BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79359_g1_i1 len=1399 path=[1:0-1398]

Length=1399
                                                                      Score     E

ref|XP_011021288.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    1e-12   
ref|XP_007139181.1|  hypothetical protein PHAVU_008G008200g           74.3    2e-12   
ref|XP_003552717.1|  PREDICTED: probable non-specific lipid-trans...  73.9    2e-12   
gb|AGC08422.1|  lipid transfer protein                                71.2    2e-11   
gb|AGC08429.1|  lipid transfer protein                                70.9    2e-11   
ref|XP_009589620.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-11   
ref|XP_010461704.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-11   
ref|XP_010500416.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-11   
gb|ACU14682.1|  unknown                                               70.1    3e-11   Glycine max [soybeans]
ref|XP_009346593.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    4e-11   
ref|XP_006365399.1|  PREDICTED: probable non-specific lipid-trans...  70.1    4e-11   
ref|XP_006383409.1|  hypothetical protein POPTR_0005s15210g           69.7    6e-11   
ref|XP_007217198.1|  hypothetical protein PRUPE_ppa013890mg           69.7    6e-11   
ref|XP_009804140.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    7e-11   
ref|XP_004241634.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    9e-11   
ref|XP_010279350.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-10   
emb|CDY51937.1|  BnaAnng11140D                                        68.9    1e-10   
ref|XP_009596861.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-10   
ref|XP_010479305.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-10   
ref|XP_008444080.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-10   
ref|XP_010506694.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-10   
ref|XP_009804692.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-10   
ref|XP_009792617.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-10   
ref|XP_009589151.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-10   
ref|XP_008374782.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-10   
ref|XP_009613979.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-10   
emb|CDX75963.1|  BnaC03g40460D                                        67.8    3e-10   
ref|XP_006406624.1|  hypothetical protein EUTSA_v10021828mg           67.8    3e-10   
ref|XP_010108883.1|  hypothetical protein L484_027077                 67.8    3e-10   
gb|ABK92836.1|  unknown                                               67.8    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_003555069.1|  PREDICTED: probable non-specific lipid-trans...  67.8    3e-10   
ref|NP_001275625.1|  probable non-specific lipid-transfer protein...  67.8    3e-10   
ref|XP_002322068.2|  protease inhibitor/seed storage/lipid transf...  67.8    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006299714.1|  hypothetical protein CARUB_v10015906mg           67.8    3e-10   
gb|AAA33933.1|  lipid transfer protein                                67.4    3e-10   Senecio odorus
ref|XP_010506674.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    4e-10   
ref|XP_007152725.1|  hypothetical protein PHAVU_004G154200g           67.4    4e-10   
ref|XP_009347476.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    4e-10   
ref|XP_009360132.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    4e-10   
ref|XP_010528992.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    4e-10   
ref|XP_004235834.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    4e-10   
ref|XP_010110085.1|  hypothetical protein L484_013260                 67.4    4e-10   
ref|XP_006442592.1|  hypothetical protein CICLE_v10023053mg           67.4    4e-10   
ref|XP_008393327.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    4e-10   
ref|XP_011035101.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    5e-10   
ref|XP_006304814.1|  hypothetical protein CARUB_v10012448mg           67.0    5e-10   
gb|KGN53816.1|  hypothetical protein Csa_4G141240                     67.0    5e-10   
gb|KGN53818.1|  hypothetical protein Csa_4G146250                     67.0    6e-10   
ref|XP_004234577.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    6e-10   
ref|XP_003624386.1|  Non-specific lipid-transfer protein              66.2    8e-10   
ref|NP_001235108.1|  uncharacterized protein LOC100306442 precursor   66.2    8e-10   
emb|CDY40833.1|  BnaC01g31230D                                        66.6    8e-10   
gb|KHN44569.1|  Putative non-specific lipid-transfer protein AKCS9    66.2    9e-10   
gb|KDP32978.1|  hypothetical protein JCGZ_13009                       66.2    9e-10   
ref|XP_006589067.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-09   
gb|KHN41531.1|  Non-specific lipid-transfer protein 2                 66.2    1e-09   
sp|P86809.1|NLTP2_APIGA  RecName: Full=Non-specific lipid-transfe...  65.5    1e-09   
ref|NP_188456.1|  Bifunctional inhibitor/lipid-transfer protein/s...  65.9    1e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24453.1|  BnaC05g35010D                                        65.5    2e-09   
gb|AFP49331.1|  non-specific lipid-transfer protein type 2            65.5    2e-09   
ref|XP_009145909.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-09   
