA N C GSM+VEAFA K TL+VPFQS+GKG    
Sbjct  263   GRESAIAQMIRTLPSKCYNLTFAVGDARNGCHGSMMVEAFAAKDTLKVPFQSQGKGRFKT  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLV  290
             A  +F A+S+RTR+ F SSFYH + D+ GSLCGPV+D+VR+V
Sbjct  323   ASLKFKALSARTRLTFFSSFYHTRIDDFGSLCGPVLDEVRVV  364



>ref|NP_001141282.1| hypothetical protein precursor [Zea mays]
 gb|ACF85954.1| unknown [Zea mays]
 tpg|DAA37150.1| TPA: hypothetical protein ZEAMMB73_862661 [Zea mays]
Length=375

 Score =   397 bits (1020),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 208/380 (55%), Positives = 270/380 (71%), Gaps = 21/380 (6%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIK  1190
             +LL LL      V S  PDGL+ NGNFEQGP + QM GT V+   +IP WEISG+VEYI 
Sbjct  11    VLLFLLVG----VASANPDGLLPNGNFEQGPDKYQMNGTWVIGRKSIPCWEISGFVEYIV  66

Query  1189  SGQKQGD-MLLLVPEGIYAVRLGEDAWIKTTVKAV-KGTYYSLSFTFARTCAQEERLNVS  1016
             SGQ+Q + M++ VPEG  AVRLG DA I+  +  + +GT YS++F+ +RTCAQ E+LNVS
Sbjct  67    SGQQQDNGMVVAVPEGARAVRLGNDASIRQRLTGMTRGTSYSVTFSASRTCAQAEQLNVS  126

Query  1015  VSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSV  836
             V+P S     G+LP+QT+Y+S GWDSYS+AF A   A  +V+HNP  E+DPACGP+IDSV
Sbjct  127   VAPES-----GVLPIQTVYTSSGWDSYSYAFRARHSAAWLVIHNPGVEEDPACGPVIDSV  181

Query  835   ALKSLNPPRRR-RGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKA  662
             A+K+L+PP R  + NMLKNG+FEEGPY+F +T WGVL+PP  EDD  PLPGW + S  KA
Sbjct  182   AIKALHPPSRTAKDNMLKNGDFEEGPYVFPDTPWGVLVPPMDEDDVSPLPGWTVMSDTKA  241

Query  661   VKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVE  482
             VKY+D+ HF+VP G RAVELVAG E+AL Q VRT PG+ Y L FS GDA + C G++ V+
Sbjct  242   VKYLDAAHFAVPRGSRAVELVAGTEAALVQEVRTTPGRSYTLSFSAGDAADGCAGALRVD  301

Query  481   AFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDD  302
             A+A +  L V ++S+G G  VR +  F A+++ TRV F S  ++MK D  G+LCGPV+DD
Sbjct  302   AYAARGRLPVSYESRGTGGFVRNELEFAAVANLTRVVFQSMGHYMKPD--GTLCGPVVDD  359

Query  301   VRLVSVRNPRIP*THTPKRL  242
             V LV+V        H  +RL
Sbjct  360   VSLVAVHK------HAARRL  373



>ref|XP_003580051.1| PREDICTED: uncharacterized protein LOC100841904 [Brachypodium 
distachyon]
Length=373

 Score =   397 bits (1020),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 203/378 (54%), Positives = 261/378 (69%), Gaps = 15/378 (4%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             + LL L+      V++ T DGL+ NG F QGP ++QM GT V   HA+P+WE+SG+VEYI
Sbjct  8     MALLLLVGMAAPAVLAVT-DGLLPNGRFSQGPDKSQMNGTVVTGKHAMPNWELSGFVEYI  66

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
             +SG K+ DMLL VP G  AVRLG DA I+  +   +  YYS++F  AR+CAQ E+LNVSV
Sbjct  67    ESGHKEADMLLAVPVGANAVRLGNDATIRQQLSVTRKAYYSITFVAARSCAQAEKLNVSV  126

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
              P     ++G+LP+QT+Y+S GWDSYSWAF A    V + +HN   E+DPACGPLI +VA
Sbjct  127   DP-----EFGVLPIQTVYTSTGWDSYSWAFKARRSTVTLSIHNTGIEEDPACGPLIIAVA  181

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVK  656
             +K+L  P+R +GNML+NG+FE GPYIF +T WGV++PP +ED H PLPGW+I S  K VK
Sbjct  182   IKALALPQRIKGNMLRNGDFELGPYIFPDTPWGVMVPPILEDVHSPLPGWMIMSHTKVVK  241

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             Y+D+ H +VP G  AVELVAGRESAL Q V T  G  Y L F VGDA N C GS+ VE +
Sbjct  242   YVDTPHHAVPHGAYAVELVAGRESALVQEVGTVEGWTYRLSFFVGDAGNGCTGSLAVEVY  301

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             A   +L+  ++S GKG S   K +FTA+ + TRV F SS +HMKSD   +LCGPV+D+V 
Sbjct  302   AAGASLRAAYESDGKGGSKPFKLQFTAVGNSTRVVFQSSNHHMKSD--ATLCGPVVDNVS  359

Query  295   LVSVRNPRIP*THTPKRL  242
             LV VR P       P+RL
Sbjct  360   LVGVRVP------APRRL  371



>emb|CDX87297.1| BnaA07g35760D [Brassica napus]
Length=342

 Score =   395 bits (1016),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 196/345 (57%), Positives = 243/345 (70%), Gaps = 35/345 (10%)
 Frame = -3

Query  1309  LVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAVR  1130
             L+ NGNFE GPK +Q+KG+ V    A+P+WEI+G VEYIK+GQKQ DM+L+VPEG  AVR
Sbjct  29    LLPNGNFEMGPKPSQLKGSVVKGRTAVPNWEITGLVEYIKAGQKQDDMVLVVPEGSSAVR  88

Query  1129  LGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSSD  950
             LG +A I   +    G  YS++F+ ARTCAQ+ERLN+SV+  S     G++P+QTMY SD
Sbjct  89    LGNEASISQKISVRSGRLYSVTFSAARTCAQDERLNISVTHES-----GVIPIQTMYGSD  143

Query  949   GWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNFE  770
             GWDSYSWAF A    ++I +HNP  E+ PACGPLID+VA+K+L PPR    N++KNGNFE
Sbjct  144   GWDSYSWAFKAGGPEIEIRIHNPGREEHPACGPLIDAVAIKALFPPRFSGNNLIKNGNFE  203

Query  769   EGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAGR  590
             EGPY+F+   WGVLIPP +EDD+ PLPGW+IESLKAVKY+D  HF VPEG RA+ELV G+
Sbjct  204   EGPYVFAKAKWGVLIPPFIEDDNSPLPGWMIESLKAVKYVDKAHFFVPEGHRAIELVGGK  263

Query  589   ESALAQVVRTRP-GKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRA  413
             ESA++Q+VRT    K Y L F VGDA +ACEG M VEAFAG                   
Sbjct  264   ESAVSQIVRTTSLNKFYALSFKVGDARDACEGPMAVEAFAG-------------------  304

Query  412   KHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
                        R   + +FYHMK+D+SGSLCGPVIDDVRLV+VR 
Sbjct  305   ----------GRKILVDTFYHMKNDHSGSLCGPVIDDVRLVAVRT  339



>gb|EMS58461.1| hypothetical protein TRIUR3_29087 [Triticum urartu]
Length=336

 Score =   395 bits (1015),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 241/345 (70%), Gaps = 38/345 (11%)
 Frame = -3

Query  1309  LVANGNFEQGPKRNQM-KGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAV  1133
             L+ NGNFE GP ++++  GT V    AIP WE SG+VEYI+SG KQGDMLL+VP+G YAV
Sbjct  20    LLPNGNFELGPAKSELVNGTVVKGGKAIPRWETSGFVEYIESGHKQGDMLLVVPQGAYAV  79

Query  1132  RLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSS  953
             RLG DA I   +   +G+YY+++F+ ARTCAQ ERLNVSVSP S     G+LP+QT+Y S
Sbjct  80    RLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSPES-----GVLPMQTIYGS  134

Query  952   DGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNF  773
             +GWDSY+WAF A+ + V++VLHNP  E+DPACGPL+D+VA+++L PP   +GNMLKNG F
Sbjct  135   NGWDSYAWAFKAKLDVVELVLHNPGVEEDPACGPLVDAVAIRTLYPPTLSKGNMLKNGGF  194

Query  772   EEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAG  593
             EEGPY   N +WGVL+PPN+EDDH PLP W+I S KAVKY+D+ HF VPEG RAVELV G
Sbjct  195   EEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFKVPEGARAVELVGG  254

Query  592   RESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRA  413
             +ESAL Q VRT PG  Y L F+VGD+ + C G                            
Sbjct  255   KESALVQEVRTVPGWAYRLSFAVGDSADGCMGD---------------------------  287

Query  412   KHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
                F A+  RTRV F S+FYHMK+D  G+LCGPVIDD +LV +R 
Sbjct  288   ---FVAVRDRTRVVFQSAFYHMKAD--GTLCGPVIDDAKLVGLRK  327



>ref|XP_009630913.1| PREDICTED: uncharacterized protein LOC104120779 [Nicotiana tomentosiformis]
Length=367

