BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7935_g1_i1 len=1382 path=[1404:0-535 1940:536-538 1943:539-1381]

Length=1382
                                                                      Score     E

dbj|BAC97837.1|  duplicated                                             496   3e-172   Ipomoea nil [qian niu]
ref|XP_009802759.1|  PREDICTED: floral homeotic protein AGAMOUS i...    418   1e-141   
ref|XP_006358066.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    412   2e-139   
ref|XP_009802761.1|  PREDICTED: floral homeotic protein AGAMOUS i...    412   3e-139   
ref|XP_010315871.1|  PREDICTED: floral homeotic protein AGAMOUS i...    412   4e-139   
ref|XP_009586720.1|  PREDICTED: floral homeotic protein AGAMOUS i...    410   2e-138   
gb|ADP06386.1|  AGAMOUS-LIKE2                                           409   4e-138   
sp|Q40885.1|AG_PETHY  RecName: Full=Floral homeotic protein AGAMO...    407   2e-137   Petunia x hybrida [garden petunia]
gb|EYU28135.1|  hypothetical protein MIMGU_mgv1a012605mg                406   4e-137   
ref|XP_006358067.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    406   5e-137   
gb|AGS44979.1|  PFAG                                                    405   7e-137   
ref|NP_001266181.1|  floral homeotic protein AGAMOUS                    405   1e-136   
dbj|BAB79434.1|  PMADS3                                                 405   1e-136   Petunia x hybrida [garden petunia]
ref|XP_009586722.1|  PREDICTED: floral homeotic protein AGAMOUS i...    403   8e-136   
ref|XP_011102153.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    402   2e-135   
gb|EYU28136.1|  hypothetical protein MIMGU_mgv1a012605mg                400   1e-134   
gb|ADP09005.1|  AGAMOUS-like protein                                    400   1e-134   
gb|AFK13159.1|  agamous                                                 396   3e-133   
ref|XP_011102155.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    395   9e-133   
gb|AIS82595.1|  AGAMOUS                                                 390   6e-131   
ref|XP_011085307.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    390   8e-131   
ref|XP_011085305.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    386   3e-129   
dbj|BAI59709.1|  MADS-box transcription factor                          384   2e-128   Lobelia erinus
ref|XP_011085309.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    384   3e-128   
emb|CAB42988.1|  MADS-box transcription factor                          382   9e-128   Antirrhinum majus [garden snapdragon]
sp|Q40872.1|AG_PANGI  RecName: Full=Floral homeotic protein AGAMO...    382   2e-127   Panax ginseng [Chinese ginseng]
ref|XP_011085308.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    380   1e-126   
dbj|BAI59708.1|  MADS-box transcription factor                          378   4e-126   Lobelia erinus
emb|CAJ44130.1|  farinelli protein                                      378   6e-126   Misopates orontium
dbj|BAG24494.1|  FARINELLI-like MADS-box protein                        378   8e-126   Torenia fournieri [bluewings]
gb|ABF50231.1|  AGAMOUS                                                 376   1e-125   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_006358069.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    372   5e-124   
emb|CDO96907.1|  unnamed protein product                                370   2e-122   
gb|ADU56831.1|  MADS-box protein AG subfamily                           369   2e-122   
dbj|BAG74745.1|  HmAGAMOUS protein                                      363   5e-120   Hydrangea macrophylla
emb|CAN83827.1|  hypothetical protein VITISV_030947                     361   2e-119   Vitis vinifera
emb|CAA08801.1|  MADS-box protein, GAGA2                                360   5e-119   Gerbera hybrid cultivar
gb|AGV40795.1|  MADS-box transcription factor 12                        358   2e-118   
emb|CAA08800.1|  MADS-box protein, GAGA1                                358   4e-118   Gerbera hybrid cultivar
gb|AAO18229.1|  MADS-box transcriptional factor HAM59                   358   5e-118   Helianthus annuus
gb|AFP99884.1|  AGAMOUS                                                 357   8e-118   
gb|AIC33050.1|  flower development transporter AG2                      357   1e-117   
gb|AEA11211.1|  AGAMOUS-like protein                                    356   1e-117   
gb|ABF50233.1|  AGAMOUS                                                 355   2e-117   Nicotiana langsdorffii x Nicotiana sanderae
gb|AID22158.1|  AGAMOUS-like protein                                    356   2e-117   
ref|XP_004485955.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    352   1e-115   
gb|AFO83615.1|  AGAMOUS-like protein                                    352   1e-115   
dbj|BAG06959.1|  MADS-box transcription factor                          352   1e-115   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AEK33831.1|  agamous                                                 350   2e-115   
gb|AER30448.1|  AGAMOUS4                                                351   3e-115   
ref|NP_001268097.1|  agamous                                            349   4e-115   
gb|AFX82108.1|  MADS-box transcription factor AG1                       350   5e-115   
ref|XP_006467575.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    350   6e-115   
dbj|BAK20022.1|  PgMADS protein7                                        349   7e-115   
ref|XP_006467576.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    350   7e-115   
gb|AAO22984.1|  MADS-box transcription factor CDM37                     350   8e-115   Chrysanthemum x morifolium [florist's chrysanthemum]
emb|CBI30760.3|  unnamed protein product                                348   1e-114   
gb|AEU08497.1|  MADS1                                                   348   1e-114   
ref|XP_006449577.1|  hypothetical protein CICLE_v10016427mg             349   1e-114   
ref|XP_008225407.1|  PREDICTED: floral homeotic protein AGAMOUS i...    348   3e-114   
ref|XP_006467577.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    348   3e-114   
ref|XP_007025251.1|  K-box region and MADS-box transcription fact...    348   3e-114   
ref|XP_010687173.1|  PREDICTED: floral homeotic protein AGAMOUS i...    348   3e-114   
gb|ADP02394.1|  AGAMOUS-like protein                                    348   4e-114   
gb|AAN47198.1|  MADS-box transcription factor AGAMOUS                   347   6e-114   Helianthus annuus
dbj|BAN13568.1|  agamous-like protein                                   347   7e-114   
gb|AIP87050.1|  AG                                                      347   9e-114   
gb|KDO77975.1|  hypothetical protein CISIN_1g036452mg                   347   1e-113   
dbj|BAG06960.1|  MADS-box transcription factor                          347   1e-113   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAO18228.1|  MADS-box transcriptional factor HAM45                   347   1e-113   Helianthus annuus
ref|XP_007025250.1|  K-box region and MADS-box transcription fact...    348   2e-113   
gb|ACH72974.1|  AGAMOUS                                                 345   2e-113   Prunus serotina
gb|AEG19542.1|  AGAMOUS-like protein                                    345   3e-113   
ref|XP_004485952.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    345   5e-113   
gb|AGV55405.1|  MADS-box transcription factor AGAMOUSa                  344   1e-112   
emb|CAB95649.1|  MADS box protein                                       343   2e-112   Betula pendula [white birch]
ref|XP_010687172.1|  PREDICTED: floral homeotic protein AGAMOUS i...    343   4e-112   
gb|AIU94283.1|  floral homeotic protein AGAMOUS                         342   5e-112   
gb|AAD03486.1|  MADS1                                                   342   6e-112   Corylus avellana [European hazelnut]
ref|XP_007147970.1|  hypothetical protein PHAVU_006G169600g             342   6e-112   
ref|XP_010687170.1|  PREDICTED: floral homeotic protein AGAMOUS i...    342   7e-112   
ref|XP_007211925.1|  hypothetical protein PRUPE_ppa010595mg             342   8e-112   
ref|XP_002305048.1|  hypothetical protein POPTR_0004s06300g             341   1e-111   Populus trichocarpa [western balsam poplar]
ref|XP_011009675.1|  PREDICTED: floral homeotic protein AGAMOUS-like    340   3e-111   
gb|AAU29513.1|  MADS4                                                   340   5e-111   Prunus persica
ref|XP_008225406.1|  PREDICTED: floral homeotic protein AGAMOUS i...    342   7e-111   
gb|AAD01744.1|  agamous-like putative transcription factor              338   2e-110   Cucumis sativus [cucumbers]
gb|AAC08528.1|  CUM1                                                    338   3e-110   Cucumis sativus [cucumbers]
ref|XP_008439701.1|  PREDICTED: floral homeotic protein AGAMOUS i...    337   4e-110   
gb|ACF93432.1|  MADS10                                                  337   6e-110   Gossypium hirsutum [American cotton]
ref|XP_010687169.1|  PREDICTED: floral homeotic protein AGAMOUS i...    337   9e-110   
ref|XP_008439700.1|  PREDICTED: floral homeotic protein AGAMOUS i...    337   1e-109   
ref|XP_010687174.1|  PREDICTED: floral homeotic protein AGAMOUS i...    337   1e-109   
emb|CAA56655.1|  SLM1                                                   336   1e-109   Silene latifolia
ref|NP_001237504.1|  MADS-box protein                                   336   1e-109   
emb|CAA61480.1|  MADS box regulatory protein                            335   4e-109   Rumex acetosa [sour dock]
ref|XP_011002033.1|  PREDICTED: floral homeotic protein AGAMOUS-like    334   6e-109   
gb|AAS45686.1|  AGAMOUS-like protein                                    333   7e-109   Meliosma dilleniifolia
emb|CAI61983.1|  AGAMOUS protein                                        333   2e-108   Impatiens balsamina [rose balsam]
gb|ADP00515.1|  MADS-box factor MADS1                                   332   2e-108   
gb|AAT46102.1|  AGAMOUS-like protein                                    333   2e-108   Akebia trifoliata
gb|KHG12869.1|  Floral homeotic AGAMOUS -like protein                   333   2e-108   
ref|XP_002317315.1|  MADS-box family protein                            332   3e-108   Populus trichocarpa [western balsam poplar]
ref|XP_004504255.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    332   3e-108   
gb|ACR47977.1|  MADS box protein                                        333   4e-108   Cucumis sativus [cucumbers]
gb|AAL92522.1|  AG-like protein                                         332   5e-108   Gossypium hirsutum [American cotton]
gb|ABC25564.1|  MADS box 2                                              332   5e-108   Momordica charantia [balsam pear]
gb|ACI23561.1|  agamous-like protein 2                                  332   5e-108   Gossypium barbadense [Egyptian cotton]
emb|CAC81071.1|  MADS box transcription factor                          332   6e-108   Daucus carota subsp. sativus
gb|AAZ77747.1|  agamous-like MADS box 2                                 331   1e-107   Castanea mollissima
gb|AFY98824.1|  AGAMOUS-like protein                                    330   1e-107   
gb|ADC79702.1|  AGAMOUS-like protein                                    330   2e-107   Pachysandra terminalis
gb|AHH28261.1|  MADS-box transcription factor                           329   3e-107   
ref|XP_008371525.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    330   3e-107   
dbj|BAD18011.1|  MADS-box transcription factor                          329   4e-107   Asparagus virgatus
ref|XP_003629877.1|  Floral homeotic protein AGAMOUS                    330   4e-107   
ref|XP_009360794.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    329   5e-107   
gb|AEZ51868.1|  AG MADS-box protein                                     329   6e-107   
gb|ABM69042.1|  MADS-box protein MADS4                                  329   6e-107   Gossypium hirsutum [American cotton]
ref|XP_003546055.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    328   1e-106   
gb|AAY85372.1|  Me341                                                   328   1e-106   Beta vulgaris [beet]
gb|AAT91060.1|  C class floral identity transcription factor AGAMOUS    327   2e-106   Spinacia oleracea
gb|ACB70410.1|  agamous MADS-box transcription factor                   327   3e-106   Hosta plantaginea [August lily]
gb|ADP00516.1|  MADS-box factor MADS2                                   326   5e-106   
ref|XP_010656928.1|  PREDICTED: MAD-box transcripion factor isofo...    328   7e-106   
dbj|BAK18553.1|  MADS-box transcription factor                          327   8e-106   
gb|AAY86364.1|  AGAMOUS-like protein                                    326   9e-106   Dendrobium thyrsiflorum
gb|KHN06927.1|  Floral homeotic protein AGAMOUS                         326   1e-105   
gb|AEL31340.1|  AGAMOUS                                                 326   1e-105   
gb|ADK35760.1|  agamous-like protein 2                                  325   1e-105   
emb|CBI31767.3|  unnamed protein product                                330   2e-105   
gb|AAX69069.1|  MADS box protein M7                                     325   2e-105   Pisum sativum [garden pea]
dbj|BAP90526.1|  C class MADS-box                                       325   2e-105   
gb|AHM92098.1|  MADS-box protein 22                                     325   2e-105   
gb|AAL76415.1|AF234617_1  MADS-box transcription factor                 325   3e-105   Phalaenopsis equestris
emb|CAC80858.1|  C-type MADS box protein                                325   3e-105   Malus domestica [apple tree]
sp|P17839.2|AG_ARATH  RecName: Full=Floral homeotic protein AGAMOUS     325   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009351902.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    325   4e-105   
ref|XP_010915441.1|  PREDICTED: MADS-box transcription factor 3 i...    324   1e-104   
dbj|BAL41415.1|  Agamous like protein                                   323   2e-104   
ref|XP_010915440.1|  PREDICTED: MADS-box transcription factor 3 i...    324   2e-104   
dbj|BAK18552.1|  MADS-box transcription factor                          323   2e-104   
ref|XP_010915446.1|  PREDICTED: MADS-box transcription factor 3 i...    322   2e-104   
gb|AER34988.1|  AGAMOUS-like protein                                    322   3e-104   
ref|NP_567569.3|  MADS domain transcription factor AGAMOUS              323   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010915443.1|  PREDICTED: MADS-box transcription factor 3 i...    322   3e-104   
ref|XP_010273432.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    321   6e-104   
ref|XP_008383546.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    322   6e-104   
dbj|BAN15734.1|  AGAMOUS like protein                                   322   6e-104   
gb|AHM92097.1|  MADS-box protein 21                                     321   9e-104   
ref|XP_004485958.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    321   9e-104   
emb|CAA37642.1|  unnamed protein product                                322   1e-103   Arabidopsis thaliana [mouse-ear cress]
dbj|BAL41416.1|  Agamous like protein                                   321   1e-103   
gb|AAZ53205.1|  AG1                                                     320   1e-103   Eschscholzia californica
ref|XP_008791901.1|  PREDICTED: MADS-box transcription factor 3 i...    320   1e-103   
ref|NP_001268105.1|  MAD-box transcripion factor                        320   1e-103   
ref|XP_010925573.1|  PREDICTED: floral homeotic protein AGAMOUS-like    320   2e-103   
emb|CAA16753.1|  floral homeotic protein agamous                        322   2e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AEX92974.1|  MADS box protein 4                                      320   2e-103   
gb|ABQ28694.1|  MADS box transcription factor                           320   2e-103   Narcissus tazetta var. chinensis
ref|XP_004504259.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    320   2e-103   
ref|XP_008791911.1|  PREDICTED: MADS-box transcription factor 3 i...    320   2e-103   
gb|AAZ95250.1|  AGAMOUS-like transcription factor                       320   2e-103   Dendrobium crumenatum
gb|AAW66881.1|  MADS box transcription factor                           319   2e-103   Elaeis guineensis
gb|AEI01160.1|  SHATTERPPOOF-like protein                               319   5e-103   
gb|AAF75773.2|AF265554_1  transcription factor CMB                      318   7e-103   Cucumis sativus [cucumbers]
gb|AHH28276.1|  MADS-box transcription factor                           318   8e-103   
ref|XP_002870009.1|  hypothetical protein ARALYDRAFT_914774             320   1e-102   
ref|XP_010451378.1|  PREDICTED: floral homeotic protein AGAMOUS         320   1e-102   
ref|XP_007217264.1|  hypothetical protein PRUPE_ppa010578mg             318   1e-102   
ref|XP_010272685.1|  PREDICTED: floral homeotic protein AGAMOUS-like    317   1e-102   
ref|XP_011082936.1|  PREDICTED: floral homeotic protein AGAMOUS-like    318   2e-102   
gb|ACN97631.1|  AGAMOUS-like protein                                    317   2e-102   Mangifera indica
emb|CDY09267.1|  BnaC03g62970D                                          317   3e-102   
gb|AFM30905.1|  transcription factor MADS5                              317   3e-102   
gb|AAA68001.1|  agamous protein                                         317   3e-102   Petunia integrifolia [violet-flowered petunia]
gb|KGN49343.1|  hypothetical protein Csa_6G520410                       336   4e-102   
gb|ADG45820.1|  mutant SHATTERPROOF-like protein                        317   4e-102   
gb|ADG45819.1|  SHATTERPROOF-like protein                               317   4e-102   
ref|XP_009132356.1|  PREDICTED: floral homeotic protein AGAMOUS i...    317   5e-102   
emb|CDP18724.1|  unnamed protein product                                316   6e-102   
gb|AEA76418.1|  putative AG                                             315   7e-102   
dbj|BAC97838.1|  peony                                                  316   7e-102   Ipomoea nil [qian niu]
dbj|BAN15735.1|  AGAMOUS like-protein                                   317   8e-102   
gb|ABB59994.1|  MADS-box protein                                        315   9e-102   Taihangia rupestris
gb|AIJ29176.1|  AG-like MADS box protein                                315   9e-102   
ref|XP_008794140.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    315   9e-102   
dbj|BAA90744.1|  MADS-box protein                                       316   1e-101   Rosa rugosa [Japanese rose]
gb|AGU92563.1|  SHATTERPROOF-like protein                               315   2e-101   
ref|XP_009132380.1|  PREDICTED: floral homeotic protein AGAMOUS i...    315   2e-101   
dbj|BAK20023.1|  PgMADS protein8                                        315   2e-101   
ref|XP_010436489.1|  PREDICTED: floral homeotic protein AGAMOUS-like    317   2e-101   
ref|XP_004513719.1|  PREDICTED: agamous-like MADS-box protein AGL...    315   2e-101   
ref|XP_009380480.1|  PREDICTED: MADS-box transcription factor 3-l...    314   2e-101   
gb|ABR68012.1|  C-class floral identity                                 314   2e-101   Carica papaya [mamon]
ref|XP_004485957.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    314   3e-101   
gb|AAK83034.1|AF286649_1  transcription factor CMB1                     313   4e-101   Cucumis sativus [cucumbers]
ref|XP_007159503.1|  hypothetical protein PHAVU_002G243200g             314   4e-101   
ref|XP_009380477.1|  PREDICTED: MADS-box transcription factor 3-l...    313   5e-101   
gb|ACD76828.1|  AGAMOUS-like protein                                    313   1e-100   Capsella bursa-pastoris
gb|AAD00025.1|  AGAMOUS protein                                         313   1e-100   Rosa hybrid cultivar
ref|XP_010445284.1|  PREDICTED: floral homeotic protein AGAMOUS-like    315   1e-100   
ref|XP_004309724.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    313   2e-100   
gb|KCW47399.1|  hypothetical protein EUGRSUZ_K01195                     313   3e-100   
gb|ADU15476.1|  AG                                                      312   3e-100   
emb|CAJ44134.1|  plena protein                                          311   3e-100   Misopates orontium
gb|ACD76829.1|  AGAMOUS-like protein                                    312   4e-100   Capsella bursa-pastoris
emb|CDX99406.1|  BnaC01g11460D                                          314   6e-100   
gb|ADC79699.1|  AGAMOUS-like protein                                    310   7e-100   Euptelea pleiosperma
gb|KCW47400.1|  hypothetical protein EUGRSUZ_K01195                     311   8e-100   
ref|XP_006284388.1|  hypothetical protein CARUB_v10005558mg             311   8e-100   
gb|AFX61408.1|  AGAMOUS-like MADS-box transcription factor              310   9e-100   
gb|AFH74367.1|  AGAMOUS-like protein                                    310   9e-100   
gb|AER34989.1|  AGAMOUS-like protein                                    311   9e-100   
dbj|BAA90745.1|  MADS-box protein                                       311   9e-100   Rosa rugosa [Japanese rose]
gb|AFH74375.1|  AGAMOUS-like protein                                    310   9e-100   
gb|AAM33099.1|  TAG1 transcription factor                               309   1e-99    Solanum lycopersicum
gb|AHH28324.1|  MADS-box transcription factor                           309   1e-99    
dbj|BAA90746.1|  MADS-box protein                                       310   2e-99    Rosa rugosa [Japanese rose]
emb|CAA48635.1|  fbp6                                                   310   2e-99    Petunia x hybrida [garden petunia]
ref|NP_001289649.1|  glycogen debranching enzyme                        310   2e-99    
gb|AEO52692.1|  AGAMOUS-like protein                                    309   2e-99    
gb|AAX13303.1|  MADS box protein AGa                                    310   2e-99    Lotus japonicus
ref|XP_008794138.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    309   2e-99    
gb|AFH74368.1|  AGAMOUS-like protein                                    309   3e-99    
gb|AFH74371.1|  AGAMOUS-like protein                                    309   3e-99    
gb|AAS67610.1|  agamous MADS-box transcription factor 1a                309   3e-99    Crocus sativus [saffron crocus]
gb|AFH74399.1|  AGAMOUS-like protein                                    308   3e-99    
gb|AHH41528.1|  MADS-box transcription factor 1a                        308   4e-99    
gb|AAS67611.1|  agamous MADS-box transcription factor 1b                308   4e-99    Crocus sativus [saffron crocus]
dbj|BAF34914.1|  MADS-box protein                                       310   4e-99    Citrus unshiu [satsuma mandarin]
gb|AAY63868.1|  AGAMOUS                                                 309   4e-99    Brassica juncea [brown mustard]
gb|AFH74389.1|  AGAMOUS-like protein                                    308   4e-99    
gb|ABM69045.1|  MADS-box protein MADS7                                  308   5e-99    Gossypium hirsutum [American cotton]
gb|AFH74369.1|  AGAMOUS-like protein                                    308   5e-99    
gb|AFH74385.1|  AGAMOUS-like protein                                    308   5e-99    
dbj|BAA90743.1|  MADS-box protein                                       309   5e-99    Rosa rugosa [Japanese rose]
gb|AFH74386.1|  AGAMOUS-like protein                                    308   6e-99    
emb|CDX98597.1|  BnaA03g43820D                                          308   8e-99    
gb|AFH74370.1|  AGAMOUS-like protein                                    307   9e-99    
gb|AFH74382.1|  AGAMOUS-like protein                                    307   1e-98    
gb|AFH74390.1|  AGAMOUS-like protein                                    307   1e-98    
ref|XP_009612079.1|  PREDICTED: floral homeotic protein AGAMOUS i...    308   1e-98    
ref|XP_009762633.1|  PREDICTED: floral homeotic protein AGAMOUS i...    308   1e-98    
emb|CAE46181.1|  AGAMOUS-like MADS box transcription factor             307   1e-98    Elaeis guineensis
dbj|BAM71400.1|  transcription factor                                   307   2e-98    
gb|AAD38119.1|  AGAMOUS homolog                                         307   2e-98    Liquidambar styraciflua [American sweet gum]
ref|XP_003545122.1|  PREDICTED: agamous-like MADS-box protein AGL...    308   2e-98    
gb|AFK13160.1|  shatterproof                                            307   2e-98    
gb|AAB25101.1|  promotes sex organ development                          307   2e-98    Antirrhinum majus [garden snapdragon]
gb|AAQ54703.1|  AGAMOUS-like protein TaAG1                              306   2e-98    Thlaspi arvense
ref|XP_006595747.1|  PREDICTED: agamous-like MADS-box protein AGL...    306   3e-98    
ref|NP_001280758.1|  agamous-like MADS-box protein AGL1                 306   4e-98    
ref|XP_009421278.1|  PREDICTED: MADS-box transcription factor 3-like    306   4e-98    
gb|AAQ54707.1|  AGAMOUS-like protein GfAG3                              306   4e-98    Caulanthus flavescens
gb|AFI23876.1|  AGAMOUS1                                                305   6e-98    
ref|XP_009136975.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    308   6e-98    
ref|XP_009356654.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    306   8e-98    
ref|XP_003524982.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    305   1e-97    
gb|AFK35166.1|  unknown                                                 305   1e-97    
gb|ABD62864.1|  AG.1                                                    305   1e-97    Persea americana
gb|ADK95059.1|  mutant AGAMOUS-like protein                             304   1e-97    
ref|XP_008342376.1|  PREDICTED: agamous-like MADS-box protein AGL...    305   1e-97    
gb|AFU81322.1|  C-class MADS-box-like protein                           305   1e-97    
emb|CAC80857.1|  C-type MADS box protein                                305   1e-97    Malus domestica [apple tree]
gb|AFD36428.1|  AG-like MADS box transcription factor                   304   2e-97    
gb|AAY25577.1|  AG                                                      304   2e-97    Amborella trichopoda
ref|XP_004293647.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    305   2e-97    
gb|AAD19360.2|  AGAMOUS homolog transcription factor                    304   2e-97    Hyacinthus orientalis [common hyacinth]
ref|XP_007048826.1|  K-box region and MADS-box transcription fact...    304   2e-97    
ref|NP_001280918.1|  agamous-like MADS-box protein AGL1                 305   2e-97    
gb|AGK25050.1|  shatterproof                                            305   2e-97    
ref|XP_009136976.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    306   2e-97    
gb|AIJ29174.1|  AG-like MADS box protein                                304   2e-97    
ref|XP_004293646.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    305   3e-97    
ref|XP_006852690.1|  hypothetical protein AMTR_s00021p00254030          304   4e-97    
ref|XP_009612078.1|  PREDICTED: floral homeotic protein AGAMOUS i...    304   5e-97    
gb|AGK25046.1|  shatterproof                                            304   5e-97    
gb|AAZ53206.1|  AG2                                                     303   5e-97    Eschscholzia californica
ref|XP_009762632.1|  PREDICTED: floral homeotic protein AGAMOUS i...    304   6e-97    
gb|AAW78030.1|  AGAMOUS-like protein                                    303   8e-97    
ref|XP_009399817.1|  PREDICTED: MADS-box transcription factor 3-like    303   8e-97    
gb|AFU81372.1|  SHATTERPROOF                                            303   8e-97    
gb|ADC79698.1|  AGAMOUS-like protein                                    302   1e-96    
gb|AAQ54704.1|  AGAMOUS-like protein TaAG2                              302   1e-96    
gb|AAS45689.1|  AGAMOUS-like protein                                    301   2e-96    
gb|AAQ54706.1|  AGAMOUS-like protein GfAG2                              301   3e-96    
gb|AAQ54702.1|  AGAMOUS-like protein GfAG1                              301   3e-96    
gb|ABF50230.1|  AGAMOUS                                                 300   4e-96    
gb|AAQ54696.1|  AGAMOUS-like protein CsaAG                              301   4e-96    
gb|AAX69070.1|  MADS box protein M8                                     301   4e-96    
gb|AAQ54701.1|  AGAMOUS-like protein EsAG1                              301   4e-96    
gb|AAQ54699.1|  AGAMOUS-like protein LpAG                               300   6e-96    
gb|AGK25045.1|  shatterproof                                            300   1e-95    
gb|ADD25206.1|  AG3                                                     299   1e-95    
ref|XP_006484831.1|  PREDICTED: agamous-like MADS-box protein AGL...    300   1e-95    
ref|XP_002876479.1|  hypothetical protein ARALYDRAFT_486333             300   2e-95    
ref|XP_006575666.1|  PREDICTED: agamous-like MADS-box protein AGL...    300   2e-95    
ref|XP_009404530.1|  PREDICTED: floral homeotic protein AGAMOUS-like    299   2e-95    
ref|XP_010504841.1|  PREDICTED: agamous-like MADS-box protein AGL...    300   3e-95    
gb|AGK25043.1|  shatterproof                                            299   3e-95    
ref|XP_010504839.1|  PREDICTED: agamous-like MADS-box protein AGL...    299   3e-95    
gb|ADP06385.1|  AGAMOUS-LIKE1                                           300   3e-95    
gb|AAX13304.1|  MADS box protein AGb                                    298   4e-95    
gb|AHH28310.1|  MADS-box transcription factor                           296   8e-95    
gb|AAQ54700.1|  AGAMOUS-like protein EsAG2                              297   8e-95    
gb|AAD45814.1|AF168468_1  agamous protein                               298   1e-94    
gb|ABQ85949.1|  MADS-box transcription factor AG-like 2                 296   1e-94    
gb|ABK28609.1|  unknown                                                 298   2e-94    
ref|XP_008229393.1|  PREDICTED: floral homeotic protein AGAMOUS-like    297   2e-94    
ref|NP_191437.1|  agamous-like MADS-box protein AGL1                    297   2e-94    
ref|XP_010516534.1|  PREDICTED: agamous-like MADS-box protein AGL...    297   3e-94    
gb|AHH28309.1|  MADS-box transcription factor                           295   3e-94    
ref|XP_010516535.1|  PREDICTED: agamous-like MADS-box protein AGL...    296   3e-94    
ref|XP_006402748.1|  hypothetical protein EUTSA_v10006196mg             296   4e-94    
ref|XP_010504840.1|  PREDICTED: agamous-like MADS-box protein AGL...    298   4e-94    
ref|NP_001289652.1|  glycogen debranching enzyme                        296   4e-94    
ref|XP_002454985.1|  hypothetical protein SORBIDRAFT_03g002525          297   5e-94    
ref|XP_010057185.1|  PREDICTED: floral homeotic protein AGAMOUS i...    295   5e-94    
gb|ABO46006.1|  AGAMOUS-like protein                                    296   5e-94    
gb|AAS45683.1|  AGAMOUS-like protein                                    295   6e-94    
ref|XP_010427791.1|  PREDICTED: agamous-like MADS-box protein AGL...    296   6e-94    
gb|AGK25048.1|  shatterproof                                            295   6e-94    
dbj|BAK20021.1|  PgMADS protein6                                        295   6e-94    
ref|XP_010427788.1|  PREDICTED: agamous-like MADS-box protein AGL...    296   7e-94    
ref|XP_006584544.1|  PREDICTED: uncharacterized protein LOC100776...    296   7e-94    
ref|XP_003565181.1|  PREDICTED: MADS-box transcription factor 3 i...    295   3e-93    
ref|XP_010230593.1|  PREDICTED: MADS-box transcription factor 3 i...    295   3e-93    
gb|AGK25038.1|  shatterproof                                            293   3e-93    
gb|AGV31153.1|  C-class MADS-box protein                                293   3e-93    
gb|AGK25044.1|  shatterproof                                            293   3e-93    
ref|XP_010518865.1|  PREDICTED: floral homeotic protein AGAMOUS-like    296   3e-93    
gb|AAQ54698.1|  AGAMOUS-like protein CsAG2                              293   4e-93    
gb|ADD25188.1|  AG                                                      292   4e-93    
gb|AFO38187.1|  AGAMOUS1                                                293   4e-93    
gb|AGK25042.1|  shatterproof                                            293   4e-93    
dbj|BAG31394.1|  PLENA-like MADS-box protein                            294   5e-93    
gb|AAQ54697.1|  AGAMOUS-like protein CsAG1                              293   5e-93    
gb|ACD76827.1|  SHATTERPROOF1-like protein                              293   5e-93    
gb|ACY26070.1|  MADS-box transcription factor 3                         293   6e-93    
emb|CBY05399.1|  SHATTERPROOF2-like protein                             293   7e-93    
ref|XP_007048825.1|  K-box region and MADS-box transcription fact...    294   7e-93    
emb|CBY05404.1|  SHATTERPROOF1-like protein                             293   7e-93    
ref|XP_010915442.1|  PREDICTED: MADS-box transcription factor 3 i...    293   7e-93    
ref|NP_001242169.1|  uncharacterized protein LOC100776263               293   9e-93    
gb|AGK25041.1|  shatterproof                                            292   9e-93    
gb|AEQ75504.1|  MADS-domain transcription factor                        291   9e-93    
gb|ADJ95380.1|  AGAMOUS-like protein                                    292   1e-92    
gb|ACD76826.1|  SHATTERPROOF1a-like protein                             293   1e-92    
ref|XP_006295872.1|  hypothetical protein CARUB_v10025002mg             292   1e-92    
gb|AAQ54692.1|  AGAMOUS-like protein CrAG                               291   1e-92    
gb|AGK25037.1|  shatterproof                                            291   2e-92    
gb|ACD76825.1|  SCHATTERPROOF2-like protein                             292   2e-92    
emb|CBY05398.1|  SHATTERPROOF1-like protein                             292   2e-92    
gb|AAS45685.1|  AGAMOUS-like protein                                    291   2e-92    
gb|AGC31682.1|  MADS-box transcription factor                           291   2e-92    
gb|AAQ54695.1|  AGAMOUS-like protein CbpAG3                             291   2e-92    
dbj|BAG24495.1|  PLENA-like MADS-box protein                            292   3e-92    
ref|XP_011098072.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    291   4e-92    
gb|AAS45697.1|  AGAMOUS-like protein                                    290   4e-92    
ref|XP_006584622.1|  PREDICTED: agamous-like MADS-box protein AGL...    291   6e-92    
gb|ACD76824.1|  SHATTERPROOF2-like protein                              291   7e-92    
gb|ABB59995.1|  MADS-box protein                                        290   7e-92    
ref|XP_004513723.1|  PREDICTED: agamous-like MADS-box protein AGL...    290   8e-92    
ref|NP_001240100.1|  agamous-like MADS-box protein AGL1-like            290   8e-92    
gb|AAQ54693.1|  AGAMOUS-like protein CbpAG1                             290   8e-92    
gb|AFO38189.1|  AGAMOUS1                                                289   1e-91    
gb|AAQ54694.1|  AGAMOUS-like protein CbpAG2                             289   1e-91    
ref|NP_001289811.1|  MADS-box transcription factor 3                    290   2e-91    
gb|AAQ54705.1|  AGAMOUS-like protein EsAG3                              288   2e-91    
ref|XP_006411552.1|  hypothetical protein EUTSA_v10017047mg             289   2e-91    
ref|XP_004968556.1|  PREDICTED: MADS-box transcription factor 3-l...    290   3e-91    
emb|CBY05405.1|  SHATTERPROOF2-like protein                             289   3e-91    
gb|AAU82079.1|  SHATTERPROOF2                                           289   3e-91    
gb|AAX13305.1|  MADS box protein AGL1                                   288   3e-91    
ref|NP_850377.1|  agamous-like MADS-box protein AGL5                    289   3e-91    
sp|Q40704.1|MADS3_ORYSJ  RecName: Full=MADS-box transcription fac...    288   3e-91    
ref|XP_009104172.1|  PREDICTED: agamous-like MADS-box protein AGL1      289   3e-91    
gb|AAU82070.1|  SHATTERPROOF2                                           289   3e-91    
ref|NP_565986.1|  agamous-like MADS-box protein AGL5                    289   4e-91    
ref|XP_010538582.1|  PREDICTED: LOW QUALITY PROTEIN: floral homeo...    288   4e-91    
ref|XP_010506126.1|  PREDICTED: agamous-like MADS-box protein AGL...    288   5e-91    
ref|XP_010506124.1|  PREDICTED: agamous-like MADS-box protein AGL...    288   5e-91    
gb|AAS60204.1|  MADS-like protein RMADS222                              288   5e-91    
ref|XP_009116562.1|  PREDICTED: agamous-like MADS-box protein AGL1      288   7e-91    
ref|XP_002880005.1|  hypothetical protein ARALYDRAFT_321962             288   7e-91    
gb|ACA42767.1|  shatterproof 2                                          288   8e-91    
gb|AFL03398.1|  MADS box transcription factor AG-2                      286   8e-91    
gb|AIU94768.1|  class C MADS-domain transcription factor                286   1e-90    
gb|ADD25196.1|  AG                                                      287   1e-90    
gb|AHH28340.1|  MADS-box transcription factor                           286   1e-90    
gb|AFL03397.1|  MADS box transcription factor AG-1                      286   1e-90    
gb|AGB51137.1|  Shatterproof                                            287   1e-90    
ref|XP_009142866.1|  PREDICTED: agamous-like MADS-box protein AGL5      287   2e-90    
gb|AGB51138.1|  Shatterproof                                            286   2e-90    
gb|ACB45306.1|  MIKC-type MADS-box transcription factor WM29B           287   3e-90    
gb|AHH28306.1|  MADS-box transcription factor                           285   3e-90    
gb|AHH28341.1|  MADS-box transcription factor                           285   3e-90    
ref|XP_008781978.1|  PREDICTED: MADS-box transcription factor 3-like    286   3e-90    
gb|AAY25575.1|  AG                                                      285   4e-90    
emb|CDX98330.1|  BnaC06g16910D                                          286   5e-90    
ref|XP_006348940.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    286   5e-90    
gb|AGB51135.1|  Shatterproof                                            286   5e-90    
emb|CAD23407.1|  putative MADS-domain transcription factor              286   6e-90    
gb|AAL93196.1|AF486648_1  AGAMOUS-like protein 1 HvAG1                  285   6e-90    
ref|XP_008654205.1|  PREDICTED: AGAMOUS-like protein isoform X1         286   6e-90    
emb|CAM59077.1|  MIKC-type MADS-box transcription factor WM29B          286   7e-90    
ref|XP_006643880.1|  PREDICTED: MADS-box transcription factor 3-like    286   7e-90    
dbj|BAG31395.1|  PLENA-like MADS-box protein                            285   9e-90    
gb|AIU94769.1|  class C MADS-domain transcription factor                284   1e-89    
emb|CDX67765.1|  BnaA07g18050D                                          288   1e-89    
ref|XP_006602240.1|  PREDICTED: agamous-like MADS-box protein AGL...    285   1e-89    
ref|XP_003551911.1|  PREDICTED: agamous-like MADS-box protein AGL...    285   1e-89    
ref|XP_009138935.1|  PREDICTED: agamous-like MADS-box protein AGL1      285   1e-89    
gb|AGB51134.1|  Shatterproof                                            285   1e-89    
ref|XP_004968558.1|  PREDICTED: MADS-box transcription factor 3-l...    285   2e-89    
ref|XP_004968557.1|  PREDICTED: MADS-box transcription factor 3-l...    285   2e-89    
gb|AAS45702.1|  AGAMOUS-like protein                                    283   2e-89    
gb|AAY86365.1|  SEEDSTICK-like protein                                  283   3e-89    
ref|XP_009401103.1|  PREDICTED: MADS-box transcription factor 3-like    283   3e-89    
gb|AAY25576.1|  AG                                                      283   3e-89    
ref|XP_010530389.1|  PREDICTED: floral homeotic protein AGAMOUS-like    286   4e-89    
ref|NP_001105946.1|  AGAMOUS-like protein                               284   4e-89    
gb|AHH28318.1|  MADS-box transcription factor                           281   5e-89    
dbj|BAH56656.1|  MADS-box transcription factor                          284   6e-89    
ref|XP_006449579.1|  hypothetical protein CICLE_v10016427mg             281   7e-89    
ref|XP_010323606.1|  PREDICTED: TAGL1 transcription factor isofor...    283   9e-89    
dbj|BAG69623.1|  MADS-box transcription factor                          282   1e-88    
gb|ABQ08574.1|  MADS-box protein 2                                      282   1e-88    
gb|AAT46096.1|  AGAMOUS-like protein                                    281   1e-88    
ref|NP_001190130.1|  agamous-like MADS-box protein AGL1                 283   1e-88    
ref|NP_001078311.1|  agamous-like MADS-box protein AGL1                 281   2e-88    
gb|ACG32928.1|  MADS-box transcription factor 3                         282   2e-88    
dbj|BAG50399.1|  MADS-box transcription factor                          281   2e-88    
gb|AFI61557.1|  MADS-box protein 7                                      281   2e-88    
dbj|BAG69621.1|  MADS-box transcription factor                          281   2e-88    
gb|ADO23651.1|  agamous-like 1                                          281   2e-88    
dbj|BAC66963.1|  MADS-box transcription factor AG                       281   3e-88    
emb|CAM59076.1|  MIKC-type MADS-box transcription factor WM29A          282   3e-88    
gb|AAU82055.1|  SHATTERPROOF1                                           280   4e-88    
gb|AGB51136.1|  Shatterproof                                            281   4e-88    
ref|NP_001234187.1|  TAGL1 transcription factor                         281   4e-88    
gb|AHH28307.1|  MADS-box transcription factor                           279   5e-88    
ref|XP_010912706.1|  PREDICTED: MADS-box transcription factor 21-...    280   5e-88    
gb|AAK00646.1|AF226865_1  SHATTERPROOF1                                 281   6e-88    
gb|ACJ64682.1|  MADS-box protein MADS5                                  280   6e-88    
dbj|BAD83772.1|  MADS-box transcription factor                          280   8e-88    
dbj|BAB70737.1|  putative MADS-domain transcription factor MpMADS2      279   8e-88    
ref|XP_010525336.1|  PREDICTED: agamous-like MADS-box protein AGL...    280   1e-87    
emb|CAD23413.1|  m23                                                    281   1e-87    
gb|ABF57939.1|  MADS-box transcription factor TaAGL39                   280   1e-87    
emb|CAC38764.1|  putative agamous protein                               278   1e-87    
ref|XP_008794142.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    278   2e-87    
gb|AAS45681.1|  AGAMOUS-like protein                                    278   2e-87    
gb|ABB92624.1|  AGAMOUS-like protein                                    278   2e-87    
gb|KHN18105.1|  Agamous-like MADS-box protein AGL1                      278   3e-87    
gb|AIU94771.1|  class C MADS-domain transcription factor                277   3e-87    
ref|XP_010908080.1|  PREDICTED: MADS-box transcription factor 21-...    278   3e-87    
gb|AAT99428.1|  AG-like MADS-box protein                                280   3e-87    
gb|ADG63468.1|  agamous-like protein                                    279   3e-87    
gb|AHX58668.1|  AGAMOUS-like MADS-box transcription factor              278   3e-87    
gb|ADW08393.1|  AGAMOUS MADS box factor transcription factor            278   3e-87    
ref|XP_010525339.1|  PREDICTED: agamous-like MADS-box protein AGL...    278   4e-87    
dbj|BAK06517.1|  predicted protein                                      279   4e-87    
ref|XP_010525329.1|  PREDICTED: agamous-like MADS-box protein AGL...    279   5e-87    
gb|ABR68545.1|  AGAMOUS-like                                            276   5e-87    
gb|AIK66813.1|  AGAMOUS-like MADS-box protein                           278   5e-87    
dbj|BAD38889.1|  MADS box transcription factor                          278   6e-87    
gb|AAS45688.1|  AGAMOUS-like protein                                    276   7e-87    
gb|AAF08830.2|  transcription factor MADS1                              277   7e-87    
gb|AAY53908.1|  MADS-box protein MADS1                                  277   9e-87    
ref|XP_008443694.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    278   1e-86    
ref|XP_006293200.1|  hypothetical protein CARUB_v10019520mg             277   1e-86    
emb|CBY05410.1|  SHATTERPROOF2-like protein                             276   2e-86    
gb|AAS45694.1|  AGAMOUS-like protein                                    275   2e-86    
gb|AAD01743.1|  agamous-like putative transcription factor              277   2e-86    
ref|NP_001267656.1|  floral homeotic protein AGAMOUS-like               277   2e-86    
ref|XP_008443688.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    277   2e-86    
gb|AAS45695.1|  AGAMOUS-like protein                                    274   4e-86    
ref|XP_004169579.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    276   4e-86    
ref|XP_009421148.1|  PREDICTED: agamous-like MADS-box protein AGL11     275   4e-86    
gb|AAL93197.1|AF486649_1  AGAMOUS-like protein 2 HvAG2                  275   4e-86    
gb|AAS45705.1|  AGAMOUS-like protein                                    274   4e-86    
ref|NP_001288321.1|  MADS-box transcription factor 58-like              276   5e-86    
ref|XP_010230318.1|  PREDICTED: MADS-box transcription factor 58-...    276   6e-86    
gb|AHM92063.1|  MADS-box protein 3                                      275   9e-86    
gb|KHN47370.1|  Floral homeotic protein AGAMOUS                         274   1e-85    
gb|AEK94071.1|  AGAMOUS                                                 275   1e-85    
ref|XP_010230317.1|  PREDICTED: MADS-box transcription factor 58-...    276   2e-85    
gb|ABD62867.1|  AGAMOUS-like transcription factor                       272   2e-85    
gb|ACU18208.1|  unknown                                                 271   2e-85    
ref|XP_008794141.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    272   3e-85    
gb|KDP36700.1|  hypothetical protein JCGZ_07991                         272   4e-85    
gb|AHM92096.1|  MADS-box protein 20                                     272   5e-85    
gb|AHH28317.1|  MADS-box transcription factor                           271   6e-85    
ref|NP_001267506.1|  agamous-like MADS-box protein AGL11-like           272   7e-85    
ref|XP_010930411.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    272   8e-85    
gb|ADC53556.1|  AG MADS-box transcription factor                        271   1e-84    
gb|AHH28255.1|  MADS-box transcription factor                           270   1e-84    
gb|AHM92076.1|  MADS-box protein 58                                     271   2e-84    