gb|KFK39166.1|  hypothetical protein AALP_AA3G208800                  65.5    2e-09   
emb|CDX92224.1|  BnaA05g21830D                                        65.5    2e-09   
ref|XP_008229267.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-09   
ref|XP_004512892.1|  PREDICTED: probable non-specific lipid-trans...  65.1    2e-09   
gb|ACM78621.1|  non-specific lipid-transfer protein type 2            65.1    2e-09   Tamarix hispida
ref|XP_009145000.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-09   
gb|KFK26688.1|  hypothetical protein AALP_AA8G280300                  64.7    3e-09   
ref|XP_003620406.1|  Non-specific lipid-transfer protein              64.7    3e-09   
ref|XP_006362367.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-09   
emb|CDY52889.1|  BnaC06g27820D                                        64.3    4e-09   
ref|XP_010667862.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-09   
ref|XP_006482207.1|  PREDICTED: probable non-specific lipid-trans...  64.3    5e-09   
gb|KDP35032.1|  hypothetical protein JCGZ_09320                       64.3    5e-09   
ref|XP_002317903.2|  protease inhibitor/seed storage/lipid transf...  63.9    6e-09   Populus trichocarpa [western balsam poplar]
gb|AFK37583.1|  unknown                                               63.9    6e-09   
gb|KDP32977.1|  hypothetical protein JCGZ_13008                       63.9    6e-09   
ref|XP_009107339.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    7e-09   
ref|XP_010062205.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    8e-09   
gb|KHN42434.1|  Putative non-specific lipid-transfer protein AKCS9    63.5    8e-09   
gb|AFK34114.1|  unknown                                               63.5    8e-09   
ref|NP_001236829.1|  uncharacterized protein LOC100500614 precursor   63.5    8e-09   
gb|KEH21557.1|  Nodule Cysteine-Rich (NCR) secreted peptide           63.5    8e-09   
gb|ACI26699.1|  lipid transfer protein                                63.9    9e-09   Gossypium hirsutum [American cotton]
ref|XP_006430725.1|  hypothetical protein CICLE_v10013188mg           63.5    9e-09   
ref|XP_008362493.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    9e-09   
ref|XP_004299573.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    9e-09   
gb|AFK45248.1|  unknown                                               63.5    1e-08   
ref|XP_009781752.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-08   
ref|XP_004492965.1|  PREDICTED: probable non-specific lipid-trans...  63.2    1e-08   
ref|XP_009418385.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-08   
ref|XP_004137484.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-08   
dbj|BAM05643.1|  lipid transfer protein                               63.2    1e-08   
emb|CAH04982.1|  type 2 non-specific lipid transfer protein precu...  62.8    1e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009626576.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-08   
dbj|BAM05641.1|  lipid transfer protein                               62.8    1e-08   
emb|CDY50600.1|  BnaC02g16970D                                        62.8    1e-08   
ref|XP_010062206.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    2e-08   
ref|XP_008229268.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    2e-08   
ref|XP_009135573.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    2e-08   
gb|KFK41090.1|  hypothetical protein AALP_AA2G084400                  62.8    2e-08   
ref|XP_007150889.1|  hypothetical protein PHAVU_004G002700g           62.4    2e-08   
ref|NP_001238401.1|  uncharacterized protein LOC100306409 precursor   62.4    2e-08   
ref|XP_010032280.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-08   
ref|XP_006654745.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-08   
gb|KHN27477.1|  Non-specific lipid-transfer protein 2                 62.4    2e-08   
ref|XP_008240231.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-08   
ref|XP_003524566.1|  PREDICTED: probable non-specific lipid-trans...  62.4    2e-08   
ref|XP_006482397.1|  PREDICTED: probable non-specific lipid-trans...  62.4    2e-08   
ref|XP_007211115.1|  hypothetical protein PRUPE_ppa025024mg           62.4    2e-08   
ref|XP_006367505.1|  PREDICTED: uncharacterized protein LOC102587705  63.5    2e-08   
ref|XP_004232333.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-08   
gb|KDO63208.1|  hypothetical protein CISIN_1g036197mg                 62.4    2e-08   
ref|XP_006430727.1|  hypothetical protein CICLE_v10013181mg           62.4    3e-08   
ref|XP_009127492.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-08   
sp|P82353.1|NLTP2_PRUAR  RecName: Full=Non-specific lipid-transfe...  61.6    3e-08   Prunus armeniaca
ref|XP_006391441.1|  hypothetical protein EUTSA_v10019362mg           62.0    3e-08   
ref|XP_009357787.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-08   
gb|ABK95885.1|  unknown                                               62.0    3e-08   Populus trichocarpa [western balsam poplar]
emb|CDY16462.1|  BnaA08g03050D                                        62.0    3e-08   
ref|XP_006367504.1|  PREDICTED: probable non-specific lipid-trans...  62.0    3e-08   
dbj|BAJ25798.1|  putative non-specific lipid-transfer protein typ...  62.0    3e-08   
ref|XP_008810040.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-08   
ref|XP_009777694.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-08   