 Score =   396 bits (1018),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 250/345 (72%), Gaps = 6/345 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPK-RNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             +GL+ NGNFE+ PK ++  K T +V  +A+P WEI+G+VEYI  G + G M   V  G++
Sbjct  27    EGLLPNGNFEEQPKPKDLKKKTVLVGKYALPKWEINGFVEYISGGPQPGGMYFPVAHGVH  86

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG DA I  T+   KG+ Y+L+F  +RTCAQ+E L VSV P +     G LPLQT+Y
Sbjct  87    AVRLGNDASISQTIPVKKGSLYALTFGASRTCAQDEVLRVSVPPQT-----GDLPLQTLY  141

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
             SS+G D+Y+W F A +  V ++ HNP  ++DPACGPL+D+VA+K L PPR  R N++KN 
Sbjct  142   SSNGGDTYAWGFYATSNVVKVIFHNPGVQEDPACGPLLDAVAIKELFPPRPTRVNLVKNP  201

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
              FEEGP++  N++ GVL+PP  ED   PLPGWIIESLKAVK++DS HF+VP GR A+EL+
Sbjct  202   GFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFLDSAHFNVPFGRAAMELL  261

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             AGRESA+AQ++RT P KVY   F+VGDA N C G M+VEAFA K T +VPF+S+GKG   
Sbjct  262   AGRESAIAQIIRTVPKKVYTFAFTVGDAKNGCHGDMMVEAFAAKETFKVPFKSQGKGSFK  321

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
                 +FTAI+ RTR+ F SSFYH K ++ G+LCGPV+D+V++  V
Sbjct  322   TVSFKFTAIADRTRITFYSSFYHTKINDYGALCGPVVDEVKVTPV  366



>ref|XP_010257158.1| PREDICTED: uncharacterized protein LOC104597378 [Nelumbo nucifera]
Length=367

 Score =   396 bits (1017),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 241/344 (70%), Gaps = 5/344 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+GP R+ MK T +V  +++P WEI+G VEYI  G + G     VP G++A
Sbjct  28    DGLLPNGNFEEGPSRSNMKKTVIVGKYSLPKWEINGVVEYISGGPQPGSFFFAVPRGVHA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I  TV    G++YSL+F   RTCAQ+E L VSV P S     G LPLQT+YS
Sbjct  88    VRLGNEASISQTVAVKPGSFYSLTFGATRTCAQDEVLRVSVPPFS-----GDLPLQTLYS  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+WAF A +    +  HNP  ++DP CGPL+D+VA+K + PP   RGN++KNG+
Sbjct  143   SNGGDTYAWAFKATSNVAKVTFHNPGIQEDPTCGPLLDAVAIKEIIPPLHTRGNLVKNGD  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FE GP++F N + GVL+PP  +D   PLPGW + SLKAVKYIDS HFSVP G  A+ELVA
Sbjct  203   FEYGPHLFKNFSTGVLLPPKQKDHVSPLPGWTVVSLKAVKYIDSKHFSVPSGFAAIELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA++QV+RT PGK Y+L F+VGDA N C GSM+VEAFA K TL+VPFQ+ G      
Sbjct  263   GRESAISQVLRTVPGKSYNLTFTVGDAKNGCHGSMMVEAFAAKETLKVPFQAHGGSKFKT  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
                +F A+  RTR+ F S FYH K  + G+LCGPV+D VR+  V
Sbjct  323   VSLKFKAVEPRTRITFYSGFYHTKLHDYGTLCGPVLDHVRVFPV  366



>emb|CDP07813.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   396 bits (1018),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 246/345 (71%), Gaps = 5/345 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +GL+ NGNFE   K + +K T ++  +A+P WEISG VEYI  G + G M   V  G++A
Sbjct  37    EGLLPNGNFEDPIKPSDIKKTTLIGKYALPKWEISGKVEYIHGGPQPGGMYFAVAHGVHA  96

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I  T+    GT Y+L+F  ++TCAQ E L VSV P +     G LPLQT+YS
Sbjct  97    VRLGNEASISQTIPVKIGTLYALTFGASKTCAQNEVLRVSVPPQT-----GDLPLQTLYS  151

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y + F+       I  HNP  ++DPACGPL+D+VA+K L+PP+  R N++KNG+
Sbjct  152   SNGGDTYGFGFIPNTNYAKITFHNPGIQEDPACGPLLDAVAIKELSPPKPTRANLVKNGD  211

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGPY   N++ GVL+PP+ ED   PLPGWIIESLKAVK+ID+ HF+VP GR A+EL+ 
Sbjct  212   FEEGPYRLINSSHGVLLPPSQEDRTSPLPGWIIESLKAVKFIDAMHFNVPSGRAAIELLG  271

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRES +AQ++RT P K Y+L FSVGD  N C GSM+VEAFA K TL+VPFQS GKG    
Sbjct  272   GRESVIAQIIRTVPNKEYNLTFSVGDGKNGCHGSMMVEAFAAKSTLKVPFQSVGKGQYKT  331

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
                +FTAIS+RTR+ F SSFYH K D+ G+LCGPV+D+V++V+ R
Sbjct  332   VSFKFTAISARTRLTFFSSFYHTKIDDYGALCGPVLDNVKVVTAR  376



>emb|CAH67377.1| OSIGBa0159F11.1 [Oryza sativa Indica Group]
 emb|CAH67293.1| OSIGBa0103O01.11 [Oryza sativa Indica Group]
 gb|EAY94677.1| hypothetical protein OsI_16456 [Oryza sativa Indica Group]
Length=371

 Score =   396 bits (1017),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 193/349 (55%), Positives = 249/349 (71%), Gaps = 8/349 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+ P ++Q+ GTRV+  +AIP WEISG+VEYI SGQ QGDMLL VPEG YA
Sbjct  26    DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I+  +   +G +YS++F+ ARTCAQ E LN++V+P     + G +P+QT+Y+
Sbjct  86    VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP-----EIGEVPIQTVYT  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWDSYSWAF A    V +++HNP    D ACGPLIDS A+K+L  P   + N+LKNG 
Sbjct  141   SSGWDSYSWAFKARRSDVSLIVHNPGVTDDAACGPLIDSFAIKTLQSPPSTKDNLLKNGG  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKYIDSDHFSVPEGRRAVELV  599
             FEEGPYIF NT+WGVL+PP  EDD+ PL  W I+   K+VKY+D+ H++VP G RAVELV
Sbjct  201   FEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTIMGYTKSVKYVDAAHYAVPGGARAVELV  260

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             AG E+AL Q V T PG+ Y L FSVGDA + C GSM V+A+    +++VP++S+G+G   
Sbjct  261   AGMEAALVQEVCTVPGRSYRLEFSVGDAGDGCVGSMSVQAYVSHGSVKVPYESQGRGGYK  320

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             R    FTA   RTRV F+S  Y MK D  G+LCGPV+DD  +V V N R
Sbjct  321   RGVLEFTATDKRTRVVFVSMAYIMKPD--GTLCGPVVDDASVVGVHNHR  367



>tpg|DAA37149.1| TPA: hypothetical protein ZEAMMB73_398073 [Zea mays]
Length=382

 Score =   395 bits (1016),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 201/370 (54%), Positives = 254/370 (69%), Gaps = 22/370 (6%)
 Frame = -3

Query  1345  TFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDM  1166
             T  L      DGL+ NGNFE GP ++ + GTRV++ +++P+WEI G+VEYI SGQKQ DM
Sbjct  20    TARLASGVVSDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEILGFVEYIGSGQKQDDM  79

Query  1165  LLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDW  986
             +L VPEG  AVRLG DA I+  +  ++ T YS++F  ARTCAQ ERL VSV+  S     
Sbjct  80    ILPVPEGACAVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVAAES-----  134

Query  985   GMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRR  806
             G+LP+QT+Y+S+GWDSYS+AF A        +HNP  E DPACGPLIDSVA+K+LNPP  
Sbjct  135   GVLPIQTVYTSNGWDSYSYAFRARHSTAWFSIHNPGHEDDPACGPLIDSVAIKALNPPHL  194

Query  805   RR--------------GNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-  671
              +               NML+NG+FEEGP IF +T WGVL+PP  EDD  PLPGW++ S 
Sbjct  195   TKESHTAGLSQRSEHADNMLRNGDFEEGPVIFPDTAWGVLVPPMSEDDVSPLPGWMVMSD  254

Query  670   LKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSM  491
              K VKY+D+ H +VP G RAVELVAGRE+AL Q VRT PG+ Y L  +VGDA N CEG M
Sbjct  255   TKVVKYVDAAHHAVPRGARAVELVAGREAALVQEVRTVPGRHYRLSLAVGDAANGCEGPM  314

Query  490   VVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPV  311
              VEA+A + TL+  ++S+G G S RA   FTAI++ TRV   S  +HMK D  G+LCGPV
Sbjct  315   AVEAYAARATLRTTYESRGNGGSKRAVVDFTAIANLTRVVLQSYNHHMKPD--GTLCGPV  372

Query  310   IDDVRLVSVR  281
             +DDV LV +R
Sbjct  373   VDDVSLVGLR  382



>ref|XP_004149718.1| PREDICTED: uncharacterized protein LOC101216438 [Cucumis sativus]
 ref|XP_004164153.1| PREDICTED: uncharacterized LOC101216438 [Cucumis sativus]
 gb|KGN58580.1| hypothetical protein Csa_3G689790 [Cucumis sativus]
Length=368