>dbj|BAC97837.1| duplicated [Ipomoea nil]
 dbj|BAF36711.1| DUPLICATED protein [Ipomoea nil]
Length=247

 Score =   496 bits (1276),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 247/247 (100%), Positives = 247/247 (100%), Gaps = 0/247 (0%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN
Sbjct  121   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  180

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLRAKIIETERAQQQQQQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD
Sbjct  181   NQYLRAKIIETERAQQQQQQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  240

Query  335   HLPLQLV  315
             HLPLQLV
Sbjct  241   HLPLQLV  247



>ref|XP_009802759.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009802760.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Nicotiana 
sylvestris]
Length=247

 Score =   418 bits (1074),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/247 (84%), Positives = 226/247 (91%), Gaps = 0/247 (0%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGSISEAN Q+YQQEA+KLR QI NL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE L   +LRDLKNLE KIEKGISKIR+KKNELLFAEI+YMQKRQEIDLHNN
Sbjct  121   QNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKRQEIDLHNN  180

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLRAKI ETERAQQQQQQMNLMPGSSSY  + PPQQFD RNYLQ++G Q+ + Y++QD
Sbjct  181   NQYLRAKIAETERAQQQQQQMNLMPGSSSYELVPPPQQFDTRNYLQVNGLQTNNHYTRQD  240

Query  335   HLPLQLV  315
                LQLV
Sbjct  241   QPSLQLV  247



>ref|XP_006358066.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Solanum 
tuberosum]
Length=249

 Score =   412 bits (1060),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/249 (82%), Positives = 226/249 (91%), Gaps = 2/249 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGS+SEAN Q+YQQEA+KLR QI NL
Sbjct  61    LVVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE LG  N ++LK+LE KIEKGISKIR+KKNELLFAEI+YMQKRQE+DLHNN
Sbjct  121   QNQNRNMLGESLGSMNSKELKSLEQKIEKGISKIRSKKNELLFAEIEYMQKRQEVDLHNN  180

Query  515   NQYLRAKIIETERAqqqqqQMNLMPG-SSSYHELA-PPQQFDARNYLQLDGFQSTSSYSK  342
             NQYLRAKI ETERAQ Q QQMNLMPG SSSYHEL  PPQQFD RNYLQ++G Q+ + Y +
Sbjct  181   NQYLRAKIAETERAQHQHQQMNLMPGSSSSYHELVPPPQQFDTRNYLQVNGLQTNNHYPR  240

Query  341   QDHLPLQLV  315
             QD  P+QLV
Sbjct  241   QDQPPIQLV  249



>ref|XP_009802761.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009802762.1| PREDICTED: floral homeotic protein AGAMOUS isoform X3 [Nicotiana 
sylvestris]
Length=246

 Score =   412 bits (1058),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/247 (84%), Positives = 225/247 (91%), Gaps = 1/247 (0%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGSISEAN Q+YQQEA+KLR QI NL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE L   +LRDLKNLE KIEKGISKIR+KKNELLFAEI+YMQKR EIDLHNN
Sbjct  121   QNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKR-EIDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLRAKI ETERAQQQQQQMNLMPGSSSY  + PPQQFD RNYLQ++G Q+ + Y++QD
Sbjct  180   NQYLRAKIAETERAQQQQQQMNLMPGSSSYELVPPPQQFDTRNYLQVNGLQTNNHYTRQD  239

Query  335   HLPLQLV  315
                LQLV
Sbjct  240   QPSLQLV  246



>ref|XP_010315871.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Solanum 
lycopersicum]
Length=249

 Score =   412 bits (1058),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 225/249 (90%), Gaps = 2/249 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFS+RGRLYEYANNSVKATI+RYKKACSDS+NTGS+SEAN Q+YQQEA+KLR QI NL
Sbjct  61    LVVFSNRGRLYEYANNSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
              NQNRN MGE L G  L++LKNLE +IEKGISKIR+KKNELLFAEI+YMQKRQE+DLHNN
Sbjct  121   MNQNRNMMGEALAGMKLKELKNLEQRIEKGISKIRSKKNELLFAEIEYMQKRQEVDLHNN  180

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSS-YHELA-PPQQFDARNYLQLDGFQSTSSYSK  342
             NQYLRAKI ETERAQ Q QQMNLMPGSSS YHEL  PPQQFD RNYLQ++G Q+ + Y +
Sbjct  181   NQYLRAKIAETERAQHQHQQMNLMPGSSSNYHELVPPPQQFDTRNYLQVNGLQTNNHYPR  240

Query  341   QDHLPLQLV  315
             QD  P+QLV
Sbjct  241   QDQPPIQLV  249



>ref|XP_009586720.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586721.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Nicotiana 
tomentosiformis]
Length=249

 Score =   410 bits (1053),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 225/249 (90%), Gaps = 2/249 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGSISEAN Q+YQQEA+KLR QI NL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE L   +LRDLKNLE KIEKGISKIR+KKNELLFAEI+YMQKRQEIDLHNN
Sbjct  121   QNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKRQEIDLHNN  180

Query  515   NQYLRAKIIETERA--qqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSK  342
             NQYLRAKI ETERA  QQQQQQMNLMPGSSSY  + PP QFD RNYLQ++G Q+ + Y++
Sbjct  181   NQYLRAKIAETERAQQQQQQQQMNLMPGSSSYELVPPPHQFDTRNYLQVNGLQTNNHYTR  240

Query  341   QDHLPLQLV  315
             QD   LQLV
Sbjct  241   QDQPSLQLV  249



>gb|ADP06386.1| AGAMOUS-LIKE2 [Capsicum annuum]
Length=247

 Score =   409 bits (1051),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 225/248 (91%), Gaps = 2/248 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGSISEAN Q+YQQE++KLR QI NL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSISEANAQYYQQESSKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRNYMGE L   N R+L+NLE KIEKGISK+R+KKNE+LFAEI+YMQKR E+DLHNN
Sbjct  121   QNQNRNYMGEALAALNHRELRNLEQKIEKGISKVRSKKNEMLFAEIEYMQKR-EVDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELA-PPQQFDARNYLQLDGFQSTSSYSKQ  339
             NQYLRAKI ETERAQQ QQQMNLMPGSSS +EL  PPQQFD RNYLQ++G Q+ + Y +Q
Sbjct  180   NQYLRAKIAETERAQQHQQQMNLMPGSSSSYELVPPPQQFDTRNYLQVNGLQTNNHYPRQ  239

Query  338   DHLPLQLV  315
             D  PLQLV
Sbjct  240   DQPPLQLV  247



>sp|Q40885.1|AG_PETHY RecName: Full=Floral homeotic protein AGAMOUS; AltName: Full=pMADS3 
[Petunia x hybrida]
 emb|CAA51417.1| pMADS3 [Petunia x hybrida]
Length=242

 Score =   407 bits (1046),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 224/248 (90%), Gaps = 7/248 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGSI+EAN Q+YQQEA+KLR QI NL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSIAEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN++GE L   NLRDL+NLE KIEKGISKIRAKKNELLFAEI+YMQKR EIDLHNN
Sbjct  121   QNQNRNFLGESLAALNLRDLRNLEQKIEKGISKIRAKKNELLFAEIEYMQKR-EIDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQ-FDARNYLQLDGFQSTSSYSKQ  339
             NQYLRAKI ETER+    QQMNLMPGSSSY +L PPQQ FDARNYLQ++G Q+ + Y +Q
Sbjct  180   NQYLRAKIAETERS----QQMNLMPGSSSY-DLVPPQQSFDARNYLQVNGLQTNNHYPRQ  234

Query  338   DHLPLQLV  315
             D  PLQLV
Sbjct  235   DQPPLQLV  242



>gb|EYU28135.1| hypothetical protein MIMGU_mgv1a012605mg [Erythranthe guttata]
 gb|EYU28137.1| hypothetical protein MIMGU_mgv1a012605mg [Erythranthe guttata]
Length=245

 Score =   406 bits (1044),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 223/248 (90%), Gaps = 4/248 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQSDQSREMSPQRK GRGKI IKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFQSDQSREMSPQRKNGRGKIAIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVKATI+RYKKA SDS N GSISEANTQFYQQEA+KLR QI+NL
Sbjct  61    LIVFSSRGRLYEYSNNSVKATIERYKKASSDSPNNGSISEANTQFYQQEASKLRAQINNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE LGG NLRDLKNLESK+E+GIS+IR+KKNELLFAEI+YMQKRQEI+LH+N
Sbjct  121   QNQNRNMLGESLGGLNLRDLKNLESKVERGISRIRSKKNELLFAEIEYMQKRQEIELHHN  180

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTS-SYSKQ  339
             NQYLRAKI ETERA   QQ MNLMPGSSS++ L  PQ FDARNYLQ++G QS    Y+ Q
Sbjct  181   NQYLRAKIAETERA--HQQNMNLMPGSSSFN-LVQPQPFDARNYLQINGLQSNDHDYTVQ  237

Query  338   DHLPLQLV  315
             DH PLQLV
Sbjct  238   DHPPLQLV  245



>ref|XP_006358067.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006358068.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Solanum 
tuberosum]
Length=248

 Score =   406 bits (1044),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 225/249 (90%), Gaps = 3/249 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGS+SEAN Q+YQQEA+KLR QI NL
Sbjct  61    LVVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE LG  N ++LK+LE KIEKGISKIR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  121   QNQNRNMLGESLGSMNSKELKSLEQKIEKGISKIRSKKNELLFAEIEYMQKR-EVDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPG-SSSYHELA-PPQQFDARNYLQLDGFQSTSSYSK  342
             NQYLRAKI ETERAQ Q QQMNLMPG SSSYHEL  PPQQFD RNYLQ++G Q+ + Y +
Sbjct  180   NQYLRAKIAETERAQHQHQQMNLMPGSSSSYHELVPPPQQFDTRNYLQVNGLQTNNHYPR  239

Query  341   QDHLPLQLV  315
             QD  P+QLV
Sbjct  240   QDQPPIQLV  248



>gb|AGS44979.1| PFAG [Physalis pubescens]
Length=246

 Score =   405 bits (1042),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 221/248 (89%), Gaps = 3/248 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK TIDRYKKACSDS+N GSISEAN Q+YQQEA KLR QI NL
Sbjct  61    LIVFSSRGRLYEYANNSVKETIDRYKKACSDSSNNGSISEANAQYYQQEAAKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN+NRNY GE LG   LRDL+NLE KIEKG+SKIR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  121   QNENRNYQGECLGPLKLRDLRNLEQKIEKGLSKIRSKKNELLFAEIEYMQKR-EVDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELA-PPQQFDARNYLQLDGFQSTSSYSKQ  339
             NQYLRAKI ETERA  Q QQMNLMPGSSSYHEL  PPQQFD RNYLQ++G Q+ + Y +Q
Sbjct  180   NQYLRAKIAETERA-HQHQQMNLMPGSSSYHELVPPPQQFDTRNYLQVNGLQTNNHYPRQ  238

Query  338   DHLPLQLV  315
             D  PLQLV
Sbjct  239   DQPPLQLV  246



>ref|NP_001266181.1| floral homeotic protein AGAMOUS [Solanum lycopersicum]
 sp|Q40168.1|AG_SOLLC RecName: Full=Floral homeotic protein AGAMOUS; AltName: Full=TAG1 
[Solanum lycopersicum]
 gb|AAA34197.1| TAG1 [Solanum lycopersicum]
Length=248

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/249 (81%), Positives = 224/249 (90%), Gaps = 3/249 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFS+RGRLYEYANNSVKATI+RYKKACSDS+NTGS+SEAN Q+YQQEA+KLR QI NL
Sbjct  61    LVVFSNRGRLYEYANNSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
              NQNRN MGE L G  L++LKNLE +IEKGISKIR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  121   MNQNRNMMGEALAGMKLKELKNLEQRIEKGISKIRSKKNELLFAEIEYMQKR-EVDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSS-YHELA-PPQQFDARNYLQLDGFQSTSSYSK  342
             NQYLRAKI ETERAQ Q QQMNLMPGSSS YHEL  PPQQFD RNYLQ++G Q+ + Y +
Sbjct  180   NQYLRAKIAETERAQHQHQQMNLMPGSSSNYHELVPPPQQFDTRNYLQVNGLQTNNHYPR  239

Query  341   QDHLPLQLV  315
             QD  P+QLV
Sbjct  240   QDQPPIQLV  248



>dbj|BAB79434.1| PMADS3 [Petunia x hybrida]
Length=242

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 7/248 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGSI+EAN Q+YQQEA+KLR QI N 
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSIAEANAQYYQQEASKLRAQIGNX  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN++GE L   NLRDL+NLE KIEKGISKIRAKKNELLFAEI+YMQKR EIDLHNN
Sbjct  121   QNQNRNFLGESLAALNLRDLRNLEQKIEKGISKIRAKKNELLFAEIEYMQKR-EIDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQ-FDARNYLQLDGFQSTSSYSKQ  339
             NQYLRAKI ETER+    QQMNLMPGSSSY +L PPQQ FDARNYLQ++G Q+ + Y +Q
Sbjct  180   NQYLRAKIAETERS----QQMNLMPGSSSY-DLVPPQQSFDARNYLQVNGLQTNNHYPRQ  234

Query  338   DHLPLQLV  315
             D  PLQLV
Sbjct  235   DQPPLQLV  242



>ref|XP_009586722.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009586723.1| PREDICTED: floral homeotic protein AGAMOUS isoform X3 [Nicotiana 
tomentosiformis]
 sp|Q43585.1|AG_TOBAC RecName: Full=Floral homeotic protein AGAMOUS; AltName: Full=NAG1 
[Nicotiana tabacum]
 gb|AAA17033.1| NAG1 [Nicotiana tabacum]
Length=248

 Score =   403 bits (1036),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 205/249 (82%), Positives = 224/249 (90%), Gaps = 3/249 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGSISEAN Q+YQQEA+KLR QI NL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE L   +LRDLKNLE KIEKGISKIR+KKNELLFAEI+YMQKR EIDLHNN
Sbjct  121   QNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKR-EIDLHNN  179

Query  515   NQYLRAKIIETERA--qqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSK  342
             NQYLRAKI ETERA  QQQQQQMNLMPGSSSY  + PP QFD RNYLQ++G Q+ + Y++
Sbjct  180   NQYLRAKIAETERAQQQQQQQQMNLMPGSSSYELVPPPHQFDTRNYLQVNGLQTNNHYTR  239

Query  341   QDHLPLQLV  315
             QD   LQLV
Sbjct  240   QDQPSLQLV  248



>ref|XP_011102153.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Sesamum 
indicum]
 ref|XP_011102154.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Sesamum 
indicum]
Length=244

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/247 (81%), Positives = 217/247 (88%), Gaps = 3/247 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF SDQSREMSPQRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSDQSREMSPQRKNGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKA SDS+N GSISEANTQ+YQQEA+KLR QISNL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKASSDSSNNGSISEANTQYYQQEASKLRAQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE LG   LRDLKNLES++E+GIS+IR+KKNELLFAEI+YMQKRQEIDLH+N
Sbjct  121   QNQNRNMLGESLGALTLRDLKNLESRVERGISRIRSKKNELLFAEIEYMQKRQEIDLHHN  180

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQ+LRAKI ETERA   QQ MNLMPGSS +  +  PQ FDARNYLQ++G Q    Y + D
Sbjct  181   NQFLRAKIAETERA---QQHMNLMPGSSEFELVQQPQHFDARNYLQVNGLQPNDDYPRPD  237

Query  335   HLPLQLV  315
               PLQLV
Sbjct  238   QPPLQLV  244



>gb|EYU28136.1| hypothetical protein MIMGU_mgv1a012605mg [Erythranthe guttata]
Length=244

 Score =   400 bits (1027),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 222/248 (90%), Gaps = 5/248 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQSDQSREMSPQRK GRGKI IKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFQSDQSREMSPQRKNGRGKIAIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVKATI+RYKKA SDS N GSISEANTQFYQQEA+KLR QI+NL
Sbjct  61    LIVFSSRGRLYEYSNNSVKATIERYKKASSDSPNNGSISEANTQFYQQEASKLRAQINNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE LGG NLRDLKNLESK+E+GIS+IR+KKNELLFAEI+YMQKR EI+LH+N
Sbjct  121   QNQNRNMLGESLGGLNLRDLKNLESKVERGISRIRSKKNELLFAEIEYMQKR-EIELHHN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTS-SYSKQ  339
             NQYLRAKI ETERA   QQ MNLMPGSSS++ L  PQ FDARNYLQ++G QS    Y+ Q
Sbjct  180   NQYLRAKIAETERA--HQQNMNLMPGSSSFN-LVQPQPFDARNYLQINGLQSNDHDYTVQ  236

Query  338   DHLPLQLV  315
             DH PLQLV
Sbjct  237   DHPPLQLV  244



>gb|ADP09005.1| AGAMOUS-like protein [Lycium barbarum]
Length=248

 Score =   400 bits (1027),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 220/249 (88%), Gaps = 3/249 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRG+LYEYANNSVK TI+RYKKACSDS+NTGSISEAN Q+YQQEA+KLR QI N 
Sbjct  61    LIVFSSRGKLYEYANNSVKETIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNP  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN+MGE L   NLRDLKNLE KIEKGISK+R+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  121   QNQNRNFMGESLASLNLRDLKNLEQKIEKGISKVRSKKNELLFAEIEYMQKR-EVDLHNN  179

Query  515   NQYLRAKIIETERA--qqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSK  342
             NQYLRAKI ETERA  Q Q QQMNLMPGSSSY  L PPQQFD RNYLQ++G QS +   +
Sbjct  180   NQYLRAKIAETERAQHQHQHQQMNLMPGSSSYELLPPPQQFDTRNYLQVNGLQSNNHCPR  239

Query  341   QDHLPLQLV  315
             QD   LQLV
Sbjct  240   QDQPSLQLV  248



>gb|AFK13159.1| agamous [Nicotiana benthamiana]
Length=247

 Score =   396 bits (1018),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 221/248 (89%), Gaps = 2/248 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK TI+RYKKACSDS+NT SISEAN Q+YQQEA+KLR QI NL
Sbjct  61    LIVFSSRGRLYEYANNSVKETIERYKKACSDSSNTDSISEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN+NRN +GE L   +LRDLKNLE  IEKGISKIR+KKNELLFAEI+YMQKR EIDLHNN
Sbjct  121   QNKNRNMLGECLAALSLRDLKNLEQNIEKGISKIRSKKNELLFAEIEYMQKR-EIDLHNN  179

Query  515   NQYLRAKIIETERA-qqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQ  339
             NQYLRAKI ETERA QQQQQQMNLMPGSSSY  + PPQQFD RNYLQ++G Q+   Y++Q
Sbjct  180   NQYLRAKIAETERAQQQQQQQMNLMPGSSSYELVHPPQQFDTRNYLQVNGLQTNDHYTRQ  239

Query  338   DHLPLQLV  315
             D   LQLV
Sbjct  240   DQPSLQLV  247



>ref|XP_011102155.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Sesamum 
indicum]
Length=243

 Score =   395 bits (1015),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 198/247 (80%), Positives = 216/247 (87%), Gaps = 4/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF SDQSREMSPQRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSDQSREMSPQRKNGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKA SDS+N GSISEANTQ+YQQEA+KLR QISNL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKASSDSSNNGSISEANTQYYQQEASKLRAQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE LG   LRDLKNLES++E+GIS+IR+KKNELLFAEI+YMQKR EIDLH+N
Sbjct  121   QNQNRNMLGESLGALTLRDLKNLESRVERGISRIRSKKNELLFAEIEYMQKR-EIDLHHN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQ+LRAKI ETERA   QQ MNLMPGSS +  +  PQ FDARNYLQ++G Q    Y + D
Sbjct  180   NQFLRAKIAETERA---QQHMNLMPGSSEFELVQQPQHFDARNYLQVNGLQPNDDYPRPD  236

Query  335   HLPLQLV  315
               PLQLV
Sbjct  237   QPPLQLV  243



>gb|AIS82595.1| AGAMOUS [Sesamum indicum]
Length=244

 Score =   390 bits (1003),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 194/247 (79%), Positives = 214/247 (87%), Gaps = 3/247 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF SDQSREMSPQRK GRG+IEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSDQSREMSPQRKNGRGEIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKA SDS+N GSISEANTQ+YQQEA+KLR QISNL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKASSDSSNNGSISEANTQYYQQEASKLRAQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE LG   LRDLKNLES++E+GIS+IR+KKNELLFAEI+YMQKRQEIDLH+N
Sbjct  121   QNQNRNMLGESLGALTLRDLKNLESRVERGISRIRSKKNELLFAEIEYMQKRQEIDLHHN  180

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQ+L AKI ETERA   QQ MNLMPGSS +  +  PQ FDARNYL++ G Q    + + D
Sbjct  181   NQFLPAKIAETERA---QQHMNLMPGSSEFELVQQPQHFDARNYLEVGGLQPNDDHPRPD  237

Query  335   HLPLQLV  315
               PL LV
Sbjct  238   QPPLLLV  244



>ref|XP_011085307.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Sesamum 
indicum]
Length=244

 Score =   390 bits (1002),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 190/247 (77%), Positives = 217/247 (88%), Gaps = 3/247 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF SDQ+REMS +RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSDQTREMSSERKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKA SDS N+GS+SEANTQ+YQQEA+KLR QISNL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKATSDSPNSGSVSEANTQYYQQEASKLRAQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQN+N +GE LG   LR+LKNLE+++E+GISKIR+KKNELL+AEI+YMQKRQEIDLH+N
Sbjct  121   QNQNKNMLGESLGALTLRELKNLETRVERGISKIRSKKNELLYAEIEYMQKRQEIDLHHN  180

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             N +LRAKI ETER    QQ M+LMPG+S YHEL   Q FD+R+YLQ+ G Q+ + Y +QD
Sbjct  181   NHFLRAKIAETERG---QQHMSLMPGNSEYHELVQSQPFDSRDYLQVSGLQTHNGYPRQD  237

Query  335   HLPLQLV  315
               PLQLV
Sbjct  238   QPPLQLV  244



>ref|XP_011085305.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Sesamum 
indicum]
 ref|XP_011085306.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Sesamum 
indicum]
Length=245

 Score =   386 bits (992),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 217/248 (88%), Gaps = 4/248 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF SDQ+REMS +RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSDQTREMSSERKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNS-VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISN  699
             LIVFSSRGRLYEYANNS VKATI+RYKKA SDS N+GS+SEANTQ+YQQEA+KLR QISN
Sbjct  61    LIVFSSRGRLYEYANNSSVKATIERYKKATSDSPNSGSVSEANTQYYQQEASKLRAQISN  120

Query  698   LQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHN  519
             LQNQN+N +GE LG   LR+LKNLE+++E+GISKIR+KKNELL+AEI+YMQKRQEIDLH+
Sbjct  121   LQNQNKNMLGESLGALTLRELKNLETRVERGISKIRSKKNELLYAEIEYMQKRQEIDLHH  180

Query  518   NNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQ  339
             NN +LRAKI ETER    QQ M+LMPG+S YHEL   Q FD+R+YLQ+ G Q+ + Y +Q
Sbjct  181   NNHFLRAKIAETERG---QQHMSLMPGNSEYHELVQSQPFDSRDYLQVSGLQTHNGYPRQ  237

Query  338   DHLPLQLV  315
             D  PLQLV
Sbjct  238   DQPPLQLV  245



>dbj|BAI59709.1| MADS-box transcription factor [Lobelia erinus]
Length=241

 Score =   384 bits (987),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/247 (80%), Positives = 215/247 (87%), Gaps = 6/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F SD S E+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSFPSD-SGEISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK TI+RYKKACSD  N+GS+SEAN QFYQQEA KLRQQISNL
Sbjct  60    LIVFSSRGRLYEYANNSVKGTIERYKKACSDPPNSGSVSEANAQFYQQEAAKLRQQISNL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN MGE LG    +DLK+LE+K+EKGISKIR+KKNELLFAEI+YMQKR EIDLHN+
Sbjct  120   QNQNRNMMGESLGSLGPKDLKSLETKLEKGISKIRSKKNELLFAEIEYMQKR-EIDLHNS  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLRAKI E ERA   QQ M+LMPGSS Y EL  PQ FDARNYLQ++G Q  ++YS+QD
Sbjct  179   NQYLRAKIAENERA---QQHMSLMPGSSDY-ELVQPQPFDARNYLQVNGLQPNNNYSRQD  234

Query  335   HLPLQLV  315
               PLQLV
Sbjct  235   QTPLQLV  241



>ref|XP_011085309.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X4 [Sesamum 
indicum]
Length=243

 Score =   384 bits (985),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/247 (77%), Positives = 216/247 (87%), Gaps = 4/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF SDQ+REMS +RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSDQTREMSSERKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKA SDS N+GS+SEANTQ+YQQEA+KLR QISNL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKATSDSPNSGSVSEANTQYYQQEASKLRAQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQN+N +GE LG   LR+LKNLE+++E+GISKIR+KKNELL+AEI+YMQKR EIDLH+N
Sbjct  121   QNQNKNMLGESLGALTLRELKNLETRVERGISKIRSKKNELLYAEIEYMQKR-EIDLHHN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             N +LRAKI ETER    QQ M+LMPG+S YHEL   Q FD+R+YLQ+ G Q+ + Y +QD
Sbjct  180   NHFLRAKIAETERG---QQHMSLMPGNSEYHELVQSQPFDSRDYLQVSGLQTHNGYPRQD  236

Query  335   HLPLQLV  315
               PLQLV
Sbjct  237   QPPLQLV  243



>emb|CAB42988.1| MADS-box transcription factor [Antirrhinum majus]
 dbj|BAI68392.1| FARINELLI protein [Antirrhinum majus]
Length=246

 Score =   382 bits (982),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 215/244 (88%), Gaps = 3/244 (1%)
 Frame = -1

Query  1043  SDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVF  864
             SDQS E+SP+RK+GRGKIEIKRIEN TN+QVTFCKRRNGLLKKAYELSVLCDAEVAL+VF
Sbjct  5     SDQSTEVSPERKIGRGKIEIKRIENKTNQQVTFCKRRNGLLKKAYELSVLCDAEVALVVF  64

Query  863   SSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQN  684
             SSRGRLYEYANNSVKATIDRYKKA SDS+  GSISEANTQ+YQQEA+KLR QISNLQNQN
Sbjct  65    SSRGRLYEYANNSVKATIDRYKKASSDSSLNGSISEANTQYYQQEASKLRAQISNLQNQN  124

Query  683   RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYL  504
             RN +GE LG  +LR+LKNLES++E+GIS+IR+KKNELLFAEI+YMQKRQEIDLH+NNQYL
Sbjct  125   RNMLGESLGALSLRELKNLESRVERGISRIRSKKNELLFAEIEYMQKRQEIDLHHNNQYL  184

Query  503   RAKIIETERAqqqqqQMNLMP-GSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLP  327
             RAKI E+ER   Q Q MNLMP GSS Y +L   Q FDARNYLQ++G Q  + Y +QD LP
Sbjct  185   RAKIAESERV--QGQHMNLMPGGSSGYEQLVETQPFDARNYLQVNGLQPNNDYPRQDQLP  242

Query  326   LQLV  315
             LQLV
Sbjct  243   LQLV  246



>sp|Q40872.1|AG_PANGI RecName: Full=Floral homeotic protein AGAMOUS; AltName: Full=GAG2 
[Panax ginseng]
 emb|CAA86585.1| agamous [Panax ginseng]
 dbj|BAK20020.1| PgMADS protein5 [Panax ginseng]
Length=242

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/247 (77%), Positives = 212/247 (86%), Gaps = 5/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F  DQS  +SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSFYDDQSGNLSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSVK TI+RYKKAC+DS NT S+SEAN QFYQQEA+KLRQ+IS++
Sbjct  61    LIVFSTRGRLYEYANNSVKGTIERYKKACTDSPNTSSVSEANAQFYQQEASKLRQEISSI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NRN MGE LG   +RDLK LE+K+EKGIS+IR+KKNELLFAEI+YMQK+ EIDLHNN
Sbjct  121   QKNNRNMMGESLGSLTVRDLKGLETKLEKGISRIRSKKNELLFAEIEYMQKK-EIDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLRAKI E ERA   QQ MNLMPGSS Y ELAPPQ FD RNY+QL+G Q  + YS+QD
Sbjct  180   NQYLRAKIAENERA---QQHMNLMPGSSDY-ELAPPQSFDGRNYIQLNGLQPNNHYSRQD  235

Query  335   HLPLQLV  315
                LQLV
Sbjct  236   QTALQLV  242



>ref|XP_011085308.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Sesamum 
indicum]
Length=244

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 216/248 (87%), Gaps = 5/248 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF SDQ+REMS +RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSDQTREMSSERKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNS-VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISN  699
             LIVFSSRGRLYEYANNS VKATI+RYKKA SDS N+GS+SEANTQ+YQQEA+KLR QISN
Sbjct  61    LIVFSSRGRLYEYANNSSVKATIERYKKATSDSPNSGSVSEANTQYYQQEASKLRAQISN  120

Query  698   LQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHN  519
             LQNQN+N +GE LG   LR+LKNLE+++E+GISKIR+KKNELL+AEI+YMQKR EIDLH+
Sbjct  121   LQNQNKNMLGESLGALTLRELKNLETRVERGISKIRSKKNELLYAEIEYMQKR-EIDLHH  179

Query  518   NNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQ  339
             NN +LRAKI ETER    QQ M+LMPG+S YHEL   Q FD+R+YLQ+ G Q+ + Y +Q
Sbjct  180   NNHFLRAKIAETERG---QQHMSLMPGNSEYHELVQSQPFDSRDYLQVSGLQTHNGYPRQ  236

Query  338   DHLPLQLV  315
             D  PLQLV
Sbjct  237   DQPPLQLV  244



>dbj|BAI59708.1| MADS-box transcription factor [Lobelia erinus]
Length=245

 Score =   378 bits (971),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 197/251 (78%), Positives = 215/251 (86%), Gaps = 10/251 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F SD S E+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSFPSD-SGEISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK TI+RYKKACSD  N+GS+SEAN QFYQQEA KLRQQISNL
Sbjct  60    LIVFSSRGRLYEYANNSVKGTIERYKKACSDPPNSGSVSEANAQFYQQEAAKLRQQISNL  119

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE LG    +DLK+LE+K+EKGISKIR+KKNELLFAEI+YMQKR EID
Sbjct  120   QNQNRQFYRNMMGESLGSLGPKDLKSLETKLEKGISKIRSKKNELLFAEIEYMQKR-EID  178

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHN+NQYLRAKI E ERA   QQ M+LMPGSS Y EL  PQ FDARNYLQ++G Q  ++Y
Sbjct  179   LHNSNQYLRAKIAENERA---QQHMSLMPGSSDY-ELVQPQPFDARNYLQVNGLQPNNNY  234

Query  347   SKQDHLPLQLV  315
             S+QD  PLQLV
Sbjct  235   SRQDQTPLQLV  245



>emb|CAJ44130.1| farinelli protein [Misopates orontium]
Length=247

 Score =   378 bits (970),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 190/245 (78%), Positives = 216/245 (88%), Gaps = 4/245 (2%)
 Frame = -1

Query  1043  SDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVF  864
             SDQS E+SP+RK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE+AL+VF
Sbjct  5     SDQSTEVSPERKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALVVF  64

Query  863   SSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQN  684
             SSRGRLYEYANNSVK TIDRYKKA SDS+  GSISEANTQ+YQQEA+KLR QISNLQNQN
Sbjct  65    SSRGRLYEYANNSVKETIDRYKKASSDSSLNGSISEANTQYYQQEASKLRAQISNLQNQN  124

Query  683   RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYL  504
             RN +GE LG  +LR+LKNLES++E+GIS+IR+KKNELLFAEI+YMQKRQEIDLH+NNQYL
Sbjct  125   RNMLGESLGALSLRELKNLESRVERGISRIRSKKNELLFAEIEYMQKRQEIDLHHNNQYL  184

Query  503   RAKIIETERAqqqqqQMNLMP-GSSSYHELAPPQQFDARNYLQLDGFQSTSS-YSKQDHL  330
             RAKI E+ER   Q Q MNLMP GSS + +L   Q FDARNYLQ++G Q  ++ Y +QD L
Sbjct  185   RAKIAESERV--QGQHMNLMPGGSSGFEQLVETQPFDARNYLQVNGLQQPNNDYPRQDQL  242

Query  329   PLQLV  315
             PLQLV
Sbjct  243   PLQLV  247



>dbj|BAG24494.1| FARINELLI-like MADS-box protein [Torenia fournieri]
Length=252

 Score =   378 bits (970),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 196/255 (77%), Positives = 220/255 (86%), Gaps = 11/255 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             ME QSDQSRE+SPQRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEIQSDQSREISPQRKNGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFSSRGRLYEYANNSVKATI+RYKKA SDS+N GSISEANTQ+YQQEA+KLR QISNL
Sbjct  61    LVVFSSRGRLYEYANNSVKATIERYKKASSDSSNNGSISEANTQYYQQEASKLRAQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN N+N +GE LG   L+DL+NLESK+EKGIS+IR+KKNELLFAEI+YMQKRQEIDLH+N
Sbjct  121   QNHNKNMLGEALGALTLKDLRNLESKVEKGISRIRSKKNELLFAEIEYMQKRQEIDLHHN  180

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL--APPQQFDAR--NYLQLDGFQ---ST  357
             NQYLRA+I ETERA   QQQMNLMPGSS  +EL  AP + F AR  NYLQ++  Q   ST
Sbjct  181   NQYLRARIAETERA---QQQMNLMPGSSEQYELVQAPHEAFHARSGNYLQVNNLQQPTST  237

Query  356   SSY-SKQDHLPLQLV  315
             ++Y ++ D   L LV
Sbjct  238   NNYPARHDQTSLHLV  252



>gb|ABF50231.1| AGAMOUS, partial [Nicotiana langsdorffii x Nicotiana sanderae]
Length=229

 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 193/230 (84%), Positives = 208/230 (90%), Gaps = 2/230 (1%)
 Frame = -1

Query  1001  RGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSV  822
             RGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSV CDAEVALIVFSSRGRLYEYANNSV
Sbjct  1     RGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVPCDAEVALIVFSSRGRLYEYANNSV  60

Query  821   KATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFNLR  642
             KATI+RYKKACSDS+NTGSISEAN Q+YQQEA+KLR QI NLQNQNRN +GE L   +LR
Sbjct  61    KATIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLAALSLR  120

Query  641   DLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERA-qqq  465
             DLKNLE KIEKGISKIR+KKNELLFAEI+YMQKR EIDLHNNNQYLRAKI ETERA QQQ
Sbjct  121   DLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKR-EIDLHNNNQYLRAKIAETERAQQQQ  179

Query  464   qqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             QQQMNLMPGSSSY  + PPQQFD RNYLQ++G Q+ + Y++QDH  LQLV
Sbjct  180   QQQMNLMPGSSSYELVPPPQQFDTRNYLQVNGLQTNNHYTRQDHPSLQLV  229



>ref|XP_006358069.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X4 [Solanum 
tuberosum]
Length=234

 Score =   372 bits (956),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 189/249 (76%), Positives = 211/249 (85%), Gaps = 17/249 (7%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGS+SEAN Q+YQQEA+KLR QI NL
Sbjct  61    LVVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE LG  N ++LK+LE KIEKGISKIR+KKNELLFAEI+YMQKR        
Sbjct  121   QNQNRNMLGESLGSMNSKELKSLEQKIEKGISKIRSKKNELLFAEIEYMQKR--------  172

Query  515   NQYLRAKIIETERAqqqqqQMNLMPG-SSSYHELA-PPQQFDARNYLQLDGFQSTSSYSK  342
                    I ETERAQ Q QQMNLMPG SSSYHEL  PPQQFD RNYLQ++G Q+ + Y +
Sbjct  173   -------IAETERAQHQHQQMNLMPGSSSSYHELVPPPQQFDTRNYLQVNGLQTNNHYPR  225

Query  341   QDHLPLQLV  315
             QD  P+QLV
Sbjct  226   QDQPPIQLV  234



>emb|CDO96907.1| unnamed protein product [Coffea canephora]
Length=266

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/247 (76%), Positives = 208/247 (84%), Gaps = 5/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M  QSD SRE SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSCQSDPSRETSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSVK TI RYK   SDS NTGSISEAN Q YQQEA+KLR QISNL
Sbjct  61    LIVFSNRGRLYEYANNSVKETIKRYKTVNSDSANTGSISEANAQHYQQEASKLRAQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NRN +GE LG  NLR+LKN+ESK+E+GIS++R+KKNELLFAEI++MQKR E+DLHNN
Sbjct  121   QNSNRNMLGESLGSLNLRELKNIESKVERGISRVRSKKNELLFAEIEFMQKR-EVDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLR+KI ETERA   Q  MNLMPGSS Y EL   Q FDAR +LQ++G Q  + Y +Q+
Sbjct  180   NQYLRSKIAETERA---QHDMNLMPGSSDY-ELVSAQPFDARTFLQVNGLQLNNHYPRQE  235

Query  335   HLPLQLV  315
               PLQLV
Sbjct  236   QRPLQLV  242



>gb|ADU56831.1| MADS-box protein AG subfamily [Coffea arabica]
 gb|AHW58037.1| AG [Coffea arabica]
Length=242

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 208/247 (84%), Gaps = 5/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M  QSD SRE SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSCQSDPSRETSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSVK TI RYK   SDS NTGSISEAN Q YQQEA+KLR QISNL
Sbjct  61    LIVFSNRGRLYEYANNSVKETIKRYKTVNSDSANTGSISEANAQHYQQEASKLRAQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NRN +GE LG  NLR+LKN+ESK+E+GIS++R+KKNELLFAEI++MQKR E+DLHNN
Sbjct  121   QNSNRNMLGESLGSLNLRELKNIESKVERGISRVRSKKNELLFAEIEFMQKR-EVDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLR+KI ETERA   Q  MNL+PGSS Y EL   Q FDAR +LQ++G Q  + Y +Q+
Sbjct  180   NQYLRSKIAETERA---QHDMNLVPGSSDY-ELVSAQPFDARTFLQVNGLQLNNHYPRQE  235

Query  335   HLPLQLV  315
               PLQLV
Sbjct  236   QRPLQLV  242



>dbj|BAG74745.1| HmAGAMOUS protein [Hydrangea macrophylla]
Length=251

 Score =   363 bits (931),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 193/253 (76%), Positives = 216/253 (85%), Gaps = 8/253 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  +QS E+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEF-PNQSGEISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSVK TI+RYKKACSDSTNTGS++E N Q YQQEA+KLR QI+NL
Sbjct  60    LIVFSTRGRLYEYANNSVKGTIERYKKACSDSTNTGSVAEINAQQYQQEASKLRSQIANL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NRN +GE LG  + RDLKNLE ++E+GIS+IR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  120   QNSNRNMLGESLGSLSPRDLKNLEGRLERGISRIRSKKNELLFAEIEYMQKR-EVDLHNN  178

Query  515   NQYLRAKIIETERA---qqqqqQMNLMPGSSSY-HELAPPQQ-FDARNYLQLDGFQSTS-  354
             NQYLRAKI E ERA   QQ QQQMNLMPG  S  +EL PP Q FDARNYLQ++G QS + 
Sbjct  179   NQYLRAKIAENERAQQQQQHQQQMNLMPGGGSCEYELMPPTQPFDARNYLQINGLQSNNH  238

Query  353   SYSKQDHLPLQLV  315
              YS+ D   LQLV
Sbjct  239   HYSRDDQTALQLV  251



>emb|CAN83827.1| hypothetical protein VITISV_030947 [Vitis vinifera]
Length=251

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 214/247 (87%), Gaps = 7/247 (3%)
 Frame = -1

Query  1052  EFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL  873
             +FQ +QSRE+SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL
Sbjct  11    DFQ-NQSREVSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL  69

Query  872   IVFSSRGRLYEYANNS-VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             IVFSSRGRLYEYANNS VK+TI+RYKKA +DS+NTGS+SEAN QFYQQE++KL QQI NL
Sbjct  70    IVFSSRGRLYEYANNSSVKSTIERYKKASADSSNTGSVSEANAQFYQQESSKLHQQIRNL  129

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE LG  N +DLK+LE ++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHN+
Sbjct  130   QNSNRHMLGESLGSLNFKDLKSLEIRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHND  188

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLRA+I E ER    +QQM+LMP  ++Y EL P QQFD+RNY QL+G Q   SYS+QD
Sbjct  189   NQYLRARIAENER---NZQQMSLMPXGANY-ELMPSQQFDSRNYFQLNGLQPNQSYSRQD  244

Query  335   HLPLQLV  315
                LQLV
Sbjct  245   QPALQLV  251



>emb|CAA08801.1| MADS-box protein, GAGA2 [Gerbera hybrid cultivar]
Length=246

 Score =   360 bits (924),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 187/251 (75%), Positives = 209/251 (83%), Gaps = 9/251 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F +D S EMSPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSFPND-SGEMSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK TIDRYKKAC D  ++GS++EAN QFYQQEA KLRQQI+NL
Sbjct  60    LIVFSSRGRLYEYANNSVKGTIDRYKKACLDPPSSGSVAEANAQFYQQEAAKLRQQIANL  119

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE LG    +DLKNLESK+EKGI KIR+KKNE+LFAEI+YMQKR E +
Sbjct  120   QNQNRQFYRNIMGESLGNMPAKDLKNLESKLEKGIGKIRSKKNEILFAEIEYMQKR-ENE  178

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHN+NQ+LR+KI E ERA   QQ M+LMPGSS Y  +AP Q FD RNYLQ++  Q  ++Y
Sbjct  179   LHNSNQFLRSKIAENERA---QQHMSLMPGSSDYELVAPHQPFDGRNYLQVNDLQPNNNY  235

Query  347   SKQDHLPLQLV  315
             S QD  PLQLV
Sbjct  236   SCQDQTPLQLV  246



>gb|AGV40795.1| MADS-box transcription factor 12 [Pisum sativum]
Length=248

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/245 (73%), Positives = 205/245 (84%), Gaps = 4/245 (2%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             +QS   SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  5     NQSMSDSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  64

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             SRGRLYEYANNSVKATI+RYKKACSDS+ TGS SEAN QFYQQEA+KLR QISNLQN NR
Sbjct  65    SRGRLYEYANNSVKATIERYKKACSDSSGTGSASEANAQFYQQEADKLRVQISNLQNNNR  124

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
               MGE LG  N ++LKNLESK+EKGIS+IR+KKNELLFAEI+YMQ+R EIDLHNNNQ LR
Sbjct  125   QMMGESLGSMNAKELKNLESKLEKGISRIRSKKNELLFAEIEYMQRR-EIDLHNNNQLLR  183

Query  500   AKIIETERAqqqqqQMNLMPGSSSYHELAP--PQQFDARNYLQLDGFQSTSS-YSKQDHL  330
             AKI E+ER       ++++PG ++Y  +     QQ+D+R Y Q+ G QS+SS Y +QD +
Sbjct  184   AKIAESERNHHHNINLSVLPGGTNYETMQSQTQQQYDSRGYFQVSGLQSSSSQYGRQDQM  243

Query  329   PLQLV  315
              LQLV
Sbjct  244   SLQLV  248



>emb|CAA08800.1| MADS-box protein, GAGA1 [Gerbera hybrid cultivar]
Length=264

 Score =   358 bits (920),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/251 (73%), Positives = 207/251 (82%), Gaps = 8/251 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F  D + +MSPQRKMG+GKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  18    MSF-PDDTGDMSPQRKMGKGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  76

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK TID+YKKAC D   +G+++EANTQ+YQQEA KLRQQI+NL
Sbjct  77    LIVFSSRGRLYEYANNSVKGTIDKYKKACLDPPTSGTVAEANTQYYQQEAAKLRQQIANL  136

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE LG   ++DLKNLE K+EK IS+IRAKKNELLFAEI+YMQKR E++
Sbjct  137   QNQNRQFYRNIMGESLGDMPVKDLKNLEGKLEKAISRIRAKKNELLFAEIEYMQKR-ELE  195

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHN+NQ+LRAKI+E ERA  QQ  M+LMPGSS Y  + P Q FD RNYLQ +  Q  + Y
Sbjct  196   LHNSNQFLRAKIVENERA--QQHHMSLMPGSSDYELVTPHQPFDGRNYLQTNDLQPNNDY  253

Query  347   SKQDHLPLQLV  315
             S QD  PLQLV
Sbjct  254   SCQDQTPLQLV  264



>gb|AAO18229.1| MADS-box transcriptional factor HAM59 [Helianthus annuus]
Length=247

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 187/251 (75%), Positives = 208/251 (83%), Gaps = 8/251 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F  ++S EMSPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSF-PNESGEMSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK TIDRYKKAC D  ++GS++EAN QFYQQEA KLRQQI+NL
Sbjct  60    LIVFSSRGRLYEYANNSVKGTIDRYKKACLDPPSSGSVAEANAQFYQQEAAKLRQQIANL  119

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE LG    +DLKNLE K+EKGIS+IR+KKNELLFAEI+YM KR E +
Sbjct  120   QNQNRQFYRNIMGESLGNMPAKDLKNLEGKLEKGISRIRSKKNELLFAEIEYMPKR-ENE  178

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHNNNQ+LRAKI E ER+  QQQ M+LMPGSS Y  + P Q FD RNYLQ++  Q  +SY
Sbjct  179   LHNNNQFLRAKIAENERS--QQQHMSLMPGSSDYDLVPPHQPFDGRNYLQVNDLQPNNSY  236

Query  347   SKQDHLPLQLV  315
             S QD  PLQLV
Sbjct  237   SCQDQTPLQLV  247



>gb|AFP99884.1| AGAMOUS [Fraxinus pennsylvanica]
Length=242

 Score =   357 bits (916),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 187/247 (76%), Positives = 214/247 (87%), Gaps = 5/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M  QSDQSRE+SPQRK+ RGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MALQSDQSREISPQRKISRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFS+RGRLYEYANNSVK TI+RYKKACSDS+N GSISEAN QFYQQEA+KLRQ I+N+
Sbjct  61    LVVFSTRGRLYEYANNSVKETIERYKKACSDSSNNGSISEANAQFYQQEASKLRQHINNM  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE LG  +L++LKNLESK+E+GIS+IR+KKNELLFAEI+YMQKR EI+  +N
Sbjct  121   QNQNRNMLGESLGALSLKELKNLESKVERGISRIRSKKNELLFAEIEYMQKR-EINKRHN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLRAKI ETERA   QQ M+LMPGSS +  + PP  FDARNYL+++G Q    Y +QD
Sbjct  180   NQYLRAKIAETERA---QQHMSLMPGSSDFDLVQPP-PFDARNYLEVNGLQPNDDYPRQD  235

Query  335   HLPLQLV  315
               PLQLV
Sbjct  236   QPPLQLV  242



>gb|AIC33050.1| flower development transporter AG2 [Chrysanthemum lavandulifolium]
Length=248

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/251 (73%), Positives = 209/251 (83%), Gaps = 7/251 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M    + S E+SP+RK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSLPENDSGEISPERKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSVK TIDRYKKAC D  ++GS++EAN QFYQQEA KLRQQI+NL
Sbjct  61    LIVFSTRGRLYEYANNSVKGTIDRYKKACLDPPSSGSVAEANAQFYQQEAQKLRQQIANL  120

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE LG    +DL+NLE+K+EKGIS+IR+KKNELLFAEI+YMQKR E +
Sbjct  121   QNQNRQFYRNIMGESLGNMQAKDLRNLETKLEKGISRIRSKKNELLFAEIEYMQKR-ENE  179

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHN+NQ+LRAKI E ERA  QQQ M+LMPGSS Y  +AP Q FD RNYLQ++  Q  ++Y
Sbjct  180   LHNSNQFLRAKIAENERA--QQQHMSLMPGSSDYDLVAPHQPFDGRNYLQVNELQPNNNY  237

Query  347   SKQDHLPLQLV  315
             S QD  PLQLV
Sbjct  238   SCQDQTPLQLV  248



>gb|AEA11211.1| AGAMOUS-like protein [Jatropha curcas]
 gb|KDP21163.1| hypothetical protein JCGZ_21634 [Jatropha curcas]
Length=241

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 207/247 (84%), Gaps = 6/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M + SD SRE SPQR+MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYPSD-SRETSPQRRMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK+TI+RYKKAC+DS+NTGS+SEAN QFYQQ+A KLR QIS L
Sbjct  60    LIVFSSRGRLYEYANNSVKSTIERYKKACADSSNTGSVSEANAQFYQQQAAKLRDQISGL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q   RN +GE LGG N +DL+ LES++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNN
Sbjct  120   QKSIRNMLGESLGGINPKDLRGLESRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNN  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQ LRAKI E ER   +QQ MNLMPG  +Y E+   Q FD RNY Q++  Q T+ Y +QD
Sbjct  179   NQLLRAKIAENER---KQQNMNLMPGGGNY-EIIQSQPFDNRNYFQVNALQPTNHYPQQD  234

Query  335   HLPLQLV  315
              + LQLV
Sbjct  235   QMALQLV  241



>gb|ABF50233.1| AGAMOUS, partial [Nicotiana langsdorffii x Nicotiana sanderae]
Length=206

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 194/207 (94%), Gaps = 2/207 (1%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQSD +RE+SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+NTGSISEAN Q+YQQEA+KLR QI NL
Sbjct  61    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN +GE L   +LRDLKNLE KIEKGISKIR+KKNELLFAEI+YMQKR EIDLHNN
Sbjct  121   QNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKR-EIDLHNN  179

Query  515   NQYLRAKIIETERA-qqqqqQMNLMPG  438
             NQYLRAKI ETERA QQQQQQMNLMPG
Sbjct  180   NQYLRAKIAETERAQQQQQQQMNLMPG  206



>gb|AID22158.1| AGAMOUS-like protein [Camellia sinensis]
Length=245

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/245 (74%), Positives = 207/245 (84%), Gaps = 7/245 (3%)
 Frame = -1

Query  1040  DQSREM--SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIV  867
             +QS E+  SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIV
Sbjct  5     NQSMEVLDSPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIV  64

Query  866   FSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQ  687
             FS+RGRLYEY+NNSVK TI+RYKKACSDS+NTGS+SE N QFYQQEA KLR QISN+QN 
Sbjct  65    FSTRGRLYEYSNNSVKGTIERYKKACSDSSNTGSVSELNAQFYQQEAAKLRGQISNMQNS  124

Query  686   NRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQY  507
             +R+ +GE L   ++RDLKNLES++E+GIS+IR+KKNELLFAEI+ MQKR EIDLHN+NQY
Sbjct  125   HRHMLGESLSSMSIRDLKNLESRLERGISRIRSKKNELLFAEIELMQKR-EIDLHNSNQY  183

Query  506   LRAKIIETERAqqqqqQMNLMPGSSSYHEL-APPQQFDARNYLQLDGFQSTSSYSKQDHL  330
             LRAKI E ERA   QQQMNLMPG  S +EL  PPQ FD RNY Q++G Q    YS+ D  
Sbjct  184   LRAKIAENERA---QQQMNLMPGGGSEYELMPPPQSFDTRNYFQVNGLQPNDHYSRHDQT  240

Query  329   PLQLV  315
              LQLV
Sbjct  241   ALQLV  245



>ref|XP_004485955.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X4 [Cicer 
arietinum]
 ref|XP_004485956.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X5 [Cicer 
arietinum]
Length=247

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 206/252 (82%), Gaps = 10/252 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQ +QS   SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQ-NQSMSDSPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+ TGS SEAN QFYQQEA+KLR QISNL
Sbjct  60    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSGTGSASEANAQFYQQEADKLRAQISNL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE LG    ++LKNLE K+EKGIS+IR+KKN+LLFAEI+YMQKR EIDLHNN
Sbjct  120   QNNNRQMMGESLGSMTAKELKNLEGKLEKGISRIRSKKNQLLFAEIEYMQKR-EIDLHNN  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQSTSS  351
             NQ LRAKI E+ER       M+++PG +SY  +        QQ+D+R Y Q+ G Q +S 
Sbjct  179   NQLLRAKIAESER---NHHNMSVLPGGTSYESMQSQHQQQQQQYDSRGYFQVTGLQPSSQ  235

Query  350   YSKQDHLPLQLV  315
             Y++QD + LQLV
Sbjct  236   YARQDQMSLQLV  247



>gb|AFO83615.1| AGAMOUS-like protein [Fagopyrum esculentum]
Length=253

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 211/257 (82%), Gaps = 14/257 (5%)
 Frame = -1

Query  1055  MEFQSDQSREM-SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  879
             MEF ++ SRE  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV
Sbjct  1     MEFSNEASREEGSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  60

Query  878   ALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISN  699
             ALIVFSSRGRLYEYAN+SVKATIDRYKKACSDS    S++EAN Q+YQQEA KLR QI  
Sbjct  61    ALIVFSSRGRLYEYANHSVKATIDRYKKACSDSAGVTSVAEANAQYYQQEAAKLRNQIRT  120

Query  698   LQNQNRN----YMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEI  531
             LQN +RN     MGEGL   +++DLKNLE+++EKGIS+IRAKKNELLF EI++MQKR EI
Sbjct  121   LQNNSRNLSRHMMGEGLSNLSMKDLKNLETRLEKGISRIRAKKNELLFGEIEFMQKR-EI  179

Query  530   DLHNNNQYLRAKIIETERAqqqqqQMNLMPGSSS--YHELAPPQQ---FDARNYLQLDGF  366
             +LHNNNQ+LRAKI E+ER    QQ MNLMPGSSS  ++EL PP Q   FD+RN+ Q++  
Sbjct  180   ELHNNNQFLRAKIAESERT---QQSMNLMPGSSSGDHYELMPPSQAGPFDSRNFFQVNDL  236

Query  365   QSTSSYSKQDHLPLQLV  315
             Q  + YS Q+  PLQLV
Sbjct  237   QPDNQYSCQNQTPLQLV  253



>dbj|BAG06959.1| MADS-box transcription factor [Chrysanthemum x morifolium]
Length=248

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/251 (72%), Positives = 207/251 (82%), Gaps = 7/251 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F  D S +MSPQRK+G+GKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSF-PDDSADMSPQRKLGKGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ TIDRYKKAC D  ++GS+SEAN Q+YQQE+ KLR QI+NL
Sbjct  60    LIVFSSRGRLYEYANNSVRGTIDRYKKACLDPPSSGSVSEANAQYYQQESGKLRSQIANL  119

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE L    ++DLKNLE+K+EK I++IR+KKNELLFAEI+YMQKR E++
Sbjct  120   QNQNRQFYRNIMGESLTDMPMKDLKNLETKLEKAITRIRSKKNELLFAEIEYMQKR-ELE  178

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHNNNQ+LRAKI E ER+  QQQ M+LMPGSS Y  + P Q FD RNYLQ +  Q ++ Y
Sbjct  179   LHNNNQFLRAKIAENERS-SQQQHMSLMPGSSDYELVTPHQHFDGRNYLQPNEMQPSNDY  237

Query  347   SKQDHLPLQLV  315
             S QD  PLQLV
Sbjct  238   SCQDQTPLQLV  248



>gb|AEK33831.1| agamous [Paeonia suffruticosa]
Length=241

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 205/247 (83%), Gaps = 6/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             ME  +D SRE SPQRK GRGKIEIKRIENT NRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MELTNDPSREESPQRKNGRGKIEIKRIENTNNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRL+EYANNSV+ATI+RYKKA +DS+ TGS+SEAN Q+YQQEA+KLR QI NL
Sbjct  61    LIVFSTRGRLFEYANNSVRATIERYKKASADSSGTGSVSEANAQYYQQEASKLRAQIRNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  +GE +   N ++LKNLESKIEKGI  IR+KKNELLF+EI+ MQKR EIDLHNN
Sbjct  121   QNSNRQMLGETISSMNPKELKNLESKIEKGIRNIRSKKNELLFSEIEDMQKR-EIDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQYLRA+I E ERA    QQMNLMPG ++Y EL P Q FD+RN+ Q+D  Q   +YS+QD
Sbjct  180   NQYLRARIAENERA----QQMNLMPGGTNY-ELLPFQPFDSRNFFQVDALQPNHNYSRQD  234

Query  335   HLPLQLV  315
              + LQLV
Sbjct  235   QIALQLV  241



>gb|AER30448.1| AGAMOUS4 [Passiflora edulis]
Length=255

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 201/241 (83%), Gaps = 4/241 (2%)
 Frame = -1

Query  1037  QSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSS  858
             +SRE SPQR +GRGK+EIKRIENTTNRQVTF KRRNGLLKKAYELSVLCDAEVALIVFS+
Sbjct  19    ESREASPQRTLGRGKVEIKRIENTTNRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFST  78

Query  857   RGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRN  678
             RGRLYEY+N+SVK+TI+RYKKA +D+  TGS+SEAN QFYQQEA KLRQQISNLQN NRN
Sbjct  79    RGRLYEYSNSSVKSTIERYKKASADTNTTGSVSEANAQFYQQEAAKLRQQISNLQNSNRN  138

Query  677   YMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRA  498
              +GE L G   +DLKNLES++EKGISKIR+KKNELLFAEI+YMQKR EIDLHNNNQ LRA
Sbjct  139   MLGESLSGLTAKDLKNLESRLEKGISKIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRA  197

Query  497   KIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
             KI E ER   ++Q MNLMPG S+Y  +   Q +D+RNY Q++   S + Y  QD + LQL
Sbjct  198   KIAENER---KRQNMNLMPGGSNYEMMQSHQTYDSRNYSQVNALPSNNHYEHQDQMALQL  254

Query  317   V  315
             V
Sbjct  255   V  255



>ref|NP_001268097.1| agamous [Vitis vinifera]
 gb|ABN46892.1| AGAMOUS-like MADS-box protein [Vitis labrusca x Vitis vinifera]
 gb|ACZ26525.1| agamous [Vitis vinifera]
Length=226

 Score =   349 bits (896),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 201/231 (87%), Gaps = 5/231 (2%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK+TI+RYKKA +DS+NTGS+SEAN QFYQQE++KL QQI NLQN NR+ +GE LG  N
Sbjct  61    SVKSTIERYKKASADSSNTGSVSEANAQFYQQESSKLHQQIRNLQNSNRHMLGESLGSLN  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              +DLK+LE ++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHN+NQYLRA+I E ER   
Sbjct  121   FKDLKSLEIRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNDNQYLRARIAENER---  176

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
              +QQM+LMPG ++Y EL P QQFD+RNY QL+G Q   SYS+QD   LQLV
Sbjct  177   NEQQMSLMPGGANY-ELMPSQQFDSRNYFQLNGLQPNQSYSRQDQPALQLV  226



>gb|AFX82108.1| MADS-box transcription factor AG1 [Camellia japonica]
Length=255

 Score =   350 bits (898),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 207/255 (81%), Gaps = 17/255 (7%)
 Frame = -1

Query  1040  DQSREM--SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIV  867
             +QS E+  SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIV
Sbjct  5     NQSMEVLDSPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIV  64

Query  866   FSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQ  687
             FS+RGRLYEY+NNSVK TI+RYKKACSDS+NTGS+SE N QFYQQEA KLR QISNLQN 
Sbjct  65    FSTRGRLYEYSNNSVKGTIERYKKACSDSSNTGSVSELNAQFYQQEAAKLRGQISNLQNS  124

Query  686   NRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQY  507
             +R  +GE L   ++RDLKNLES++E+GIS+IR+KKNELLFAEI+ MQ+R EIDLHN+NQY
Sbjct  125   HRQMLGESLSSMSIRDLKNLESRLERGISRIRSKKNELLFAEIELMQQR-EIDLHNSNQY  183

Query  506   LRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSS--------  351
             LRAKI E ERA   QQQMNLMPG  S +EL P Q FDARNYLQ++G Q            
Sbjct  184   LRAKIAENERA---QQQMNLMPGGGSEYELMPSQSFDARNYLQMNGIQQQQPQQQQQQPN  240

Query  350   ---YSKQDHLPLQLV  315
                YS+ D   LQLV
Sbjct  241   HHHYSRHDQTALQLV  255



>ref|XP_006467575.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Citrus 
sinensis]
Length=254

 Score =   350 bits (898),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 210/253 (83%), Gaps = 8/253 (3%)
 Frame = -1

Query  1064  KLRMEFQSDQS---REMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVL  894
             K RM F ++ +    E+SP+RKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVL
Sbjct  7     KKRMAFPNELAAGREELSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVL  66

Query  893   CDAEVALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLR  714
             CDAEV+LIVFSSRGRLYEY+NNSVK+TIDRYKKA +D++NTGSI EAN QFYQQEA KLR
Sbjct  67    CDAEVSLIVFSSRGRLYEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLR  126

Query  713   QQISNLQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQE  534
              QISN+QN NRN +GE L G N ++LKN+E+++EKGIS+IR+KKNELLFAEI+YMQKR E
Sbjct  127   IQISNMQNSNRNMLGESLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKR-E  185

Query  533   IDLHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTS  354
             +DLHN+NQ LRAKI E ER    QQ MNLM G SSY E+   Q FD+R+Y Q++  Q T+
Sbjct  186   VDLHNSNQLLRAKIAENERG---QQNMNLMQGGSSY-EIIQSQPFDSRSYFQVNALQPTN  241

Query  353   SYSKQDHLPLQLV  315
              Y +QD + LQLV
Sbjct  242   HYPRQDQMALQLV  254



>dbj|BAK20022.1| PgMADS protein7 [Panax ginseng]
Length=230

 Score =   349 bits (895),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 177/226 (78%), Positives = 202/226 (89%), Gaps = 5/226 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F ++QS ++ PQ+K+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSFPNNQSGDIFPQKKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS++GRLYEYANNSVK TI+RYKKA SDS NT S+SEAN Q+YQQEA+KLRQQISN+
Sbjct  61    LIVFSNKGRLYEYANNSVKETIERYKKANSDSPNTTSVSEANAQYYQQEASKLRQQISNM  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QNQNRN MGE LG  N+++LK LE+K+EKGIS+IR+KKNELLFAEI+YMQKR EI+LHNN
Sbjct  121   QNQNRNMMGENLGDLNIKELKGLETKLEKGISRIRSKKNELLFAEIEYMQKR-EIELHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQ-FDARNYL  381
             NQYLR+KI E ERA   QQ MNLMPGSSS +E+APPQQ FDA NYL
Sbjct  180   NQYLRSKISENERA---QQHMNLMPGSSSAYEIAPPQQSFDAGNYL  222



>ref|XP_006467576.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Citrus 
sinensis]
Length=252

 Score =   350 bits (897),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 210/253 (83%), Gaps = 8/253 (3%)
 Frame = -1

Query  1064  KLRMEFQSDQS---REMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVL  894
             K RM F ++ +    E+SP+RKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVL
Sbjct  5     KKRMAFPNELAAGREELSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVL  64

Query  893   CDAEVALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLR  714
             CDAEV+LIVFSSRGRLYEY+NNSVK+TIDRYKKA +D++NTGSI EAN QFYQQEA KLR
Sbjct  65    CDAEVSLIVFSSRGRLYEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLR  124

Query  713   QQISNLQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQE  534
              QISN+QN NRN +GE L G N ++LKN+E+++EKGIS+IR+KKNELLFAEI+YMQKR E
Sbjct  125   IQISNMQNSNRNMLGESLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKR-E  183

Query  533   IDLHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTS  354
             +DLHN+NQ LRAKI E ER    QQ MNLM G SSY E+   Q FD+R+Y Q++  Q T+
Sbjct  184   VDLHNSNQLLRAKIAENERG---QQNMNLMQGGSSY-EIIQSQPFDSRSYFQVNALQPTN  239

Query  353   SYSKQDHLPLQLV  315
              Y +QD + LQLV
Sbjct  240   HYPRQDQMALQLV  252



>gb|AAO22984.1| MADS-box transcription factor CDM37 [Chrysanthemum x morifolium]
Length=265

 Score =   350 bits (898),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 179/251 (71%), Positives = 208/251 (83%), Gaps = 7/251 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F  D+S +MSPQRK+G+GKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  18    MSF-PDESADMSPQRKLGKGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  76

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ TIDRYKKAC D  ++GS+SEAN Q+YQ+E+ KLR QI+NL
Sbjct  77    LIVFSSRGRLYEYANNSVRGTIDRYKKACLDPPSSGSVSEANAQYYQEESGKLRSQIANL  136

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE L    ++DLKNLE+K+EK I++IR+KKNELLFAEI+YMQKR E++
Sbjct  137   QNQNRQFYRNIMGESLTDMPMKDLKNLETKLEKAITRIRSKKNELLFAEIEYMQKR-ELE  195

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHNNNQ+LRAKI E ER+  QQQ M+LMPGSS Y  + P Q FD RNYLQ +  Q ++ Y
Sbjct  196   LHNNNQFLRAKIAENERS-AQQQHMSLMPGSSDYELVTPHQPFDGRNYLQSNEMQPSNDY  254

Query  347   SKQDHLPLQLV  315
             S QD  PLQLV
Sbjct  255   SCQDQTPLQLV  265



>emb|CBI30760.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 201/231 (87%), Gaps = 5/231 (2%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK+TI+RYKKA +DS+NTGS+SEAN QFYQQE++KL QQI NLQN NR+ +GE LG  N
Sbjct  61    SVKSTIERYKKASADSSNTGSVSEANAQFYQQESSKLHQQIRNLQNSNRHMLGESLGSLN  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              +DLK+LE ++EKGIS+IR++KNELLFAEI+YMQKR EIDLHN+NQYLRA+I E ER   
Sbjct  121   FKDLKSLEIRLEKGISRIRSRKNELLFAEIEYMQKR-EIDLHNDNQYLRARIAENER---  176

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
              +QQM+LMPG ++Y EL P QQFD+RNY QL+G Q   SYS+QD   LQLV
Sbjct  177   NEQQMSLMPGGANY-ELMPSQQFDSRNYFQLNGLQPNQSYSRQDQPALQLV  226



>gb|AEU08497.1| MADS1 [Corylus heterophylla]
Length=241

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/247 (71%), Positives = 206/247 (83%), Gaps = 6/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQ +QS  +SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE+A
Sbjct  1     MEFQ-NQSMSVSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK TI+RYKKAC+DS+N+GS+SEANTQFYQQEA KLR QI ++
Sbjct  60    LIVFSSRGRLYEYANNSVKTTIERYKKACADSSNSGSVSEANTQFYQQEAAKLRGQIRSV  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q+ NR+ +GE L   N ++LK+LE  +EKGI++IR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  120   QDSNRHMLGEALSELNFKELKSLEKNLEKGINRIRSKKNELLFAEIEYMQKR-EVDLHNN  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQ+LRAKI E ER    QQ +N+MPG  +Y EL   Q FD+RNY Q+D  Q    Y +QD
Sbjct  179   NQFLRAKIAENER---NQQNLNVMPGGGNY-ELMQSQSFDSRNYFQVDALQPNHHYPRQD  234

Query  335   HLPLQLV  315
              + LQLV
Sbjct  235   QMALQLV  241



>ref|XP_006449577.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 ref|XP_006449578.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 ref|XP_006449580.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 dbj|BAF34911.1| MADS-box protein [Citrus unshiu]
 gb|ESR62817.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 gb|ESR62818.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
 gb|ESR62820.1| hypothetical protein CICLE_v10016427mg [Citrus clementina]
Length=245

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 203/238 (85%), Gaps = 5/238 (2%)
 Frame = -1

Query  1028  EMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             E+SP+RKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGR
Sbjct  13    ELSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGR  72

Query  848   LYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMG  669
             LYEY+NNSVK+TIDRYKKA +D++NTGSI EAN QFYQQEA KLR QISN+QN NRN +G
Sbjct  73    LYEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLG  132

Query  668   EGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKII  489
             E L G N ++LKN+E+++EKGIS+IR+KKNELLFAEI+YMQKR E+DLHN+NQ LRAKI 
Sbjct  133   ESLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLHNSNQLLRAKIA  191

Query  488   ETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             E ER    QQ MNLM G SSY E+   Q FD+R+Y Q++  Q T+ Y +QD + LQLV
Sbjct  192   ENERG---QQNMNLMQGGSSY-EIIQSQPFDSRSYFQVNALQPTNHYPRQDQMALQLV  245



>ref|XP_008225407.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Prunus 
mume]
Length=244

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 202/237 (85%), Gaps = 5/237 (2%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  12    SPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLY  71

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVK TI+RYKKAC++STNTGS+SEA+TQ+YQQEA KLR QI NLQN +R+ MGE 
Sbjct  72    EYANNSVKETIERYKKACAESTNTGSVSEASTQYYQQEAAKLRAQIGNLQNSSRHMMGES  131

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   N++DLKNLESK+EKGI++IR+KKNELLFAEI+YMQKRQEIDLHNNNQ LRAKI E 
Sbjct  132   LSSMNMKDLKNLESKLEKGINRIRSKKNELLFAEIEYMQKRQEIDLHNNNQLLRAKIAEN  191

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY-SKQDHLPLQLV  315
             ER+   QQ +N+M G  SY E+   Q +D+RNY Q++  Q    Y S+QD + LQLV
Sbjct  192   ERS---QQNINVMAGGGSY-EIMQSQPYDSRNYFQVNALQPNHQYNSRQDPMALQLV  244



>ref|XP_006467577.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Citrus 
sinensis]
 ref|XP_006467578.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X4 [Citrus 
sinensis]
 ref|XP_006467579.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X5 [Citrus 
sinensis]
Length=245

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 203/238 (85%), Gaps = 5/238 (2%)
 Frame = -1

Query  1028  EMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             E+SP+RKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV+LIVFSSRGR
Sbjct  13    ELSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGR  72

Query  848   LYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMG  669
             LYEY+NNSVK+TIDRYKKA +D++NTGSI EAN QFYQQEA KLR QISN+QN NRN +G
Sbjct  73    LYEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLG  132

Query  668   EGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKII  489
             E L G N ++LKN+E+++EKGIS+IR+KKNELLFAEI+YMQKR E+DLHN+NQ LRAKI 
Sbjct  133   ESLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLHNSNQLLRAKIA  191

Query  488   ETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             E ER    QQ MNLM G SSY E+   Q FD+R+Y Q++  Q T+ Y +QD + LQLV
Sbjct  192   ENERG---QQNMNLMQGGSSY-EIIQSQPFDSRSYFQVNALQPTNHYPRQDQMALQLV  245



>ref|XP_007025251.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 ref|XP_007025252.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 ref|XP_007025253.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|ABA39727.1| AGAMOUS-like protein [Theobroma cacao]
 gb|EOY27873.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOY27874.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOY27875.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
Length=241

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 204/242 (84%), Gaps = 5/242 (2%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             ++S E SPQ+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  5     NESCETSPQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  64

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             SRGRLYEYANNSVKATI+RYKK C+DS+NTGS+SEAN QFYQQEA KLR QI NLQN NR
Sbjct  65    SRGRLYEYANNSVKATIERYKKTCADSSNTGSVSEANAQFYQQEAAKLRVQIGNLQNSNR  124

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
             + +GE L    ++DL++LE+++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LR
Sbjct  125   HMLGESLSALPMKDLRSLENRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLR  183

Query  500   AKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQ  321
             AKI E ER   +QQ +NLMPG S++ E+   Q FD+RNY Q++  Q  + Y  QD + LQ
Sbjct  184   AKIAENER---KQQNINLMPGGSNF-EIMHSQPFDSRNYFQVNALQPANHYPHQDQMALQ  239

Query  320   LV  315
             LV
Sbjct  240   LV  241



>ref|XP_010687173.1| PREDICTED: floral homeotic protein AGAMOUS isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=250

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/249 (71%), Positives = 206/249 (83%), Gaps = 8/249 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSP--QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  882
             MEF + Q+ E SP  QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE
Sbjct  8     MEFPT-QTMEGSPSSQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  66

Query  881   VALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQIS  702
             VALIVFSSRGRLYEYAN+SVK TIDRYKKACSD +  GS++EAN Q+YQQEA KLR QI 
Sbjct  67    VALIVFSSRGRLYEYANHSVKGTIDRYKKACSDQSGAGSVAEANAQYYQQEAAKLRNQIR  126

Query  701   NLQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLH  522
                  NR+ MGEGL   ++++LKNLE+K+E+GIS+IR+KKNELLFAEI++MQKR EI+LH
Sbjct  127   TATENNRHMMGEGLSSLSMKELKNLETKLERGISRIRSKKNELLFAEIEFMQKR-EIELH  185

Query  521   NNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSK  342
             NNNQ+LRA+I E ERA   QQ M+LMPG S Y +L P Q FD+RNY Q++  Q +S Y++
Sbjct  186   NNNQFLRARISENERA---QQSMSLMPGGSDY-DLVPSQSFDSRNYFQVNALQPSSQYAR  241

Query  341   QDHLPLQLV  315
             QD  PLQLV
Sbjct  242   QDQTPLQLV  250



>gb|ADP02394.1| AGAMOUS-like protein [Citrus sinensis]
Length=246

 Score =   348 bits (892),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 203/238 (85%), Gaps = 5/238 (2%)
 Frame = -1

Query  1028  EMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             E+SP+RKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV+LIVFSSRGR
Sbjct  13    ELSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGR  72

Query  848   LYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMG  669
             LYEY+NNSVK+TIDRYKKA +D++NTGSI EAN QFYQQEA KLR QISN+QN NRN +G
Sbjct  73    LYEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLG  132

Query  668   EGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKII  489
             E L G N ++LKN+E+++EKGIS+IR+KKNELLFAEI+YMQKR E+DLHN+NQ LRAKI 
Sbjct  133   ESLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLHNSNQLLRAKIA  191

Query  488   ETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             E ER    QQ MNLM G SSY E+   Q FD+R+Y Q++  Q T+ Y +QD + LQLV
Sbjct  192   ENERG---QQNMNLMQGGSSY-EIIQSQPFDSRSYFQVNALQPTNHYPRQDQMALQLV  245



>gb|AAN47198.1| MADS-box transcription factor AGAMOUS [Helianthus annuus]
Length=248

 Score =   347 bits (891),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 179/251 (71%), Positives = 208/251 (83%), Gaps = 7/251 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M FQ++ S ++SPQR++G+GKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSFQNEDSGDISPQRRIGKGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV  TIDRYKK+C D  +TGS++EAN QFYQQEA KLRQQI+NL
Sbjct  61    LIVFSSRGRLYEYANNSVTGTIDRYKKSCLDPPSTGSVAEANAQFYQQEATKLRQQIANL  120

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE L     ++LKNLESK+EK I++IRAKKNELLFAEI+YMQKR E++
Sbjct  121   QNQNRQFYRNIMGESLADMPGKELKNLESKLEKAINRIRAKKNELLFAEIEYMQKR-ELE  179

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHN+NQ+LRA+I E ERA  QQQ M+LMPGSS Y++L P Q FD  N LQ +  Q  ++Y
Sbjct  180   LHNSNQFLRARIAENERA--QQQHMSLMPGSSGYNDLGPHQSFDGLNDLQTNELQLNNNY  237

Query  347   SKQDHLPLQLV  315
             S QD  PLQLV
Sbjct  238   SCQDQTPLQLV  248



>dbj|BAN13568.1| agamous-like protein [Chrysanthemum seticuspe f. boreale]
Length=239

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 201/241 (83%), Gaps = 6/241 (2%)
 Frame = -1

Query  1025  MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             MSPQRK+G+GKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL
Sbjct  1     MSPQRKLGKGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  60

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQN----RN  678
             YEYANNSV+ TIDRYKKAC D  ++GS+SEAN Q+YQQE+ KLR QI+NLQNQN    RN
Sbjct  61    YEYANNSVRGTIDRYKKACLDPPSSGSVSEANAQYYQQESGKLRSQIANLQNQNRQFYRN  120

Query  677   YMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRA  498
              MGE L    ++DLKNLE+K+EK I++IR+KKNELLFAEI+YMQKR E++LHNNNQ+LRA
Sbjct  121   IMGESLTDMPMKDLKNLETKLEKAITRIRSKKNELLFAEIEYMQKR-ELELHNNNQFLRA  179

Query  497   KIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
             KI E ER+  Q Q M+LMPGSS Y  + P Q FD RNYLQ +  Q ++ YS QD  PLQL
Sbjct  180   KIAENERS-AQHQHMSLMPGSSDYELVTPHQPFDGRNYLQSNEMQPSNDYSCQDQTPLQL  238

Query  317   V  315
             V
Sbjct  239   V  239



>gb|AIP87050.1| AG [Camellia japonica]
Length=258

 Score =   347 bits (890),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 188/264 (71%), Positives = 207/264 (78%), Gaps = 23/264 (9%)
 Frame = -1

Query  1055  MEFQS---DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDA  885
             MEFQ+   D SR +SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDA
Sbjct  1     MEFQNQSMDVSR-LSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDA  59

Query  884   EVALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQI  705
             EVALIVFS+RGRLYEYANNSVKATI+RYKKACS  +NTGS+SE N QFYQQEA KLR QI
Sbjct  60    EVALIVFSTRGRLYEYANNSVKATIERYKKACSGPSNTGSVSELNAQFYQQEAAKLRVQI  119

Query  704   SNLQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDL  525
              NLQN NR+  GE L   ++RDLKNLE ++E+GIS+IR+KKNELLFAEI+ MQKR EIDL
Sbjct  120   GNLQNSNRHMRGESLCSLSMRDLKNLEGRLERGISRIRSKKNELLFAEIELMQKR-EIDL  178

Query  524   HNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSS--  351
             HNNNQYLRAKI E ERA   QQQM+LMPG   Y EL P Q FDARNYLQ++G Q      
Sbjct  179   HNNNQYLRAKIAENERA---QQQMSLMPGGPEY-ELMPSQSFDARNYLQMNGIQQQQPQQ  234

Query  350   ------------YSKQDHLPLQLV  315
                         YS+ D   LQLV
Sbjct  235   QQQQQQPPNHHHYSRHDQTALQLV  258



>gb|KDO77975.1| hypothetical protein CISIN_1g036452mg, partial [Citrus sinensis]
Length=244