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 250/343 (73%), Gaps = 5/343 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +GL+ANGNFE+ P +  +K T ++  +++P WEI+G+VEYI  G + G M   V  G++A
Sbjct  29    EGLLANGNFEEPPAQTNLKKTVIIGKNSLPSWEINGFVEYISGGPQPGGMFFPVAHGVHA  88

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I   +   KG+ Y+L+F  +RTCAQ+E L+V V P +     G LPLQT+YS
Sbjct  89    VRLGNEASISQIINVKKGSLYALTFGASRTCAQDEVLSVLVPPQN-----GSLPLQTLYS  143

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             SDG D Y++ F+A+++ V +  HNP  ++DPACGPL+D+VA+K L  P   R N+++N +
Sbjct  144   SDGGDVYAYGFVAQSDLVKVTFHNPGVQEDPACGPLLDAVAIKELARPLPTRDNLVRNPS  203

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FE GP+   N+T GVL+PP  ED   PLPGWIIESLKAVK+IDS HF+VP G  A+ELVA
Sbjct  204   FEVGPHRLVNSTNGVLLPPRQEDVTSPLPGWIIESLKAVKFIDSKHFNVPVGLAAIELVA  263

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P KVY L F VGDA N C GSM+VEAFA K T++VPFQS+GKG+   
Sbjct  264   GRESAVAQIIRTIPNKVYSLTFKVGDAKNGCHGSMMVEAFAAKETVKVPFQSQGKGLYKN  323

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVS  287
             A  +F A S RTR+ F SS+YH ++D+ GSLCGPV+DDVR++S
Sbjct  324   AILKFKATSRRTRITFFSSYYHTRTDDFGSLCGPVLDDVRVIS  366



>ref|XP_004229647.1| PREDICTED: uncharacterized protein LOC101251618 [Solanum lycopersicum]
Length=402

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 246/345 (71%), Gaps = 6/345 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             +GL+ NGNFE+ PK   +K   V+   +A+P WEI+G VEYI  G + G M   V  G++
Sbjct  62    EGLLPNGNFEELPKAKDLKKKTVLQGKYALPKWEINGLVEYISGGPQPGGMYFAVAHGVH  121

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG +A I  T+   KG+ Y+L+F  +RTCAQEE L VSV P +     G LPLQT+Y
Sbjct  122   AVRLGNEASISQTIPVKKGSLYALTFGASRTCAQEEVLRVSVPPQT-----GDLPLQTLY  176

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
             SS+G D+Y+W F A +  V I  HNP  ++DPACGPL+D+VA+K L PPR  R N++KN 
Sbjct  177   SSNGGDTYAWGFYATSNVVKITFHNPGVQEDPACGPLLDAVAIKELFPPRPTRVNLVKNA  236

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
              FEEGP++  N++ GVL+PP  ED   PLPGWIIESLKAVK++DS HF+VP G+ AVEL+
Sbjct  237   GFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFLDSAHFNVPFGQAAVELL  296

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             AGRESALAQ++RT P KVY   FSVGDA N C G M+VEAFA K T +VPF+S+GKG   
Sbjct  297   AGRESALAQIIRTVPKKVYAFTFSVGDAKNGCHGDMMVEAFAAKETFKVPFKSQGKGSFK  356

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
                 +FTAI+ RTR+ F SSFYH K ++ G+LCGPV+D+V++  V
Sbjct  357   TVSFKFTAIADRTRITFYSSFYHTKINDYGALCGPVVDEVKVTPV  401



>ref|XP_002446727.1| hypothetical protein SORBIDRAFT_06g021310 [Sorghum bicolor]
 gb|EES11055.1| hypothetical protein SORBIDRAFT_06g021310 [Sorghum bicolor]
Length=380

 Score =   395 bits (1014),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 207/381 (54%), Positives = 268/381 (70%), Gaps = 17/381 (4%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             ++LL L+     +      DGL+ NGNFE GP ++ + GTRV+  ++IP+WEISG+VEYI
Sbjct  11    VLLLFLVGVAARVASGVVTDGLLPNGNFEFGPAKSDLNGTRVMGQNSIPNWEISGFVEYI  70

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
              SGQ+Q DM+L VPEG YAVRLG DA I+  +   + T YS++F  ARTCAQ E+LNVSV
Sbjct  71    GSGQQQDDMILPVPEGAYAVRLGNDATIRQKLSVNRKTTYSITFCAARTCAQAEQLNVSV  130

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +  S     G+LP+QT+Y+S GWDSYS+AF A      + +HNP+ E DPACGPLIDSVA
Sbjct  131   AAES-----GVLPVQTVYTSSGWDSYSYAFRARHSTAWLTIHNPSHEDDPACGPLIDSVA  185

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIES-LKAVK  656
             +K+LNPP   +GN+L+NG+FEEGP+IF  T WGVL+PP  EDD  PLPGW++ S  K VK
Sbjct  186   IKALNPPHHTKGNLLRNGDFEEGPFIFPGTAWGVLVPPMDEDDVSPLPGWMVMSDTKVVK  245

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVR-TRPGKVYDLYFSVGDANNACEGSMVVEA  479
             Y+D+ H +VP G RAVELVAGRE+AL Q VR T PG+ Y L FSVGDA N CEGS+ VEA
Sbjct  246   YVDAAHHAVPRGARAVELVAGREAALVQEVRGTVPGRRYRLSFSVGDAGNGCEGSLAVEA  305

Query  478   FAGKLTLQVPFQSKGKGVSVR--AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVID  305
             +A + T +  ++S+G G S++  A   F AI++ TRV F S  +HMK D  G+LCGPV+D
Sbjct  306   YAARATARATYESRGTGGSIKRAAVVEFAAIANLTRVVFQSYNHHMKPD--GTLCGPVVD  363

Query  304   DVRLVSVRNPRIP*THTPKRL  242
             DV LV +R       H  +RL
Sbjct  364   DVSLVGLRK------HAARRL  378



>emb|CAD41548.2| OSJNBb0091E11.18 [Oryza sativa Japonica Group]
Length=371

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/349 (55%), Positives = 249/349 (71%), Gaps = 8/349 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+ P ++Q+ GTRV+  +AIP WEISG+VEYI SGQ QGDMLL VPEG YA
Sbjct  26    DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I+  +   +G +YS++F+ ARTCAQ E LN++V+P     + G +P+QT+Y+
Sbjct  86    VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP-----EIGEVPIQTVYT  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWDSYSWAF A    V +++HNP    D ACGPLIDS A+K+L  P   + N+LKNG 
Sbjct  141   SSGWDSYSWAFKARRSDVSLIVHNPGVTDDAACGPLIDSFAIKTLQSPPSTKDNLLKNGG  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKYIDSDHFSVPEGRRAVELV  599
             FEEGPYIF NT+WGVL+PP  EDD+ PL  W I+   K+VKY+D+ H++VP G RAVELV
Sbjct  201   FEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTIMGYTKSVKYVDAAHYAVPGGARAVELV  260

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             AG E+AL Q V T PG+ Y L FSVGDA + C GSM V+A+    +++VP++S+G+G   
Sbjct  261   AGMEAALVQEVCTVPGRSYRLEFSVGDAGDGCVGSMSVQAYVSHGSVKVPYESQGRGGYK  320

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             R    FTA   RTRV F+S  Y MK D  G+LCGPV+DD  +V V + R
Sbjct  321   RGVLEFTATDKRTRVVFVSMAYTMKPD--GTLCGPVVDDASVVGVHSHR  367



>ref|NP_001053190.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAF15104.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAG93696.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/349 (55%), Positives = 249/349 (71%), Gaps = 8/349 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+ P ++Q+ GTRV+  +AIP WEISG+VEYI SGQ QGDMLL VPEG YA
Sbjct  32    DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  91

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I+  +   +G +YS++F+ ARTCAQ E LN++V+P     + G +P+QT+Y+
Sbjct  92    VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP-----EIGEVPIQTVYT  146

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S GWDSYSWAF A    V +++HNP    D ACGPLIDS A+K+L  P   + N+LKNG 
Sbjct  147   SSGWDSYSWAFKARRSDVSLIVHNPGVTDDAACGPLIDSFAIKTLQSPPSTKDNLLKNGG  206

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKYIDSDHFSVPEGRRAVELV  599
             FEEGPYIF NT+WGVL+PP  EDD+ PL  W I+   K+VKY+D+ H++VP G RAVELV
Sbjct  207   FEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTIMGYTKSVKYVDAAHYAVPGGARAVELV  266

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             AG E+AL Q V T PG+ Y L FSVGDA + C GSM V+A+    +++VP++S+G+G   
Sbjct  267   AGMEAALVQEVCTVPGRSYRLEFSVGDAGDGCVGSMSVQAYVSHGSVKVPYESQGRGGYK  326

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRNPR  272
             R    FTA   RTRV F+S  Y MK D  G+LCGPV+DD  +V V + R
Sbjct  327   RGVLEFTATDKRTRVVFVSMAYTMKPD--GTLCGPVVDDASVVGVHSHR  373