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/237 (73%), Positives = 202/237 (85%), Gaps = 5/237 (2%)
 Frame = -1

Query  1028  EMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             E+SP+RKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV+LIVFSSRGR
Sbjct  13    ELSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGR  72

Query  848   LYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMG  669
             LYEY+NNSVK+TIDRYKKA +D++NTGSI EAN QFYQQEA KLR QISN+QN NRN +G
Sbjct  73    LYEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLG  132

Query  668   EGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKII  489
             E L G N ++LKN+E+++EKGIS+IR+KKNELLFAEI+YMQKR E+DLHN+NQ LRAKI 
Sbjct  133   ESLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLHNSNQLLRAKIA  191

Query  488   ETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
             E ER    QQ MNLM G SSY E+   Q FD+R+Y Q++  Q T+ Y +QD + LQL
Sbjct  192   ENERG---QQNMNLMQGGSSY-EIIQSQPFDSRSYFQVNALQPTNHYPRQDQMALQL  244



>dbj|BAG06960.1| MADS-box transcription factor [Chrysanthemum x morifolium]
 dbj|BAG06961.1| MADS-box transcription factor [Chrysanthemum x morifolium]
 gb|AIC33049.1| flower development transporter AG1 [Chrysanthemum lavandulifolium]
Length=249

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 207/252 (82%), Gaps = 8/252 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F  D S +MSPQRK+G+GKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MSF-PDDSADMSPQRKLGKGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ TIDRYKKAC D  ++GS+SEAN Q+YQQE+ KLR QI+NL
Sbjct  60    LIVFSSRGRLYEYANNSVRGTIDRYKKACLDPPSSGSVSEANAQYYQQESGKLRSQIANL  119

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE L    ++DLKNLE+K+EK I++IR+KKNELLFAEI+YMQKR E++
Sbjct  120   QNQNRQFYRNIMGESLTDMPMKDLKNLETKLEKAITRIRSKKNELLFAEIEYMQKR-ELE  178

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQ-FDARNYLQLDGFQSTSS  351
             LHNNNQ+LRAKI E ER+  QQQ M+LMPGSS Y  + P  Q FD RNYLQ +  Q ++ 
Sbjct  179   LHNNNQFLRAKIAENERS-AQQQHMSLMPGSSDYELVTPHHQPFDGRNYLQSNEMQPSND  237

Query  350   YSKQDHLPLQLV  315
             YS QD  PLQLV
Sbjct  238   YSCQDQTPLQLV  249



>gb|AAO18228.1| MADS-box transcriptional factor HAM45 [Helianthus annuus]
Length=267

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/251 (71%), Positives = 209/251 (83%), Gaps = 7/251 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M FQ++ S ++SPQR++G+GKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  20    MSFQNEDSGDISPQRRIGKGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  79

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ TIDRYKK+C D  +TGS++EAN QFYQQEA KLRQQI+NL
Sbjct  80    LIVFSSRGRLYEYANNSVRGTIDRYKKSCLDPPSTGSVAEANAQFYQQEATKLRQQIANL  139

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QNQN    RN MGE L     ++LKNLESK+EK I++IRAKKNELLFAEI+YMQKR E++
Sbjct  140   QNQNRQFYRNIMGESLADMPGKELKNLESKLEKAINRIRAKKNELLFAEIEYMQKR-ELE  198

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHN+NQ+LRA+I E ERA  QQQ M+LMPGSS Y++L P Q FD  N LQ +  Q  ++Y
Sbjct  199   LHNSNQFLRARISENERA--QQQHMSLMPGSSGYNDLGPHQSFDGLNDLQTNELQLNNNY  256

Query  347   SKQDHLPLQLV  315
             S QD  PLQLV
Sbjct  257   SCQDQTPLQLV  267



>ref|XP_007025250.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOY27872.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
Length=294

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 204/242 (84%), Gaps = 5/242 (2%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             ++S E SPQ+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  58    NESCETSPQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  117

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             SRGRLYEYANNSVKATI+RYKK C+DS+NTGS+SEAN QFYQQEA KLR QI NLQN NR
Sbjct  118   SRGRLYEYANNSVKATIERYKKTCADSSNTGSVSEANAQFYQQEAAKLRVQIGNLQNSNR  177

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
             + +GE L    ++DL++LE+++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LR
Sbjct  178   HMLGESLSALPMKDLRSLENRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLR  236

Query  500   AKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQ  321
             AKI E ER   +QQ +NLMPG S++ E+   Q FD+RNY Q++  Q  + Y  QD + LQ
Sbjct  237   AKIAENER---KQQNINLMPGGSNF-EIMHSQPFDSRNYFQVNALQPANHYPHQDQMALQ  292

Query  320   LV  315
             LV
Sbjct  293   LV  294



>gb|ACH72974.1| AGAMOUS [Prunus serotina]
Length=243

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/237 (74%), Positives = 200/237 (84%), Gaps = 6/237 (3%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  12    SPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLY  71

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVK TI+RYKKAC++STNTGS+SEA+TQ+YQQEA KLR QI NLQN +RN MGE 
Sbjct  72    EYANNSVKETIERYKKACAESTNTGSVSEASTQYYQQEAAKLRAQIRNLQNSSRNMMGES  131

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L    ++DLKNLESK+EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAKI E 
Sbjct  132   LSSMKMKDLKNLESKLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAKIAEN  190

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY-SKQDHLPLQLV  315
             ER+   QQ +N+M G  SY E+   Q +D+RNY Q+D  Q    Y S+QD + LQLV
Sbjct  191   ERS---QQNINVMAGGGSY-EIMQSQPYDSRNYFQVDALQPNHQYNSRQDQMALQLV  243



>gb|AEG19542.1| AGAMOUS-like protein [Vitis labrusca x Vitis vinifera]
Length=226

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 199/231 (86%), Gaps = 5/231 (2%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK+TI+RYKKA +DS+NTGS+SEAN QFYQQE++KL QQI NLQN NR+ + E LG  N
Sbjct  61    SVKSTIERYKKASADSSNTGSVSEANAQFYQQESSKLHQQIRNLQNSNRHMLAESLGSLN  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              +DLK+LE ++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHN+NQYLRA+I E ER   
Sbjct  121   FKDLKSLEIRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNDNQYLRARIAENER---  176

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
              QQQM+LMPG ++Y EL P QQFD+RNY QL+  Q   SYS+QD   LQLV
Sbjct  177   NQQQMSLMPGGANY-ELMPSQQFDSRNYFQLNELQPNQSYSRQDQPALQLV  226



>ref|XP_004485952.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Cicer 
arietinum]
 ref|XP_004485953.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Cicer 
arietinum]
 ref|XP_004485954.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Cicer 
arietinum]
Length=251

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 180/256 (70%), Positives = 206/256 (80%), Gaps = 14/256 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQ +QS   SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQ-NQSMSDSPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+ TGS SEAN QFYQQEA+KLR QISNL
Sbjct  60    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSGTGSASEANAQFYQQEADKLRAQISNL  119

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QN N    R  MGE LG    ++LKNLE K+EKGIS+IR+KKN+LLFAEI+YMQKR EID
Sbjct  120   QNNNRLKCRQMMGESLGSMTAKELKNLEGKLEKGISRIRSKKNQLLFAEIEYMQKR-EID  178

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQ  363
             LHNNNQ LRAKI E+ER       M+++PG +SY  +        QQ+D+R Y Q+ G Q
Sbjct  179   LHNNNQLLRAKIAESER---NHHNMSVLPGGTSYESMQSQHQQQQQQYDSRGYFQVTGLQ  235

Query  362   STSSYSKQDHLPLQLV  315
              +S Y++QD + LQLV
Sbjct  236   PSSQYARQDQMSLQLV  251



>gb|AGV55405.1| MADS-box transcription factor AGAMOUSa [Medicago truncatula]
 gb|KEH36661.1| MADS-box transcription factor [Medicago truncatula]
 gb|AIT11837.1| AGAMOUSa [Medicago truncatula]
Length=260

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 209/262 (80%), Gaps = 17/262 (6%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+F  ++S   SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDF-PNESMSDSPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVK TI RYKKACSDS+ TGS +EAN QFYQQEA+KLR QISNL
Sbjct  60    LIVFSSRGRLYEYANNSVKETIARYKKACSDSSGTGSATEANAQFYQQEADKLRVQISNL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE LG  N ++LKNLESK+EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNN
Sbjct  120   QNNNRQMMGESLGSMNAKELKNLESKLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNN  178

Query  515   NQYLRAKIIETER--AqqqqqQMNLMPGSSSYHEL---APPQQFDARNYLQLDGFQSTSS  351
             NQ LRAKI E+ER  +      M+++PG ++Y  +      QQ+++R Y Q+ G QS+SS
Sbjct  179   NQLLRAKIAESERNHSHHSNINMSMLPGGTNYEPMQSQNQQQQYESRGYFQVSGLQSSSS  238

Query  350   ----------YSKQDHLPLQLV  315
                       Y++QDH+ LQLV
Sbjct  239   QMTALQPSSQYARQDHMSLQLV  260



>emb|CAB95649.1| MADS box protein [Betula pendula]
Length=242

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/248 (71%), Positives = 205/248 (83%), Gaps = 7/248 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQ +QS  +SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE+A
Sbjct  1     MEFQ-NQSMSVSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIA  59

Query  875   LIVFSSRGRLYEYANNS-VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISN  699
             LIVFSSRGRLYEYANNS VK TI+RYKKAC++S+N+GS+SEANTQFYQQEA KLR QI +
Sbjct  60    LIVFSSRGRLYEYANNSSVKTTIERYKKACAESSNSGSVSEANTQFYQQEAAKLRGQIRS  119

Query  698   LQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHN  519
             +QN NR+ +GE L   N ++LKNLE K+EKGI+KIR+KKNELLFAEI+YMQKR E +LHN
Sbjct  120   VQNSNRHLLGEALSELNFKELKNLEIKLEKGINKIRSKKNELLFAEIEYMQKR-EAELHN  178

Query  518   NNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQ  339
             NNQ LRAKI E ER    QQ +N+MPG  +Y EL   Q +D+R Y Q+D  Q    Y +Q
Sbjct  179   NNQILRAKIAENER---NQQNLNVMPGGGNY-ELMQSQSYDSRTYFQVDALQPNHHYPRQ  234

Query  338   DHLPLQLV  315
             D +PLQLV
Sbjct  235   DQIPLQLV  242



>ref|XP_010687172.1| PREDICTED: floral homeotic protein AGAMOUS isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=252

 Score =   343 bits (879),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 176/251 (70%), Positives = 206/251 (82%), Gaps = 10/251 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSP--QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  882
             MEF + Q+ E SP  QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE
Sbjct  8     MEFPT-QTMEGSPSSQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  66

Query  881   VALIVFSSRGRLYEYANNS--VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQ  708
             VALIVFSSRGRLYEYAN+S  VK TIDRYKKACSD +  GS++EAN Q+YQQEA KLR Q
Sbjct  67    VALIVFSSRGRLYEYANHSCSVKGTIDRYKKACSDQSGAGSVAEANAQYYQQEAAKLRNQ  126

Query  707   ISNLQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             I      NR+ MGEGL   ++++LKNLE+K+E+GIS+IR+KKNELLFAEI++MQKR EI+
Sbjct  127   IRTATENNRHMMGEGLSSLSMKELKNLETKLERGISRIRSKKNELLFAEIEFMQKR-EIE  185

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY  348
             LHNNNQ+LRA+I E ERA   QQ M+LMPG S Y +L P Q FD+RNY Q++  Q +S Y
Sbjct  186   LHNNNQFLRARISENERA---QQSMSLMPGGSDY-DLVPSQSFDSRNYFQVNALQPSSQY  241

Query  347   SKQDHLPLQLV  315
             ++QD  PLQLV
Sbjct  242   ARQDQTPLQLV  252



>gb|AIU94283.1| floral homeotic protein AGAMOUS [Prunus pseudocerasus]
Length=243

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 201/237 (85%), Gaps = 6/237 (3%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  12    SPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLY  71

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVK TI+RYKKAC++STNTGS+SEA+TQ+YQQEA KLR QI NLQN +R+ MGE 
Sbjct  72    EYANNSVKETIERYKKACAESTNTGSVSEASTQYYQQEAAKLRAQIGNLQNSSRHMMGES  131

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   N++DLKNLESK+EKGI++IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAKI E 
Sbjct  132   LSSMNMKDLKNLESKLEKGINRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAKIAEN  190

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY-SKQDHLPLQLV  315
             ER+   QQ +N+M G  SY E+   Q +D+RNY Q++  Q    Y S+QD + LQLV
Sbjct  191   ERS---QQNINVMAGGGSY-EIMQSQPYDSRNYFQVNALQPNHQYNSRQDPMALQLV  243



>gb|AAD03486.1| MADS1 [Corylus avellana]
Length=242

 Score =   342 bits (877),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 204/248 (82%), Gaps = 7/248 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQ +QS  +SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE+A
Sbjct  1     MEFQ-NQSMSVSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIA  59

Query  875   LIVFSSRGRLYEYANNS-VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISN  699
             LIVFSSRGRLYEYANNS VK TI+RYKKAC+DS+N+GS+SEANTQFYQQEA KLR QI +
Sbjct  60    LIVFSSRGRLYEYANNSSVKTTIERYKKACADSSNSGSVSEANTQFYQQEAAKLRGQIRS  119

Query  698   LQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHN  519
             +Q+ NR+ +GE L   N ++LKNLE  +EKGI++IR+KKNELL AEI+YM KR E+DLHN
Sbjct  120   VQDSNRHMLGEALSELNFKELKNLEKNLEKGINRIRSKKNELLLAEIEYMHKR-EVDLHN  178

Query  518   NNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQ  339
             NNQ+LRAKI E ER    QQ +N+MPG  +Y EL   Q FD+RNY Q+D  Q    Y +Q
Sbjct  179   NNQFLRAKIAENER---NQQNLNVMPGGGNY-ELMQSQSFDSRNYFQVDALQPNHHYPRQ  234

Query  338   DHLPLQLV  315
             D + LQLV
Sbjct  235   DQMALQLV  242



>ref|XP_007147970.1| hypothetical protein PHAVU_006G169600g, partial [Phaseolus vulgaris]
 gb|ESW19964.1| hypothetical protein PHAVU_006G169600g, partial [Phaseolus vulgaris]
Length=245

 Score =   342 bits (877),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 177/240 (74%), Positives = 199/240 (83%), Gaps = 5/240 (2%)
 Frame = -1

Query  1034  SREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR  855
             S  +SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR
Sbjct  11    SMSVSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR  70

Query  854   GRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNY  675
             GRLYEYANNSVKATI+RYKKACSDS+  GS SEAN QFYQQEA+KLR QISN+QN NR  
Sbjct  71    GRLYEYANNSVKATIERYKKACSDSSGAGSASEANAQFYQQEADKLRAQISNMQNNNRQM  130

Query  674   MGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAK  495
             MGE LG    +DLKNLESK+EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAK
Sbjct  131   MGESLGSMTAKDLKNLESKLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAK  189

Query  494   IIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             I E+ER+    Q M ++ G +SY  +   Q FD+R Y Q+ G Q  + Y++QD + LQLV
Sbjct  190   IAESERS----QNMGVLAGGTSYESMQSQQAFDSRGYFQVTGLQPNNQYARQDQMSLQLV  245



>ref|XP_010687170.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=254

 Score =   342 bits (877),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 176/253 (70%), Positives = 206/253 (81%), Gaps = 12/253 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSP--QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  882
             MEF + Q+ E SP  QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE
Sbjct  8     MEFPT-QTMEGSPSSQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  66

Query  881   VALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQIS  702
             VALIVFSSRGRLYEYAN+SVK TIDRYKKACSD +  GS++EAN Q+YQQEA KLR QI 
Sbjct  67    VALIVFSSRGRLYEYANHSVKGTIDRYKKACSDQSGAGSVAEANAQYYQQEAAKLRNQIR  126

Query  701   NLQNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQE  534
                  N    R+ MGEGL   ++++LKNLE+K+E+GIS+IR+KKNELLFAEI++MQKR E
Sbjct  127   TATENNRLLSRHMMGEGLSSLSMKELKNLETKLERGISRIRSKKNELLFAEIEFMQKR-E  185

Query  533   IDLHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTS  354
             I+LHNNNQ+LRA+I E ERA   QQ M+LMPG S Y +L P Q FD+RNY Q++  Q +S
Sbjct  186   IELHNNNQFLRARISENERA---QQSMSLMPGGSDY-DLVPSQSFDSRNYFQVNALQPSS  241

Query  353   SYSKQDHLPLQLV  315
              Y++QD  PLQLV
Sbjct  242   QYARQDQTPLQLV  254



>ref|XP_007211925.1| hypothetical protein PRUPE_ppa010595mg [Prunus persica]
 ref|XP_008225408.1| PREDICTED: floral homeotic protein AGAMOUS isoform X3 [Prunus 
mume]
 ref|XP_008225409.1| PREDICTED: floral homeotic protein AGAMOUS isoform X4 [Prunus 
mume]
 gb|ABU41518.1| AGAMOUS-like protein [Prunus mume]
 gb|ABU50335.1| AGAMOUS-like protein [Prunus persica]
 gb|ACL31212.1| MADS-box transcription factor [Prunus persica]
 gb|ADK95058.1| AGAMOUS-like protein [Prunus serrulata var. lannesiana]
 gb|AEA48983.1| AGAMOUS-like protein [Prunus serrulata var. lannesiana]
 gb|EMJ13124.1| hypothetical protein PRUPE_ppa010595mg [Prunus persica]
Length=243

 Score =   342 bits (876),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 201/237 (85%), Gaps = 6/237 (3%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  12    SPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLY  71

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVK TI+RYKKAC++STNTGS+SEA+TQ+YQQEA KLR QI NLQN +R+ MGE 
Sbjct  72    EYANNSVKETIERYKKACAESTNTGSVSEASTQYYQQEAAKLRAQIGNLQNSSRHMMGES  131

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   N++DLKNLESK+EKGI++IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAKI E 
Sbjct  132   LSSMNMKDLKNLESKLEKGINRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAKIAEN  190

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY-SKQDHLPLQLV  315
             ER+   QQ +N+M G  SY E+   Q +D+RNY Q++  Q    Y S+QD + LQLV
Sbjct  191   ERS---QQNINVMAGGGSY-EIMQSQPYDSRNYFQVNALQPNHQYNSRQDPMALQLV  243



>ref|XP_002305048.1| hypothetical protein POPTR_0004s06300g [Populus trichocarpa]
 gb|AAC06237.1| AGAMOUS homolog [Populus trichocarpa]
 gb|EEE85559.1| hypothetical protein POPTR_0004s06300g [Populus trichocarpa]
 gb|AFH66690.1| flowering locus C [Populus simonii x Populus nigra]
Length=241

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/247 (69%), Positives = 208/247 (84%), Gaps = 6/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             ME+Q ++S E SP RK+GRGK+EIKRIENTTNRQVTFCKRR+GLLKKAYELSVLCDAEVA
Sbjct  1     MEYQ-NESLESSPLRKLGRGKVEIKRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+N+SVK+TI+RYKKA +DS+NTGS+SEAN Q+YQQEA KLR QI NL
Sbjct  60    LIVFSSRGRLYEYSNDSVKSTIERYKKASADSSNTGSVSEANAQYYQQEAAKLRSQIGNL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   ++++LK+LE ++EKGIS+IR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  120   QNSNRHMLGEALSSLSVKELKSLEIRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLHNN  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQ LRAKI E ER   ++Q MNLMPG + + E+   Q +D+RNY Q++G Q  S YS QD
Sbjct  179   NQLLRAKISENER---KRQSMNLMPGGADF-EIVQSQPYDSRNYSQVNGLQPASHYSHQD  234

Query  335   HLPLQLV  315
              + LQLV
Sbjct  235   QMALQLV  241



>ref|XP_011009675.1| PREDICTED: floral homeotic protein AGAMOUS-like [Populus euphratica]
 ref|XP_011009676.1| PREDICTED: floral homeotic protein AGAMOUS-like [Populus euphratica]
 ref|XP_011009678.1| PREDICTED: floral homeotic protein AGAMOUS-like [Populus euphratica]
Length=241

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/247 (69%), Positives = 207/247 (84%), Gaps = 6/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEFQ ++S E SP RK+GRGK+EIKRIENTTNRQVTFCKRR+GLLKKAYELSVLCDAEVA
Sbjct  1     MEFQ-NESLESSPLRKLGRGKVEIKRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+N+SVK+TI+RYKKA +DS+NTGS+SEAN Q+YQQEA KLR QI NL
Sbjct  60    LIVFSSRGRLYEYSNDSVKSTIERYKKASADSSNTGSVSEANAQYYQQEAAKLRSQIGNL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   ++++LK+LE ++EKGIS+IR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  120   QNSNRHMLGEALSSLSVKELKSLEIRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLHNN  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQ LRAKI E ER   ++Q MNLMPG + + E+   Q +D+RNY Q++G    S YS QD
Sbjct  179   NQLLRAKISENER---KRQSMNLMPGGADF-EIVQSQPYDSRNYSQVNGLPPASHYSHQD  234

Query  335   HLPLQLV  315
              + LQLV
Sbjct  235   QMALQLV  241



>gb|AAU29513.1| MADS4 [Prunus persica]
Length=243

 Score =   340 bits (871),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 173/237 (73%), Positives = 200/237 (84%), Gaps = 6/237 (3%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  12    SPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLY  71

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVK TI+RYKKAC++STNTGS+SEA+TQ+YQQEA KLR Q  NLQN +R+ MGE 
Sbjct  72    EYANNSVKETIERYKKACAESTNTGSVSEASTQYYQQEAAKLRAQTGNLQNSSRHMMGES  131

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   N++DLKNLESK+EKGI++IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAKI E 
Sbjct  132   LSSMNMKDLKNLESKLEKGINRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAKIAEN  190

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY-SKQDHLPLQLV  315
             ER+   QQ +N+M G  SY E+   Q +D+RNY Q++  Q    Y S+QD + LQLV
Sbjct  191   ERS---QQNINVMAGGGSY-EIMQSQPYDSRNYFQVNALQPNHQYNSRQDPMALQLV  243



>ref|XP_008225406.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Prunus 
mume]
Length=304

 Score =   342 bits (876),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 201/237 (85%), Gaps = 6/237 (3%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  73    SPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLY  132

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVK TI+RYKKAC++STNTGS+SEA+TQ+YQQEA KLR QI NLQN +R+ MGE 
Sbjct  133   EYANNSVKETIERYKKACAESTNTGSVSEASTQYYQQEAAKLRAQIGNLQNSSRHMMGES  192

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   N++DLKNLESK+EKGI++IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAKI E 
Sbjct  193   LSSMNMKDLKNLESKLEKGINRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAKIAEN  251

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY-SKQDHLPLQLV  315
             ER+   QQ +N+M G  SY E+   Q +D+RNY Q++  Q    Y S+QD + LQLV
Sbjct  252   ERS---QQNINVMAGGGSY-EIMQSQPYDSRNYFQVNALQPNHQYNSRQDPMALQLV  304



>gb|AAD01744.1| agamous-like putative transcription factor [Cucumis sativus]
Length=237

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 192/236 (81%), Gaps = 10/236 (4%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY
Sbjct  12    SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  71

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKATIDRYKKA SDS+NTGS SEANTQFYQQEA KLR QI NLQN NRN +GE 
Sbjct  72    EYANNSVKATIDRYKKASSDSSNTGSTSEANTQFYQQEAAKLRVQIGNLQNSNRNMLGES  131

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L     +DLK LE+K+EKGIS+IR+KKNELLFAEI+YM+KR EIDLHNNNQ LRAKI E+
Sbjct  132   LSSLTAKDLKGLETKLEKGISRIRSKKNELLFAEIEYMRKR-EIDLHNNNQMLRAKIAES  190

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             ER       +N+M G     EL     +D R++ Q++G Q    Y +QD++ LQLV
Sbjct  191   ER------NVNMMGGE---FELMQSHPYDPRDFFQVNGLQHNHQYPRQDNMALQLV  237



>gb|AAC08528.1| CUM1 [Cucumis sativus]
Length=262

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 192/236 (81%), Gaps = 10/236 (4%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY
Sbjct  37    SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  96

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKATIDRYKKA SDS+NTGS SEANTQFYQQEA KLR QI NLQN NRN +GE 
Sbjct  97    EYANNSVKATIDRYKKASSDSSNTGSTSEANTQFYQQEAAKLRVQIGNLQNSNRNMLGES  156

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L     +DLK LE+K+EKGIS+IR+KKNELLFAEI+YM+KR EIDLHNNNQ LRAKI E+
Sbjct  157   LSSLTAKDLKGLETKLEKGISRIRSKKNELLFAEIEYMRKR-EIDLHNNNQMLRAKIAES  215

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             ER       +N+M G     EL     +D R++ Q++G Q    Y +QD++ LQLV
Sbjct  216   ER------NVNMMGGE---FELMQSHPYDPRDFFQVNGLQHNHQYPRQDNMALQLV  262



>ref|XP_008439701.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Cucumis 
melo]
Length=237

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 192/236 (81%), Gaps = 10/236 (4%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY
Sbjct  12    SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  71

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKATIDRYKKA SDS+NTGS SEANTQFYQQEA KLR QI NLQN NRN +GE 
Sbjct  72    EYANNSVKATIDRYKKASSDSSNTGSTSEANTQFYQQEAAKLRVQIGNLQNSNRNMLGES  131

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L     +DLK LE+K+EKGIS+IR+KKNELLFAEI+YM +R+EIDLHNNNQ LRAKI E+
Sbjct  132   LSSLTAKDLKGLETKLEKGISRIRSKKNELLFAEIEYM-RRREIDLHNNNQMLRAKIAES  190

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             ER       +N+M G     EL     +D R++ Q++G Q    Y +QD++ LQLV
Sbjct  191   ER------NVNMMGGE---FELMQSHPYDPRDFFQVNGLQHNHQYPRQDNMALQLV  237



>gb|ACF93432.1| MADS10 [Gossypium hirsutum]
Length=246

 Score =   337 bits (864),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 207/247 (84%), Gaps = 10/247 (4%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             ++S E SPQ+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL+VFS
Sbjct  5     NESLEDSPQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFS  64

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             SRGRLYEYANNSVKATI+RYKKA SDS+NTGS++E N +FYQQEA+KLR QI NLQN NR
Sbjct  65    SRGRLYEYANNSVKATIERYKKA-SDSSNTGSVAEVNARFYQQEADKLRNQIRNLQNANR  123

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
             + +GE +GG  +++LK+LES++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LR
Sbjct  124   HMLGESIGGLPMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLR  182

Query  500   AKIIETERAqqqqqQMNLMPGSSSYH-ELAPPQQFDARNYLQLDGFQSTSSYS----KQD  336
             AKI E ER   +QQ MNLMPG SS + E    Q +D+RNY Q+D  Q  ++Y     +QD
Sbjct  183   AKIAENER---KQQSMNLMPGGSSANFEALHSQPYDSRNYFQVDALQPATNYYNPQLQQD  239

Query  335   HLPLQLV  315
              + LQLV
Sbjct  240   QIALQLV  246



>ref|XP_010687169.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=256

 Score =   337 bits (864),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 206/255 (81%), Gaps = 14/255 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSP--QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  882
             MEF + Q+ E SP  QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE
Sbjct  8     MEFPT-QTMEGSPSSQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  66

Query  881   VALIVFSSRGRLYEYANN--SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQ  708
             VALIVFSSRGRLYEYAN+  SVK TIDRYKKACSD +  GS++EAN Q+YQQEA KLR Q
Sbjct  67    VALIVFSSRGRLYEYANHSCSVKGTIDRYKKACSDQSGAGSVAEANAQYYQQEAAKLRNQ  126

Query  707   ISNLQNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKR  540
             I      N    R+ MGEGL   ++++LKNLE+K+E+GIS+IR+KKNELLFAEI++MQKR
Sbjct  127   IRTATENNRLLSRHMMGEGLSSLSMKELKNLETKLERGISRIRSKKNELLFAEIEFMQKR  186

Query  539   QEIDLHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQS  360
              EI+LHNNNQ+LRA+I E ERA   QQ M+LMPG S Y +L P Q FD+RNY Q++  Q 
Sbjct  187   -EIELHNNNQFLRARISENERA---QQSMSLMPGGSDY-DLVPSQSFDSRNYFQVNALQP  241

Query  359   TSSYSKQDHLPLQLV  315
             +S Y++QD  PLQLV
Sbjct  242   SSQYARQDQTPLQLV  256



>ref|XP_008439700.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Cucumis 
melo]
Length=262

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 192/236 (81%), Gaps = 10/236 (4%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY
Sbjct  37    SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  96

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKATIDRYKKA SDS+NTGS SEANTQFYQQEA KLR QI NLQN NRN +GE 
Sbjct  97    EYANNSVKATIDRYKKASSDSSNTGSTSEANTQFYQQEAAKLRVQIGNLQNSNRNMLGES  156

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L     +DLK LE+K+EKGIS+IR+KKNELLFAEI+YM +R+EIDLHNNNQ LRAKI E+
Sbjct  157   LSSLTAKDLKGLETKLEKGISRIRSKKNELLFAEIEYM-RRREIDLHNNNQMLRAKIAES  215

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             ER       +N+M G     EL     +D R++ Q++G Q    Y +QD++ LQLV
Sbjct  216   ER------NVNMMGGE---FELMQSHPYDPRDFFQVNGLQHNHQYPRQDNMALQLV  262



>ref|XP_010687174.1| PREDICTED: floral homeotic protein AGAMOUS isoform X5 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687175.1| PREDICTED: floral homeotic protein AGAMOUS isoform X5 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687176.1| PREDICTED: floral homeotic protein AGAMOUS isoform X5 [Beta vulgaris 
subsp. vulgaris]
 gb|ABL63815.1| MADS-BOX protein [Beta vulgaris]
Length=249

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 206/255 (81%), Gaps = 14/255 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSP--QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  882
             MEF + Q+ E SP  QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE
Sbjct  1     MEFPT-QTMEGSPSSQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE  59

Query  881   VALIVFSSRGRLYEYANN--SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQ  708
             VALIVFSSRGRLYEYAN+  SVK TIDRYKKACSD +  GS++EAN Q+YQQEA KLR Q
Sbjct  60    VALIVFSSRGRLYEYANHSCSVKGTIDRYKKACSDQSGAGSVAEANAQYYQQEAAKLRNQ  119

Query  707   ISNLQNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKR  540
             I      N    R+ MGEGL   ++++LKNLE+K+E+GIS+IR+KKNELLFAEI++MQKR
Sbjct  120   IRTATENNRLLSRHMMGEGLSSLSMKELKNLETKLERGISRIRSKKNELLFAEIEFMQKR  179

Query  539   QEIDLHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQS  360
              EI+LHNNNQ+LRA+I E ERA   QQ M+LMPG S Y +L P Q FD+RNY Q++  Q 
Sbjct  180   -EIELHNNNQFLRARISENERA---QQSMSLMPGGSDY-DLVPSQSFDSRNYFQVNALQP  234

Query  359   TSSYSKQDHLPLQLV  315
             +S Y++QD  PLQLV
Sbjct  235   SSQYARQDQTPLQLV  249



>emb|CAA56655.1| SLM1 [Silene latifolia subsp. alba]
Length=248

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 204/251 (81%), Gaps = 9/251 (4%)
 Frame = -1

Query  1055  MEFQSDQSRE---MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDA  885
             MEF S  +RE    S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDA
Sbjct  1     MEFSSQITREEGSPSSQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDA  60

Query  884   EVALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQI  705
             EVALIVFSSRGRLYEYAN+SVK TIDRYKKA SD++   S +EAN Q+YQQEA KLR QI
Sbjct  61    EVALIVFSSRGRLYEYANHSVKGTIDRYKKASSDNSGASSAAEANAQYYQQEAAKLRNQI  120

Query  704   SNLQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDL  525
               +   NR+ MGEGL   N++DLK+LE+K+E+GIS+IR+KKNELLFAEI++MQKR E++L
Sbjct  121   RTVTENNRHLMGEGLSSLNMKDLKSLENKLERGISRIRSKKNELLFAEIEFMQKR-EVEL  179

Query  524   HNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELA-PPQQFDARNYLQLDGFQSTSS-  351
             HNNNQYLRAKI E ERA   QQ M+LMPG SS +ELA PPQ FD+RNY Q++  Q  ++ 
Sbjct  180   HNNNQYLRAKIAENERA---QQSMSLMPGGSSEYELAPPPQSFDSRNYFQVNALQPNNTH  236

Query  350   YSKQDHLPLQL  318
             YS+ D   LQL
Sbjct  237   YSRPDQTTLQL  247



>ref|NP_001237504.1| MADS-box protein [Glycine max]
 gb|AAR26530.1| MADS-box protein [Glycine max]
Length=243

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/243 (73%), Positives = 201/243 (83%), Gaps = 5/243 (2%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             D S  +SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  5     DPSMSVSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  64

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             SRGRLYEYANNSVKATI+RYKKA SDS+  GS SEAN QFYQQEA+KLRQQISNLQN NR
Sbjct  65    SRGRLYEYANNSVKATIERYKKASSDSSGAGSASEANAQFYQQEADKLRQQISNLQNNNR  124

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
               MG+ LG    +DLKNLE+K+EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LR
Sbjct  125   QMMGDSLGSLTAKDLKNLETKLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLR  183

Query  500   AKIIETERAqqqqqQMNLMPGSSSYHEL-APPQQFDARNYLQLDGFQSTSSYSKQDHLPL  324
             AKI E+ER       M ++PG S+Y  + +  QQFD+R Y Q+ G Q  + Y++QD + L
Sbjct  184   AKIAESER---NHHNMAVLPGGSNYDSMQSSQQQFDSRGYFQVTGLQPNNQYARQDQMSL  240

Query  323   QLV  315
             QLV
Sbjct  241   QLV  243



>emb|CAA61480.1| MADS box regulatory protein [Rumex acetosa]
 gb|AAA80306.1| MADS box regulatory protein [Rumex acetosa]
Length=253

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 179/260 (69%), Positives = 206/260 (79%), Gaps = 20/260 (8%)
 Frame = -1

Query  1055  MEFQSDQSREM---SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDA  885
             MEF ++ SR+M   SPQRKMGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDA
Sbjct  1     MEFSNELSRDMEDGSPQRKMGRGKIEIKRIENVTNRQVTFCKRRNGLLKKAYELSVLCDA  60

Query  884   EVALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQI  705
             EVALIVFSSRGRLYEYAN+SVKATI+RYKK CSDST   S+ EAN    QQEA KLR QI
Sbjct  61    EVALIVFSSRGRLYEYANHSVKATIERYKKTCSDSTGVTSVEEANA---QQEAAKLRNQI  117

Query  704   SNLQNQ----NRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQ  537
               LQNQ    +RN MGEGL   N++DLKNLE+++EKGIS++RAKKNELLF EI++MQK+ 
Sbjct  118   RTLQNQTRNTSRNLMGEGLTSMNMKDLKNLETRLEKGISRVRAKKNELLFGEIEFMQKK-  176

Query  536   EIDLHNNNQYLRAKIIETERAqqqqqQMNLMPGSSS---YHELAPPQQ---FDARNYLQL  375
             EI+LHNNNQ+LRAKI E+ER+   QQ MNLMPGSSS   ++EL P  Q   FD+RN+ Q+
Sbjct  177   EIELHNNNQFLRAKIAESERS---QQSMNLMPGSSSGEQHYELMPQSQAGPFDSRNFFQV  233

Query  374   DGFQSTSSYSKQDHLPLQLV  315
                Q    YS Q+  PLQLV
Sbjct  234   SDLQPDERYSCQNQTPLQLV  253



>ref|XP_011002033.1| PREDICTED: floral homeotic protein AGAMOUS-like [Populus euphratica]
 ref|XP_011002034.1| PREDICTED: floral homeotic protein AGAMOUS-like [Populus euphratica]
 ref|XP_011002035.1| PREDICTED: floral homeotic protein AGAMOUS-like [Populus euphratica]
Length=241

 Score =   334 bits (857),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 203/247 (82%), Gaps = 6/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M +Q ++S+  SP RK+GRGK+EIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYQ-NESQGSSPLRKLGRGKVEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEY+NNSVK+TI+RYKKAC+DS+N GS+SEAN QFYQQEA KLR QI NL
Sbjct  60    LIVFSNRGRLYEYSNNSVKSTIERYKKACADSSNNGSVSEANAQFYQQEAAKLRSQIGNL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NRN +GE L   ++++LK+LE K+EKGI +IR+KKNELLFAEI+YMQKR EIDLHNN
Sbjct  120   QNSNRNMLGESLSALSVKELKSLEIKLEKGIGRIRSKKNELLFAEIEYMQKR-EIDLHNN  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQ LRAKI E ER   +++ MNLMP   ++ E+   Q FD+RNY Q++G    + Y  +D
Sbjct  179   NQLLRAKIAENER---KREHMNLMPAGVNF-EIMQSQPFDSRNYSQVNGLPPANHYPHED  234

Query  335   HLPLQLV  315
              + LQLV
Sbjct  235   QMALQLV  241



>gb|AAS45686.1| AGAMOUS-like protein [Meliosma dilleniifolia]
Length=225

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 195/230 (85%), Gaps = 6/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATIDRYKKAC+D++NTGS+SEAN QFYQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVKATIDRYKKACADTSNTGSVSEANAQFYQQESSKLRQQIVILQNSNRHLMGEALSAMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE ++EKGIS+IR+KKNE+LFAEI+YMQKR EID+ N+N YLRAKI E ERA  
Sbjct  121   VKELKQLEGRLEKGISRIRSKKNEMLFAEIEYMQKR-EIDMQNDNMYLRAKIAENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQ M++MP  +S +E  PPQQFD+RN+LQ++  +    YS+Q+   LQL
Sbjct  178   -QQHMSMMP--TSEYEAMPPQQFDSRNFLQVNLLEPNHHYSRQEQTALQL  224



>emb|CAI61983.1| AGAMOUS protein [Impatiens balsamina]
Length=256

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 175/246 (71%), Positives = 201/246 (82%), Gaps = 10/246 (4%)
 Frame = -1

Query  1028  EMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             ++S QRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL+VFSSRGR
Sbjct  13    DISGQRKNGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGR  72

Query  848   LYEYANNSVKATIDRYKKACSDSTNT-GSISEANTQFYQQEANKLRQQISNLQNQNRNYM  672
             LYEYANNSV+ TI+RYKKA SD+ NT GS++EAN QFYQQE++KLRQQI NLQN NR  +
Sbjct  73    LYEYANNSVRGTIERYKKASSDTPNTAGSVAEANAQFYQQESSKLRQQIGNLQNSNRQIL  132

Query  671   GEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKI  492
             GE L   NLRDLK+LES++E+ ISKIR+KKNELLFAEID+MQKR E+DLHNNNQ+LRAKI
Sbjct  133   GESLSSMNLRDLKSLESRLERSISKIRSKKNELLFAEIDFMQKR-EVDLHNNNQFLRAKI  191

Query  491   IETERA----qqqqqQMNLMPGSSSYHELAPPQ---QFDARNYLQLDGFQSTSSYSKQDH  333
              E+ERA    Q QQ Q+NLMPG S+Y EL   Q    FD RN+ Q+   Q  + YS+ D 
Sbjct  192   SESERAQQQQQHQQTQINLMPGGSNY-ELVQSQAQTSFDNRNFFQVTALQPDNQYSRDDQ  250

Query  332   LPLQLV  315
              P QLV
Sbjct  251   TPFQLV  256



>gb|ADP00515.1| MADS-box factor MADS1 [Cymbidium ensifolium]
 gb|AFP19447.1| MADS-box protein AG1 [Cymbidium faberi]
Length=233

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 199/236 (84%), Gaps = 4/236 (2%)
 Frame = -1

Query  1025  MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             M P+ KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FSSRGRL
Sbjct  1     MEPKEKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRL  60

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGE  666
             YEYANNSVK TIDRYKKAC+D+++TGSISEAN+Q+YQQEA KLRQQI+NLQN NRN +G+
Sbjct  61    YEYANNSVKGTIDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGD  120

Query  665   GLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIE  486
              L   +LRDLK LE+++EKGISKIR+KKNELL AEIDYMQKR E+DL  +N YLR+KI +
Sbjct  121   ALTTMSLRDLKQLETRLEKGISKIRSKKNELLHAEIDYMQKR-EMDLQTDNMYLRSKIAD  179

Query  485   TERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              ERA QQ Q M+++P +S+ +E+ PP  FD+R++LQ++    +  YS Q    LQL
Sbjct  180   NERA-QQHQHMSILPSTSTEYEVMPP--FDSRSFLQVNLLDPSDHYSHQQQTALQL  232



>gb|AAT46102.1| AGAMOUS-like protein [Akebia trifoliata]
Length=245

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 196/235 (83%), Gaps = 6/235 (3%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL+VFS+RGRLY
Sbjct  16    SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSNRGRLY  75

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EY+NNSVK TI+RYKKAC DS+N+GS+SEAN QFYQQE+ KLRQQI NLQN NR+ MGE 
Sbjct  76    EYSNNSVKTTIERYKKACVDSSNSGSVSEANAQFYQQESLKLRQQIGNLQNLNRHLMGEA  135

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             LG  ++++LK LE++IEKGIS+IR+KKNELLFAEI+YMQKR EIDL N+N YLRAKI E 
Sbjct  136   LGSMSIKELKQLETRIEKGISRIRSKKNELLFAEIEYMQKR-EIDLQNDNMYLRAKIAEN  194

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
             ERA    Q MNLMPG+   +E+     FD+RN+LQ++  +  + YS  D   LQL
Sbjct  195   ERA---GQHMNLMPGNE--YEVMSSAPFDSRNFLQVNLLEPNNHYSHTDQTALQL  244



>gb|KHG12869.1| Floral homeotic AGAMOUS -like protein [Gossypium arboreum]
 gb|KHG29394.1| Floral homeotic AGAMOUS -like protein [Gossypium arboreum]
Length=246

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 177/247 (72%), Positives = 207/247 (84%), Gaps = 10/247 (4%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             ++S E SPQ+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  5     NESLEDSPQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  64

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             +RGRLYEYANNSVKATI+RYKKA SDS+NTGS++E N QFYQQEA+KLR QI NLQN NR
Sbjct  65    NRGRLYEYANNSVKATIERYKKA-SDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNANR  123

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
             + +GE +GG  +++LK+LES++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LR
Sbjct  124   HMLGESIGGLPMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLR  182

Query  500   AKIIETERAqqqqqQMNLMPGSSSYH-ELAPPQQFDARNYLQLDGFQSTSSY----SKQD  336
             AKI E ER   +QQ MNLMPG SS + E    Q +D+RNY Q+D  Q  ++Y     +QD
Sbjct  183   AKIAENER---KQQSMNLMPGGSSANFEALHSQPYDSRNYFQVDALQPATNYYNPQQQQD  239

Query  335   HLPLQLV  315
              + LQLV
Sbjct  240   QIALQLV  246



>ref|XP_002317315.1| MADS-box family protein [Populus trichocarpa]
 gb|AAC06238.1| AGAMOUS homolog [Populus trichocarpa]
 gb|EEE97927.1| MADS-box family protein [Populus trichocarpa]
Length=238

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 200/242 (83%), Gaps = 6/242 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M +Q ++ +E SP RK+GRGK+EIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYQ-NEPQESSPLRKLGRGKVEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVK+TI+RYKKAC+DS+N GS+SEAN QFYQQEA KLR QI NL
Sbjct  60    LIVFSSRGRLYEYSNNSVKSTIERYKKACADSSNNGSVSEANAQFYQQEAAKLRSQIGNL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NRN +GE L   ++++LK+LE K+EKGI +IR+KKNELLFAEI+YMQKR EIDLHNN
Sbjct  120   QNSNRNMLGESLSALSVKELKSLEIKLEKGIGRIRSKKNELLFAEIEYMQKR-EIDLHNN  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             NQ LRAKI E ER   ++Q MNLMPG  ++ E+   Q FD+RNY Q++G    + Y  +D
Sbjct  179   NQLLRAKIAENER---KRQHMNLMPGGVNF-EIMQSQPFDSRNYSQVNGLPPANHYPHED  234

Query  335   HL  330
              L
Sbjct  235   QL  236



>ref|XP_004504255.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Cicer 
arietinum]
 ref|XP_004504256.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Cicer 
arietinum]
 ref|XP_004504257.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Cicer 
arietinum]
 ref|XP_004504258.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X4 [Cicer 
arietinum]
Length=237

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/237 (70%), Positives = 198/237 (84%), Gaps = 5/237 (2%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  5     SPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLY  64

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKA+I+RYKKACSDS+   S SE N Q+YQQEA KLR QISNLQN NR  MGE 
Sbjct  65    EYANNSVKASIERYKKACSDSSGCKSASETNAQYYQQEAAKLRVQISNLQNHNRQMMGEA  124

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   + +DL+NLE+K+EKGIS+IR+KKNE+LFAEI+YMQK+ EI+LHN+NQ LRAKI E+
Sbjct  125   LSNMSGKDLRNLETKLEKGISRIRSKKNEMLFAEIEYMQKK-EIELHNSNQVLRAKISES  183

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSS-YSKQDHLPLQLV  315
             ER+   Q  +N++ G +++  +  PQQFD RNY Q+ G Q  ++ Y++QDH+ LQ V
Sbjct  184   ERS---QHNVNVLSGGTNFECMQTPQQFDPRNYFQVTGLQPNNNQYARQDHISLQFV  237



>gb|ACR47977.1| MADS box protein [Cucumis sativus]
Length=262

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 170/236 (72%), Positives = 191/236 (81%), Gaps = 10/236 (4%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLK+AYELSVLCDAEVALIVFSSRGRLY
Sbjct  37    SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKRAYELSVLCDAEVALIVFSSRGRLY  96

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKATIDRYKKA SDS+NTGS SEANTQFYQQEA KLR QI NLQ+ NRN +GE 
Sbjct  97    EYANNSVKATIDRYKKASSDSSNTGSTSEANTQFYQQEAAKLRVQIGNLQSSNRNMLGES  156

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L     +DLK LE+K+EKGIS+IR+KKNELLFAEI+YM+KR EIDLHNNNQ LRAKI E+
Sbjct  157   LSPLTAKDLKGLETKLEKGISRIRSKKNELLFAEIEYMRKR-EIDLHNNNQMLRAKIAES  215

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             ER       +N+M G     EL     +D R + Q++G Q    Y +QD++ LQLV
Sbjct  216   ER------NVNMMGGE---FELMQSHPYDPRVFFQVNGLQHNHQYPRQDNMALQLV  262



>gb|AAL92522.1| AG-like protein [Gossypium hirsutum]
Length=244

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 173/245 (71%), Positives = 203/245 (83%), Gaps = 10/245 (4%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             ++S E SPQ+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL+ FS
Sbjct  5     NESLEDSPQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVAFS  64

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             SRGRLYEYANNSVKATI+RYKKA SDS+NTGS++E N QFYQQEA+KLR QI NLQN NR
Sbjct  65    SRGRLYEYANNSVKATIERYKKA-SDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNANR  123

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
             + +GE +GG  +++LK+LES++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LR
Sbjct  124   HMLGESIGGLPMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLR  182

Query  500   AKIIETERAqqqqqQMNLMPGSSSYH-ELAPPQQFDARNYLQLDGFQSTSSYS----KQD  336
             AKI E ER   +QQ MNLMPG SS + E    Q +D+RNY Q+D  Q  ++Y     +QD
Sbjct  183   AKIAENER---KQQSMNLMPGGSSANFEALHSQPYDSRNYFQVDALQPATNYYNPQLQQD  239

Query  335   HLPLQ  321
              + L 
Sbjct  240   QIALH  244



>gb|ABC25564.1| MADS box 2 [Momordica charantia]
Length=231

 Score =   332 bits (850),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 194/238 (82%), Gaps = 12/238 (5%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY
Sbjct  4     SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  63

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKATIDRYKKA SDS+NTGS SEANTQFYQQEA KLR QI NLQN NRN +GE 
Sbjct  64    EYANNSVKATIDRYKKASSDSSNTGSTSEANTQFYQQEAAKLRVQIGNLQNSNRNMLGES  123

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   +++DLK+LESK+EKGIS+IR+KKNELLFAEI+YM+KR EIDLHNNNQ LRAKI E+
Sbjct  124   LSSLSVKDLKSLESKLEKGISRIRSKKNELLFAEIEYMRKR-EIDLHNNNQLLRAKIAES  182

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSS--YSKQDHLPLQLV  315
             ER          M G     EL     +D R++ Q++G Q  ++  Y +QD++ LQLV
Sbjct  183   ERNAS-------MIGGD--FELMQSHPYDPRDFFQVNGLQHNNNHQYPRQDNMALQLV  231



>gb|ACI23561.1| agamous-like protein 2 [Gossypium barbadense]
Length=244

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 174/245 (71%), Positives = 204/245 (83%), Gaps = 10/245 (4%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             ++S E SPQ+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  5     NESLEDSPQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  64

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             SRGRLYEYANNSVKATI+RYKKA SDS+NTGS++E N QFYQQEA+KLR QI NLQN NR
Sbjct  65    SRGRLYEYANNSVKATIERYKKA-SDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNTNR  123

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
             + +GE +GG  +++LK+LES++EKGIS+IR+KKNELLFAEI+YMQK+ EIDLHNNNQ LR
Sbjct  124   HMLGESVGGLPMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKK-EIDLHNNNQLLR  182

Query  500   AKIIETERAqqqqqQMNLMPGSSSYH-ELAPPQQFDARNYLQLDGFQSTSSY----SKQD  336
             AKI E ER   +QQ MNLMPG SS + E    Q +D+RNY Q+D  Q  ++Y     +QD
Sbjct  183   AKIAENER---KQQSMNLMPGGSSNNFEAIHSQPYDSRNYFQVDTLQPAANYYNPQQQQD  239

Query  335   HLPLQ  321
              + L 
Sbjct  240   QIALH  244



>emb|CAC81071.1| MADS box transcription factor [Daucus carota subsp. sativus]
Length=255

 Score =   332 bits (851),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 176/259 (68%), Positives = 211/259 (81%), Gaps = 16/259 (6%)
 Frame = -1

Query  1055  MEFQSDQSREMS-PQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  879
             M F  DQS ++S  +RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV
Sbjct  1     MSFVDDQSGDLSLHERKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  60

Query  878   ALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISN  699
             ALIVFS+RGRLYEYANNSV+ TI+RYKKA SD+ NT ++SEANTQ+YQ+EA +LRQQISN
Sbjct  61    ALIVFSNRGRLYEYANNSVRGTIERYKKANSDTPNTATVSEANTQYYQKEAARLRQQISN  120

Query  698   LQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHN  519
             LQN NR+ MGE LG    ++LK LE+K++ G+S++R+KKNELLFAEI++M+KR EIDLHN
Sbjct  121   LQNSNRHLMGEALGAVPAKELKGLETKLQNGLSRVRSKKNELLFAEIEFMRKR-EIDLHN  179

Query  518   NNQYLRAKIIETERAqqqqqQMNLMPGSSS----YHELAPPQQ-FDARNYLQLDGFQSTS  354
             NNQYLRAKI E ERA   QQQM+LMPG+S     Y ++  P + FDARNYLQ++G Q  +
Sbjct  180   NNQYLRAKISENERA---QQQMSLMPGASGSSEQYRDVGQPHESFDARNYLQVNGLQPNN  236

Query  353   S--YSKQD----HLPLQLV  315
             +   S QD    H+PLQLV
Sbjct  237   ANYSSHQDHQTQHVPLQLV  255



>gb|AAZ77747.1| agamous-like MADS box 2 [Castanea mollissima]
Length=242

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 199/242 (82%), Gaps = 4/242 (2%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             +QS  +SPQRK+GRGK+E+KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  5     NQSMSLSPQRKIGRGKMEMKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  64

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             +RGRLYEYANNSVK+TI+RYKKAC+DS+NTGS++EANTQFYQQE+ KLR QI NLQN  +
Sbjct  65    TRGRLYEYANNSVKSTIERYKKACADSSNTGSVAEANTQFYQQESAKLRAQIGNLQNSKQ  124

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
                GE L    +++LK+LE K+E+GIS+IR+KKNELLFAEI+YMQKR E++LHNNNQ LR
Sbjct  125   ANDGESLSNLTVKELKSLEIKLERGISRIRSKKNELLFAEIEYMQKR-EVELHNNNQLLR  183

Query  500   AKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQ  321
             AKI E ER    QQ +N+MP     +EL   QQ+D+RN+ Q++  Q    Y ++D + LQ
Sbjct  184   AKIAENER---NQQNLNVMPAGGGSYELMQTQQYDSRNFFQVNALQPNHQYPREDQMSLQ  240

Query  320   LV  315
             LV
Sbjct  241   LV  242



>gb|AFY98824.1| AGAMOUS-like protein [Platanus x acerifolia]
 gb|AFY98825.1| AGAMOUS-like protein [Platanus x acerifolia]
Length=225

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 195/230 (85%), Gaps = 6/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL+VFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK TIDRYKKAC+DS+N+GS+SEAN  FYQQEA+KLRQQI  LQNQ R  MGE L   N
Sbjct  61    SVKTTIDRYKKACADSSNSGSVSEANALFYQQEASKLRQQIGYLQNQQRELMGESLSSMN  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             ++ LK+LE+++EKGI++IR+KKNELLFAEI++MQKR EIDL N+N YLRAKI E ER   
Sbjct  121   VKQLKHLETRLEKGINRIRSKKNELLFAEIEFMQKR-EIDLQNDNMYLRAKIAENERT--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQ+N+MPG S  +E+ PPQ FD+RN+LQ++  +    YS+Q+ + LQL
Sbjct  178   -QQQLNMMPGPS--YEVMPPQAFDSRNFLQVNQMEPNRHYSRQESIALQL  224



>gb|ADC79702.1| AGAMOUS-like protein [Pachysandra terminalis]
Length=225

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 195/230 (85%), Gaps = 6/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKI IKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN
Sbjct  1     MGRGKIAIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYKKA +DS+N GS+SEAN Q+YQQEANKLRQQI NLQN +RN +GE L   +
Sbjct  61    SVKATIERYKKASTDSSNPGSVSEANAQYYQQEANKLRQQIGNLQNSSRNMLGESLSSLS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK+LE+++EK ISKIR+KKNELLFAEI+YMQKR EIDL N+N YLRAKI E ER   
Sbjct  121   MKELKSLETRLEKAISKIRSKKNELLFAEIEYMQKR-EIDLQNDNMYLRAKITENERV--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMNLMPGS   +E+   Q FD+RN+LQ++  + +  YS+Q+H  LQL
Sbjct  178   -QQQMNLMPGSD--YEVMASQSFDSRNFLQVNLMEPSHHYSRQEHTALQL  224



>gb|AHH28261.1| MADS-box transcription factor, partial [Rhizanthes lowii]
Length=225

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 192/230 (83%), Gaps = 5/230 (2%)
 Frame = -1

Query  1004  GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  825
             GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS
Sbjct  1     GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  60

Query  824   VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFNL  645
             VK+TIDRYKKA +DS+N+GS+SEAN QFYQQEA KLR QI NLQN NR+ +GE L   ++
Sbjct  61    VKSTIDRYKKASADSSNSGSVSEANAQFYQQEAAKLRVQIGNLQNSNRHMLGESLDALSI  120

Query  644   RDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqqq  465
             ++LK+LE ++EKGIS+IR+KKNELLFAEI+YMQ+R EIDLHNNNQ LRAKI E ER   +
Sbjct  121   KELKSLEIRLEKGISRIRSKKNELLFAEIEYMQRR-EIDLHNNNQLLRAKIAENER---K  176

Query  464   qqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
              Q MNLMPG  +Y E+   Q FD+RNY Q++  Q  + Y  QD + LQLV
Sbjct  177   HQNMNLMPGEGNY-EIMQSQPFDSRNYFQVNALQPINHYHHQDQMSLQLV  225



>ref|XP_008371525.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Malus 
domestica]
 ref|XP_008371526.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Malus 
domestica]
 ref|XP_008371527.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Malus 
domestica]
 ref|XP_008371528.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Malus 
domestica]
Length=245

 Score =   330 bits (846),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 198/238 (83%), Gaps = 6/238 (3%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  12    SPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLY  71

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKAT++RYKK C+DS+NTGS+SEA+TQ+YQQE  KLR QI NLQN NRN MG+ 
Sbjct  72    EYANNSVKATVERYKKTCADSSNTGSVSEASTQYYQQEXAKLRAQIGNLQNANRNMMGDA  131

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L    ++DLK+LESK+EKGIS+IR+KKNELLFAEI+YMQKR E+DLHNNNQ LRAKI E 
Sbjct  132   LSSMPIKDLKSLESKLEKGISRIRSKKNELLFAEIEYMQKR-ELDLHNNNQLLRAKIAEN  190

Query  482   ERAqqqqqQMNLMP-GSSSYHELAPPQQFDARNYLQLDGFQSTSSYS-KQDHLPLQLV  315
             ER    QQ +N+M  G +S +++   Q +D+RNY Q++  Q    Y+ + D + LQLV
Sbjct  191   ERG---QQNINVMAGGGTSSYDILQSQPYDSRNYFQVNALQPNHQYNPRHDQISLQLV  245



>dbj|BAD18011.1| MADS-box transcription factor [Asparagus virgatus]
Length=226

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 194/230 (84%), Gaps = 5/230 (2%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYKKAC+D+TNTG++SEAN+Q+YQQEA+KLRQQI+NLQN NRN MGE L    
Sbjct  61    SVKATIERYKKACTDTTNTGTVSEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSSMG  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LES++EKGISKIR+KKNELL+AEI+YMQKR E++L N+N YLR KI E ERA  
Sbjct  121   LRDLKQLESRLEKGISKIRSKKNELLYAEIEYMQKR-EMELQNDNMYLRNKIAENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++P ++S      P QFD+RN+LQ++       YS+Q    LQL
Sbjct  178   -QQQMNMLPAATSNEYEGMP-QFDSRNFLQVNLLDPNHHYSQQQQTALQL  225



>ref|XP_003629877.1| Floral homeotic protein AGAMOUS [Medicago truncatula]
 gb|AET04353.1| MADS-box transcription factor [Medicago truncatula]
 gb|AGV55406.1| MADS-box transcription factor AGAMOUSb [Medicago truncatula]
 gb|AIT11838.1| AGAMOUSb [Medicago truncatula]
Length=244

 Score =   330 bits (845),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 196/237 (83%), Gaps = 4/237 (2%)
 Frame = -1

Query  1022  SPQR-KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             SPQR K+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRL
Sbjct  11    SPQRAKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRL  70

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGE  666
             YEYANNSVKA+I+RYKKACSDS+   S SE+N Q+YQQEA KLR QISNLQN NR  MGE
Sbjct  71    YEYANNSVKASIERYKKACSDSSGAKSASESNVQYYQQEAAKLRVQISNLQNHNRQMMGE  130

Query  665   GLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIE  486
              L   N +DL+NLESK+EKGIS+IR+KKNE+LFAE++YMQKR E++LHN+NQ LRAKI E
Sbjct  131   SLSNMNGKDLRNLESKLEKGISRIRSKKNEMLFAELEYMQKR-EVELHNSNQVLRAKISE  189

Query  485   TERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             +E+  +    +N++PG +S+  + P QQFD+R Y Q++  Q    Y++QD + LQ V
Sbjct  190   SEQ--RSNHNVNVLPGGTSFECMQPQQQFDSRGYFQVNELQPNDQYARQDQMSLQFV  244



>ref|XP_009360794.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009360795.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009360796.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Pyrus 
x bretschneideri]
Length=243

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 202/248 (81%), Gaps = 6/248 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M ++S      SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYESKSLSMDSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFS+RGRLYEYANNSVK TI+RYKKAC+DS+NTGS+SEA+TQ+YQQEA KLR QI  L
Sbjct  61    LVVFSNRGRLYEYANNSVKGTIERYKKACADSSNTGSVSEASTQYYQQEAAKLRAQIVKL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NRN MG+ L    ++DLK+LE+K+EKGIS+IR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  121   QNDNRNMMGDALSSMPVKDLKSLENKLEKGISRIRSKKNELLFAEIEYMQKR-ELDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYS-KQ  339
             NQ LRAKI E ER    QQ +N+M G  SY E+   Q +D+R+Y Q++  Q  + Y+ + 
Sbjct  180   NQLLRAKIAENERG---QQNINVMAGGGSY-EILQSQPYDSRDYFQVNVLQPNNHYNPRH  235

Query  338   DHLPLQLV  315
             D + LQLV
Sbjct  236   DQISLQLV  243



>gb|AEZ51868.1| AG MADS-box protein [Cymbidium ensifolium]
Length=233

 Score =   329 bits (843),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 163/236 (69%), Positives = 198/236 (84%), Gaps = 4/236 (2%)
 Frame = -1

Query  1025  MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             M P+ KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FSSRGRL
Sbjct  1     MEPKEKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRL  60

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGE  666
             YEYANNSVK T DRYKKAC+D+++TGSISEAN+Q+YQQEA KLRQQI+NLQN NRN +G+
Sbjct  61    YEYANNSVKGTTDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGD  120

Query  665   GLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIE  486
              L   +LRDLK LE+++EKGISKIR+KKNELL AEIDYMQKR E+DL  +N YLR+KI +
Sbjct  121   ALTTMSLRDLKQLETRLEKGISKIRSKKNELLHAEIDYMQKR-EMDLQTDNMYLRSKIAD  179

Query  485   TERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              ERA QQ Q ++++P +S+ +E+ PP  FD+R++LQ++    +  YS Q    LQL
Sbjct  180   NERA-QQHQHISILPSTSTEYEVMPP--FDSRSFLQVNLLDPSDHYSHQQQTALQL  232



>gb|ABM69042.1| MADS-box protein MADS4 [Gossypium hirsutum]
Length=246

 Score =   329 bits (844),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 199/232 (86%), Gaps = 6/232 (3%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             ++S E SPQ+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  5     NESLEDSPQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  64

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             +RGRLYEYANNSVKATI+RYKKA SDS+NTGS++E N QFYQQEA+KLR QI NLQN NR
Sbjct  65    NRGRLYEYANNSVKATIERYKKA-SDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNTNR  123

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
             + +GE +GG  +++LK+LE+++EKGIS+IR+KKNELLFAEI+YMQK+ EIDLHNNNQ LR
Sbjct  124   HMLGESVGGLPMKELKSLETRLEKGISRIRSKKNELLFAEIEYMQKK-EIDLHNNNQLLR  182

Query  500   AKIIETERAqqqqqQMNLMPGSSSYH-ELAPPQQFDARNYLQLDGFQSTSSY  348
             AKI E ER   +Q+ MNLMPG SS + E    Q +D+RNY Q+D  Q  ++Y
Sbjct  183   AKIAENER---KQESMNLMPGGSSNNFEAIHSQPYDSRNYFQVDALQPAANY  231



>ref|XP_003546055.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Glycine 
max]
 ref|XP_006597496.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Glycine 
max]
Length=243

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 197/241 (82%), Gaps = 5/241 (2%)
 Frame = -1

Query  1034  SREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR  855
             S  +SPQ+KMG GKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR
Sbjct  7     SMSVSPQKKMGGGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR  66

Query  854   GRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNY  675
             GRLYEYANNSVKATI+RYKKACSDS+  GS SEAN QFYQQEA+KLR QIS+LQN NR  
Sbjct  67    GRLYEYANNSVKATIERYKKACSDSSGAGSASEANAQFYQQEADKLRAQISSLQNNNRQM  126

Query  674   MGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAK  495
             MGE LG    ++LKNLE+K+EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAK
Sbjct  127   MGESLGPLTAKELKNLETKLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAK  185

Query  494   IIETERAqqqqqQMNLMPGSSSYHEL-APPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
             I E ER       + ++PG S+Y  L    QQFD+R Y Q+ G Q  + Y++QD + LQL
Sbjct  186   IAEGER---NHHNLAVLPGGSNYDSLQTSQQQFDSRGYFQVTGLQPNNQYARQDQMSLQL  242

Query  317   V  315
             V
Sbjct  243   V  243



>gb|AAY85372.1| Me341 [Beta vulgaris]
Length=230

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 194/235 (83%), Gaps = 9/235 (4%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN+
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANH  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQN----RNYMGEGL  660
             SVK TIDRYKKACS+ +  GS++EAN Q+YQQEA KLR QI      N    R+ MGEGL
Sbjct  61    SVKGTIDRYKKACSNQSGAGSVAEANAQYYQQEAAKLRNQIRTATENNRLLSRHMMGEGL  120

Query  659   GGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETE  480
                ++++LKNLE+K+E+GIS+IR+KKNELLFAEI++MQKR EI+LHNNNQ+LRA+I E E
Sbjct  121   SSLSMKELKNLETKLERGISRIRSKKNELLFAEIEFMQKR-EIELHNNNQFLRARISENE  179

Query  479   RAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             RA   QQ M+LMPG S Y +L P Q FD+RNY Q++  Q +S Y++QD  PLQLV
Sbjct  180   RA---QQSMSLMPGGSDY-DLVPXQSFDSRNYFQVNXLQPSSQYARQDQTPLQLV  230



>gb|AAT91060.1| C class floral identity transcription factor AGAMOUS [Spinacia 
oleracea]
Length=230

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 190/234 (81%), Gaps = 8/234 (3%)
 Frame = -1

Query  1004  GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  825
             GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE+ALIVFSSRGRLYEYAN S
Sbjct  1     GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYANQS  60

Query  824   VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQN----RNYMGEGLG  657
             VK TIDRYKKACSD T  GS++EAN Q+YQQEA KLR QI      N    R+ MGEGL 
Sbjct  61    VKGTIDRYKKACSDQTGAGSVAEANAQYYQQEAAKLRNQIRTATENNRLLSRHMMGEGLS  120

Query  656   GFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETER  477
               ++++LKNLE+K+EKGIS+IR+KKNELLFAEI++MQKR EI+LHNNNQ+LRA+I E ER
Sbjct  121   SLSMKELKNLETKLEKGISRIRSKKNELLFAEIEFMQKR-EIELHNNNQFLRARISENER  179

Query  476   AqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             A   QQ M+LMP   S ++L P Q FD+RNY Q++  Q  S Y++QD  PLQLV
Sbjct  180   A---QQSMSLMPPGGSDYDLVPSQSFDSRNYFQVNALQPNSQYARQDQTPLQLV  230



>gb|ACB70410.1| agamous MADS-box transcription factor [Hosta plantaginea]
Length=225

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 195/230 (85%), Gaps = 6/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYKKAC+D+TNTG++SEAN+Q+YQQEA+KLRQQI+NLQN NRN +GE L   +
Sbjct  61    SVKATIERYKKACTDTTNTGTVSEANSQYYQQEASKLRQQITNLQNSNRNLLGESLSTMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N+N YLR KI E ERA  
Sbjct  121   LRDLKQLEGRLEKGINKIRIKKNELLFAEIEYMQKR-EMELQNDNMYLRNKIAENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++P +++ +E  P  QFD+RN+LQ+   +    YS+Q    LQL
Sbjct  178   -QQQMNMLPAATTDYEGVP--QFDSRNFLQVSLMEPNHHYSRQQQTALQL  224



>gb|ADP00516.1| MADS-box factor MADS2 [Cymbidium ensifolium]
Length=234

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/236 (69%), Positives = 198/236 (84%), Gaps = 4/236 (2%)
 Frame = -1

Query  1025  MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             M P+ KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FS+RGRL
Sbjct  2     MEPKEKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRL  61

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGE  666
             YEYANNSVKATI++YKKACSD++N+G+ISE N Q+Y QEA+KLRQQI+NLQN NRN MGE
Sbjct  62    YEYANNSVKATIEKYKKACSDNSNSGTISETNAQYYMQEASKLRQQITNLQNSNRNLMGE  121

Query  665   GLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIE  486
              L   +LRDLK LE+++EKGI+KIR+KKNELL+AEI+YMQKR E++L N+N YLR KI E
Sbjct  122   ALSTMSLRDLKQLETRLEKGINKIRSKKNELLYAEIEYMQKR-EMELQNDNMYLRNKIAE  180

Query  485   TERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              ER  QQQ  +N++P +S+ +E+ PP  FD+RN+LQ++    +  YS Q    LQL
Sbjct  181   NERT-QQQPHINMVPSTSTEYEVMPP--FDSRNFLQVNLMDPSHHYSLQQQTALQL  233



>ref|XP_010656928.1| PREDICTED: MAD-box transcripion factor isoform X2 [Vitis vinifera]
Length=303

 Score =   328 bits (842),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 200/242 (83%), Gaps = 6/242 (2%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             +Q+ E S QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  68    NQASEGSSQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  127

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             SRGRLYEYANNSV+ TI+RYKK CSDS+NTGS+SEAN QFYQQEA+KLR+QI ++QN NR
Sbjct  128   SRGRLYEYANNSVRTTIERYKKVCSDSSNTGSVSEANAQFYQQEASKLRRQIRDIQNLNR  187

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
             + +GE L   N ++LKNLE+++EKGIS+IR+KKNELLFAEI+YMQKR EI+L N+N +LR
Sbjct  188   HILGEALSSLNFKELKNLETRLEKGISRIRSKKNELLFAEIEYMQKR-EIELQNSNLFLR  246

Query  500   AKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQ  321
             A+I E ERA   QQQMNLMPGS   +E  P Q +D++N L ++       YS+ D   LQ
Sbjct  247   AQIAENERA---QQQMNLMPGSQ--YESVPQQPYDSQNLLPVNLLDPNHHYSRHDQTALQ  301

Query  320   LV  315
             LV
Sbjct  302   LV  303



>dbj|BAK18553.1| MADS-box transcription factor [Cyclamen persicum]
Length=248

 Score =   327 bits (837),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 201/251 (80%), Gaps = 9/251 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  D S ++S + K+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPHD-SMDLSDKNKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFS+RGRLYEY+N+SVKATI RYKKA SD T+ GS+SE N Q+YQQEA KLR QI NL
Sbjct  60    LVVFSNRGRLYEYSNSSVKATIQRYKKATSD-TSAGSVSELNAQYYQQEAAKLRAQIGNL  118

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             +N NRN  GE L    +RDLKNLE+K+EK ISKIR+KKNELLFAE+D MQKR E+DLH+N
Sbjct  119   ENSNRNMRGESLCSLPMRDLKNLEAKLEKSISKIRSKKNELLFAELDLMQKR-EVDLHSN  177

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQ----FDARNYLQLDGF-QSTSS  351
             NQYLRAKI E+ERA QQ QQMNLM GSS Y  + PP Q    +DARNY+QL+G       
Sbjct  178   NQYLRAKIAESERA-QQHQQMNLMSGSSEYELMQPPAQQSSSYDARNYIQLNGLPPDLGH  236

Query  350   YSKQDHLPLQL  318
             YS QD   LQL
Sbjct  237   YSHQDQTLLQL  247



>gb|AAY86364.1| AGAMOUS-like protein [Dendrobium thyrsiflorum]
Length=233

 Score =   326 bits (835),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 196/236 (83%), Gaps = 4/236 (2%)
 Frame = -1

Query  1025  MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             M P+ KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI+FSSRGRL
Sbjct  1     MEPKEKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGRL  60

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGE  666
             YEYANNSVK TIDRYKKA SD++N+GSISEAN+Q+YQQEA KLRQQI+NLQN NRN +G+
Sbjct  61    YEYANNSVKGTIDRYKKANSDNSNSGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGD  120

Query  665   GLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIE  486
              L   +LRDLK LE+++EKGI+KIR+KKNELL AEIDYMQKR E+DL  +N YLR KI +
Sbjct  121   ALTTMSLRDLKQLETRLEKGINKIRSKKNELLHAEIDYMQKR-EMDLQTDNMYLRNKIAD  179

Query  485   TERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              ERA QQ Q MN++P +S+ +E+ PP  FD+R++LQ++       Y+ Q    LQL
Sbjct  180   NERA-QQHQHMNILPSTSAEYEVMPP--FDSRSFLQVNLLDPNDHYAHQQQTALQL  232



>gb|KHN06927.1| Floral homeotic protein AGAMOUS [Glycine soja]
Length=247

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 175/245 (71%), Positives = 198/245 (81%), Gaps = 9/245 (4%)
 Frame = -1

Query  1034  SREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR  855
             S  +SPQ+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR
Sbjct  7     SMSVSPQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR  66

Query  854   GRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNY  675
             GRLYEYANNSVKATI+RYKKACSDS+  GS SEAN QFYQQEA+KLR QIS+LQN NR  
Sbjct  67    GRLYEYANNSVKATIERYKKACSDSSGAGSASEANAQFYQQEADKLRAQISSLQNNNRQV  126

Query  674   ----MGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQY  507
                 MGE LG    ++LKNLE+K+EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ 
Sbjct  127   ESQMMGESLGPLTAKELKNLETKLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQL  185

Query  506   LRAKIIETERAqqqqqQMNLMPGSSSYHEL-APPQQFDARNYLQLDGFQSTSSYSKQDHL  330
             LRAKI E ER       + ++PG S+Y  L    QQFD+R Y Q+ G Q  + Y++QD +
Sbjct  186   LRAKIAEGER---NHHNLAVLPGGSNYDSLQTSQQQFDSRGYFQVTGLQPNNQYARQDQM  242

Query  329   PLQLV  315
              LQLV
Sbjct  243   SLQLV  247



>gb|AEL31340.1| AGAMOUS [Vicia sativa]
Length=244

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/237 (68%), Positives = 195/237 (82%), Gaps = 4/237 (2%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  11    SPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLY  70

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKA+I+RYKKACSD++   S SE N Q+YQQEA KLR QISNLQN NR  MGE 
Sbjct  71    EYANNSVKASIERYKKACSDTSGAKSASETNAQYYQQEAAKLRVQISNLQNHNRQMMGEA  130

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   N +DL+NLESK+EKGIS+IR+KKNE+LFAEI+YMQKR EI+LHN+NQ LRAKI E 
Sbjct  131   LSNMNGKDLRNLESKLEKGISRIRSKKNEMLFAEIEYMQKR-EIELHNSNQVLRAKISEN  189

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDH-LPLQLV  315
             ++  +     N++ G +++  + P QQFD+R+Y Q++  Q  + Y++QDH + LQ V
Sbjct  190   DQ--RNNHNANMLHGGTNFECMQPQQQFDSRSYFQVNELQPNNQYARQDHQMSLQFV  244



>gb|ADK35760.1| agamous-like protein 2 [Hosta plantaginea]
Length=225

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 193/230 (84%), Gaps = 6/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYKKA +D+TNTG+ISEAN+Q+YQQEA+KLRQQI+NLQN NRN MGE L   +
Sbjct  61    SVKATIERYKKAFTDTTNTGTISEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSTMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N+N YLR KI E ERA  
Sbjct  121   LRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKR-EMELQNDNMYLRNKIAENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM+++P +++ +E  P  QFD+RN+LQ+   Q    YS Q    LQL
Sbjct  178   -QQQMSMLPATTTEYEEVP--QFDSRNFLQVSLLQPNHHYSSQQQTALQL  224



>emb|CBI31767.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/265 (66%), Positives = 206/265 (78%), Gaps = 13/265 (5%)
 Frame = -1

Query  1040  DQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  861
             +Q+ E S QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS
Sbjct  79    NQASEGSSQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS  138

Query  860   SRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNR  681
             SRGRLYEYANNSV+ TI+RYKK CSDS+NTGS+SEAN QFYQQEA+KLR+QI ++QN NR
Sbjct  139   SRGRLYEYANNSVRTTIERYKKVCSDSSNTGSVSEANAQFYQQEASKLRRQIRDIQNLNR  198

Query  680   NYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLR  501
             + +GE L   N ++LKNLE+++EKGIS+IR+KKNELLFAEI+YMQKR EI+L N+N +LR
Sbjct  199   HILGEALSSLNFKELKNLETRLEKGISRIRSKKNELLFAEIEYMQKR-EIELQNSNLFLR  257

Query  500   AKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQ  321
             A+I E ERA   QQQMNLMPGS   +E  P Q +D++N L ++       YS+ D   LQ
Sbjct  258   AQIAENERA---QQQMNLMPGSQ--YESVPQQPYDSQNLLPVNLLDPNHHYSRHDQTALQ  312

Query  320   LV**SGRDPWCCLSQNYIYKYIWII  246
             LV         CL   Y+  Y   I
Sbjct  313   LV-------TICLLYLYLKTYFSSI  330



>gb|AAX69069.1| MADS box protein M7 [Pisum sativum]
Length=243

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 195/236 (83%), Gaps = 3/236 (1%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  11    SPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLY  70

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKA+I+RYKKACSD++   S SE N Q+YQQEA KLR QISNLQN NR  MGE 
Sbjct  71    EYANNSVKASIERYKKACSDTSGAKSASETNAQYYQQEAAKLRVQISNLQNHNRQMMGEA  130

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   N ++L+NLESK+EKGIS+IR+KKNE+LFAEI+YMQKR EI+LHN+NQ LRAKI E 
Sbjct  131   LSNMNGKELRNLESKLEKGISRIRSKKNEMLFAEIEYMQKR-EIELHNSNQALRAKISEN  189

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             ++  +    +N++ G +++  + P QQFD+R+Y Q++  Q  + Y++QD + LQ V
Sbjct  190   DQ--RNNHNVNVLHGGTNFECIQPQQQFDSRSYFQVNELQPNNQYARQDQMSLQFV  243



>dbj|BAP90526.1| C class MADS-box [Prunus avium]
Length=236

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/237 (70%), Positives = 197/237 (83%), Gaps = 6/237 (3%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+  GKIE+KRIE+T+NRQVTFCKRRNGLLKKAYEL VLCDAEVALIVFS+RGRLY
Sbjct  5     SPQRKLVWGKIEVKRIEDTSNRQVTFCKRRNGLLKKAYELLVLCDAEVALIVFSNRGRLY  64

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVK TI+RYKKAC++STNTGS+SEA+TQ+YQQEA KLR QI NLQN +R+ MGE 
Sbjct  65    EYANNSVKETIERYKKACAESTNTGSVSEASTQYYQQEAAKLRAQIGNLQNSSRHMMGES  124

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   N++DLKNLESK+EKGI++IR+KKNELLFAEI+YMQKR E+D HNNNQ LRAKI E 
Sbjct  125   LSSMNMKDLKNLESKLEKGINRIRSKKNELLFAEIEYMQKR-EVDSHNNNQLLRAKIAEN  183

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSY-SKQDHLPLQLV  315
             ER+   QQ +N+M G  SY E+   Q +D+RNY Q++  Q    Y S+QD + LQLV
Sbjct  184   ERS---QQNINVMAGGGSY-EIMQSQPYDSRNYFQVNALQPNHQYNSRQDPVALQLV  236



>gb|AHM92098.1| MADS-box protein 22 [Erycina pusilla]
Length=234

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 198/236 (84%), Gaps = 4/236 (2%)
 Frame = -1

Query  1025  MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             M P+ KMGRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FSSRGRL
Sbjct  2     MEPKEKMGRGKIEIKRIENITNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRL  61

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGE  666
             YEYANNSVKATI+RYKKA SDS+N+G ISE N Q+Y QEA+KLRQQI+NLQN NRN MGE
Sbjct  62    YEYANNSVKATIERYKKASSDSSNSGPISETNAQYYMQEASKLRQQITNLQNSNRNLMGE  121

Query  665   GLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIE  486
              L   +LRDLK LE+++EKGI+KIR+KKNELL+AEI+YMQKR E++L N+N YLR +I E
Sbjct  122   ALSTMSLRDLKQLETRLEKGINKIRSKKNELLYAEIEYMQKR-EMELQNDNMYLRNQIAE  180

Query  485   TERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
             TER+ QQQQQ+N++P +S+ +E+ PP  FD+RN+LQ++       YS Q    LQL
Sbjct  181   TERS-QQQQQINMVPSTSTEYEVMPP--FDSRNFLQVNLMDPNHHYSLQQQTALQL  233



>gb|AAL76415.1|AF234617_1 MADS-box transcription factor [Phalaenopsis equestris]
 dbj|BAE80120.1| MADS-box transcription factor [Phalaenopsis hybrid cultivar]
 gb|ABF61451.1| AGAMOUSE-like protein [Phalaenopsis hybrid cultivar]
Length=239

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/239 (68%), Positives = 197/239 (82%), Gaps = 3/239 (1%)
 Frame = -1

Query  1034  SREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSR  855
             S  M P+ KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI+FS+R
Sbjct  3     SSSMEPKEKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSTR  62

Query  854   GRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNY  675
             GRLYEYANNSVK TI+RYKKA +D++NTGSISEAN+Q+YQQEA KLRQQI+NLQN NRN 
Sbjct  63    GRLYEYANNSVKGTIERYKKASTDNSNTGSISEANSQYYQQEATKLRQQITNLQNSNRNL  122

Query  674   MGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAK  495
             +G+ L   +LRDLK LE+++EKGI+KIRAKKNELL AEIDYMQKR E++L  +N +LR K
Sbjct  123   LGDALTTMSLRDLKQLETRLEKGINKIRAKKNELLHAEIDYMQKR-EMELQTDNMFLRNK  181

Query  494   IIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
             I + ERAQQQ Q M+++P +S+ +E+ PP  FD+R++L ++       YS Q    LQL
Sbjct  182   ISDNERAQQQHQHMSILPSTSTEYEVMPP--FDSRSFLHVNLMDPNDRYSHQQQTALQL  238