>gb|KDP43556.1| hypothetical protein JCGZ_16843 [Jatropha curcas]
Length=365

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/344 (55%), Positives = 246/344 (72%), Gaps = 5/344 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +G + NGNFE+ PK + +  T +    A+P WEI+G VEYI +G + G M   V  G++A
Sbjct  26    EGFLNNGNFEEKPKPSDINKTVLKGKTALPGWEINGRVEYISAGPQPGGMYFAVAHGVHA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG DA I  T+    G+ Y+L+F  +RTCAQEE L VSV P S     G LPLQT+YS
Sbjct  86    VRLGNDASISQTITVKPGSLYALTFGASRTCAQEEVLRVSVPPLS-----GDLPLQTLYS  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F+A++    ++ HNP  ++DPACGPLID+VA+K L PPR  R N++KN  
Sbjct  141   SNGGDTYAWGFIAKSTVAKVIFHNPGVQEDPACGPLIDAVAIKELFPPRPTRYNLVKNPG  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP++F N++ GVL+PP   D   PLPGWIIESLKAVK+IDS HF+VP G  AVELVA
Sbjct  201   FEEGPHLFVNSSNGVLLPPRQLDLTSPLPGWIIESLKAVKFIDSKHFNVPFGLAAVELVA  260

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P KVY L FSVGDA N C GSM+VEAFA K T +VPF+S+GKG    
Sbjct  261   GRESAIAQILRTIPNKVYGLTFSVGDAKNGCHGSMMVEAFAAKDTFKVPFESQGKGKFKT  320

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
                +F A+S+RTR+ F SS+YH + D+ GSLCGPV+D VR+  +
Sbjct  321   VSFKFKAVSARTRITFYSSYYHTRIDDFGSLCGPVLDQVRVFPI  364


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 76/187 (41%), Gaps = 32/187 (17%)
 Frame = -3

Query  802  RGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSD------  641
            R   L NGNFEE P           I   V      LPGW I     V+YI +       
Sbjct  25   REGFLNNGNFEEKPKPSD-------INKTVLKGKTALPGWEING--RVEYISAGPQPGGM  75

Query  640  HFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMV----VEAFA  473
            +F+V  G  AV L  G +++++Q +  +PG +Y L F    A+  C    V    V   +
Sbjct  76   YFAVAHGVHAVRL--GNDASISQTITVKPGSLYALTFG---ASRTCAQEEVLRVSVPPLS  130

Query  472  GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
            G L LQ  + S G          F A S+  +V F     H         CGP+ID V +
Sbjct  131  GDLPLQTLYSSNGGDTYAWG---FIAKSTVAKVIF-----HNPGVQEDPACGPLIDAVAI  182

Query  292  VSVRNPR  272
              +  PR
Sbjct  183  KELFPPR  189



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/369 (52%), Positives = 259/369 (70%), Gaps = 17/369 (5%)
 Frame = -3

Query  1363  LALLCATFHL---VISFTP---------DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHW  1220
             +ALL  +F L   +IS +P         +GL+ANGNFE+ PK + +K T ++  +A+P W
Sbjct  1     MALLLVSFTLALSLISTSPAFAVAPKPFEGLLANGNFEEPPKPSSLKKTVLIGKNALPKW  60

Query  1219  EISGYVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCA  1040
             EI+G+VEYI  G + G M   V  G++AVRLG +A I  T+K   G+ Y+L+F  +RTCA
Sbjct  61    EINGFVEYISGGPQPGGMYFAVAHGVHAVRLGNEASISQTIKVKPGSLYALTFGASRTCA  120

Query  1039  QEERLNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPA  860
             QEE L VSV P +     G LPLQT+YSS+G D+Y+W F A +  V +  HNP  ++DPA
Sbjct  121   QEEVLRVSVPPQA-----GDLPLQTLYSSNGGDTYAWGFKATSNTVKVTFHNPGIQEDPA  175

Query  859   CGPLIDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWI  680
             CGPL+D++A+K L P    R N+++N  FEE P+   N++ GVL+PP   D   PLPGWI
Sbjct  176   CGPLLDAIAIKELFPVLPTRDNLVRNPGFEEAPHRLMNSSHGVLLPPKQLDATSPLPGWI  235

Query  679   IESLKAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACE  500
             IESLKAVK+ID+ HF+VP G+ AVELVAGRESA+AQV+RT P K+Y L F++GDA N C 
Sbjct  236   IESLKAVKFIDAKHFNVPFGKGAVELVAGRESAIAQVLRTVPNKLYSLSFTIGDARNGCH  295

Query  499   GSMVVEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLC  320
             GSM+VEAFAGK TL+VPF S+GKG    A  +F A S RTR+ F SSFYH ++D+ G+LC
Sbjct  296   GSMMVEAFAGKDTLKVPFNSQGKGGFKNASFKFKATSFRTRITFFSSFYHTRTDDYGALC  355

Query  319   GPVIDDVRL  293
             GP++D+V++
Sbjct  356   GPILDEVKV  364



>ref|XP_009758716.1| PREDICTED: uncharacterized protein LOC104211372 [Nicotiana sylvestris]
Length=366

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/345 (55%), Positives = 248/345 (72%), Gaps = 6/345 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPK-RNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             +GL+ NGNFE+ PK ++  K T +V  +A+P WEI+G VEYI  G + G M   V  GI+
Sbjct  26    EGLLPNGNFEEQPKPKDLKKKTVLVGKYALPKWEINGLVEYISGGPQPGGMYFPVAHGIH  85

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG DA I  T+   KG+ Y+L+F  +RTCAQ+E L VSV P +     G LPLQT+Y
Sbjct  86    AVRLGNDASISQTIPVKKGSLYALTFGASRTCAQDEVLRVSVPPQT-----GDLPLQTLY  140

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
             SS+G D+Y+W F A +  V +  HNP  ++DPACGPL+D+VA+K L PPR  R N++KN 
Sbjct  141   SSNGGDTYAWGFYATSNVVKVSFHNPGVQEDPACGPLLDAVAIKELFPPRPTRVNLVKNP  200

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
              FEEGP++  N++ GVL+PP  ED   PLPGWIIESLKAVK++DS HF+VP G+ AVEL+
Sbjct  201   GFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFLDSAHFNVPFGQAAVELL  260

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
             AGRESA+AQ++RT P KVY   F+VGDA N C G M+VEAFA K T +VPF+S+GKG   
Sbjct  261   AGRESAIAQIIRTVPKKVYAFAFTVGDAKNGCHGDMMVEAFAAKETFKVPFKSQGKGSFK  320

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
                 +FTAI+ RTR+ F SS+YH K ++ GSLCGPV+D+V++  V
Sbjct  321   TVSFKFTAIADRTRITFYSSYYHTKINDYGSLCGPVVDEVKVTPV  365



>dbj|BAJ96954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/366 (53%), Positives = 256/366 (70%), Gaps = 9/366 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             + LL L+C    LV S T DG++ NGNFE+ P R+QM GTRV   +AIP WE+ G VEYI
Sbjct  14    VALLLLVCMA-ALVASDTTDGILPNGNFEEAPDRSQMDGTRVTGRYAIPRWEVCGCVEYI  72

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
              SGQKQGDM+L VPEG YA+RLG DA ++  +    GT+YS++F+ ARTCAQ ERLNV+V
Sbjct  73    CSGQKQGDMVLPVPEGAYAMRLGNDASVQQQLSVTPGTHYSITFSAARTCAQAERLNVTV  132

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
             +  S     G LP+QT+Y+S GWDSYSWAF A+   V + +HNP  ++D  CGPL+DS A
Sbjct  133   AAES-----GQLPIQTVYTSSGWDSYSWAFEAKDNVVLLTVHNPGYDEDATCGPLVDSFA  187

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVK  656
             +K+L PP+    NMLKNG+FEEGPYI   T+ GV++P   ED + PL  W I+ S K+V+
Sbjct  188   IKTLLPPQSNDYNMLKNGDFEEGPYICPGTSCGVMVPAMGEDRYSPLSPWTIMSSTKSVR  247

Query  655   YIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAF  476
             Y+DS H++VP+G RAV+LV G ESAL Q V T PG  Y + FSVGDA + C GS+ VEA+
Sbjct  248   YVDSAHYAVPQGARAVQLVFGAESALVQEVGTMPGLSYKMEFSVGDAADGCTGSLAVEAY  307

Query  475   AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             A    ++VP++S+G G   R    FTA   RTRV F+S+ Y+MK D  G++CGPV+DD  
Sbjct  308   AANGRVKVPYESQGTGGHTRGVLEFTATEDRTRVVFVSASYNMKPD--GTVCGPVVDDAS  365

Query  295   LVSVRN  278
             LV V++
Sbjct  366   LVCVQS  371



>ref|XP_010534242.1| PREDICTED: uncharacterized protein LOC104809851 [Tarenaya hassleriana]
Length=365

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 244/344 (71%), Gaps = 5/344 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +G +ANGNFE+ PK++ MK T ++  +A+P WEI+G VEYI  G + G M   V  G++A
Sbjct  26    EGYLANGNFEEQPKKSDMKKTVLIGKNALPKWEITGMVEYISGGPQPGGMFFPVAHGVHA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I   ++   G+ Y+L+F  +RTCAQ+E L VSV P S     G LPLQT+YS
Sbjct  86    VRLGNEASISQKIQVKPGSLYALTFGASRTCAQDEVLRVSVLPQS-----GDLPLQTLYS  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S G D Y+W F+ + + V +  HNP  ++DPACGPL+D+VA+K L  P   R N+++N  
Sbjct  141   SFGGDVYAWGFIPKTQEVTVTFHNPGVQEDPACGPLLDAVAIKKLAFPLPTRDNLVRNPG  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP+   N+T GVL+PP  ED   PLPGWIIESLKAVK+IDS HF+VP G  A+ELVA
Sbjct  201   FEEGPHRLVNSTGGVLLPPKQEDSTSPLPGWIIESLKAVKFIDSKHFNVPYGEAAIELVA  260

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQV+RT P KVY L F+VGDA N C GSMVVEAFAGK TL+VP  S G G    
Sbjct  261   GKESAIAQVIRTVPNKVYSLSFAVGDARNGCHGSMVVEAFAGKDTLKVPHNSVGAGHYKT  320

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
             A  +F A+ +RTR+ F S++YH K D+ GSLCGP+IDD+R+V V
Sbjct  321   ASLKFKALEARTRITFFSTYYHTKKDDFGSLCGPIIDDIRVVPV  364



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 252/368 (68%), Gaps = 11/368 (3%)
 Frame = -3

Query  1369  ILLALLCATF------HLVISFTPDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISG  1208
             +L  LL  +F      +  +    DGL+ NGNFE+ PK   +K T ++  +A+P WEI+G
Sbjct  4     VLFLLLAFSFMFTNPAYAAVQVPLDGLLNNGNFEEPPKPTNLKKTVLIGKYALPKWEING  63

Query  1207  YVEYIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEER  1028
             +VEYI  G + G M   V  G++AVRLG +A I  T+K   G+ Y+L+F  +RTCAQEE 
Sbjct  64    FVEYISGGPQPGGMYFSVAHGVHAVRLGNEASISQTIKVKPGSLYALTFGASRTCAQEEV  123

Query  1027  LNVSVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPL  848
             L VSV P +     G LPLQT+YSS+G D+Y+W F A +  V +  HNP  ++DPACGPL
Sbjct  124   LRVSVPPQA-----GDLPLQTLYSSNGGDTYAWGFRATSNVVKVTFHNPGVQEDPACGPL  178

Query  847   IDSVALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESL  668
             +D++A+K L P    R N+++N  FEE P+   N++ GVL+PP   D   PLPGWIIESL
Sbjct  179   LDAIAIKELFPALPTRDNLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSPLPGWIIESL  238

Query  667   KAVKYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMV  488
             KAVK+IDS HF+VP G+ AVELVAGRESA+AQV+RT P K+YDL F VGDA N C GSM+
Sbjct  239   KAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNGCHGSMM  298

Query  487   VEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVI  308
             VEAFAGK TL+VPF S+GKG    A  +F A S RTR+ F SSFYH + D+ G+LCGP++
Sbjct  299   VEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGALCGPIL  358

Query  307   DDVRLVSV  284
             D VR+  V
Sbjct  359   DQVRVYPV  366



>ref|XP_002517797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44604.1| conserved hypothetical protein [Ricinus communis]
Length=365

 Score =   390 bits (1003),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 190/341 (56%), Positives = 243/341 (71%), Gaps = 5/341 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +G + NGNFEQ PK   +  T +   +A+P WE +G VEYI +G + G M   V  G++A
Sbjct  26    EGFLKNGNFEQKPKPRDINKTVLKGKNALPGWETNGLVEYISAGPQPGGMYFAVAHGVHA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I  T+    G+ Y+L+F  +RTCAQ+E L VSV P S     G LPLQT+YS
Sbjct  86    VRLGNEASISQTLAVKAGSLYALTFGASRTCAQDEVLRVSVPPLS-----GDLPLQTLYS  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F+A++  V +  HNP  ++DPACGPL+D+VA+K L PPR  R N++KN  
Sbjct  141   SNGGDTYAWGFIAKSNVVKVTFHNPGVQEDPACGPLVDAVAIKELFPPRPTRDNLVKNPG  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP+   NT+ GVL+PP  ED   PLPGWIIESLKAVK+IDS HF+VP G  AVELVA
Sbjct  201   FEEGPHRLVNTSNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDSKHFNVPFGLAAVELVA  260

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P KVYDL FSVGDA N C GSM+VEAFA K T +VPF+S+GKG    
Sbjct  261   GRESAIAQILRTIPNKVYDLTFSVGDAKNGCHGSMMVEAFAAKDTFKVPFESQGKGKFKT  320

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
                 F A+S+RTR+ F SS+YH + D+ GSLCGPV+D VR+
Sbjct  321   VSFNFKAVSARTRITFYSSYYHTRIDDFGSLCGPVLDQVRV  361



>ref|XP_011087959.1| PREDICTED: uncharacterized protein LOC105169285 [Sesamum indicum]
Length=369

 Score =   391 bits (1004),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 249/346 (72%), Gaps = 5/346 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
              GL+ NGNFE+ PK   +K T +   +A+P WEI+G VEYI  G + G M   V +GI+A
Sbjct  28    QGLLPNGNFEEKPKSTGIKKTVLEGRYALPKWEINGLVEYISGGPQPGGMYFPVAQGIHA  87

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I  T+    G+ Y+L+F+ +RTCAQ+E L VSV P +     G LPLQT+Y 
Sbjct  88    VRLGNEASISQTIPVKNGSLYALTFSASRTCAQDEVLRVSVPPQT-----GDLPLQTLYC  142

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F A++ +V ++ HNP  ++DPACGPL+D+VA+K L PPR  + N++KN  
Sbjct  143   SNGGDTYAWGFRAKSNSVKVIFHNPGVQEDPACGPLLDAVAIKELKPPRPTKENLVKNAG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP+   N++ GVL+PP  +D   PLPGW+IESLKAVK+IDS ++++P G+ AVELVA
Sbjct  203   FEEGPHHLFNSSNGVLLPPRQQDLTSPLPGWMIESLKAVKFIDSTYYNIPFGKSAVELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQV+RT P KVY+L F VGDA N C GSM+VEAFA K +++ PF+S+GKG    
Sbjct  263   GRESAIAQVIRTIPNKVYNLKFVVGDAKNGCHGSMMVEAFAAKASIKAPFKSEGKGKFQA  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
                +FTA S RTR+ FLSSFYH + D+SGSLCGPV+D V++    N
Sbjct  323   FSFQFTATSYRTRITFLSSFYHTRIDDSGSLCGPVLDQVQVFPAAN  368


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 79/197 (40%), Gaps = 32/197 (16%)
 Frame = -3

Query  832  LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
            +  L  P      +L NGNFEE P           I   V +    LP W I  L  V+Y
Sbjct  17   VSGLASPSASFQGLLPNGNFEEKPK-------STGIKKTVLEGRYALPKWEINGL--VEY  67

Query  652  IDSD------HFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSM  491
            I         +F V +G  AV L  G E++++Q +  + G +Y L FS   A+  C    
Sbjct  68   ISGGPQPGGMYFPVAQGIHAVRL--GNEASISQTIPVKNGSLYALTFS---ASRTCAQDE  122

Query  490  V----VEAFAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSL  323
            V    V    G L LQ  + S G          F A S+  +V F     H         
Sbjct  123  VLRVSVPPQTGDLPLQTLYCSNGGDTYAWG---FRAKSNSVKVIF-----HNPGVQEDPA  174

Query  322  CGPVIDDVRLVSVRNPR  272
            CGP++D V +  ++ PR
Sbjct  175  CGPLLDAVAIKELKPPR  191



>ref|XP_010257157.1| PREDICTED: uncharacterized protein LOC104597377 [Nelumbo nucifera]
Length=366

 Score =   390 bits (1003),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 186/345 (54%), Positives = 246/345 (71%), Gaps = 5/345 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +GL+ NGNFE+ P  + +  T +   +++P WEI+G VEYI  G + G M   V  GI+A
Sbjct  26    EGLLPNGNFEEKPSASNLNKTVLKGKNSLPKWEINGLVEYISGGPQPGGMYFAVAHGIHA  85

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A +  T+    G+ YSL+F  +RTCAQ+E L VSV P S     G LPLQT+YS
Sbjct  86    VRLGNEASVSQTIPVKPGSLYSLTFGASRTCAQDEVLRVSVPPLS-----GDLPLQTLYS  140

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F A ++   ++ HNP  ++DPACGPL+D+VA+K L PP   + N++KN  
Sbjct  141   SNGGDTYAWGFRATSKFAKVIFHNPGIQEDPACGPLLDAVAIKELFPPMATKDNLVKNSG  200

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP++  N+T GVL+PP  ED   PLPGWIIESLKAVK+IDS HF+VP G +AVELVA
Sbjct  201   FEEGPHLLQNSTNGVLLPPKQEDSTSPLPGWIIESLKAVKFIDSAHFNVPYGFKAVELVA  260

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P ++Y + F+VGDA N C GSM+VEAFA K TL+VP++S GKG    
Sbjct  261   GRESAIAQIIRTVPNRLYGVSFTVGDARNGCHGSMMVEAFAAKETLKVPYESHGKGGFKT  320

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
             A  +F AI  RTR+ F SSFYH + D+ GSLCGP++D VR+V VR
Sbjct  321   ASFKFKAIEPRTRITFYSSFYHTRVDDYGSLCGPILDQVRVVPVR  365



>ref|XP_008364711.1| PREDICTED: uncharacterized protein LOC103428382 [Malus domestica]
Length=367

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/344 (55%), Positives = 249/344 (72%), Gaps = 7/344 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ANGNFE+ PK   +K T +V  +A+P WEI+G VEYI +G + G M   V  G++A
Sbjct  30    DGLLANGNFEEPPKPTSLKKTVLVGKYALPKWEINGLVEYISAGPQPGGMYFHVAHGVHA  89

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I  T+K   G+ Y+L+F  +RTCAQEE L V V P +     G LP+QT+YS
Sbjct  90    VRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPPQA-----GDLPMQTLYS  144