>emb|CAC80858.1| C-type MADS box protein [Malus domestica]
Length=245

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 201/249 (81%), Gaps = 6/249 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M ++S      SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYESKSLSLDSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSVK TI+RYKKA +DS+NTGS+SEA+TQ+YQQEA KLR +I  L
Sbjct  61    LIVFSNRGRLYEYANNSVKGTIERYKKASADSSNTGSVSEASTQYYQQEAAKLRARIVKL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NRN MG+ L   +++DLK+LE+K+EK IS+IR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  121   QNDNRNMMGDALNSMSVKDLKSLENKLEKAISRIRSKKNELLFAEIEYMQKR-ELDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMP-GSSSYHELAPPQQFDARNYLQLDGFQSTSSYS-K  342
             NQ LRAKI E ERA    + +N+M  G +S +++   Q +D+RNY Q++  Q    Y+ +
Sbjct  180   NQLLRAKIAENERA---SRTLNVMAGGGTSSYDILQSQPYDSRNYFQVNALQPNHQYNPR  236

Query  341   QDHLPLQLV  315
              D + LQLV
Sbjct  237   HDQISLQLV  245



>sp|P17839.2|AG_ARATH RecName: Full=Floral homeotic protein AGAMOUS [Arabidopsis thaliana]
Length=252

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 199/256 (78%), Gaps = 13/256 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M +QS+   + SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++
Sbjct  61    LIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E+DLHN+
Sbjct  121   QNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-EVDLHND  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPP-----QQFDARNYLQLDGFQST--  357
             NQ LRAKI E ER       ++LMPG S+Y +L PP     Q FD+RNY Q+   Q    
Sbjct  180   NQILRAKIAENER---NNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNH  236

Query  356   --SSYSKQDHLPLQLV  315
               SS  +QD   LQLV
Sbjct  237   HYSSAGRQDQTALQLV  252



>ref|XP_009351902.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009351910.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009351917.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Pyrus 
x bretschneideri]
Length=245

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 197/238 (83%), Gaps = 6/238 (3%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  12    SPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLY  71

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVK T++RY+KAC+DS+NTG +SEA+TQ+YQQEA KLR QI NLQN NRN MG+ 
Sbjct  72    EYANNSVKETVERYRKACADSSNTGLVSEASTQYYQQEAAKLRAQIGNLQNANRNMMGDA  131

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L    ++DLK+LESK+EKGIS+IR+KKNELLFAEI+YMQKR E+DLH+NNQ LRAKI E 
Sbjct  132   LSSMPIKDLKSLESKLEKGISRIRSKKNELLFAEIEYMQKR-ELDLHSNNQLLRAKIAEN  190

Query  482   ERAqqqqqQMNLMPGSS-SYHELAPPQQFDARNYLQLDGFQSTSSYS-KQDHLPLQLV  315
             ER    QQ +N+M G   S +++   Q +D+RNY Q++  Q    Y+ + D + LQLV
Sbjct  191   ERG---QQNINVMAGGGPSSYDILQSQPYDSRNYFQVNALQPNHQYNPRHDQISLQLV  245



>ref|XP_010915441.1| PREDICTED: MADS-box transcription factor 3 isoform X2 [Elaeis 
guineensis]
Length=258

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 193/231 (84%), Gaps = 7/231 (3%)
 Frame = -1

Query  1010  KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  831
             KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN
Sbjct  34    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  93

Query  830   NSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGF  651
             NSVKATI+RYK+AC+D++N+GS+SEA++Q+YQQE+ KLRQQI +LQN NRN MGE LG  
Sbjct  94    NSVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSM  153

Query  650   NLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAq  471
             + RDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N N YLR KI E ERA 
Sbjct  154   SPRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKR-EVELQNANMYLRNKIAENERA-  211

Query  470   qqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
               QQQMN++P ++ Y  +AP   +D+RN+LQ++  QS   YS Q    LQL
Sbjct  212   --QQQMNMLPQTTEYEVMAP---YDSRNFLQVNLMQSNQHYSHQQQTTLQL  257



>dbj|BAL41415.1| Agamous like protein [Rhododendron kaempferi]
 dbj|BAN15736.1| AGAMOUS like-proein [Rhododendron macrosepalum]
Length=252

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 202/257 (79%), Gaps = 15/257 (6%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F S Q  E S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAFPS-QDSEGSSQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYA+NSV++TIDRYKKACSD +NTGS+SEANTQFYQQE+NKLR+QI ++
Sbjct  60    LIVFSTRGRLYEYASNSVRSTIDRYKKACSDVSNTGSVSEANTQFYQQESNKLRRQIKDI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L     +++KNLE+K+EK IS+IR+KKNE+LFAEI++MQKR EI+L N 
Sbjct  120   QNSNRHILGEALSALTFKEVKNLETKLEKAISRIRSKKNEMLFAEIEHMQKR-EIELQNA  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYH----------ELAPPQQFDARNYLQLDGF  366
             N YLRAKI E ERA   Q+QMNLMP S  +           +   PQ +DARN+L ++  
Sbjct  179   NMYLRAKIAENERA---QEQMNLMPSSHDHQYQTMGAGSQAQQQQPQSYDARNFLPVNLL  235

Query  365   QSTSSYSKQDHLPLQLV  315
             +    YS+ D  PLQLV
Sbjct  236   EPNHHYSRHDQPPLQLV  252



>ref|XP_010915440.1| PREDICTED: MADS-box transcription factor 3 isoform X1 [Elaeis 
guineensis]
Length=268

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/239 (69%), Positives = 196/239 (82%), Gaps = 11/239 (5%)
 Frame = -1

Query  1010  KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  831
             KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN
Sbjct  34    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN  93

Query  830   NSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGF  651
             NSVKATI+RYK+AC+D++N+GS+SEA++Q+YQQE+ KLRQQI +LQN NRN MGE LG  
Sbjct  94    NSVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSM  153

Query  650   NLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAq  471
             + RDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N N YLR KI E ERA 
Sbjct  154   SPRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKR-EVELQNANMYLRNKIAENERA-  211

Query  470   qqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV**SGRDP  294
               QQQMN++P ++ Y  +AP   +D+RN+LQ++  QS   YS Q    LQL    G +P
Sbjct  212   --QQQMNMLPQTTEYEVMAP---YDSRNFLQVNLMQSNQHYSHQQQTTLQL----GYEP  261



>dbj|BAK18552.1| MADS-box transcription factor [Cyclamen persicum]
Length=247

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 196/251 (78%), Gaps = 10/251 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  D S ++S  RK  RGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE+A
Sbjct  1     MEFPHD-SMDVS-DRKFARGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIA  58

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEY+NNSVKATI RYKKA SDS   GS+SE N QFYQQEA KLR QI NL
Sbjct  59    LIVFSNRGRLYEYSNNSVKATIQRYKKATSDS-GAGSVSELNAQFYQQEAAKLRAQIGNL  117

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             +N NRN  GE L    +RDLKNLE+K+EK I KIR+KKNELLFAEID MQKR E+DLHNN
Sbjct  118   ENSNRNMRGESLCSLPMRDLKNLETKLEKSIGKIRSKKNELLFAEIDLMQKR-EVDLHNN  176

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPP----QQFDARNYLQLDGFQST-SS  351
             NQYLRAKI E ER  QQ +QMNLMPG+S Y  + PP      +DARNY+Q++G Q     
Sbjct  177   NQYLRAKIAENERV-QQHRQMNLMPGTSEYELMQPPAPQSSSYDARNYIQVNGLQPNLGH  235

Query  350   YSKQDHLPLQL  318
             YS QD   LQL
Sbjct  236   YSHQDQTLLQL  246



>ref|XP_010915446.1| PREDICTED: MADS-box transcription factor 3 isoform X5 [Elaeis 
guineensis]
Length=224

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 192/230 (83%), Gaps = 7/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYK+AC+D++N+GS+SEA++Q+YQQE+ KLRQQI +LQN NRN MGE LG  +
Sbjct  61    SVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              RDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N N YLR KI E ERA  
Sbjct  121   PRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKR-EVELQNANMYLRNKIAENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++P ++ Y  +AP   +D+RN+LQ++  QS   YS Q    LQL
Sbjct  178   -QQQMNMLPQTTEYEVMAP---YDSRNFLQVNLMQSNQHYSHQQQTTLQL  223



>gb|AER34988.1| AGAMOUS-like protein [Mangifera indica]
Length=242

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 205/243 (84%), Gaps = 6/243 (2%)
 Frame = -1

Query  1040  DQSREMSP-QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVF  864
             ++SRE SP ++K+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVF
Sbjct  5     NESREDSPREKKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVF  64

Query  863   SSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQN  684
             SSRGRLYEY+NNSVK TI+RYKKA +DS++  S+S AN QFYQQEANKLRQQI NLQN N
Sbjct  65    SSRGRLYEYSNNSVKTTIERYKKASADSSHAASVSGANAQFYQQEANKLRQQIRNLQNSN  124

Query  683   RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYL  504
             RN +GE LG  ++++LKNLE+++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ L
Sbjct  125   RNMLGESLGALSVKELKNLETRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLL  183

Query  503   RAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPL  324
             RAKI E ER    QQ MNL+ G  SY E+   Q FD+R++ Q++  Q T+ Y++QD + L
Sbjct  184   RAKIAENERG---QQNMNLIAGGGSY-EIIQSQPFDSRDFFQVNALQPTNHYARQDQMAL  239

Query  323   QLV  315
             QLV
Sbjct  240   QLV  242



>ref|NP_567569.3| MADS domain transcription factor AGAMOUS [Arabidopsis thaliana]
 gb|AEE84111.1| MADS domain transcription factor AGAMOUS, partial [Arabidopsis 
thaliana]
Length=252

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 198/254 (78%), Gaps = 13/254 (5%)
 Frame = -1

Query  1049  FQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  870
             +QS+   + SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI
Sbjct  3     YQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  62

Query  869   VFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQN  690
             VFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++QN
Sbjct  63    VFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQN  122

Query  689   QNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQ  510
              NR  MGE +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E+DLHN+NQ
Sbjct  123   SNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-EVDLHNDNQ  181

Query  509   YLRAKIIETERAqqqqqQMNLMPGSSSYHELAPP-----QQFDARNYLQLDGFQST----  357
              LRAKI E ER       ++LMPG S+Y +L PP     Q FD+RNY Q+   Q      
Sbjct  182   ILRAKIAENER---NNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHY  238

Query  356   SSYSKQDHLPLQLV  315
             SS  +QD   LQLV
Sbjct  239   SSAGRQDQTALQLV  252



>ref|XP_010915443.1| PREDICTED: MADS-box transcription factor 3 isoform X4 [Elaeis 
guineensis]
 ref|XP_010915444.1| PREDICTED: MADS-box transcription factor 3 isoform X4 [Elaeis 
guineensis]
 ref|XP_010915445.1| PREDICTED: MADS-box transcription factor 3 isoform X4 [Elaeis 
guineensis]
Length=234

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 195/238 (82%), Gaps = 11/238 (5%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYK+AC+D++N+GS+SEA++Q+YQQE+ KLRQQI +LQN NRN MGE LG  +
Sbjct  61    SVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              RDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N N YLR KI E ERA  
Sbjct  121   PRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKR-EVELQNANMYLRNKIAENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV**SGRDP  294
              QQQMN++P ++ Y  +AP   +D+RN+LQ++  QS   YS Q    LQL    G +P
Sbjct  178   -QQQMNMLPQTTEYEVMAP---YDSRNFLQVNLMQSNQHYSHQQQTTLQL----GYEP  227



>ref|XP_010273432.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273433.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Nelumbo 
nucifera]
Length=225

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 191/230 (83%), Gaps = 6/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN+
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANH  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK TI+RYKK  +DS+N+GS+SEAN QFYQQEANKLRQQI  LQN NR+ MGE L    
Sbjct  61    SVKTTIERYKKTLADSSNSGSVSEANAQFYQQEANKLRQQIGILQNSNRHLMGEALSTMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE ++EKGIS+IR+KKNELLFAEI+YMQKR EIDL N+N  LRA+I E ERA  
Sbjct  121   VKELKQLEGRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLQNDNMMLRARIAENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM+++P S   +E+ PPQ FD+RN+LQ++  +    YS+Q+   LQL
Sbjct  178   -QQQMSMIPASE--YEVMPPQSFDSRNFLQVNLLEPNHHYSRQEQTALQL  224



>ref|XP_008383546.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Malus 
domestica]
 ref|XP_008383547.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Malus 
domestica]
 ref|XP_008383548.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 [Malus 
domestica]
Length=243

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 199/248 (80%), Gaps = 6/248 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M ++S      SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYESKSLSMDSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSVK TI+RYKKA +DS+NTGS+SEA+TQ+YQQEA KLR QI  L
Sbjct  61    LIVFSNRGRLYEYANNSVKGTIERYKKASADSSNTGSVSEASTQYYQQEAAKLRAQIVKL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NRN MG+ L   +++DLK+LE+K+EK IS+IR+KKNELLFAEI+YMQKR E+DLHNN
Sbjct  121   QNDNRNMMGDALSSMSVKDLKSLENKLEKAISRIRSKKNELLFAEIEYMQKR-ELDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYS-KQ  339
             NQ LRAKI E ER    QQ +N+M G  SY E+   Q +D+R+Y Q++  Q     + + 
Sbjct  180   NQLLRAKIAENERG---QQNINVMAGGGSY-EILQSQPYDSRDYFQVNVLQPNHHXNPRX  235

Query  338   DHLPLQLV  315
             D + LQLV
Sbjct  236   DQISLQLV  243



>dbj|BAN15734.1| AGAMOUS like protein [Rhododendron macrosepalum]
Length=252

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 201/257 (78%), Gaps = 15/257 (6%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F S Q  E S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAFPS-QDSEGSSQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYA+NSV++TIDRYKKACSD +NTGS+SEANTQFYQQE+NKLR+QI ++
Sbjct  60    LIVFSTRGRLYEYASNSVRSTIDRYKKACSDVSNTGSVSEANTQFYQQESNKLRRQIKDI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L     +++KNLE+K+EK IS+IR+KKNE+LFAEI++MQKR EI+L N 
Sbjct  120   QNSNRHILGEALSALTFKEVKNLETKLEKAISRIRSKKNEMLFAEIEHMQKR-EIELQNA  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYH----------ELAPPQQFDARNYLQLDGF  366
             N YLRAKI E ERA   Q+QMNLMP S  +           +   PQ +DARN L ++  
Sbjct  179   NMYLRAKIAENERA---QEQMNLMPSSHDHQYQTMGAGSQAQQQQPQSYDARNLLPVNLL  235

Query  365   QSTSSYSKQDHLPLQLV  315
             +    YS+ D  PLQLV
Sbjct  236   EPNHHYSRHDQPPLQLV  252



>gb|AHM92097.1| MADS-box protein 21 [Erycina pusilla]
Length=233

 Score =   321 bits (822),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 161/236 (68%), Positives = 197/236 (83%), Gaps = 4/236 (2%)
 Frame = -1

Query  1025  MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             M P+ KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FSSRGRL
Sbjct  1     MEPKEKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRL  60

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGE  666
             YEYANNSVK TIDRYKKAC+D+++TGSISEAN+Q+YQQEA KLRQQI+NLQN NRN +G+
Sbjct  61    YEYANNSVKGTIDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGD  120

Query  665   GLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIE  486
              L   +LRDLK LE+++EKGI+KIR+KKNELL AEIDYMQKR E++L  +N YLR KI +
Sbjct  121   ALTTMSLRDLKQLETRLEKGINKIRSKKNELLHAEIDYMQKR-EMELQTDNMYLRNKIAD  179

Query  485   TERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              ER  QQ QQM+++P +S+ +E+  P  +D+R++LQ++    +  YS Q    LQL
Sbjct  180   NERV-QQHQQMSILPSTSTDYEVMTP--YDSRSFLQVNLLDPSDHYSHQQQTTLQL  232



>ref|XP_004485958.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X7 [Cicer 
arietinum]
Length=233

 Score =   321 bits (822),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 168/252 (67%), Positives = 192/252 (76%), Gaps = 24/252 (10%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQ +QS   SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQ-NQSMSDSPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+ TGS SEAN QFYQQEA+KLR QISNL
Sbjct  60    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSGTGSASEANAQFYQQEADKLRAQISNL  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE LG    ++LKNLE K+EKGIS+IR+KK               EIDLHNN
Sbjct  120   QNNNRQMMGESLGSMTAKELKNLEGKLEKGISRIRSKK---------------EIDLHNN  164

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQSTSS  351
             NQ LRAKI E+ER       M+++PG +SY  +        QQ+D+R Y Q+ G Q +S 
Sbjct  165   NQLLRAKIAESER---NHHNMSVLPGGTSYESMQSQHQQQQQQYDSRGYFQVTGLQPSSQ  221

Query  350   YSKQDHLPLQLV  315
             Y++QD + LQLV
Sbjct  222   YARQDQMSLQLV  233



>emb|CAA37642.1| unnamed protein product [Arabidopsis thaliana]
 prf||1612343A agamous gene
Length=285

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 198/254 (78%), Gaps = 13/254 (5%)
 Frame = -1

Query  1049  FQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  870
             +QS+   + SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI
Sbjct  36    YQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  95

Query  869   VFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQN  690
             VFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++QN
Sbjct  96    VFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQN  155

Query  689   QNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQ  510
              NR  MGE +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E+DLHN+NQ
Sbjct  156   SNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-EVDLHNDNQ  214

Query  509   YLRAKIIETERAqqqqqQMNLMPGSSSYHELAPP-----QQFDARNYLQLDGFQST----  357
              LRAKI E ER       ++LMPG S+Y +L PP     Q FD+RNY Q+   Q      
Sbjct  215   ILRAKIAENER---NNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHY  271

Query  356   SSYSKQDHLPLQLV  315
             SS  +QD   LQLV
Sbjct  272   SSAGRQDQTALQLV  285



>dbj|BAL41416.1| Agamous like protein [Rhododendron kaempferi]
Length=252

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/257 (65%), Positives = 202/257 (79%), Gaps = 15/257 (6%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F S Q  E S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAFPS-QDSEGSSQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYA+NSV++TIDRYKKACSD +NTGS+SEANTQFYQQE+NKLR+QI ++
Sbjct  60    LIVFSTRGRLYEYASNSVRSTIDRYKKACSDVSNTGSVSEANTQFYQQESNKLRRQIKDI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L     +++KNLE+K+EK IS+IR+KKNE+LFAEI++MQKR EI+L N 
Sbjct  120   QNSNRHILGEALSALTFKEVKNLETKLEKAISRIRSKKNEMLFAEIEHMQKR-EIELQNA  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYH----------ELAPPQQFDARNYLQLDGF  366
             N YLRAKI E ERA   Q+QMNLMP S  +           +   PQ ++ARN+L ++  
Sbjct  179   NMYLRAKIAENERA---QEQMNLMPSSHDHQYQTMGAGSQAQQQQPQSYNARNFLPVNLL  235

Query  365   QSTSSYSKQDHLPLQLV  315
             +    YS+ D  PLQLV
Sbjct  236   EPNHHYSRHDQPPLQLV  252



>gb|AAZ53205.1| AG1 [Eschscholzia californica]
Length=241

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 201/246 (82%), Gaps = 8/246 (3%)
 Frame = -1

Query  1052  EFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL  873
             +FQS Q  E S +RKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL
Sbjct  2     DFQS-QVTEDSSRRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL  60

Query  872   IVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQ  693
             IVFS+RGRLYEYANNSVK+TI+RYKK C+D +N+   SEANTQFYQQEA KLRQQI  LQ
Sbjct  61    IVFSTRGRLYEYANNSVKSTIERYKKTCADPSNSACASEANTQFYQQEATKLRQQIGILQ  120

Query  692   NQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNN  513
             N NRN MGE +   ++++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR EIDL N+N
Sbjct  121   NSNRNLMGEAISTMSVKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLQNDN  179

Query  512   QYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSS-YSKQD  336
              YLRAKI + ERA   QQQM+LMPG+   +E      +D+RN+LQ++  QS+S  YS Q+
Sbjct  180   MYLRAKIADNERA---QQQMSLMPGNE--YEGMTSSGYDSRNFLQVNLLQSSSQHYSHQE  234

Query  335   HLPLQL  318
                LQL
Sbjct  235   QTTLQL  240



>ref|XP_008791901.1| PREDICTED: MADS-box transcription factor 3 isoform X1 [Phoenix 
dactylifera]
Length=224

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 189/230 (82%), Gaps = 7/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYKKAC+D++N GS+ EAN+Q+YQQE+ KLRQQI NLQN NRN MGE LG  N
Sbjct  61    SVKATIERYKKACTDTSNPGSVFEANSQYYQQESTKLRQQIINLQNSNRNLMGESLGSMN  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N+N YLR KI E ER   
Sbjct  121   LRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKR-EMELQNDNMYLRNKIAENERT--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++  ++ Y  +AP   +D+RN+LQ++  QS   Y  Q    LQL
Sbjct  178   -QQQMNMLHPTTEYEVMAP---YDSRNFLQVNLMQSNQHYPHQQQTALQL  223



>ref|NP_001268105.1| MAD-box transcripion factor [Vitis vinifera]
 ref|XP_010656929.1| PREDICTED: MAD-box transcripion factor isoform X1 [Vitis vinifera]
 gb|AAK58564.1|AF265562_1 MAD-box transcripion factor [Vitis vinifera]
Length=225

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 192/231 (83%), Gaps = 6/231 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TI+RYKK CSDS+NTGS+SEAN QFYQQEA+KLR+QI ++QN NR+ +GE L   N
Sbjct  61    SVRTTIERYKKVCSDSSNTGSVSEANAQFYQQEASKLRRQIRDIQNLNRHILGEALSSLN  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              ++LKNLE+++EKGIS+IR+KKNELLFAEI+YMQKR EI+L N+N +LRA+I E ERA  
Sbjct  121   FKELKNLETRLEKGISRIRSKKNELLFAEIEYMQKR-EIELQNSNLFLRAQIAENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
              QQQMNLMPGS   +E  P Q +D++N L ++       YS+ D   LQLV
Sbjct  178   -QQQMNLMPGSQ--YESVPQQPYDSQNLLPVNLLDPNHHYSRHDQTALQLV  225



>ref|XP_010925573.1| PREDICTED: floral homeotic protein AGAMOUS-like [Elaeis guineensis]
 gb|AAW66882.1| MADS box transcription factor [Elaeis guineensis]
Length=224

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 193/230 (84%), Gaps = 7/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI+FSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYKKAC+D++N+GS+SEA++Q+YQQE+ KLRQQI++LQN NRN MG+ LG  +
Sbjct  61    SVKATIERYKKACTDTSNSGSVSEADSQYYQQESLKLRQQITSLQNSNRNLMGDSLGSMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E +L N N YLR KI E E A  
Sbjct  121   LRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKR-ETELQNANMYLRNKIAENEGA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++P ++ Y E+ PP  +D+RN+LQ++  QS   YS Q    LQL
Sbjct  178   -QQQMNMLPATTEY-EVMPP--YDSRNFLQVNLMQSNQHYSHQQQTALQL  223



>emb|CAA16753.1| floral homeotic protein agamous [Arabidopsis thaliana]
 emb|CAB78898.1| floral homeotic protein agamous [Arabidopsis thaliana]
Length=284

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 198/254 (78%), Gaps = 13/254 (5%)
 Frame = -1

Query  1049  FQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  870
             +QS+   + SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI
Sbjct  35    YQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  94

Query  869   VFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQN  690
             VFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++QN
Sbjct  95    VFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQN  154

Query  689   QNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQ  510
              NR  MGE +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E+DLHN+NQ
Sbjct  155   SNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-EVDLHNDNQ  213

Query  509   YLRAKIIETERAqqqqqQMNLMPGSSSYHELAPP-----QQFDARNYLQLDGFQST----  357
              LRAKI E ER       ++LMPG S+Y +L PP     Q FD+RNY Q+   Q      
Sbjct  214   ILRAKIAENER---NNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHY  270

Query  356   SSYSKQDHLPLQLV  315
             SS  +QD   LQLV
Sbjct  271   SSAGRQDQTALQLV  284



>gb|AEX92974.1| MADS box protein 4 [Agave tequilana]
Length=225

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 193/230 (84%), Gaps = 6/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRI+NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIDNTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKAT++RYKKAC+D+ NTG++SEAN+Q+YQQEA+KLRQQI+NLQN NRN MGE L   +
Sbjct  61    SVKATVERYKKACTDTNNTGTVSEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSTMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N+N YLR KI E +RA  
Sbjct  121   LRDLKQLEGRLEKGINKIRIKKNELLFAEIEYMQKR-EMELQNDNMYLRNKIAENDRA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++P +++ ++  P  QFD+RN+LQ+   +    YS Q    LQL
Sbjct  178   -QQQMNILPAATAEYDGVP--QFDSRNFLQVSLIEPNHHYSCQQQTALQL  224



>gb|ABQ28694.1| MADS box transcription factor [Narcissus tazetta var. chinensis]
Length=230

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 192/233 (82%), Gaps = 7/233 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYKKAC+D++NT ++SEAN+Q+YQQEA+KLRQQI+NLQN NRN MGE L   +
Sbjct  61    SVKATIERYKKACTDTSNTATVSEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSTMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LES++EKGISKIR KKNELLFAEI+YMQKR EI+L N+N YLR KI + ERA  
Sbjct  121   LRDLKQLESRLEKGISKIRTKKNELLFAEIEYMQKR-EIELQNDNMYLRNKITDNERA--  177

Query  467   qqqQMNLMPG---SSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++P    +S++ +     QFD+RN+LQ+        YS+Q     QL
Sbjct  178   -QQQMNMLPSAATTSTHDQYEGIPQFDSRNFLQVSLMDPGHHYSRQQQTTPQL  229



>ref|XP_004504259.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X5 [Cicer 
arietinum]
Length=228

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 186/220 (85%), Gaps = 4/220 (2%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLY
Sbjct  5     SPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLY  64

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKA+I+RYKKACSDS+   S SE N Q+YQQEA KLR QISNLQN NR  MGE 
Sbjct  65    EYANNSVKASIERYKKACSDSSGCKSASETNAQYYQQEAAKLRVQISNLQNHNRQMMGEA  124

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L   + +DL+NLE+K+EKGIS+IR+KKNE+LFAEI+YMQK+ EI+LHN+NQ LRAKI E+
Sbjct  125   LSNMSGKDLRNLETKLEKGISRIRSKKNEMLFAEIEYMQKK-EIELHNSNQVLRAKISES  183

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQ  363
             ER+   Q  +N++ G +++  +  PQQFD RNY Q+ G Q
Sbjct  184   ERS---QHNVNVLSGGTNFECMQTPQQFDPRNYFQVTGLQ  220



>ref|XP_008791911.1| PREDICTED: MADS-box transcription factor 3 isoform X2 [Phoenix 
dactylifera]
Length=234

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/239 (69%), Positives = 192/239 (80%), Gaps = 11/239 (5%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYKKAC+D++N GS+ EAN+Q+YQQE+ KLRQQI NLQN NRN MGE LG  N
Sbjct  61    SVKATIERYKKACTDTSNPGSVFEANSQYYQQESTKLRQQIINLQNSNRNLMGESLGSMN  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N+N YLR KI E ER   
Sbjct  121   LRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKR-EMELQNDNMYLRNKIAENERT--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV**SGRDPW  291
              QQQMN++  ++ Y  +AP   +D+RN+LQ++  QS   Y  Q    LQL    G  P+
Sbjct  178   -QQQMNMLHPTTEYEVMAP---YDSRNFLQVNLMQSNQHYPHQQQTALQL----GYGPF  228



>gb|AAZ95250.1| AGAMOUS-like transcription factor [Dendrobium crumenatum]
Length=234

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 196/236 (83%), Gaps = 4/236 (2%)
 Frame = -1

Query  1025  MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             M P+ KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FSSRGRL
Sbjct  2     MEPKEKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRL  61

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGE  666
             YEYANNSVK TI+RYKKA +D++N+GSISE N Q+Y QEA+KLRQQI+NLQN NRN MGE
Sbjct  62    YEYANNSVKGTIERYKKASADNSNSGSISETNAQYYLQEASKLRQQITNLQNSNRNLMGE  121

Query  665   GLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIE  486
              L   +LRDLK LE+++EKGI+KIR+KKNELL+AEI+YMQKR E++L N+N YLR KI +
Sbjct  122   ALSTMSLRDLKQLETRLEKGINKIRSKKNELLYAEIEYMQKR-EMELQNDNMYLRNKIAD  180

Query  485   TERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              ER  QQQ  +N++P +S+ +E+ PP  FD+RN+LQ++    +  YS Q    LQ+
Sbjct  181   NERT-QQQHHINMVPSTSTEYEVMPP--FDSRNFLQVNLMDPSHHYSLQQQTALQV  233



>gb|AAW66881.1| MADS box transcription factor [Elaeis guineensis]
Length=224

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 191/230 (83%), Gaps = 7/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYK+AC+D++N+GS+SEA++Q+YQQE+ KLRQQI +LQN NRN MGE LG  +
Sbjct  61    SVKATIERYKRACTDTSNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              RDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E++L N N YLR KI E ERA  
Sbjct  121   PRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKR-EVELQNANMYLRNKIAENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++P ++ Y  +AP   +D+RN+LQ++  QS   YS Q    L L
Sbjct  178   -QQQMNMLPQTTEYEVMAP---YDSRNFLQVNLMQSNQHYSHQQQTTLPL  223



>gb|AEI01160.1| SHATTERPPOOF-like protein [Prunus triloba]
Length=244

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 205/250 (82%), Gaps = 9/250 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  +Q+ E S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEF-PNQAPESSSQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSV+ATIDRYKKAC+DSTN GS+SEANTQFYQQE++KLR+QI  +
Sbjct  60    LIVFSTRGRLYEYANNSVRATIDRYKKACTDSTNGGSVSEANTQFYQQESSKLRRQIREI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   N+++LKNLE ++EKGIS+IR+KKNE+LFAEI++MQKR EI+L N+
Sbjct  120   QNSNRHILGEALSTLNIKELKNLEGRLEKGISRIRSKKNEMLFAEIEFMQKR-EIELQNH  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQL---DGFQSTSSYS  345
             N YLRAKI E ERA  QQQQ N++ G +SY +  P Q +D RN+L +       + + YS
Sbjct  179   NNYLRAKIAENERA--QQQQTNMIQG-TSYDQSMPSQSYD-RNFLPVILEANNNNNNHYS  234

Query  344   KQDHLPLQLV  315
             + D   LQLV
Sbjct  235   RHDQTALQLV  244



>gb|AAF75773.2|AF265554_1 transcription factor CMB [Cucumis sativus]
Length=221

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 184/231 (80%), Gaps = 10/231 (4%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV LIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVVLIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATIDRYKKA SDS+NTGS SE NTQFYQQEA KLR QI NLQN NRN +GE L    
Sbjct  61    SVKATIDRYKKASSDSSNTGSTSEDNTQFYQQEAAKLRVQIGNLQNSNRNMLGESLSSLT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              +DLK LE+K+EKGIS+IR+KKNELLFAEI+YM+KR EIDLHNNNQ LRAKI  +ER   
Sbjct  121   AKDLKGLETKLEKGISRIRSKKNELLFAEIEYMRKR-EIDLHNNNQMLRAKIAVSER---  176

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
                 +++M G     EL     +D R++ Q++G Q    Y +QD++ LQLV
Sbjct  177   ---NVSMMGGE---FELMQSHPYDPRDFFQVNGLQHNHQYPRQDNMALQLV  221



>gb|AHH28276.1| MADS-box transcription factor, partial [Rafflesia cantleyi]
Length=221

 Score =   318 bits (814),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 187/226 (83%), Gaps = 5/226 (2%)
 Frame = -1

Query  992  IEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKAT  813
            IEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVK+T
Sbjct  1    IEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKST  60

Query  812  IDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFNLRDLK  633
            IDRYKKA +DS+N+GS+SEAN QFYQQEA KLR QI NLQN NR+ +GE L   ++++LK
Sbjct  61   IDRYKKASADSSNSGSVSEANAQFYQQEAAKLRVQIGNLQNSNRHMLGESLDALSIKELK  120

Query  632  NLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqqqqqQM  453
            +LE ++EKGIS+IR+KKNELLFAEI+YMQ+R EIDLHNNNQ LRAKI E ER   + Q M
Sbjct  121  SLEIRLEKGISRIRSKKNELLFAEIEYMQRR-EIDLHNNNQLLRAKIAENER---KHQNM  176

Query  452  NLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
            NLM G  +Y E+   Q FD+RNY Q++  Q  + Y  QD + LQLV
Sbjct  177  NLMAGEGNY-EIMQSQPFDSRNYFQVNALQPINHYHHQDQMSLQLV  221



>ref|XP_002870009.1| hypothetical protein ARALYDRAFT_914774 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46268.1| hypothetical protein ARALYDRAFT_914774 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/254 (64%), Positives = 198/254 (78%), Gaps = 13/254 (5%)
 Frame = -1

Query  1049  FQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  870
             +QS+   + SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI
Sbjct  53    YQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  112

Query  869   VFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQN  690
             VFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++QN
Sbjct  113   VFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQN  172

Query  689   QNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQ  510
              NR  MGE +G  + ++L+NLE ++E+ I++IR+KKNEL+F+EIDYMQKR E+DLHN+NQ
Sbjct  173   SNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELIFSEIDYMQKR-EVDLHNDNQ  231

Query  509   YLRAKIIETERAqqqqqQMNLMPGSSSYHELAPP-----QQFDARNYLQLDGFQST----  357
              LRAKI E ER       ++LMPG S+Y ++ PP     Q FD+RNY Q+   Q      
Sbjct  232   LLRAKIAENER---NNPSISLMPGGSNYEQIMPPPQTQSQPFDSRNYFQVAALQPNNHHY  288

Query  356   SSYSKQDHLPLQLV  315
             SS  +QD   LQLV
Sbjct  289   SSAGRQDQTALQLV  302



>ref|XP_010451378.1| PREDICTED: floral homeotic protein AGAMOUS [Camelina sativa]
Length=293

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 196/252 (78%), Gaps = 11/252 (4%)
 Frame = -1

Query  1049  FQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  870
             +Q +   + SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI
Sbjct  46    YQPELGEDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  105

Query  869   VFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQN  690
             VFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++QN
Sbjct  106   VFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQN  165

Query  689   QNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQ  510
              NR  MGE +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E DLHN+NQ
Sbjct  166   SNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-ESDLHNDNQ  224

Query  509   YLRAKIIETERAqqqqqQMNLMPGSSSYHELAPP---QQFDARNYLQLDGFQST----SS  351
              LRAKI E ER       ++LMPG S+Y +L PP   Q FD+RNY Q+   Q      SS
Sbjct  225   ILRAKIAENER---NHPSISLMPGGSNYEQLMPPPQTQPFDSRNYFQVAALQPNNHHYSS  281

Query  350   YSKQDHLPLQLV  315
               +QD   LQLV
Sbjct  282   AGRQDQTALQLV  293



>ref|XP_007217264.1| hypothetical protein PRUPE_ppa010578mg [Prunus persica]
 gb|ABG75908.1| SHATTERPROOF-like [Prunus persica]
 gb|ABU48614.1| SHATTERPROOF-like protein [Prunus persica]
 gb|ACL31234.1| PLENA-like MADS-box protein [Prunus persica]
 gb|EMJ18463.1| hypothetical protein PRUPE_ppa010578mg [Prunus persica]
Length=244

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 205/250 (82%), Gaps = 9/250 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  +Q+ E S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEF-PNQAPESSSQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSV+ATIDRYKKAC+DSTN GS+SEANTQFYQQE++KLR+QI  +
Sbjct  60    LIVFSTRGRLYEYANNSVRATIDRYKKACTDSTNGGSVSEANTQFYQQESSKLRRQIREI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   N+++LKNLE ++EKGIS+IR+KKNE+LFAEI++MQKR E++L N+
Sbjct  120   QNSNRHILGEALSTLNIKELKNLEGRLEKGISRIRSKKNEMLFAEIEFMQKR-EMELQNH  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQL---DGFQSTSSYS  345
             N YLRAKI E ERAQQQQ   N++ G +SY +  P Q +D RN+L +       + + YS
Sbjct  179   NNYLRAKIAENERAQQQQT--NMIQG-TSYDQSMPSQSYD-RNFLPVILEANNNNNNHYS  234

Query  344   KQDHLPLQLV  315
             + D   LQLV
Sbjct  235   RHDQTALQLV  244



>ref|XP_010272685.1| PREDICTED: floral homeotic protein AGAMOUS-like [Nelumbo nucifera]
Length=224

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 189/230 (82%), Gaps = 7/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK TI+RYKKA +DS+N+GS+SEAN QFYQQEANKLRQQI  LQN NR+ MGE L    
Sbjct  61    SVKTTIERYKKASADSSNSGSVSEANAQFYQQEANKLRQQIGILQNSNRHLMGEALSTMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LES++EKGIS+IR+KKNELL+AEI YMQKR EI+L N+N YLRAKI E ERAQQ
Sbjct  121   VKELKQLESRLEKGISRIRSKKNELLYAEIQYMQKR-EIELQNDNMYLRAKIAENERAQQ  179

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
                 M     S+S +E+  PQ FD+RN+LQ++  +    YS+Q+   LQL
Sbjct  180   HMSMM-----SASEYEVM-PQTFDSRNFLQVNLLEPNHHYSRQEQTALQL  223



>ref|XP_011082936.1| PREDICTED: floral homeotic protein AGAMOUS-like [Sesamum indicum]
 ref|XP_011082938.1| PREDICTED: floral homeotic protein AGAMOUS-like [Sesamum indicum]
Length=250

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/254 (66%), Positives = 196/254 (77%), Gaps = 11/254 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F + +S   +  RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAFPNQESESSNSLRKNGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+A+I+RYKKA +DSTN+ S SEANTQFYQQEANKLR+QI  +
Sbjct  61    LIVFSSRGRLYEYANNSVRASIERYKKASADSTNSVSTSEANTQFYQQEANKLRRQIREI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR  +GEG+G   L+DLK++E KIEK IS+IR+KKNELLFAEI+ MQKR E++LHN 
Sbjct  121   QTSNRQILGEGVGSMTLKDLKSMEGKIEKAISRIRSKKNELLFAEIELMQKR-ELELHNA  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSS--YHELAP-----PQQFDARNYLQLDGFQST  357
             N +LRAKI E ERA   QQQMNLMP  SS  +H+  P        +D RN+L ++  +  
Sbjct  180   NMFLRAKIAENERA---QQQMNLMPAGSSDDHHQYQPMTSSHEAAYDLRNFLPMNLMEPN  236

Query  356   SSYSKQDHLPLQLV  315
               Y + D  PLQLV
Sbjct  237   HHYPRHDQTPLQLV  250



>gb|ACN97631.1| AGAMOUS-like protein [Mangifera indica]
Length=225

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 195/230 (85%), Gaps = 5/230 (2%)
 Frame = -1

Query  1004  GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  825
             GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY+NNS
Sbjct  1     GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNS  60

Query  824   VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFNL  645
             VK TI+RYKKA +DS++  S+SEAN QFYQQEANKLRQQI NLQN NRN +GE LG  ++
Sbjct  61    VKTTIERYKKASADSSHAASVSEANAQFYQQEANKLRQQIRNLQNSNRNMLGESLGALSV  120

Query  644   RDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqqq  465
             ++LKNLE+++EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAKI E ER    
Sbjct  121   KELKNLETRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAKIAENERG---  176

Query  464   qqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             QQ MNL+ G  SY E+   Q FD+R++ Q++  Q T+ Y++QD + LQLV
Sbjct  177   QQNMNLIAGGGSY-EIIQSQPFDSRDFFQVNALQPTNHYARQDQMALQLV  225



>emb|CDY09267.1| BnaC03g62970D [Brassica napus]
Length=249

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/257 (65%), Positives = 197/257 (77%), Gaps = 18/257 (7%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKM-GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  879
             ME   D S    PQRK  GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV
Sbjct  1     MELGGDSS----PQRKTAGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  56

Query  878   ALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISN  699
             ALIVFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI +
Sbjct  57    ALIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIIS  116

Query  698   LQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHN  519
             +QN NR  MGE +G  + ++L+NLE ++++ I++IR+KKNELLFAEIDYMQKR E+DLH+
Sbjct  117   IQNSNRQLMGETIGSMSPKELRNLEGRLDRSINRIRSKKNELLFAEIDYMQKR-EVDLHS  175

Query  518   NNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPP-----QQFDARNYLQLDGFQST-  357
             +NQ LRAKI E ER       MNLMPG S+Y ++ PP     Q FD+RNY Q+   Q   
Sbjct  176   DNQLLRAKIAENER---NNPSMNLMPGGSNYEQIIPPPQTNSQPFDSRNYFQVAALQPNN  232