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F A +E V +  HNP  ++DPACGPL+D++A+K L P    RGN+++N  
Sbjct  145   SNGGDTYAWGFRATSETVKVTFHNPGVQEDPACGPLLDAIAIKELFPVYPTRGNLVRNPG  204

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEE P+   N++ GVL+PP   D   PLPGWIIESLKAVK+IDS+HF+VP G+ AVELVA
Sbjct  205   FEEAPHRLLNSSHGVLLPPKQLDVTSPLPGWIIESLKAVKFIDSNHFNVPVGKGAVELVA  264

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P K+Y L F+VGDA N C+GSM+VEAFAGK TL+VPF SKGK    +
Sbjct  265   GRESAIAQIIRTVPNKLYSLSFTVGDARNGCQGSMMVEAFAGKDTLKVPFASKGKCGFKK  324

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
             A  RF A+S RTR+ F SSFYH K  + G+LCGP++D+V++  V
Sbjct  325   ASFRFKAVSIRTRITFFSSFYHTK--DYGALCGPILDEVKVSPV  366



>ref|XP_008363312.1| PREDICTED: uncharacterized protein LOC103427013 [Malus domestica]
Length=367

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/344 (55%), Positives = 246/344 (72%), Gaps = 7/344 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ANGNFE+ PK   +K T ++  +++P WEI G VEYI +G + G M   V  G++A
Sbjct  30    DGLLANGNFEEPPKPTDLKKTVIIGKNSLPKWEIDGLVEYISAGPQPGGMYFDVAHGVHA  89

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG DA I  T+K   G+ Y+L+F  +RTCAQEE L VSV P +     G LPLQT+YS
Sbjct  90    VRLGNDASISQTIKVKLGSLYALTFGASRTCAQEEVLRVSVPPQA-----GDLPLQTLYS  144

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F A +E V +  HNP  ++DPACGPL+D+VA+K L P    R N+++N  
Sbjct  145   SNGGDTYAWGFRATSETVKVTFHNPGIQEDPACGPLLDAVAIKELFPVYPSRDNLVRNPG  204

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEE P+   N++ GVL+PP   D   PLPGWIIESLKA+K+ID+ HF+VP G+ AVELVA
Sbjct  205   FEEAPHRLFNSSHGVLLPPKQLDATSPLPGWIIESLKAIKFIDAKHFNVPFGKGAVELVA  264

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQV+RT P K+Y L F+VGDA N C GSM+VEAFAGK TL+VPF SKGKG    
Sbjct  265   GRESAIAQVLRTVPNKLYSLSFTVGDARNGCHGSMMVEAFAGKETLKVPFTSKGKGGFKT  324

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
             A  RF A+S RTR+ F SSFYH K  + G+LCGP++D+V++  V
Sbjct  325   ASFRFKAVSIRTRITFFSSFYHTK--DYGALCGPILDEVKVSPV  366



>gb|EAY74932.1| hypothetical protein OsI_02826 [Oryza sativa Indica Group]
Length=361

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 249/347 (72%), Gaps = 20/347 (6%)
 Frame = -3

Query  1315  DGLVANGNFEQGP-KRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             DGL+ NGNFE+GP K + + GT V   +AIP WE SG+VEYI+SG KQGDMLL+VP+G +
Sbjct  25    DGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGAH  84

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG +A I+  +   +G YY+++F+ ARTCAQ E+LNVSV+P     +WG+LP+QT+Y
Sbjct  85    AVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVTP-----EWGVLPMQTIY  139

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNG  779
              S+GWDSY+WAF A+ + V +V+HNP  E+DPA           +L PP   +GNMLKN 
Sbjct  140   GSNGWDSYAWAFKAKMDEVALVIHNPGVEEDPA-----------ALYPPTLAKGNMLKNA  188

Query  778   NFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELV  599
                  P +  + +WGVL+PPN+EDDH PLP W+I S KAVKY+D+ HF+VP+G RAVELV
Sbjct  189   GSRR-PLLPPHASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFAVPQGARAVELV  247

Query  598   AGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSV  419
              G+ESAL Q VRT PG  Y L F+VGDA + C GSMV EA+A + +++VP++SKG G   
Sbjct  248   GGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIKVPYESKGTGGYK  307

Query  418   RAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
             RA   F AI++RTRV F S+FYH  +D  GSLCGPVIDD  LV +R 
Sbjct  308   RAVLEFAAIANRTRVVFQSTFYHTMTD--GSLCGPVIDDASLVGLRK  352



>ref|XP_008375195.1| PREDICTED: uncharacterized protein LOC103438421 [Malus domestica]
Length=367

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 249/344 (72%), Gaps = 7/344 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ANGNFE+ PK   +K T +V  +A+P WEI+G VEYI +G + G M   V  G++A
Sbjct  30    DGLLANGNFEEPPKPTSLKKTVLVGKYALPKWEINGLVEYISAGPQPGGMYFHVAHGVHA  89

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I  T+K   G+ Y+L+F  +RTCAQEE L V V P +     G LP+QT+YS
Sbjct  90    VRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPPQA-----GDLPMQTLYS  144

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F A +E V +  HNP  ++DPACGPL+D++A+K L P    R N+++N  
Sbjct  145   SNGGDTYAWGFRATSETVKVTFHNPGVQEDPACGPLLDAIAIKELFPVYPTRDNLVRNPG  204

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEE P+   N++ GVL+PP   D   PLPGWIIESLKAVK+IDS+HF+VP G+ AVELVA
Sbjct  205   FEEAPHRLLNSSHGVLLPPKQLDVTSPLPGWIIESLKAVKFIDSNHFNVPVGKGAVELVA  264

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P K+Y L F+VGDA N C+GSM+VEAFAGK TL+VPF SKGKG   +
Sbjct  265   GRESAIAQIIRTVPNKLYSLSFTVGDARNGCQGSMMVEAFAGKDTLKVPFASKGKGGFKK  324

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
             A  RF A+S RTR+ F SS+YH K  + G+LCGP++D+V++  V
Sbjct  325   ASFRFKAVSIRTRITFFSSYYHTK--DYGALCGPILDEVKVSPV  366



>ref|XP_006439076.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 ref|XP_006482850.1| PREDICTED: uncharacterized protein LOC102610407 [Citrus sinensis]
 gb|ESR52316.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 gb|KDO83472.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=368

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 246/345 (71%), Gaps = 6/345 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +G + NG+FE+ PK   +K T +V  HA+P WEI+G+VE+I  G + G M   V  G++A
Sbjct  29    EGYLPNGDFEELPKPTNLKKTVLVGKHALPKWEINGFVEFIAGGPQPGGMFFPVSHGVHA  88

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             +RLG +A I  T+    G  Y+L+F  +RTCAQ+E L VSV P S     G LPLQT+Y 
Sbjct  89    IRLGNEASISQTITVKPGALYALTFGASRTCAQDEVLRVSVPPQS-----GDLPLQTLYD  143

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
              +G D+Y+W F A+   V +  HNP  ++DPACGPLID+VA+K L PP   R N++KN  
Sbjct  144   ING-DTYAWGFRAKTNIVTVTFHNPGVQEDPACGPLIDAVAIKELYPPMPTRDNLVKNPG  202

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP+   NTT GVL+PP  ED   PLPGWIIESLKAVK+ID+ HF+VP G  AVELVA
Sbjct  203   FEEGPHRLVNTTNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDAKHFNVPYGHAAVELVA  262

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P K Y+L F++GDA N C GSM VEAFAGK T+ VPF+SKGKG    
Sbjct  263   GRESAIAQILRTVPNKEYNLTFTIGDAKNGCHGSMRVEAFAGKDTVAVPFESKGKGGFKS  322

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVR  281
             A  +F AI++RTR+ F S++YH K ++ GSLCGPV+D+VR++S+R
Sbjct  323   ASLKFKAIAARTRITFFSTYYHTKINDFGSLCGPVLDEVRVLSIR  367



>ref|XP_002446725.1| hypothetical protein SORBIDRAFT_06g021290 [Sorghum bicolor]
 gb|EES11053.1| hypothetical protein SORBIDRAFT_06g021290 [Sorghum bicolor]
Length=374

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 188/349 (54%), Positives = 253/349 (72%), Gaps = 9/349 (3%)
 Frame = -3

Query  1318  PDGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIY  1139
             PDGL+ NGNFE+ P ++++ GTRV    AIPHWEISG+VEYI  GQKQGDM+L VPEG Y
Sbjct  25    PDGLLPNGNFEEAPAKSELNGTRVKGRDAIPHWEISGFVEYIGPGQKQGDMILPVPEGAY  84

Query  1138  AVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMY  959
             AVRLG +A I+  +   +G  YS++F+ ARTCAQ E+LNV+V+ +S+     +LP+QT+Y
Sbjct  85    AVRLGNEASIQQRLAVTQGARYSVTFSAARTCAQAEQLNVTVATDSD-----VLPIQTVY  139

Query  958   SSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPR-RRRGNMLKN  782
             +S GWDSYSWAF A   AV +++HNP   +DPACGPL+D+ A+K+L PP    + NM++N
Sbjct  140   TSSGWDSYSWAFEATRSAVTLIVHNPGVTEDPACGPLLDAFAIKTLQPPPVLAKNNMIQN  199

Query  781   GNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGW-IIESLKAVKYIDSDHFSVPEGRRAVE  605
             G+FEEGPYIF +  WGVL+PP  EDD+ PL  W I+ + K+VKY+D+ H++VP G RAVE
Sbjct  200   GDFEEGPYIFPDAPWGVLVPPMDEDDYSPLSPWMILSTTKSVKYLDAAHYAVPHGARAVE  259

Query  604   LVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGV  425
             L++G E+ALAQ V T  G+ Y L FS GDA + C GS+ + A+A   ++ VP +S+G+G 
Sbjct  260   LLSGVETALAQDVATVAGRPYRLEFSTGDAGDGCSGSLSLRAYAASGSVTVPHESQGRGG  319

Query  424   SVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSVRN  278
               R    FTA + RTRV F+S  Y MKSD  G+LCGPV+DDV LV + +
Sbjct  320   HKRGVLDFTATADRTRVAFVSMAYTMKSD--GTLCGPVLDDVSLVGLHS  366



>ref|XP_008461812.1| PREDICTED: uncharacterized protein LOC103500323 [Cucumis melo]
Length=368

 Score =   388 bits (997),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/341 (54%), Positives = 247/341 (72%), Gaps = 5/341 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +GL+ANGNFE  P +  +K T ++  +++P WEI+G VEYI  G + G M   V  G++A
Sbjct  29    EGLLANGNFEVPPAKTNLKKTVIIGKNSLPSWEINGLVEYISGGPQPGGMFFPVAHGVHA  88

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I   ++  KG+ Y+L+F  +RTCAQ+E L+V V P +     G LPLQT+YS
Sbjct  89    VRLGNEASISQIIQVKKGSLYALTFGASRTCAQDEVLSVLVPPQN-----GSLPLQTLYS  143

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             SDG D Y++ F+A +++V +  HNP  ++DPACGPL+D+VA+K L  P     N+++N +
Sbjct  144   SDGGDVYAYGFVAPSDSVKVTFHNPGVQEDPACGPLLDAVAIKELVRPLPTTVNLVRNPS  203

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FE GP+   N+T GVL+PP  ED   PLPGWIIESLKAVK+IDS HF+VP+G  A+ELVA
Sbjct  204   FEVGPHRLGNSTNGVLLPPRQEDVTSPLPGWIIESLKAVKFIDSKHFNVPDGEAAIELVA  263

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P KVY L F VGDA N C GSM+VEAFA K T++VPFQS+GKG+   
Sbjct  264   GRESAVAQIIRTIPNKVYSLKFKVGDAKNGCHGSMMVEAFAAKETVKVPFQSEGKGLYKD  323

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             A  +FTA S RTR+ F SS+YH ++D+ GSLCGPV+DDV +
Sbjct  324   AILKFTATSPRTRITFFSSYYHTRTDDFGSLCGPVLDDVSV  364



>ref|XP_011016219.1| PREDICTED: uncharacterized protein LOC105119742 [Populus euphratica]
Length=369

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 251/360 (70%), Gaps = 6/360 (2%)
 Frame = -3

Query  1369  ILLALLCATFHLVISFTP-DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYI  1193
             I+L+    + H  I   P DGLV NGNFEQ P ++ +K   ++  +++P WEI+G VEY+
Sbjct  11    IILSFCHGSAHAAIPPRPLDGLVENGNFEQAPAKSNLKKRAIIGKYSLPKWEINGIVEYV  70

Query  1192  KSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSV  1013
               G + G   L +P G++AVRLG +A I  T+    G+ Y+L+F   RTCAQ+E L VSV
Sbjct  71    SGGPQPGGFYLAIPRGVHAVRLGNEASISQTLTVKPGSIYALTFGATRTCAQDEVLRVSV  130

Query  1012  SPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVA  833
                  P     LP+QT+YSS+G D+Y+WA+ A ++AV +  HNP  ++DP CGPL+D++A
Sbjct  131   -----PGQSSDLPIQTLYSSNGGDTYAWAWKATSKAVKVTFHNPGIQEDPTCGPLLDAIA  185

Query  832   LKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKY  653
             +K   P +  +GN++KNG FE GP++F N + G+L+PP  +D   PLPGWIIESLK VKY
Sbjct  186   IKETLPLKYSKGNLVKNGVFEVGPHVFKNFSTGILLPPKQQDLISPLPGWIIESLKPVKY  245

Query  652   IDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFA  473
             IDS HF VP G  A+E+VAGRESA+AQ++RT P K Y+L F++GDA NAC GSM+VEAFA
Sbjct  246   IDSKHFFVPTGFAAIEMVAGRESAIAQIIRTIPNKFYNLSFTIGDAKNACHGSMMVEAFA  305

Query  472   GKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
             G+ TL+VP+ S+GKG    A  RF AISSRTR+ F S +YH K  + G +CGPV+DDVR+
Sbjct  306   GRETLKVPYVSRGKGGYKTATLRFKAISSRTRITFYSGYYHTKLHDYGHMCGPVLDDVRV  365



>ref|XP_006345424.1| PREDICTED: uncharacterized protein LOC102582371 [Solanum tuberosum]
Length=367

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/365 (53%), Positives = 254/365 (70%), Gaps = 7/365 (2%)
 Frame = -3

Query  1372  IILLALLCATFHLVISFTP-DGLVANGNFEQGPKRNQMKGTRVVD-PHAIPHWEISGYVE  1199
             ++LL     T   V S  P +GL+ NGNFE+ PK   +K   V+   +A+P WEI+G VE
Sbjct  7     VLLLFSFLFTASAVRSAPPLEGLLPNGNFEELPKPKDLKKKTVLQGKYALPKWEINGLVE  66

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YI  G + G M   V  G++AVRLG +A I  T+   KG+ Y+L+F  +RTCAQEE L V
Sbjct  67    YISGGPQPGGMYFAVAHGVHAVRLGNEASISQTIPVKKGSLYALTFGASRTCAQEEVLRV  126

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV P +     G LPLQT+YSS+G D+Y+W F A +  V +  HNP  ++DPACGPL+D+
Sbjct  127   SVPPQT-----GDLPLQTLYSSNGGDTYAWGFYATSNVVKVTFHNPGVQEDPACGPLLDA  181

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+K L PPR  R N++KN  FEEGP++  N++ GVL+PP  ED   PLPGWIIESLKAV
Sbjct  182   VAIKELFPPRPTRVNLVKNAGFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAV  241

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             K++DS HF+VP G+ AVEL+AGRESALAQ++RT P KVY   FSVGDA N C G M+VEA
Sbjct  242   KFLDSAHFNVPFGQAAVELLAGRESALAQIIRTVPKKVYAFTFSVGDAKNGCHGDMMVEA  301

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FA K T +VPF+S+GKG       +FTAI+ RTR+ F SSFYH K ++ G+LCGPV+D+V
Sbjct  302   FAAKETFKVPFKSQGKGSFKTVSFKFTAIADRTRITFYSSFYHTKINDYGALCGPVVDEV  361

Query  298   RLVSV  284
             ++  V
Sbjct  362   KVTPV  366



>ref|XP_010241207.1| PREDICTED: uncharacterized protein LOC104585883 [Nelumbo nucifera]
Length=365

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 243/344 (71%), Gaps = 5/344 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             +GL+ NGNFE+ P  + +  T +   +++P WEI+G VEYI  G + G M   V  G++A
Sbjct  25    EGLLPNGNFEEPPNPSTLHKTVIQGKYSLPKWEINGLVEYISGGPQPGGMYFPVVHGVHA  84

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I  T+    G+ YSL+F  +RTCAQ+E L VSV P S     G LPLQT+YS
Sbjct  85    VRLGNEASISQTIPVKPGSLYSLTFGSSRTCAQDEVLRVSVPPLS-----GDLPLQTLYS  139

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+WAF   +    ++ HN   ++DPACGPL+D+VA+K L PP   R N+++NG 
Sbjct  140   SNGGDTYAWAFRPTSNFAKVIFHNLGVQEDPACGPLLDAVAIKELLPPMPTRDNLVRNGG  199

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEEGP++  N+T GVL+PP  ED   PLPGWIIESLKAVK+IDS HF+VP G  AVELVA
Sbjct  200   FEEGPHLLKNSTNGVLLPPKQEDATSPLPGWIIESLKAVKFIDSAHFNVPYGSAAVELVA  259

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             G+ESA+AQV+RT P K+Y+L F+VGDA N C GSM VEAFAG  TL+VPF+SKGKG    
Sbjct  260   GKESAIAQVIRTVPNKLYNLTFTVGDARNGCHGSMSVEAFAGAETLKVPFESKGKGGFKA  319

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
                +F A+ +RTR+ F SSFYH + D+ GSLCGP++D VR+  V
Sbjct  320   VSFKFKAVGARTRITFFSSFYHTRVDDYGSLCGPILDQVRVFPV  363



>ref|XP_009354784.1| PREDICTED: uncharacterized protein LOC103945912 [Pyrus x bretschneideri]
 ref|XP_009354785.1| PREDICTED: uncharacterized protein LOC103945913 [Pyrus x bretschneideri]
Length=367

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 246/344 (72%), Gaps = 7/344 (2%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ANGNFE+ PK   +K   +V  +A+P WEI G VEYI +G + G M   V  G++A
Sbjct  30    DGLLANGNFEEPPKPTNLKKKVLVGKYALPKWEIDGLVEYISAGPQPGGMYFNVAHGVHA  89

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I  T+K   G+ Y+L+F  +RTCAQEE L V V P +     G LP+QT+YS
Sbjct  90    VRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPPQA-----GDLPMQTLYS  144