Query  356   ---SSYSKQDHLPLQLV  315
                SS  +QD   LQLV
Sbjct  233   QHYSSAGRQDLTALQLV  249



>gb|AFM30905.1| transcription factor MADS5 [Prunus avium]
Length=246

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 169/252 (67%), Positives = 205/252 (81%), Gaps = 11/252 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  +Q+ E S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEF-PNQAPESSSQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSV+ATIDRYKKAC+DSTN GS+SEANTQFYQQE++KLR+QI  +
Sbjct  60    LIVFSTRGRLYEYANNSVRATIDRYKKACTDSTNGGSVSEANTQFYQQESSKLRRQIREI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   N+++LKNLE ++EKGIS+IR+KKNE+LF EI++MQKR EI+L N+
Sbjct  120   QNSNRHILGEALSTLNIKELKNLEGRLEKGISRIRSKKNEMLFTEIEFMQKR-EIELQNH  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQL-----DGFQSTSS  351
             N YLRAKI E ERAQQQQ   N++ G +SY +  P Q +D RN+L +     +   + + 
Sbjct  179   NNYLRAKIAENERAQQQQT--NMIQG-TSYDQSMPSQSYD-RNFLPVMLEANNNNNNNNH  234

Query  350   YSKQDHLPLQLV  315
             YS+ D   LQLV
Sbjct  235   YSRHDQTALQLV  246



>gb|AAA68001.1| agamous protein [Petunia integrifolia subsp. inflata]
Length=247

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/251 (66%), Positives = 194/251 (77%), Gaps = 8/251 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F + +    S QRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MVFPNQEFESSSSQRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ATIDRYKK  +DST+TGS+SEANTQ+YQQEA KLR+QI ++
Sbjct  61    LIVFSSRGRLYEYANNSVRATIDRYKKHHADSTSTGSVSEANTQYYQQEAAKLRRQIRDI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR  +GE L   + RDLKNLE K+EK I ++R+KKNELLF+EI+ MQKR EI++ N 
Sbjct  121   QTYNRQIVGEALSSLSPRDLKNLEGKLEKAIGRVRSKKNELLFSEIELMQKR-EIEMQNA  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAP----PQQFDARNYLQLDGFQSTSSY  348
             N YLRAKI E ERA    QQMNLMPG  S ++  P     Q +DARN+L ++  +    Y
Sbjct  180   NMYLRAKIAEVERA---TQQMNLMPGGGSEYQQQPMSSTSQPYDARNFLPVNLLEPNPHY  236

Query  347   SKQDHLPLQLV  315
             S+QD   LQLV
Sbjct  237   SRQDQTALQLV  247



>gb|KGN49343.1| hypothetical protein Csa_6G520410 [Cucumis sativus]
Length=882

 Score =   336 bits (862),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 192/236 (81%), Gaps = 10/236 (4%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY
Sbjct  657   SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  716

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EYANNSVKATIDRYKKA SDS+NTGS SEANTQFYQQEA KLR QI NLQN NRN +GE 
Sbjct  717   EYANNSVKATIDRYKKASSDSSNTGSTSEANTQFYQQEAAKLRVQIGNLQNSNRNMLGES  776

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             L     +DLK LE+K+EKGIS+IR+KKNELLFAEI+YM+KR EIDLHNNNQ LRAKI E+
Sbjct  777   LSSLTAKDLKGLETKLEKGISRIRSKKNELLFAEIEYMRKR-EIDLHNNNQMLRAKIAES  835

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             ER       +N+M G     EL     +D R++ Q++G Q    Y +QD++ LQLV
Sbjct  836   ER------NVNMMGGE---FELMQSHPYDPRDFFQVNGLQHNHQYPRQDNMALQLV  882



>gb|ADG45820.1| mutant SHATTERPROOF-like protein [Prunus serrulata var. lannesiana]
Length=246

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 205/252 (81%), Gaps = 11/252 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  +Q+ E S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEF-PNQAPESSSQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSV+ATIDRYKKAC+DSTN GS+SEANTQFYQQE++KLR+QI  +
Sbjct  60    LIVFSTRGRLYEYANNSVRATIDRYKKACTDSTNGGSVSEANTQFYQQESSKLRRQIREI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   N+++LKNLE ++EKGIS+IR+KKNE+LF EI++MQKR EI+L N+
Sbjct  120   QNSNRHILGEALSTLNIKELKNLEGRLEKGISRIRSKKNEMLFTEIEFMQKR-EIELQNH  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQL-----DGFQSTSS  351
             N YLRAKI E ERA  QQQQ N++ G +SY +  P Q +D RN+L +     D   + + 
Sbjct  179   NNYLRAKIAENERA--QQQQTNMIQG-TSYDQSMPSQSYD-RNFLPVILEANDNNNNNNH  234

Query  350   YSKQDHLPLQLV  315
             YS+ D   LQLV
Sbjct  235   YSRHDQTALQLV  246



>gb|ADG45819.1| SHATTERPROOF-like protein [Prunus serrulata var. lannesiana]
 gb|AIU94280.1| SHATTERPROOF-like protein [Prunus pseudocerasus]
 dbj|BAP90527.1| C class MADS-box [Prunus avium]
Length=246

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 169/252 (67%), Positives = 205/252 (81%), Gaps = 11/252 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  +Q+ E S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEF-PNQAPESSSQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSV+ATIDRYKKAC+DSTN GS+SEANTQFYQQE++KLR+QI  +
Sbjct  60    LIVFSTRGRLYEYANNSVRATIDRYKKACTDSTNGGSVSEANTQFYQQESSKLRRQIREI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   N+++LKNLE ++EKGIS+IR+KKNE+LF EI++MQKR EI+L N+
Sbjct  120   QNSNRHILGEALSTLNIKELKNLEGRLEKGISRIRSKKNEMLFTEIEFMQKR-EIELQNH  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQL-----DGFQSTSS  351
             N YLRAKI E ERA  QQQQ N++ G +SY +  P Q +D RN+L +     +   + + 
Sbjct  179   NNYLRAKIAENERA--QQQQTNMIQG-TSYDQSMPSQSYD-RNFLPVILEANNNNNNNNH  234

Query  350   YSKQDHLPLQLV  315
             YS+ D   LQLV
Sbjct  235   YSRHDQTALQLV  246



>ref|XP_009132356.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Brassica 
rapa]
 ref|XP_009132365.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Brassica 
rapa]
 ref|XP_009132372.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Brassica 
rapa]
 ref|XP_009132388.1| PREDICTED: floral homeotic protein AGAMOUS isoform X1 [Brassica 
rapa]
 gb|AGT96410.1| AG [Brassica oleracea var. viridis]
Length=255

 Score =   317 bits (812),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 164/258 (64%), Positives = 199/258 (77%), Gaps = 14/258 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M +Q +   E SPQRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYQMELGGESSPQRKAGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++
Sbjct  61    LIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKR--QEIDLH  522
             QN NR  MGE +G  + ++L+NLE ++++ +++IR+KKNELLFAEIDYMQKR  QE+DLH
Sbjct  121   QNSNRQLMGETIGSMSPKELRNLEGRLDRSVNRIRSKKNELLFAEIDYMQKRSVQEVDLH  180

Query  521   NNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQST  357
             N+NQ LRAKI E ER       M+LMPG S+Y ++       PQ FD+RNY Q+   Q  
Sbjct  181   NDNQLLRAKIAENER---NNPSMSLMPGGSNYEQIMPPPQTQPQPFDSRNYFQVAALQPN  237

Query  356   ----SSYSKQDHLPLQLV  315
                 SS  ++D   LQLV
Sbjct  238   NHHYSSAGREDQTALQLV  255



>emb|CDP18724.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 167/246 (68%), Positives = 193/246 (78%), Gaps = 7/246 (3%)
 Frame = -1

Query  1052  EFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL  873
             + Q DQS   S  RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL
Sbjct  7     DHQFDQSSS-SQLRKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL  65

Query  872   IVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQ  693
             IVFSSRGRLYEYANNSV+ TI+RYKKAC+DS+N GS+SEAN QFYQQEA+KLR+ I  +Q
Sbjct  66    IVFSSRGRLYEYANNSVRGTIERYKKACADSSNPGSVSEANAQFYQQEASKLRKHIREIQ  125

Query  692   NQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNN  513
             N NR+ +G+G+ G N ++LKNLE K+EK I +IR +KNELLFAEI+ M KR EI+L N N
Sbjct  126   NSNRHILGDGVDGLNFKELKNLEGKVEKAIGRIRTRKNELLFAEIELMHKR-EIELQNAN  184

Query  512   QYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDH  333
              YLRAKI E ERA   QQ MNLMPG S Y  LA  Q +D RN+L ++  +    YS+QD 
Sbjct  185   TYLRAKIAENERA---QQHMNLMPG-SEYQPLA-SQPYDVRNFLPVNLLEPDQHYSRQDQ  239

Query  332   LPLQLV  315
               LQLV
Sbjct  240   TALQLV  245



>gb|AEA76418.1| putative AG, partial [Catharanthus roseus]
Length=219

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 188/221 (85%), Gaps = 9/221 (4%)
 Frame = -1

Query  983  KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATIDR  804
            KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATI+R
Sbjct  1    KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATIER  60

Query  803  YKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFNLRDLKNLE  624
            YKKA SD+++ GS++EAN QFYQQEA+KLR QISNLQN N+N +GE LG   +RDLKNLE
Sbjct  61   YKKANSDTSHAGSVAEANAQFYQQEASKLRAQISNLQNSNKNMLGESLGSLTMRDLKNLE  120

Query  623  SKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqqqqqQMNLM  444
            S++E+GIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQYLRAKI ETERA  +Q  +NLM
Sbjct  121  SRVERGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQYLRAKIAETERA-HEQPAVNLM  178

Query  443  PGSSSYHELA------PPQQFD-ARNYLQLDGFQSTSSYSK  342
            P  SS +E+         QQ+D ARN+LQ++G QS   YS+
Sbjct  179  PAGSSEYEMVQAHHHQQQQQYDAARNFLQVNGLQSNDHYSR  219



>dbj|BAC97838.1| peony [Ipomoea nil]
Length=244

 Score =   316 bits (810),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 190/248 (77%), Gaps = 5/248 (2%)
 Frame = -1

Query  1055  MEFQSDQ-SREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  879
             MEF +     E S  RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV
Sbjct  1     MEFPNQALEEEESSHRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  60

Query  878   ALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISN  699
             ALIVFS+RGRLYEYANNSV+ATIDRYKK  SDSTNTGS+SEANTQFYQQE+ KLR+QI  
Sbjct  61    ALIVFSTRGRLYEYANNSVRATIDRYKKHHSDSTNTGSVSEANTQFYQQESAKLRRQIRE  120

Query  698   LQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHN  519
             +Q  N+  +GE LG  N ++LKNLE K+EK I ++R+KKNELLF+EI+ MQKR EI+L N
Sbjct  121   IQTSNKQILGESLGVLNHKELKNLEGKVEKAIGRVRSKKNELLFSEIELMQKR-EIELQN  179

Query  518   NNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQ  339
              N YLRAKI E ERA   QQQMNLMPGS     +   Q +DA N+L L   +    YS+ 
Sbjct  180   ANMYLRAKISEFERA---QQQMNLMPGSEYQETMTTSQTYDAHNFLPLTLLEPNQHYSRH  236

Query  338   DHLPLQLV  315
             D   LQLV
Sbjct  237   DQTALQLV  244



>dbj|BAN15735.1| AGAMOUS like-protein [Rhododendron macrosepalum]
Length=255

 Score =   317 bits (811),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 201/260 (77%), Gaps = 18/260 (7%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F S Q  E S QRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAFPS-QDSEGSSQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYA+NSV++TIDRYKKACSD +NTGS+SEANTQFYQQE+NKLR+QI ++
Sbjct  60    LIVFSTRGRLYEYASNSVRSTIDRYKKACSDVSNTGSVSEANTQFYQQESNKLRRQIKDI  119

Query  695   QNQN---RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDL  525
             QN N   R+ +GE L     +++KNLE+K+EK IS+IR+KKNE+LFAEI++MQKR EI+L
Sbjct  120   QNSNSSSRHILGEALSALTFKEVKNLETKLEKAISRIRSKKNEMLFAEIEHMQKR-EIEL  178

Query  524   HNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYH----------ELAPPQQFDARNYLQL  375
              N N YLRAKI E ERA   Q+QMNLMP S  +           +   PQ +DARN L +
Sbjct  179   QNANMYLRAKIAENERA---QEQMNLMPSSHDHQYQTMGAGSQAQQQQPQSYDARNLLPV  235

Query  374   DGFQSTSSYSKQDHLPLQLV  315
             +  +    YS+ D  PLQLV
Sbjct  236   NLLEPNHHYSRHDQPPLQLV  255



>gb|ABB59994.1| MADS-box protein [Taihangia rupestris]
Length=232

 Score =   315 bits (808),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 186/233 (80%), Gaps = 3/233 (1%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEY+NN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYSNN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TI+RYKKAC+D++N GS+SEA TQ+YQQEA KLR QI+ LQN NRNYM EGLG  +
Sbjct  61    SVRETIERYKKACADTSNNGSVSEATTQYYQQEAAKLRNQITALQNNNRNYMAEGLGNMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LKN+ESK+EK I KIR+KKNELLF+EI+YMQKR E+DLHNNNQ LRAKI E ER QQ
Sbjct  121   VKELKNVESKLEKAIGKIRSKKNELLFSEIEYMQKR-ELDLHNNNQILRAKIAENERHQQ  179

Query  467   q-qqQMNLMPGSSSYHELAPPQQF-DARNYLQLDGFQSTSSYSKQDHLPLQLV  315
                          SY  +   Q F +ARNY Q++  Q    YS+ D + LQLV
Sbjct  180   SINAIAGGGGAHGSYEIMQSAQSFHEARNYFQVNALQPNHQYSRHDQISLQLV  232



>gb|AIJ29176.1| AG-like MADS box protein [Oncidium hybrid cultivar]
Length=233

 Score =   315 bits (808),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 195/236 (83%), Gaps = 4/236 (2%)
 Frame = -1

Query  1025  MSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRL  846
             M P+ KMGRGKIEI+RIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL +FSSRGRL
Sbjct  1     MEPKEKMGRGKIEIRRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALAIFSSRGRL  60

Query  845   YEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGE  666
             YEYANNSVK TIDRYKKAC+D+++TGSISEAN+Q+YQQEA KLRQQI NLQN NRN +G+
Sbjct  61    YEYANNSVKGTIDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQIINLQNSNRNLLGD  120

Query  665   GLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIE  486
              L   +LRDLK LE+++EKGI+KIR+KKNELL +EIDYMQKR E++L  +N YLR KI +
Sbjct  121   ALTTMSLRDLKQLETRLEKGINKIRSKKNELLHSEIDYMQKR-EMELQTDNMYLRNKIAD  179

Query  485   TERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              ER  +Q QQM+++P +S+ +E+  P  FD+R++LQ++    +  YS Q    LQL
Sbjct  180   NERV-RQHQQMSILPSTSTDYEVMTP--FDSRSFLQVNLLDPSDHYSPQQQTALQL  232



>ref|XP_008794140.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Phoenix 
dactylifera]
Length=224

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 191/230 (83%), Gaps = 7/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FS+RGRLYEYAN+
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAND  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK TI+RYKKAC+D++N+GS+SEAN Q+YQQE++KLRQQI+NLQN NRN MGE LG  N
Sbjct  61    SVKGTIERYKKACTDTSNSGSVSEANFQYYQQESSKLRQQITNLQNSNRNLMGESLGSMN  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LE ++EKGI+KIR KKNELL AEI+YMQKR E++L + N YLR KI E ERA  
Sbjct  121   LRDLKQLEGRLEKGINKIRTKKNELLLAEIEYMQKR-ELELQSANMYLRNKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++  ++ Y E+ PP  +D+RN+L ++  QS   YS Q    LQL
Sbjct  178   -QQQMNMLTPTTEY-EVMPP--YDSRNFLPMNLMQSNQHYSHQQQTALQL  223



>dbj|BAA90744.1| MADS-box protein [Rosa rugosa]
Length=248

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/236 (68%), Positives = 191/236 (81%), Gaps = 5/236 (2%)
 Frame = -1

Query  1016  QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY  837
             QR++GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEY
Sbjct  16    QRRLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEY  75

Query  836   ANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLG  657
             +NNSV+ TI+RYKKAC+DS+N GS+SEA TQ+YQQEA KLR QI+ LQN NR YM EGL 
Sbjct  76    SNNSVRETIERYKKACADSSNNGSVSEATTQYYQQEAAKLRAQITTLQNSNRGYMAEGLS  135

Query  656   GFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETER  477
               ++++LK +E+K+EK IS+IR+KKNELLFAEI+YMQKR E+DLHNNNQ LRAKI E ER
Sbjct  136   NMSIKELKGVETKLEKAISRIRSKKNELLFAEIEYMQKR-ELDLHNNNQLLRAKIAENER  194

Query  476   AqqqqqQMNLMPGSSSYHELAPPQQF-DARNYLQLDGFQ-STSSYSKQDHLPLQLV  315
              QQ      +  G  SY  + P Q F +ARNY Q++  Q +   YS+ D + LQLV
Sbjct  195   HQQSINA--IAGGHGSYDIMQPTQPFHEARNYFQVNALQPNIHQYSRHDQISLQLV  248



>gb|AGU92563.1| SHATTERPROOF-like protein [Fragaria x ananassa]
Length=249

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 205/242 (85%), Gaps = 10/242 (4%)
 Frame = -1

Query  1028  EMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             E S Q+K+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGR
Sbjct  14    ESSSQKKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGR  73

Query  848   LYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMG  669
             LYEYANNSV+ATI+RYKKAC DS+NTGS++EAN QFYQQEA+KLR+QI ++QN NR+ +G
Sbjct  74    LYEYANNSVRATIERYKKAC-DSSNTGSVTEANVQFYQQEASKLRRQIRDIQNSNRHILG  132

Query  668   EGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKII  489
             E L    ++DLKNLE ++EKGIS+IR+KKNE+LFAEI+YMQKR EI+L N+N +LRAKI 
Sbjct  133   EALSTLTVKDLKNLEGRLEKGISRIRSKKNEMLFAEIEYMQKR-EIELQNHNNFLRAKIA  191

Query  488   ETERAqqqqqQMNLMPGSSSYHE--LAPPQQFDARNYLQLDGFQSTSSYSK--QDHLPLQ  321
             E +RAQQQQ   N++PG+SS +E  + PPQ +D R++L +   +S  +Y++  Q+  PLQ
Sbjct  192   ENDRAQQQQA--NMLPGTSSAYEQPMPPPQSYD-RSFLPV-SLESNHNYNRQGQNQTPLQ  247

Query  320   LV  315
             LV
Sbjct  248   LV  249



>ref|XP_009132380.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Brassica 
rapa]
 ref|XP_009132395.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Brassica 
rapa]
 sp|Q01540.1|AG_BRANA RecName: Full=Floral homeotic protein AGAMOUS [Brassica napus]
 gb|AAA32985.1| BAG1 [Brassica napus]
 emb|CDX78909.1| BnaA01g09760D [Brassica napus]
Length=252

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 198/256 (77%), Gaps = 13/256 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M +Q +   E SPQRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYQMELGGESSPQRKAGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++
Sbjct  61    LIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE +G  + ++L+NLE ++++ +++IR+KKNELLFAEIDYMQKR E+DLHN+
Sbjct  121   QNSNRQLMGETIGSMSPKELRNLEGRLDRSVNRIRSKKNELLFAEIDYMQKR-EVDLHND  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQST--  357
             NQ LRAKI E ER       M+LMPG S+Y ++       PQ FD+RNY Q+   Q    
Sbjct  180   NQLLRAKIAENER---NNPSMSLMPGGSNYEQIMPPPQTQPQPFDSRNYFQVAALQPNNH  236

Query  356   --SSYSKQDHLPLQLV  315
               SS  ++D   LQLV
Sbjct  237   HYSSAGREDQTALQLV  252



>dbj|BAK20023.1| PgMADS protein8 [Panax ginseng]
Length=253

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/236 (68%), Positives = 193/236 (82%), Gaps = 6/236 (3%)
 Frame = -1

Query  1016  QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY  837
             Q+++GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEY
Sbjct  22    QQQVGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEY  81

Query  836   ANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLG  657
             ANNS+++TIDRYKK C+DS+NT S+SEANTQFYQQEA+KLR+ I ++QN NRN +GEGLG
Sbjct  82    ANNSIRSTIDRYKKVCADSSNTRSVSEANTQFYQQEASKLRRDIKSIQNSNRNIVGEGLG  141

Query  656   GFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETER  477
               + ++LKNLE ++EK ISKIR+KKNELLFAEI+ MQKR E +L + N YLRAKI E ER
Sbjct  142   SLSFKELKNLEGRLEKAISKIRSKKNELLFAEIELMQKR-ESELQHANMYLRAKISENER  200

Query  476   AqqqqqQMNLMPGSSS--YHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             A   +QQMN+MPG  S  Y  +A     DARN+L ++  +    YS+QD   LQLV
Sbjct  201   A---EQQMNMMPGGGSHEYQTMASQHYQDARNFLPVNFLEPNHHYSRQDQTALQLV  253



>ref|XP_010436489.1| PREDICTED: floral homeotic protein AGAMOUS-like [Camelina sativa]
Length=303

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 192/243 (79%), Gaps = 11/243 (5%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY
Sbjct  65    SPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  124

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++QN NR  MGE 
Sbjct  125   EYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGET  184

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E DLHN+NQ LRAKI E 
Sbjct  185   IGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-ESDLHNDNQLLRAKIAEN  243

Query  482   ERAqqqqqQMNLMPGSSSYHELAPP---QQFDARNYLQLDGFQST----SSYSKQDHLPL  324
             ER       ++LMPG S+Y +L PP   Q FD+RNY Q+   Q      SS  +QD   L
Sbjct  244   ER---NHPSISLMPGGSNYEQLMPPPQTQPFDSRNYFQVAALQPNNHHYSSAGRQDQTAL  300

Query  323   QLV  315
             QLV
Sbjct  301   QLV  303



>ref|XP_004513719.1| PREDICTED: agamous-like MADS-box protein AGL1-like isoform X1 
[Cicer arietinum]
 ref|XP_004513720.1| PREDICTED: agamous-like MADS-box protein AGL1-like isoform X2 
[Cicer arietinum]
 ref|XP_004513721.1| PREDICTED: agamous-like MADS-box protein AGL1-like isoform X3 
[Cicer arietinum]
 ref|XP_004513722.1| PREDICTED: agamous-like MADS-box protein AGL1-like isoform X4 
[Cicer arietinum]
Length=241

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 201/247 (81%), Gaps = 6/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             ME  + +  E S Q+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MELPNHEDGEGSSQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFS+RGRLYEYANNSV+ATI+RYKKACS +TN  S+SEANTQFYQQE++KLR+QI ++
Sbjct  61    LVVFSTRGRLYEYANNSVRATIERYKKACSATTNAESVSEANTQFYQQESSKLRRQIRDI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE LG  +L++LKNLE ++EKG+S++R++K+E LFA++++MQKR EIDL N 
Sbjct  121   QNLNRHILGEALGSLSLKELKNLEGRLEKGLSRVRSRKHETLFADVEFMQKR-EIDLQNQ  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             N YLRAKI E ERAQQQQQ  N+MP   +Y E  P Q +D RN+  ++   S   YS+QD
Sbjct  180   NNYLRAKIAECERAQQQQQ--NMMP--ETYSESLPSQSYD-RNFFPVNLLGSDQQYSRQD  234

Query  335   HLPLQLV  315
                LQLV
Sbjct  235   QTALQLV  241



>ref|XP_009380480.1| PREDICTED: MADS-box transcription factor 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=226

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 193/231 (84%), Gaps = 7/231 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDA+VALIVFSSRGRLYEYA N
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDADVALIVFSSRGRLYEYATN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATIDRYKKAC+ +TNTG  SE N Q+YQQEA+KLRQQI+NLQ+ NR+ MGE LG  +
Sbjct  61    SVKATIDRYKKACNGTTNTGFASEDNAQYYQQEASKLRQQINNLQSTNRSLMGESLGSMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRD+K LE+++EKGI+KIR KKNELLFAEI+YMQKR E++L N+N YLR KI E ERA  
Sbjct  121   LRDMKQLETRLEKGINKIRNKKNELLFAEIEYMQKR-EMELQNDNMYLRNKIAENERA--  177

Query  467   qqqQMNLMPGS-SSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM+++P + ++ +E+ PP  +D+RN+LQ++  Q T  Y+ Q    LQL
Sbjct  178   -QQQMSMLPSARTTEYEIMPP--YDSRNFLQVNAVQPTQHYTHQQRTALQL  225



>gb|ABR68012.1| C-class floral identity [Carica papaya]
Length=228

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 187/231 (81%), Gaps = 3/231 (1%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             M RGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MARGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATI+RYKKACSD+TN GS++EANTQFYQQEA KLR+QI  +QN NR+ +GE LG   
Sbjct  61    SVKATIERYKKACSDATNPGSVTEANTQFYQQEATKLRRQIREIQNSNRHILGEALGSLT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              ++LKNLE ++EKGIS+IR+KKNELLFAEI+YMQKR EI+L N+N YLRAKI E ER Q+
Sbjct  121   FKELKNLEGRLEKGISRIRSKKNELLFAEIEYMQKR-EIELQNDNMYLRAKIAENERVQE  179

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             QQQ  NLM G S Y  +    Q   RN+L ++  +    YS  DH  LQLV
Sbjct  180   QQQS-NLMQG-SVYESMPSQSQTYNRNFLPVNLLEPNHQYSADDHTALQLV  228



>ref|XP_004485957.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X6 [Cicer 
arietinum]
Length=237

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 192/256 (75%), Gaps = 28/256 (11%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M+FQ +QS   SPQRK+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MDFQ-NQSMSDSPQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSVKATI+RYKKACSDS+ TGS SEAN QFYQQEA+KLR QISNL
Sbjct  60    LIVFSSRGRLYEYANNSVKATIERYKKACSDSSGTGSASEANAQFYQQEADKLRAQISNL  119

Query  695   QNQN----RNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEID  528
             QN N    R  MGE LG    ++LKNLE K+EKGIS+IR+KK               EID
Sbjct  120   QNNNRLKCRQMMGESLGSMTAKELKNLEGKLEKGISRIRSKK---------------EID  164

Query  527   LHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQ  363
             LHNNNQ LRAKI E+ER       M+++PG +SY  +        QQ+D+R Y Q+ G Q
Sbjct  165   LHNNNQLLRAKIAESER---NHHNMSVLPGGTSYESMQSQHQQQQQQYDSRGYFQVTGLQ  221

Query  362   STSSYSKQDHLPLQLV  315
              +S Y++QD + LQLV
Sbjct  222   PSSQYARQDQMSLQLV  237



>gb|AAK83034.1|AF286649_1 transcription factor CMB1 [Cucumis sativus]
Length=215

 Score =   313 bits (802),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 181/225 (80%), Gaps = 10/225 (4%)
 Frame = -1

Query  989  EIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATI  810
            EIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATI
Sbjct  1    EIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATI  60

Query  809  DRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFNLRDLKN  630
            DRYKKA SDS+NTGS SEANTQFYQQEA KLR QI NLQN NRN +GE L     +DLK 
Sbjct  61   DRYKKASSDSSNTGSTSEANTQFYQQEAAKLRVQIGNLQNPNRNMLGESLSSLTAKDLKG  120

Query  629  LESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqqqqqQMN  450
            LE+K+EKGIS+IR+KKNELLFAEI+YM+KR EIDLHNNNQ LRAKI E+ER       +N
Sbjct  121  LETKLEKGISRIRSKKNELLFAEIEYMRKR-EIDLHNNNQMLRAKIAESER------NVN  173

Query  449  LMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
            +M G     EL     +D R++ Q++G Q    Y +QD++ LQLV
Sbjct  174  MMGGE---FELMQSHPYDPRDFFQVNGLQHNHQYPRQDNMALQLV  215



>ref|XP_007159503.1| hypothetical protein PHAVU_002G243200g [Phaseolus vulgaris]
 gb|ESW31497.1| hypothetical protein PHAVU_002G243200g [Phaseolus vulgaris]
Length=242

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 198/248 (80%), Gaps = 7/248 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F +     +SP+RK GRGKIEIKRIENTT+RQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAFPNQSVSSVSPERKTGRGKIEIKRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSVKA+I+RYKKA SDS++ GS SEAN QFYQQEA KLR QISNL
Sbjct  61    LIVFSNRGRLYEYANNSVKASIERYKKASSDSSSGGSASEANAQFYQQEAAKLRVQISNL  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE L   N +DLKNLE+K+EKGIS+IR+KKNELLFAEI+YMQKR E DLHNN
Sbjct  121   QNHNRQMMGEALSNMNAKDLKNLETKLEKGISRIRSKKNELLFAEIEYMQKR-ETDLHNN  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSS-YSKQ  339
             NQ LRAK+ E ER    +  +N++ GS+SY  +    QFD+R + Q+ G Q  ++ Y+ Q
Sbjct  180   NQLLRAKMAERERG---EHNVNVLSGSTSYESMQS--QFDSRGFFQVTGLQPNNNQYAGQ  234

Query  338   DHLPLQLV  315
             DH+ LQ V
Sbjct  235   DHMSLQFV  242



>ref|XP_009380477.1| PREDICTED: MADS-box transcription factor 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380478.1| PREDICTED: MADS-box transcription factor 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380479.1| PREDICTED: MADS-box transcription factor 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=232

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 193/231 (84%), Gaps = 7/231 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDA+VALIVFSSRGRLYEYA N
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDADVALIVFSSRGRLYEYATN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVKATIDRYKKAC+ +TNTG  SE N Q+YQQEA+KLRQQI+NLQ+ NR+ MGE LG  +
Sbjct  61    SVKATIDRYKKACNGTTNTGFASEDNAQYYQQEASKLRQQINNLQSTNRSLMGESLGSMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRD+K LE+++EKGI+KIR KKNELLFAEI+YMQKR E++L N+N YLR KI E ERA  
Sbjct  121   LRDMKQLETRLEKGINKIRNKKNELLFAEIEYMQKR-EMELQNDNMYLRNKIAENERA--  177

Query  467   qqqQMNLMPGS-SSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM+++P + ++ +E+ PP  +D+RN+LQ++  Q T  Y+ Q    LQL
Sbjct  178   -QQQMSMLPSARTTEYEIMPP--YDSRNFLQVNAVQPTQHYTHQQRTALQL  225



>gb|ACD76828.1| AGAMOUS-like protein [Capsella bursa-pastoris]
Length=252

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 198/256 (77%), Gaps = 13/256 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M +Q++   + SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYQAELGEDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++
Sbjct  61    LIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E+DLHN+
Sbjct  121   QNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-EVDLHND  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQST--  357
             NQ LRAKI E ER       ++LMPG S+Y ++       PQ FD+RNY Q+   Q    
Sbjct  180   NQILRAKIAENER---NNPSISLMPGGSNYEQIMPPPQTQPQPFDSRNYFQVAALQPNNH  236

Query  356   --SSYSKQDHLPLQLV  315
               SS  +QD   LQLV
Sbjct  237   HYSSAGRQDQTALQLV  252



>gb|AAD00025.1| AGAMOUS protein [Rosa hybrid cultivar]
Length=248

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 192/240 (80%), Gaps = 5/240 (2%)
 Frame = -1

Query  1028  EMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             +   QR++GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGR
Sbjct  12    DADAQRRLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGR  71

Query  848   LYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMG  669
             LYEY+NNSV+ TI+RYKKAC+DS+N GS+SEA TQ+YQQEA KLR QI+ LQN NR YM 
Sbjct  72    LYEYSNNSVRETIERYKKACADSSNNGSVSEATTQYYQQEAAKLRAQITTLQNSNRGYMA  131

Query  668   EGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKII  489
             EGL   ++++LK +E+K+EK IS+IR+KKNELLFAEI+YMQKR E+DLHNNNQ LRAKI 
Sbjct  132   EGLSNMSIKELKGVETKLEKAISRIRSKKNELLFAEIEYMQKR-ELDLHNNNQLLRAKIA  190

Query  488   ETERAqqqqqQMNLMPGSSSYHELAPPQQF-DARNYLQLDGFQ-STSSYSKQDHLPLQLV  315
             + ER QQ      +  G  SY  + P Q F +ARNY Q++  + +   YS+ D + LQLV
Sbjct  191   DNERHQQSINA--IAGGHGSYEIMQPTQPFHEARNYFQVNALEPNIHQYSRHDQISLQLV  248



>ref|XP_010445284.1| PREDICTED: floral homeotic protein AGAMOUS-like [Camelina sativa]
Length=298

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 191/243 (79%), Gaps = 11/243 (5%)
 Frame = -1

Query  1022  SPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLY  843
             SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCD EVALIVFSSRGRLY
Sbjct  60    SPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDVEVALIVFSSRGRLY  119

Query  842   EYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEG  663
             EY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++QN NR  MGE 
Sbjct  120   EYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGET  179

Query  662   LGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIET  483
             +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E DLHN+NQ LRAKI E 
Sbjct  180   IGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-ESDLHNDNQLLRAKIAEN  238

Query  482   ERAqqqqqQMNLMPGSSSYHELAPP---QQFDARNYLQLDGFQST----SSYSKQDHLPL  324
             ER       ++LMPG S+Y +L PP   Q FD+RNY Q+   Q      SS  +QD   L
Sbjct  239   ER---NHPSISLMPGGSNYEQLMPPPQTQPFDSRNYFQVAALQPNNHHYSSAGRQDQTAL  295

Query  323   QLV  315
             QLV
Sbjct  296   QLV  298



>ref|XP_004309724.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004309725.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=249

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 204/242 (84%), Gaps = 10/242 (4%)
 Frame = -1

Query  1028  EMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             E S Q+K+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGR
Sbjct  14    ESSSQKKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGR  73

Query  848   LYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMG  669
             LYEYANNSV+ATI+RYKKAC DS+NTGS++EAN QFYQQEA+KLR+QI  +QN NR+ +G
Sbjct  74    LYEYANNSVRATIERYKKAC-DSSNTGSVTEANVQFYQQEASKLRRQIREIQNSNRHILG  132

Query  668   EGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKII  489
             E L   N+++LKNLE ++EKGIS+IR+KKNE+LFAEI+YMQKR EI+L N+N +LRAKI 
Sbjct  133   EALSTLNVKELKNLEGRLEKGISRIRSKKNEMLFAEIEYMQKR-EIELQNHNNFLRAKIA  191

Query  488   ETERAqqqqqQMNLMPGSSSYHE--LAPPQQFDARNYLQLDGFQSTSSYSKQDH--LPLQ  321
             E +RAQQQQ   N++PG+SS +E  + PPQ +D R++L +   +S  +Y++Q     PLQ
Sbjct  192   ENDRAQQQQA--NMLPGTSSAYEQPMPPPQSYD-RSFLPVI-IESNHNYNRQGQNLTPLQ  247

Query  320   LV  315
             LV
Sbjct  248   LV  249



>gb|KCW47399.1| hypothetical protein EUGRSUZ_K01195 [Eucalyptus grandis]
Length=255

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 171/255 (67%), Positives = 201/255 (79%), Gaps = 8/255 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF S+ S   S +R  GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSEFSEASSQKRIGGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ TI+RYKKA SDS++  S+SE NTQFYQQEA+KLR+QI  +
Sbjct  61    LIVFSSRGRLYEYANNSVRGTIERYKKASSDSSHPQSVSEVNTQFYQQEASKLRRQIREI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKR---QEIDL  525
             Q  NR+ +GEG+   + +DLKNLESK+EK IS++R+KKNE+LFAEI+YMQKR   QEI+L
Sbjct  121   QVSNRHILGEGISDLSFKDLKNLESKLEKSISRVRSKKNEMLFAEIEYMQKRGLVQEIEL  180

Query  524   HNNNQYLRAKIIETERAqqqqqQMNL----MPGSSSYHELAPPQQFDARNYLQLDGFQST  357
              N+N YLRAKI E E AQQQQQQ +     MPGSSS +E  P Q    RN+LQ++  +  
Sbjct  181   QNDNMYLRAKIAENEGAQQQQQQGSDHHFNMPGSSSVYEALPSQPAYDRNFLQVNVLEPN  240

Query  356   S-SYSKQDHLPLQLV  315
               SYS+ DH  LQLV
Sbjct  241   HQSYSRSDHTALQLV  255



>gb|ADU15476.1| AG [Actinidia arguta]
Length=239

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/240 (70%), Positives = 190/240 (79%), Gaps = 8/240 (3%)
 Frame = -1

Query  1025  MSPQRKMG-RGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             +SPQ+KMG RGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGR
Sbjct  5     LSPQKKMGGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGR  64

Query  848   LYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMG  669
             LYEYANNSVK TI+RYKKA S S+NTGS+SE N QFYQQEA KLR QI+NLQ+ N +  G
Sbjct  65    LYEYANNSVKGTIERYKKASSGSSNTGSVSELNAQFYQQEAAKLRVQINNLQSSNSHMHG  124

Query  668   EGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKII  489
             + L   +LR+LKNLE ++E+GIS+IR+KKNELLFAEI+ MQKR E  L  N Q LRAKI 
Sbjct  125   DSLSSMSLRELKNLEGRLERGISRIRSKKNELLFAEIELMQKR-EAYLPQNTQCLRAKIA  183

Query  488   ETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDG-FQST-SSYSKQDHLPLQLV  315
             E ER     QQMNLMP  S Y  +  P   D RNYLQ+DG  QS  +SYS+QD   LQLV
Sbjct  184   EGERV----QQMNLMPAGSDYELMQQPPSLDTRNYLQVDGRLQSDHNSYSRQDQTVLQLV  239



>emb|CAJ44134.1| plena protein [Misopates orontium]
Length=238

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 196/248 (79%), Gaps = 11/248 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF +  S     +RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPNQDS-----ERKNGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  55

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFSSRGRLYEYANNSV+ATIDRYKKA +DS+N+ S SEANTQFYQQEANKLR+QI  +
Sbjct  56    LVVFSSRGRLYEYANNSVRATIDRYKKASADSSNSVSTSEANTQFYQQEANKLRRQIREI  115

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR  +GEG+G   L+DLK+ E+K+EK IS+IR+KKNELLFAEI+ MQKR E++LHN 
Sbjct  116   QTSNRQMLGEGVGNMALKDLKSTEAKVEKAISRIRSKKNELLFAEIELMQKR-ELELHNA  174

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQST-SSYSKQ  339
             N +LRAKI E ERA  QQQQMNLMPGS   ++    Q +D RN+L ++  +     YS+ 
Sbjct  175   NMFLRAKIAEGERA--QQQQMNLMPGSD--YQPMTSQSYDVRNFLPMNLMEPNQQQYSRH  230

Query  338   DHLPLQLV  315
             D   LQLV
Sbjct  231   DQTALQLV  238



>gb|ACD76829.1| AGAMOUS-like protein [Capsella bursa-pastoris]
Length=252

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 199/256 (78%), Gaps = 13/256 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M +Q++   + SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MAYQAELGEDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVK TI+RYKKA SD++N+GS++E N Q+YQQE+ KLRQQI ++
Sbjct  61    LIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNSGSVAEINAQYYQQESAKLRQQIISI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E+DLHN+
Sbjct  121   QNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-EVDLHND  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQST--  357
             NQ LRAKI E ER       ++LMPG S+Y ++       PQQFD+RNY Q+   Q    
Sbjct  180   NQILRAKIAENER---NNPSISLMPGGSNYEQIMPPPQTQPQQFDSRNYFQVAALQPNNH  236

Query  356   --SSYSKQDHLPLQLV  315
               SS  +QD   LQLV
Sbjct  237   HYSSAGRQDQTALQLV  252



>emb|CDX99406.1| BnaC01g11460D [Brassica napus]
Length=312

 Score =   314 bits (804),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 198/256 (77%), Gaps = 13/256 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M +Q +   E SPQRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  61    MAYQMELGGESSPQRKAGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  120

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++
Sbjct  121   LIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISI  180

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE +G  + ++L+NLE ++++ +++IR+KKNELLFAEIDYMQKR E+DLHN+
Sbjct  181   QNSNRQLMGETIGSMSPKELRNLEGRLDRSVNRIRSKKNELLFAEIDYMQKR-EVDLHND  239

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQST--  357
             NQ LRAKI E ER       M+LMPG ++Y ++       PQ FD+RNY Q+   Q    
Sbjct  240   NQLLRAKIAENER---NNPSMSLMPGGTNYEQIMPPPQTQPQPFDSRNYFQVAALQPNNH  296

Query  356   --SSYSKQDHLPLQLV  315
               SS  ++D   LQLV
Sbjct  297   HYSSAGREDQTALQLV  312



>gb|ADC79699.1| AGAMOUS-like protein [Euptelea pleiosperma]
Length=225

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 189/231 (82%), Gaps = 8/231 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY+NN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK TI+RYKKAC++S+N+ ++SEAN QFYQQEA KLRQQI  LQN NRN MG+ L    
Sbjct  61    SVKTTIERYKKACANSSNSITVSEANAQFYQQEATKLRQQIVTLQNANRNLMGDALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              ++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR EIDL N+N YLRAKI E ERA  
Sbjct  121   GKELKQLETRLEKGISRIRSKKNELLFAEIEYMQKR-EIDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSS-SYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++P +      LAP   FD+RN+LQ++  +  + YS+ +   LQL
Sbjct  178   -QQQMNMLPANEYEVMSLAP---FDSRNFLQVNLLEHNNQYSRPEQTALQL  224