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F A +  V +  HNP  ++DPACGPL+D++A+K L P    R N+++N  
Sbjct  145   SNGGDTYAWGFRATSATVKVTFHNPGVQEDPACGPLLDAIAIKELFPVYPTRDNLVRNPG  204

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEE P+   N++ GVL+PP   D   PLPGWIIESLKAVK+IDS+HF+VP G+ AVELVA
Sbjct  205   FEEAPHRLLNSSHGVLLPPKQLDATSPLPGWIIESLKAVKFIDSNHFNVPVGKGAVELVA  264

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQ++RT P K+Y L F+VGDA N C+GSM+VEAFAGK TL+VPF SKGKG   +
Sbjct  265   GRESAIAQIIRTVPNKLYSLSFTVGDARNGCQGSMMVEAFAGKETLKVPFASKGKGGFKK  324

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
             A  RF A+S RTR+ F SSFYH K  + G+LCGP++D+V++  V
Sbjct  325   ASFRFKAVSIRTRITFFSSFYHTK--DYGALCGPILDEVKVSPV  366



>ref|XP_002313314.1| hypothetical protein POPTR_0009s06370g [Populus trichocarpa]
 gb|EEE87269.1| hypothetical protein POPTR_0009s06370g [Populus trichocarpa]
Length=365

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 249/362 (69%), Gaps = 10/362 (3%)
 Frame = -3

Query  1363  LALLCATFHLVISFTP-----DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVE  1199
              +L+ A F L I         +G + NGNFE+ PK   ++ T +   +A+P WEI+G+VE
Sbjct  5     FSLMLALFLLFIGSASAATYMEGFLKNGNFEEKPKPGAIRKTVLKGKNALPSWEINGFVE  64

Query  1198  YIKSGQKQGDMLLLVPEGIYAVRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNV  1019
             YI +G + G M   V  G++AVRLG +A I  T+    G+ Y+L+F  +RTCAQ+E L V
Sbjct  65    YISAGPQPGGMYFNVAHGVHAVRLGNEASISQTITIKAGSLYALTFGASRTCAQDEVLRV  124

Query  1018  SVSPNSEPNDWGMLPLQTMYSSDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDS  839
             SV P      +G LPLQT+YSS+G D+Y+W F   A  V +  HN   ++DPACGPLID+
Sbjct  125   SVGP-----VFGDLPLQTLYSSNGGDTYAWGFRLNATVVQVTFHNTGVQEDPACGPLIDA  179

Query  838   VALKSLNPPRRRRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAV  659
             VA+K L PP   R N+++N  FEEGP+   NT+ G+L+PP  ED   PLPGWIIESLKAV
Sbjct  180   VAIKELFPPMPTRDNLVRNHGFEEGPHRLVNTSNGILLPPRQEDLTSPLPGWIIESLKAV  239

Query  658   KYIDSDHFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA  479
             K+ID  HF+VP G  AVELVAGRESA+AQ++RT P KVY L F++GDA N C GSM+VEA
Sbjct  240   KFIDKRHFNVPFGLAAVELVAGRESAIAQILRTTPNKVYSLAFTIGDARNGCHGSMMVEA  299

Query  478   FAGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDV  299
             FA   T +VPF+SKGKG S  A  +F AIS+RTR+ F SS+YH + D+ GSLCGP++D+V
Sbjct  300   FAAGDTFKVPFESKGKGESKSASFKFKAISARTRITFYSSYYHTRIDDYGSLCGPILDEV  359

Query  298   RL  293
             R+
Sbjct  360   RV  361



>ref|XP_008231461.1| PREDICTED: uncharacterized protein LOC103330638 [Prunus mume]
Length=454

 Score =   389 bits (1000),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 244/344 (71%), Gaps = 5/344 (1%)
 Frame = -3

Query  1315  DGLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYA  1136
             DGL+ NGNFE+ PK   +K T ++  +A+P WEI+G+VEYI  G + G M   V  G++A
Sbjct  115   DGLLNNGNFEEPPKPTSLKKTVLIGKYALPKWEINGFVEYISGGPQPGGMYFSVAHGVHA  174

Query  1135  VRLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYS  956
             VRLG +A I  T+K   G+ Y+L+F  +RTCAQEE L VSV P +     G LPLQT+YS
Sbjct  175   VRLGNEASISQTIKVKPGSLYALTFGASRTCAQEEVLRVSVPPQA-----GDLPLQTLYS  229

Query  955   SDGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGN  776
             S+G D+Y+W F A +  V +  HNP  ++DPACGPL+D++A+K L P    R N+++N  
Sbjct  230   SNGGDTYAWGFRATSNVVKVTFHNPGVQEDPACGPLLDAIAIKELFPALPTRDNLVRNPG  289

Query  775   FEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVA  596
             FEE P+   N++ GVL+PP   D   PLPGWIIESLKAVK+IDS HF+VP G+ AVELVA
Sbjct  290   FEEAPHRLFNSSHGVLLPPKQLDVTSPLPGWIIESLKAVKFIDSQHFNVPFGKGAVELVA  349

Query  595   GRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVR  416
             GRESA+AQV+RT P K+Y+L F VGDA N C GSM+VEAFAGK TL+VPF S+GKG    
Sbjct  350   GRESAIAQVLRTVPNKIYNLSFVVGDARNGCHGSMMVEAFAGKDTLKVPFTSQGKGGFKA  409

Query  415   AKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRLVSV  284
             A  +F A S RTR+ F SSFYH + D+ G+LCGP++D VR+  V
Sbjct  410   ASLKFKAASPRTRITFYSSFYHTRVDDYGALCGPILDQVRVYPV  453



>ref|XP_010695068.1| PREDICTED: uncharacterized protein LOC104907775 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   385 bits (989),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 184/340 (54%), Positives = 245/340 (72%), Gaps = 7/340 (2%)
 Frame = -3

Query  1312  GLVANGNFEQGPKRNQMKGTRVVDPHAIPHWEISGYVEYIKSGQKQGDMLLLVPEGIYAV  1133
             GL+ NGNFE  PK  QMK T+++   ++P WEI+G VEYI+ G + G M   V  G +AV
Sbjct  32    GLIPNGNFEDPPK--QMKNTKIIGKFSLPKWEINGLVEYIRGGPQPGGMYFAVAHGQHAV  89

Query  1132  RLGEDAWIKTTVKAVKGTYYSLSFTFARTCAQEERLNVSVSPNSEPNDWGMLPLQTMYSS  953
             RLG +A +  +V    G++Y+L+F  +RTCAQ+E L VS+ P       G LP+QT+YS+
Sbjct  90    RLGNEASVSQSVPVKPGSFYALTFGASRTCAQDEVLRVSIPPFH-----GDLPIQTLYST  144

Query  952   DGWDSYSWAFLAEAEAVDIVLHNPAAEKDPACGPLIDSVALKSLNPPRRRRGNMLKNGNF  773
             DG D++++ F A ++   I  HNP  ++DPACGPLID+VALK L P    +GN+++NG F
Sbjct  145   DGGDTHAFGFKATSKVAKITFHNPGVQEDPACGPLIDAVALKELMPVYPAKGNLIRNGGF  204

Query  772   EEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSDHFSVPEGRRAVELVAG  593
             EEGPY   NT+ G+L+PP  ED + PLPGW+IESLKAVKYID  HF+VP GR A+ELVAG
Sbjct  205   EEGPYRILNTSNGILLPPKQEDINSPLPGWVIESLKAVKYIDKRHFNVPFGRSAIELVAG  264

Query  592   RESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEAFAGKLTLQVPFQSKGKGVSVRA  413
             RESA+AQV+RT P KVY+L F++GDA N+C+GSM+VEAFAG+ TL+ PF S+G G     
Sbjct  265   RESAIAQVIRTVPNKVYNLTFTIGDAKNSCKGSMLVEAFAGRDTLKAPFLSQGLGKFQTV  324

Query  412   KHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVRL  293
               +F AIS RTR+ F SS+YH K+D  G LCGPV+D+VR+
Sbjct  325   SMKFKAISDRTRITFFSSYYHSKADGFGILCGPVLDEVRV  364


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 73/181 (40%), Gaps = 34/181 (19%)
 Frame = -3

Query  805  RRGNMLKNGNFEEGPYIFSNTTWGVLIPPNVEDDHCPLPGWIIESLKAVKYIDSD-----  641
             RG ++ NGNFE+ P    NT                LP W I  L  V+YI        
Sbjct  29   HRGGLIPNGNFEDPPKQMKNTKI---------IGKFSLPKWEINGL--VEYIRGGPQPGG  77

Query  640  -HFSVPEGRRAVELVAGRESALAQVVRTRPGKVYDLYFSVGDANNACEGSMVVEA----F  476
             +F+V  G+ AV L  G E++++Q V  +PG  Y L F    A+  C    V+      F
Sbjct  78   MYFAVAHGQHAVRL--GNEASVSQSVPVKPGSFYALTFG---ASRTCAQDEVLRVSIPPF  132

Query  475  AGKLTLQVPFQSKGKGVSVRAKHRFTAISSRTRVRFLSSFYHMKSDNSGSLCGPVIDDVR  296
             G L +Q  + + G          F A S   ++ F     H         CGP+ID V 
Sbjct  133  HGDLPIQTLYSTDGGDTHAFG---FKATSKVAKITF-----HNPGVQEDPACGPLIDAVA  184

Query  295  L  293
            L
Sbjct  185  L  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3863858971050