>gb|KCW47400.1| hypothetical protein EUGRSUZ_K01195 [Eucalyptus grandis]
Length=251

 Score =   311 bits (797),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 200/252 (79%), Gaps = 6/252 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF S+ S   S +R  GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSEFSEASSQKRIGGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ TI+RYKKA SDS++  S+SE NTQFYQQEA+KLR+QI  +
Sbjct  61    LIVFSSRGRLYEYANNSVRGTIERYKKASSDSSHPQSVSEVNTQFYQQEASKLRRQIREI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR+ +GEG+   + +DLKNLESK+EK IS++R+KKNE+LFAEI+YMQKR EI+L N+
Sbjct  121   QVSNRHILGEGISDLSFKDLKNLESKLEKSISRVRSKKNEMLFAEIEYMQKR-EIELQND  179

Query  515   NQYLRAKIIETERAqqqqqQMNL----MPGSSSYHELAPPQQFDARNYLQLDGFQSTS-S  351
             N YLRAKI E E AQQQQQQ +     MPGSSS +E  P Q    RN+LQ++  +    S
Sbjct  180   NMYLRAKIAENEGAQQQQQQGSDHHFNMPGSSSVYEALPSQPAYDRNFLQVNVLEPNHQS  239

Query  350   YSKQDHLPLQLV  315
             YS+ DH  LQLV
Sbjct  240   YSRSDHTALQLV  251



>ref|XP_006284388.1| hypothetical protein CARUB_v10005558mg, partial [Capsella rubella]
 gb|EOA17286.1| hypothetical protein CARUB_v10005558mg, partial [Capsella rubella]
Length=254

 Score =   311 bits (797),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 198/255 (78%), Gaps = 14/255 (5%)
 Frame = -1

Query  1049  FQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  870
             +Q++   + SP RK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI
Sbjct  4     YQAELGEDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI  63

Query  869   VFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQN  690
             VFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++QN
Sbjct  64    VFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQN  123

Query  689   QNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQ  510
              NR  MGE +G  + ++L+NLE ++E+ I++IR+KKNELLF+EIDYMQKR E+DLHN+NQ
Sbjct  124   SNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKR-EVDLHNDNQ  182

Query  509   YLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQS-----  360
              LRAKI E ER       ++LMPG S+Y +L       PQ FD+RNY Q+   Q      
Sbjct  183   ILRAKIAENER---NNPSISLMPGGSNYEQLMPPPQTQPQPFDSRNYFQVAALQPNNHHY  239

Query  359   TSSYSKQDHLPLQLV  315
             +S+  +QD   LQLV
Sbjct  240   SSAGGRQDQTALQLV  254



>gb|AFX61408.1| AGAMOUS-like MADS-box transcription factor, partial [Narcissus 
bulbocodium subsp. quintanilhae]
Length=221

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 186/224 (83%), Gaps = 6/224 (3%)
 Frame = -1

Query  983  KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATIDR  804
            KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANNSVKATI+R
Sbjct  1    KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKATIER  60

Query  803  YKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFNLRDLKNLE  624
            YKKAC+D++NT ++SEAN+Q+YQQEA+KLRQQI+NLQN NRN MGE L   +LRDLK LE
Sbjct  61   YKKACTDTSNTATVSEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSTMSLRDLKQLE  120

Query  623  SKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqqqqqQMNLM  444
            +++EKGISKIR KKNELLFAEI++MQKR EI+L N+N YLR KI + ERA   QQQMN++
Sbjct  121  TRLEKGISKIRTKKNELLFAEIEHMQKR-EIELQNDNMYLRNKITDNERA---QQQMNML  176

Query  443  P--GSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
            P   S+S HE     QFD+RN+LQ+   +    YS+Q    LQL
Sbjct  177  PSAASTSTHEYEGIPQFDSRNFLQVSLMEPGHHYSRQQQTTLQL  220



>gb|AFH74367.1| AGAMOUS-like protein [Magnolia kwangtungensis]
Length=223

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 191/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI +LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIVHLQNANRHLMGEALSAMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLLDSSHHYSHQEQTALQL  222



>gb|AER34989.1| AGAMOUS-like protein [Mangifera indica]
Length=241

 Score =   311 bits (796),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 199/247 (81%), Gaps = 6/247 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF S Q  E S  +K GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPS-QEPESSSHKKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFSSRGRLYEYANNSV++TI+RYKK+C+DS+N GS++EANTQFYQQEA KLR+QI  +
Sbjct  60    LVVFSSRGRLYEYANNSVRSTIERYKKSCADSSNPGSVTEANTQFYQQEATKLRRQIREI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   + ++LKNLE+++EKGIS+IR+KKNE+LFAEI++MQKR EI L N+
Sbjct  120   QNLNRHILGEALSSLSFKELKNLEARLEKGISRIRSKKNEMLFAEIEFMQKR-EIQLQND  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             N YLRAKI E ER +QQQ   N+M G + Y +  P Q +D RN++ ++  +    YS+++
Sbjct  179   NMYLRAKIAENERVEQQQS--NMMQG-AVYDQSVPSQSYD-RNFIPVNLLEPNHQYSREE  234

Query  335   HLPLQLV  315
                LQLV
Sbjct  235   QTALQLV  241



>dbj|BAA90745.1| MADS-box protein [Rosa rugosa]
Length=249

 Score =   311 bits (796),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 191/237 (81%), Gaps = 6/237 (3%)
 Frame = -1

Query  1016  QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY  837
             QR++GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEY
Sbjct  16    QRRLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEY  75

Query  836   ANNS-VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGL  660
             +NNS V+ TI+RYKKAC+DS+N GS+SEA TQ+YQQEA KLR QI+ LQN NR YM EGL
Sbjct  76    SNNSSVRETIERYKKACADSSNNGSVSEATTQYYQQEAAKLRAQITTLQNSNRGYMAEGL  135

Query  659   GGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETE  480
                ++++LK +E+K+EK IS+IR+KKNELLFAEI+YMQKR E+DLHNNNQ LRAKI E E
Sbjct  136   SNMSIKELKGVETKLEKAISRIRSKKNELLFAEIEYMQKR-ELDLHNNNQLLRAKIAENE  194

Query  479   RAqqqqqQMNLMPGSSSYHELAPPQQF-DARNYLQLDGFQ-STSSYSKQDHLPLQLV  315
             R QQ      +  G  SY  + P Q F +ARNY Q++  Q +   YS+ D + LQLV
Sbjct  195   RHQQSINA--IAGGHGSYDIMQPTQPFHEARNYFQVNALQPNIHQYSRHDQISLQLV  249



>gb|AFH74375.1| AGAMOUS-like protein [Liriodendron chinense]
Length=223

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS+N G +SEAN+Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSNLGCVSEANSQYYQQESSKLRQQIGILQNANRHLMGEALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLLDSSHHYSHQEQTALQL  222



>gb|AAM33099.1| TAG1 transcription factor [Solanum lycopersicum]
Length=197

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 174/198 (88%), Gaps = 3/198 (2%)
 Frame = -1

Query  902  SVLCDAEVALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEAN  723
            SVLCDAEVAL+VFS+RGRLYEYANNSVKATI+RYKKACSDS+NTGS+SEAN Q+YQQEA+
Sbjct  1    SVLCDAEVALVVFSNRGRLYEYANNSVKATIERYKKACSDSSNTGSVSEANAQYYQQEAS  60

Query  722  KLRQQISNLQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQK  543
            KLR QI NL NQNRN MGE L G  L++LKNLE +IEKGISKIR+KKNELLFAEI+YMQK
Sbjct  61   KLRAQIGNLMNQNRNMMGEALAGMKLKELKNLEQRIEKGISKIRSKKNELLFAEIEYMQK  120

Query  542  RQEIDLHNNNQYLRAKIIETERAqqqqqQMNLMPGSSS-YHELA-PPQQFDARNYLQLDG  369
            R E+DLHNNNQYLRAKI ETERAQ Q QQMNLMPGSSS YHEL  PPQQFD RNYLQ++G
Sbjct  121  R-EVDLHNNNQYLRAKIAETERAQHQHQQMNLMPGSSSNYHELVPPPQQFDTRNYLQVNG  179

Query  368  FQSTSSYSKQDHLPLQLV  315
             Q+ + Y +QD  P+QLV
Sbjct  180  LQTNNHYPRQDQPPIQLV  197



>gb|AHH28324.1| MADS-box transcription factor, partial [Dalechampia sp. CONN 
198500613]
Length=212

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 179/217 (82%), Gaps = 5/217 (2%)
 Frame = -1

Query  965  TNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATIDRYKKACS  786
            TNRQVTFCKRRNGLLKKAYELSVLCDAEV LIVFSSRGRLYEYANNSVKATI+RYKKA S
Sbjct  1    TNRQVTFCKRRNGLLKKAYELSVLCDAEVGLIVFSSRGRLYEYANNSVKATIERYKKATS  60

Query  785  DSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFNLRDLKNLESKIEKG  606
            DS+ TGS+SE N Q+YQQE+ KLR QI NLQN NR+ +GE LG  N ++LKNLE+K+EKG
Sbjct  61   DSSTTGSVSEINVQYYQQESAKLRAQIGNLQNSNRHMLGESLGSLNAKELKNLETKLEKG  120

Query  605  ISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqqqqqQMNLMPGSSSY  426
            IS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAKI E ER   +QQ MN +P S +Y
Sbjct  121  ISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAKIAENER---KQQNMNAVPASGNY  176

Query  425  HELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQLV  315
             E+  PQ FD RNY Q+D  Q T+ Y +QD + LQLV
Sbjct  177  -EIMQPQSFDNRNYFQVDALQPTNQYPQQDQMALQLV  212



>dbj|BAA90746.1| MADS-box protein [Rosa rugosa]
Length=250

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 191/238 (80%), Gaps = 7/238 (3%)
 Frame = -1

Query  1016  QRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY  837
             QR++GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEY
Sbjct  16    QRRLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEY  75

Query  836   ANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLG  657
             +NNSV+ TI+RYKKAC+DS+N GS+SEA TQ+YQQEA KLR QI+ LQN NR YM EGL 
Sbjct  76    SNNSVRETIERYKKACADSSNNGSVSEATTQYYQQEAAKLRAQITTLQNSNRGYMAEGLS  135

Query  656   GFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAK--IIET  483
               ++++LK +E+K+EK IS+IR+KKNELLFAEI+YMQKR E+DLHNNNQ LRAK  I E 
Sbjct  136   NMSIKELKGVETKLEKAISRIRSKKNELLFAEIEYMQKR-ELDLHNNNQLLRAKGQIAEN  194

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQF-DARNYLQLDGFQ-STSSYSKQDHLPLQLV  315
             ER QQ      +  G  SY  + P Q F +ARNY Q++  Q +   YS+ D + LQLV
Sbjct  195   ERHQQSINA--IAGGHGSYDIMQPTQPFHEARNYFQVNALQPNIHQYSRHDQISLQLV  250



>emb|CAA48635.1| fbp6 [Petunia x hybrida]
Length=247

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 192/251 (76%), Gaps = 8/251 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F + +    S QRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MVFPNQEFESSSSQRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ATIDRYKK  +DST+TGS+SEANTQ+YQQEA KLR+QI ++
Sbjct  61    LIVFSSRGRLYEYANNSVRATIDRYKKHHADSTSTGSVSEANTQYYQQEAAKLRRQIRDI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR  +GE L   + R LKNLE K+EK I ++R+KKNELLF+EI+ MQKR EI++ N 
Sbjct  121   QTYNRQIVGEALSSLSPRGLKNLEGKLEKAIGRVRSKKNELLFSEIELMQKR-EIEMQNA  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAP----PQQFDARNYLQLDGFQSTSSY  348
             N YLRAKI E ERA    QQMNLM G  S ++  P     Q +DARN+L ++  +    Y
Sbjct  180   NMYLRAKIAEVERA---TQQMNLMHGGGSEYQQQPMSSTSQPYDARNFLPVNLLEPNPHY  236

Query  347   SKQDHLPLQLV  315
             S+QD   LQLV
Sbjct  237   SRQDQTALQLV  247



>ref|NP_001289649.1| glycogen debranching enzyme [Eucalyptus grandis]
 dbj|BAH56657.1| agamous-like protein [Eucalyptus grandis]
Length=251

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 200/252 (79%), Gaps = 6/252 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF S+ S   S +R  GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPSEFSEASSQKRIGGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ TI+RYKKA SDS++  S+SE NTQFYQQEA+KLR+QI  +
Sbjct  61    LIVFSSRGRLYEYANNSVRGTIERYKKASSDSSHPQSVSEVNTQFYQQEASKLRRQIREI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR+ +GEG+   + +DLKNLESK+EK IS++R+KKNE+LFAEI+YMQKR EI+L N+
Sbjct  121   QVSNRHILGEGISDLSFKDLKNLESKLEKSISRVRSKKNEMLFAEIEYMQKR-EIELQND  179

Query  515   NQYLRAKIIETERAqqqqqQMNL----MPGSSSYHELAPPQQFDARNYLQLDGFQSTS-S  351
             N YLRAKI E E AQQQQQQ +     MPGSSS +E  P Q    RN+LQ++  +    S
Sbjct  180   NMYLRAKIAENEGAQQQQQQGSDHHFNMPGSSSVYEALPSQPAYDRNFLQVNVLEPNHQS  239

Query  350   YSKQDHLPLQLV  315
             YS+ DH  LQLV
Sbjct  240   YSRFDHTALQLV  251



>gb|AEO52692.1| AGAMOUS-like protein [Magnolia wufengensis]
 gb|AFH74373.1| AGAMOUS-like protein [Magnolia zenii]
 gb|AFH74374.1| AGAMOUS-like protein [Magnolia cylindrica]
 gb|AFH74377.1| AGAMOUS-like protein [Magnolia maudiae]
 gb|AFH74378.1| AGAMOUS-like protein [Magnolia amoena]
 gb|AFH74379.1| AGAMOUS-like protein [Magnolia biondii]
 gb|AFH74380.1| AGAMOUS-like protein [Magnolia denudata]
 gb|AFH74381.1| AGAMOUS-like protein [Magnolia liliiflora]
 gb|AFH74392.1| AGAMOUS-like protein [Magnolia stellata]
 gb|AFH74401.1| AGAMOUS-like protein [Magnolia salicifolia]
 gb|AFH74402.1| AGAMOUS-like protein [Magnolia chapensis]
 gb|AFH74404.1| AGAMOUS-like protein [Magnolia liliiflora]
 gb|AFH74405.1| AGAMOUS-like protein [Magnolia denudata]
 gb|AFN68772.1| AGAMOUS-like protein [Magnolia sprengeri]
Length=223

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 191/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI+ LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIALLQNANRHLMGEALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLMDSSHHYSHQEQTALQL  222



>gb|AAX13303.1| MADS box protein AGa [Lotus japonicus]
Length=248

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 194/252 (77%), Gaps = 26/252 (10%)
 Frame = -1

Query  1004  GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  825
             GRGK+EIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS
Sbjct  1     GRGKMEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNS  60

Query  824   VKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFNL  645
             VKATIDRYKKACSDS+  GS SEAN QFYQQEA+KLR QISNLQN NR  M E LG  N 
Sbjct  61    VKATIDRYKKACSDSSGAGSASEANAQFYQQEADKLRVQISNLQNNNRQMMSESLGSMNA  120

Query  644   RDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqqq  465
             ++LKNLE+K+EKGIS+IR+KKNELLFAEI+YMQKR EIDLHNNNQ LRAKI E+ER    
Sbjct  121   KELKNLETKLEKGISRIRSKKNELLFAEIEYMQKR-EIDLHNNNQLLRAKIAESER---N  176

Query  464   qqQMNLMPGSSSYHE------LAPPQQFDARNYLQLDGFQST----------------SS  351
                ++++ GS+S +E          QQFD+R Y Q+ G Q T                S 
Sbjct  177   HPNLSILAGSTSNYESMQSQQQQQQQQFDSRGYFQVTGLQPTTHTQYSRQDQISLQPSSQ  236

Query  350   YSKQDHLPLQLV  315
             Y++QDH+ LQLV
Sbjct  237   YARQDHMSLQLV  248



>ref|XP_008794138.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008794139.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 [Phoenix 
dactylifera]
Length=229

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 191/235 (81%), Gaps = 12/235 (5%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FS+RGRLYEYAN+
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAND  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK TI+RYKKAC+D++N+GS+SEAN Q+YQQE++KLRQQI+NLQN NRN MGE LG  N
Sbjct  61    SVKGTIERYKKACTDTSNSGSVSEANFQYYQQESSKLRQQITNLQNSNRNLMGESLGSMN  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAK-----IIET  483
             LRDLK LE ++EKGI+KIR KKNELL AEI+YMQKR E++L + N YLR K     I E 
Sbjct  121   LRDLKQLEGRLEKGINKIRTKKNELLLAEIEYMQKR-ELELQSANMYLRNKLMWKQITEN  179

Query  482   ERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
             ERA   QQQMN++  ++ Y E+ PP  +D+RN+L ++  QS   YS Q    LQL
Sbjct  180   ERA---QQQMNMLTPTTEY-EVMPP--YDSRNFLPMNLMQSNQHYSHQQQTALQL  228



>gb|AFH74368.1| AGAMOUS-like protein [Michelia alba]
Length=223

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 191/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGLLQNANRHLMGEALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM+++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMSMLPAPE--YDVMPG--FDSRNFLQVNLMDSSHHYSHQEQTALQL  222



>gb|AFH74371.1| AGAMOUS-like protein [Magnolia crassipes]
 gb|AFH74372.1| AGAMOUS-like protein [Magnolia dandyi]
 gb|AFH74376.1| AGAMOUS-like protein [Magnolia conifera var. chingii]
 gb|AFH74391.1| AGAMOUS-like protein [Magnolia officinalis subsp. biloba]
 gb|AFH74393.1| AGAMOUS-like protein [Magnolia rufibarbata]
Length=223

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIVLLQNANRHLMGEALSAMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLLDSSHHYSHQEQTALQL  222



>gb|AAS67610.1| agamous MADS-box transcription factor 1a [Crocus sativus]
Length=226

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 189/231 (82%), Gaps = 7/231 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK TIDRYKKAC+D++N+G++SEAN+Q+YQQEA+KL QQI+ LQN NRN MGE L   +
Sbjct  61    SVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              R+L+ LE K+EKGI+KIRAKKNELL+AEI+YMQKR E++L N+N YLR KI E ERA  
Sbjct  121   PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKR-EMELQNDNMYLRNKISENERA--  177

Query  467   qqqQMNLMP-GSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQ MN++P  +++ +E  PP  FD+R++LQ +       YS Q    LQL
Sbjct  178   -QQHMNMLPSATATEYEAMPP--FDSRSFLQANLVDPNHHYSHQQQTALQL  225



>gb|AFH74399.1| AGAMOUS-like protein [Magnolia paenetalauma]
Length=223

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G ISEAN+Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCISEANSQYYQQESSKLRQQIGILQNANRHLMGEALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLLDSSHHYSHQEQTALQL  222



>gb|AHH41528.1| MADS-box transcription factor 1a [Crocus sativus]
Length=226

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 189/231 (82%), Gaps = 7/231 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK TIDRYKKAC+D++N+G++SEAN+Q+YQQEA+KL QQI+ LQN NRN MGE L   +
Sbjct  61    SVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              R+L+ LE K+EKGI+KIRAKKNELL+AEI+YMQKR E++L N+N YLR KI E ERA  
Sbjct  121   PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKR-EMELQNDNMYLRNKISENERA--  177

Query  467   qqqQMNLMP-GSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQ MN++P  +++ +E  PP  FD+R++LQ +       YS Q    LQL
Sbjct  178   -QQHMNMLPSATATEYEAMPP--FDSRSFLQANLVDPNHHYSHQQRTALQL  225



>gb|AAS67611.1| agamous MADS-box transcription factor 1b [Crocus sativus]
 gb|AHH41529.1| MADS-box transcription factor 1b [Crocus sativus]
Length=228

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 189/231 (82%), Gaps = 7/231 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SVK TIDRYKKAC+D++N+G++SEAN+Q+YQQEA+KL QQI+ LQN NRN MGE L   +
Sbjct  61    SVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
              R+L+ LE K+EKGI+KIRAKKNELL+AEI+YMQKR E++L N+N YLR KI E ERA  
Sbjct  121   PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKR-EMELQNDNMYLRNKISENERA--  177

Query  467   qqqQMNLMP-GSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQ MN++P  +++ +E  PP  FD+R++LQ +       YS Q    LQL
Sbjct  178   -QQHMNMLPSATATEYEAMPP--FDSRSFLQANLVDPNHHYSHQQQTALQL  225



>dbj|BAF34914.1| MADS-box protein [Citrus unshiu]
Length=257

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 197/249 (79%), Gaps = 4/249 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF        S  +K+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  11    MEFPKQNPESSSQSKKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  70

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ATIDRYKKAC+DS+N GSI+EANTQFYQQEA KLR+QI  +
Sbjct  71    LIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREI  130

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   N ++LKNLE+++EKGI ++R+KKNE+L AEI++M+KR EI L N+
Sbjct  131   QNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSKKNEMLLAEIEFMEKR-EIQLQND  189

Query  515   NQYLRAKIIETERAqqqqqQMNLM-PGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQ  339
             N YLRA+I E ERAQQ++Q  ++M  G    +E A  Q +D RN+L ++  +    Y++Q
Sbjct  190   NMYLRARISENERAQQERQSESMMQQGGGHVYEPAASQPYD-RNFLPVNLLEPNHQYARQ  248

Query  338   -DHLPLQLV  315
              D  PLQLV
Sbjct  249   DDQPPLQLV  257



>gb|AAY63868.1| AGAMOUS [Brassica juncea]
Length=252

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/256 (63%), Positives = 197/256 (77%), Gaps = 13/256 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M +Q++   E S QRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLC AEVA
Sbjct  1     MAYQTELGGESSSQRKAGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCYAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEY+NNSVK TI+RYKKA SD++NTGS++E N Q+YQQE+ KLRQQI ++
Sbjct  61    LIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR  MGE +G  + ++L+NLE ++++ +++IR+KKNELLFAEIDYMQKR E+DLHN+
Sbjct  121   QNSNRQLMGETIGSMSPKELRNLEGRLDRSVNRIRSKKNELLFAEIDYMQKR-EVDLHND  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHEL-----APPQQFDARNYLQLDGFQST--  357
             NQ LRAKI E ER       M+LMPG S+Y ++       PQ FD+RNY Q+   Q    
Sbjct  180   NQLLRAKIAENER---NNPSMSLMPGGSNYEQIMPPPQTQPQPFDSRNYFQVAALQPNNH  236

Query  356   --SSYSKQDHLPLQLV  315
               SS  ++D   LQLV
Sbjct  237   HYSSAGREDQTALQLV  252



>gb|AFH74389.1| AGAMOUS-like protein [Magnolia odoratissima]
 gb|AFH74398.1| AGAMOUS-like protein [Magnolia coco]
 gb|AFH74400.1| AGAMOUS-like protein [Magnolia championii]
 gb|AFH74403.1| AGAMOUS-like protein [Magnolia championii]
Length=223

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGILQNANRHLMGEALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLLDSSHHYSHQEQTALQL  222



>gb|ABM69045.1| MADS-box protein MADS7 [Gossypium hirsutum]
Length=234

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 195/248 (79%), Gaps = 15/248 (6%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  +   E S Q+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEF-PNLDPESSSQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ATI+RYKKACSD+T  GS++EAN QFYQQEA KLR+QI ++
Sbjct  60    LIVFSSRGRLYEYANNSVRATIERYKKACSDATTPGSVAEANIQFYQQEATKLRRQIRDV  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L     ++LKNLE ++EKGI +IR+KKNELLFAEI +MQKR E++L N+
Sbjct  120   QNMNRHILGEALSSLTFKELKNLEGRLEKGICRIRSKKNELLFAEIGFMQKR-EVELQND  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQ-STSSYSKQ  339
             N YLRAKI E ERAQQQ  Q  LM  +SSY+          RN+L ++  + S + YS Q
Sbjct  179   NMYLRAKIAENERAQQQSNQ--LMQAASSYN----------RNFLPVNLLEPSNNDYSNQ  226

Query  338   DHLPLQLV  315
             D  PLQLV
Sbjct  227   DQTPLQLV  234



>gb|AFH74369.1| AGAMOUS-like protein [Magnolia duclouxii]
 gb|AFH74383.1| AGAMOUS-like protein [Magnolia insignis]
 gb|AFH74384.1| AGAMOUS-like protein [Magnolia insignis]
 gb|AFH74387.1| AGAMOUS-like protein [Magnolia fordiana]
 gb|AFH74394.1| AGAMOUS-like protein [Magnolia aromatica]
 gb|AFH74395.1| AGAMOUS-like protein [Magnolia insignis]
 gb|AFH74397.1| AGAMOUS-like protein [Magnolia hookeri]
Length=223

 Score =   308 bits (789),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 189/230 (82%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANAQYYQQESSKLRQQIVLLQNANRHLMGEALSAMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLLDSSHHYSHQEQTALQL  222



>gb|AFH74385.1| AGAMOUS-like protein [Magnolia figo]
 gb|AFH74396.1| AGAMOUS-like protein [Magnolia crassipes]
Length=223

 Score =   308 bits (789),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIVLLQNANRHLMGEALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLMDSSHHYSHQEQTALQL  222



>dbj|BAA90743.1| MADS-box protein [Rosa rugosa]
Length=249

 Score =   309 bits (791),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 202/242 (83%), Gaps = 10/242 (4%)
 Frame = -1

Query  1028  EMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGR  849
             E S Q+K+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGR
Sbjct  14    ESSSQKKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGR  73

Query  848   LYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMG  669
             LYEYANNSV+ATI+RYKKAC DS+NTGS++E N QFYQQEA+KLR+QI  +QN NR+ +G
Sbjct  74    LYEYANNSVRATIERYKKAC-DSSNTGSVTETNVQFYQQEASKLRRQIREIQNSNRHILG  132

Query  668   EGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKII  489
             E L   N+++LKNLE ++EKGIS+IR+KKNE+LFAEI+YMQKR EI+L N+N +LRAKI 
Sbjct  133   EALSTLNVKELKNLEGRLEKGISRIRSKKNEMLFAEIEYMQKR-EIELQNHNNFLRAKIA  191

Query  488   ETERAqqqqqQMNLMPGSSSYHE--LAPPQQFDARNYLQLDGFQSTSSYSK--QDHLPLQ  321
             E +RAQQQQ   N+MPG+ S ++  + PPQ +D R++L +   +S   Y++  Q+  PLQ
Sbjct  192   ENDRAQQQQA--NMMPGTLSAYDQSMPPPQSYD-RSFLPVI-LESNHHYNRQGQNQTPLQ  247

Query  320   LV  315
             LV
Sbjct  248   LV  249



>gb|AFH74386.1| AGAMOUS-like protein [Magnolia fulva var. calcicola]
 gb|AGZ63865.1| AGAMOUS-like protein [Magnolia sirindhorniae]
 gb|AGZ63866.1| AGAMOUS-like protein [Magnolia baillonii]
Length=223

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGLLQNANRHLMGEALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLMDSSHHYSHQEQTALQL  222



>emb|CDX98597.1| BnaA03g43820D [Brassica napus]
Length=251

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 193/256 (75%), Gaps = 14/256 (5%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRK-MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  879
             M +Q +   + SPQRK  GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV
Sbjct  1     MAYQMELGGDSSPQRKSAGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEV  60

Query  878   ALIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISN  699
              LIVFSSRGRLYEY+NNSVK TI+RYKKA SD+TNTG+++E N Q+YQQE+ KLRQQI +
Sbjct  61    TLIVFSSRGRLYEYSNNSVKGTIERYKKAISDNTNTGTVAEINGQYYQQESAKLRQQIIS  120

Query  698   LQNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHN  519
             +QN NR  MGE +G  + ++L+NLE ++++ I++IR+KKNELLFAEIDYMQKR E+DLH+
Sbjct  121   IQNSNRQLMGETIGSMSPKELRNLEGRLDRSINRIRSKKNELLFAEIDYMQKR-EVDLHS  179

Query  518   NNQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQ----FDARNYLQLDGFQST--  357
              NQ LRAKI E ER       MNLMPG      + PPQ     FD+RNY Q+   Q    
Sbjct  180   ENQLLRAKIAENER---NNSSMNLMPGGYE-QTMQPPQTQSQPFDSRNYFQVAALQPNNH  235

Query  356   --SSYSKQDHLPLQLV  315
               SS  +QD   LQLV
Sbjct  236   HYSSAGRQDQTALQLV  251



>gb|AFH74370.1| AGAMOUS-like protein [Magnolia grandis]
 gb|AFH74388.1| AGAMOUS-like protein [Magnolia yunnanensis]
Length=223

 Score =   307 bits (787),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TI+RYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI NLQ  NR+ MGE L    
Sbjct  61    SVRNTINRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGNLQTANRHLMGEALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLMDSSHHYSHQEQTALQL  222



>gb|AFH74382.1| AGAMOUS-like protein [Magnolia grandiflora]
Length=223

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGILQNANRHLMGEALSAMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPPPE--YDVMPG--FDSRNFLQVNLMDSSHHYSHQEQTALQL  222



>gb|AFH74390.1| AGAMOUS-like protein [Magnolia delavayi]
Length=223

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             SV+ TIDRYKKAC+DS++ G +SEAN+Q+YQQE++KLRQQI  LQN NR+ MGE L    
Sbjct  61    SVRNTIDRYKKACADSSSLGCVSEANSQYYQQESSKLRQQIGILQNANRHLMGEALSSMT  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             +++LK LE+++EKGIS+IR+KKNELLFAEI+YMQKR E+DL N+N YLRAKI E ERA  
Sbjct  121   VKELKQLENRLEKGISRIRSKKNELLFAEIEYMQKR-EVDLQNDNMYLRAKITENERA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQM ++P     +++ P   FD+RN+LQ++   S+  YS Q+   LQL
Sbjct  178   -QQQMGMLPAPE--YDVMPG--FDSRNFLQVNLLDSSHHYSHQEQTALQL  222



>ref|XP_009612079.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Nicotiana 
tomentosiformis]
Length=249

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 167/253 (66%), Positives = 195/253 (77%), Gaps = 10/253 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             M F +++    + QRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MVFPNEEFESSNSQRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ATIDRYKK  +DST+ GS+SEANTQ+YQQEA KLR+QI ++
Sbjct  61    LIVFSSRGRLYEYANNSVRATIDRYKKHHADSTSQGSVSEANTQYYQQEAAKLRRQIRDI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR  +GE L   + RDLKNLE K+EK I ++R+KKNELLF+EI+ MQKR EIDL N 
Sbjct  121   QTYNRQIVGEALSSLSPRDLKNLEGKLEKAIGRVRSKKNELLFSEIELMQKR-EIDLQNA  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPP----QQF-DARNYLQLDGFQSTSS  351
             N YLRAKI E ERA   QQQMNLMPG S Y++   P    Q + DARN+L ++  +    
Sbjct  180   NMYLRAKIAEVERA---QQQMNLMPGGSEYNQQQQPMTTSQNYNDARNFLPVNLLEPNPH  236

Query  350   YSKQ-DHLPLQLV  315
             YS+  D   LQLV
Sbjct  237   YSRHDDQTALQLV  249



>ref|XP_009762633.1| PREDICTED: floral homeotic protein AGAMOUS isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009762634.1| PREDICTED: floral homeotic protein AGAMOUS isoform X3 [Nicotiana 
sylvestris]
Length=249

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 193/253 (76%), Gaps = 10/253 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF +++    + QRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPNEEFESSNSQRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ATIDRYKK  +DST+ GS+SEANTQ+YQQEA KLR+QI ++
Sbjct  61    LIVFSSRGRLYEYANNSVRATIDRYKKHHADSTSQGSVSEANTQYYQQEAAKLRRQIRDI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR  +GE L   + RDLKNLE K+EK I ++R+KKNELLF+EI+ MQKR EI++ N 
Sbjct  121   QTYNRQIVGEALSSLSPRDLKNLEGKLEKAIGRVRSKKNELLFSEIELMQKR-EIEMQNA  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQF-----DARNYLQLDGFQSTSS  351
             N YLRAKI E ERA   QQQMNLMPG S Y+    P        DARN+L ++  +    
Sbjct  180   NMYLRAKIAEVERA---QQQMNLMPGGSEYNHQQQPMSTSQNYNDARNFLPVNLLEPNHH  236

Query  350   YSKQ-DHLPLQLV  315
             YS+  D   LQLV
Sbjct  237   YSRHDDQTALQLV  249



>emb|CAE46181.1| AGAMOUS-like MADS box transcription factor [Elaeis guineensis]
Length=224

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 188/230 (82%), Gaps = 7/230 (3%)
 Frame = -1

Query  1007  MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  828
             MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI+FSSRGRLYEYANN
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLYEYANN  60

Query  827   SVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGGFN  648
             S KATI+RYKK   D++N+GS+SEA++Q+YQQE+ KLRQQI++LQN NRN MG+ LG  +
Sbjct  61    SXKATIERYKKHVLDTSNSGSVSEADSQYYQQESLKLRQQITSLQNSNRNLMGDSLGSMS  120

Query  647   LRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERAqq  468
             LRDLK LE ++EKGI+KIR KKNELLFAEI+YMQKR E +L N N YLR KI E E A  
Sbjct  121   LRDLKXLEGRLEKGINKIRTKKNELLFAEIEYMQKR-ETELQNANMYLRNKIAENEGA--  177

Query  467   qqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQDHLPLQL  318
              QQQMN++P ++ Y E+ PP  +D+ N+LQ++  QS   YS Q    LQL
Sbjct  178   -QQQMNMLPATTEY-EVMPP--YDSXNFLQVNLMQSNQHYSHQQQTALQL  223



>dbj|BAM71400.1| transcription factor [Pyrus pyrifolia]
Length=242

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 199/248 (80%), Gaps = 7/248 (3%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF  +Q+ E S Q+K+GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEF-PNQAPESSSQKKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  59

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFS+RGRLYEYANNSV+ATIDRYKKACSD TN GS+SEANTQFYQQEA+KLR+QI  +
Sbjct  60    LIVFSNRGRLYEYANNSVRATIDRYKKACSDPTNGGSVSEANTQFYQQEASKLRRQIREI  119

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   N ++LKNLE ++EKGIS+IR+KKNE+LF+EI++MQKR E +L ++
Sbjct  120   QNSNRHILGEALSTLNTKELKNLEGRLEKGISRIRSKKNEMLFSEIEFMQKR-ETELQHH  178

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSS-YSKQ  339
             N +LRAK+ E ER QQQQ  M  MPG +SY +  P   +D RN+L     +S ++ Y  Q
Sbjct  179   NNFLRAKMAENEREQQQQTHM--MPG-TSYDQSMPSHSYD-RNFLPAVILESNNNHYPHQ  234

Query  338   DHLPLQLV  315
                 LQLV
Sbjct  235   VQTALQLV  242



>gb|AAD38119.1| AGAMOUS homolog [Liquidambar styraciflua]
Length=244

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 194/247 (79%), Gaps = 8/247 (3%)
 Frame = -1

Query  1052  EFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL  873
             EF +  S   S Q+KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAE+AL
Sbjct  5     EFPNQSSEGSSSQKKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIAL  64

Query  872   IVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQ  693
             IVFSSRGRLYEYANNSVK+TI+RYKKA SD++N GS+SE N QFYQQE++KLR+QI ++Q
Sbjct  65    IVFSSRGRLYEYANNSVKSTIERYKKA-SDTSNPGSVSETNAQFYQQESSKLRRQIRDIQ  123

Query  692   NQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNN  513
             N NR+ MGE L     R+LKNLE ++EKGIS+IR+KKNELLFAEI+YMQKR EI+L N N
Sbjct  124   NLNRHIMGEALSSLTFRELKNLEGRLEKGISRIRSKKNELLFAEIEYMQKR-EIELQNAN  182

Query  512   QYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTS-SYSKQD  336
              YLRAKI E ER    QQQ  LMPG  S +E  P  Q   R++L  +  +  +  YS+QD
Sbjct  183   MYLRAKIAENER---NQQQTELMPG--SVYETMPSSQPYDRSFLVANLLEPPNHHYSRQD  237

Query  335   HLPLQLV  315
               PLQLV
Sbjct  238   QTPLQLV  244



>ref|XP_003545122.1| PREDICTED: agamous-like MADS-box protein AGL5-like isoform X1 
[Glycine max]
Length=256

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 202/251 (80%), Gaps = 5/251 (2%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF ++   E   Q+K GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPNEAIPEGCSQKKTGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFSSRGRLYEYANNSV+ TIDRYKKAC+ STN  S+SEANTQFYQQEA+KL++QI ++
Sbjct  61    LVVFSSRGRLYEYANNSVRGTIDRYKKACAASTNPESVSEANTQFYQQEASKLKRQIRDI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             QN NR+ +GE L   +L++LKNLES++EKG+S++R++K+E LFA+I++MQKR EI+L N+
Sbjct  121   QNLNRHILGEALSSLSLKELKNLESRLEKGLSRVRSRKHETLFADIEFMQKR-EIELQNH  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQSTSSYSKQD  336
             N +LRAKI E E+AQQ+QQ M  +PG+     + PPQ +D RN+  ++   S + YS QD
Sbjct  180   NNFLRAKIAEHEKAQQRQQDM--IPGNVCESTI-PPQSYD-RNFFPVNLIDSNNQYSNQD  235

Query  335   HLPLQLV**SG  303
                LQLV  SG
Sbjct  236   QTALQLVLSSG  246



>gb|AFK13160.1| shatterproof [Nicotiana benthamiana]
Length=250

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 167/254 (66%), Positives = 196/254 (77%), Gaps = 11/254 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF +++    + QRK GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPNEEFESSNSQRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  60

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             LIVFSSRGRLYEYANNSV+ATIDRYKK  +DST+ GS+SEANTQ+YQQEA KLR+QI ++
Sbjct  61    LIVFSSRGRLYEYANNSVRATIDRYKKHHADSTSQGSVSEANTQYYQQEAAKLRRQIRDI  120

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR  +GE L   + RDLKNLE K+EK I ++R+KKNELLF+EI+ MQKR EI++ N 
Sbjct  121   QTYNRQIVGEALSSLSPRDLKNLEGKLEKAIGRVRSKKNELLFSEIEVMQKR-EIEMQNA  179

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSY--HELAP---PQQF-DARNYLQLDGFQSTS  354
             N YLRAKI E ERA   QQQMNLMPG S Y  H+  P    Q + DARN+L ++  +   
Sbjct  180   NMYLRAKIAEVERA---QQQMNLMPGGSEYSHHQQQPMSTSQNYNDARNFLPVNLLEPNP  236

Query  353   SYSKQ-DHLPLQLV  315
              YS+  D   LQLV
Sbjct  237   HYSRHDDQTALQLV  250



>gb|AAB25101.1| promotes sex organ development [Antirrhinum majus]
 dbj|BAI68391.1| PLENA protein [Antirrhinum majus]
Length=239

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 194/248 (78%), Gaps = 10/248 (4%)
 Frame = -1

Query  1055  MEFQSDQSREMSPQRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA  876
             MEF +  S  +   RK GRGKIEIKRIEN TNRQVTFCKRRNGLLKKAYELSVLCDAEVA
Sbjct  1     MEFPNQDSESL---RKNGRGKIEIKRIENITNRQVTFCKRRNGLLKKAYELSVLCDAEVA  57

Query  875   LIVFSSRGRLYEYANNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNL  696
             L+VFSSRGRLYEYANNSV+ATI+RYKKA +DS+N+ S SEANTQFYQQEANKLR+QI  +
Sbjct  58    LVVFSSRGRLYEYANNSVRATIERYKKASADSSNSVSTSEANTQFYQQEANKLRRQIREI  117

Query  695   QNQNRNYMGEGLGGFNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNN  516
             Q  NR  +GEG+    L+DLK+ E+K+EK IS+IR+KKNELLFAEI++MQKR E++LHN 
Sbjct  118   QTSNRQMLGEGVSNMALKDLKSTEAKVEKAISRIRSKKNELLFAEIEHMQKR-ELELHNA  176

Query  515   NQYLRAKIIETERAqqqqqQMNLMPGSSSYHELAPPQQFDARNYLQLDGFQST-SSYSKQ  339
             N +LRAKI E ERA   QQQMNLMPGS   ++    Q +D RN+L ++  +     YS+ 
Sbjct  177   NMFLRAKIAEGERA---QQQMNLMPGSD--YQPMTSQSYDVRNFLPMNLMEPNQQQYSRH  231

Query  338   DHLPLQLV  315
             D   LQLV
Sbjct  232   DQTALQLV  239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3649860628038