gb|EMT00048.1|  Putative non-specific lipid-transfer protein AKCS9    62.0    3e-08   
ref|XP_010044111.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-08   
ref|XP_008460998.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-08   
emb|CDP02752.1|  unnamed protein product                              61.6    3e-08   
emb|CDP02750.1|  unnamed protein product                              61.6    4e-08   
dbj|BAA25680.1|  Lipid transfer protein                               61.6    4e-08   Brassica rapa
ref|XP_007033193.1|  Bifunctional inhibitor/lipid-transfer protei...  62.0    4e-08   
ref|XP_010528502.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-08   
ref|XP_006855792.1|  hypothetical protein AMTR_s00044p00213670        61.6    4e-08   
gb|EMS52280.1|  Non-specific lipid-transfer protein 2G                61.6    4e-08   
gb|EMS64122.1|  Non-specific lipid-transfer protein 2G                61.6    4e-08   
ref|XP_010528993.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-08   
gb|EYU40792.1|  hypothetical protein MIMGU_mgv1a022792mg              61.2    4e-08   
ref|NP_564532.1|  bifunctional inhibitor/lipid-transfer protein/s...  61.6    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036906.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    4e-08   
gb|KEH44195.1|  Lipid transfer protein                                61.2    4e-08   
ref|XP_003633726.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    5e-08   
ref|XP_009357786.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    5e-08   
gb|ACM78623.1|  non-specific lipid-transfer protein type 2            61.2    5e-08   Tamarix hispida
ref|XP_010528501.1|  PREDICTED: probable non-specific lipid-trans...  61.2    5e-08   
gb|KGN63840.1|  hypothetical protein Csa_1G024245                     61.2    5e-08   
ref|XP_008381283.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    5e-08   
emb|CDX77289.1|  BnaC08g03340D                                        61.2    5e-08   
ref|XP_011076327.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-08   
emb|CDM81735.1|  unnamed protein product                              60.8    7e-08   
ref|XP_006430726.1|  hypothetical protein CICLE_v10013191mg           60.8    7e-08   
ref|XP_002887506.1|  protease inhibitor/seed storage/lipid transf...  60.8    8e-08   
ref|XP_004986022.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    8e-08   
ref|XP_007044235.1|  Bifunctional inhibitor/lipid-transfer protei...  60.8    8e-08   
gb|EYU41300.1|  hypothetical protein MIMGU_mgv1a024516mg              60.5    9e-08   
ref|XP_010474155.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    9e-08   
ref|XP_002527025.1|  Nonspecific lipid-transfer protein, putative     60.5    9e-08   Ricinus communis
ref|XP_002887080.1|  hypothetical protein ARALYDRAFT_475781           60.5    1e-07   
ref|XP_010450660.1|  PREDICTED: probable non-specific lipid-trans...  60.1    1e-07   
ref|XP_008782311.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-07   
ref|XP_008453433.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-07   
ref|XP_006390508.1|  hypothetical protein EUTSA_v10019361mg           60.5    1e-07   
ref|XP_010926507.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-07   
ref|XP_010511588.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-07   
gb|EMT25475.1|  Non-specific lipid-transfer protein 2G                59.7    1e-07   
ref|XP_011097163.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-07   
ref|NP_176857.1|  bifunctional inhibitor/lipid-transfer protein/s...  60.1    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ACM78620.1|  non-specific lipid-transfer protein type 2            60.1    1e-07   Tamarix hispida
gb|ACG48207.1|  nonspecific lipid-transfer protein precursor          60.1    1e-07   Zea mays [maize]
ref|XP_006301055.1|  hypothetical protein CARUB_v10021448mg           60.1    1e-07   
emb|CDY48021.1|  BnaA04g26690D                                        59.7    2e-07   
ref|XP_006357827.1|  PREDICTED: probable non-specific lipid-trans...  59.7    2e-07   
ref|XP_010419026.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    2e-07   
ref|XP_008444077.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    2e-07   
ref|XP_008809159.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-07   
ref|XP_003535202.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-07   
emb|CDP02751.1|  unnamed protein product                              59.3    2e-07   
gb|KFK43095.1|  hypothetical protein AALP_AA1G079200                  59.3    2e-07   
ref|XP_006482208.1|  PREDICTED: probable non-specific lipid-trans...  59.3    3e-07   
ref|XP_002870865.1|  hypothetical protein ARALYDRAFT_916549           59.3    3e-07   
ref|XP_008444076.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    3e-07   
ref|XP_009105236.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    3e-07   
sp|Q43681.1|NLTP_VIGUN  RecName: Full=Probable non-specific lipid...  59.3    3e-07   Vigna unguiculata
ref|XP_006282777.1|  hypothetical protein CARUB_v10006242mg           58.9    3e-07   
gb|AAG60123.1|AC073555_7  lipid transfer protein, putative            58.9    3e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDP00664.1|  unnamed protein product                              58.9    3e-07   
gb|AAS79106.1|  probable lipid transfer protein family protein        58.9    3e-07   Tamarix androssowii
ref|NP_849769.1|  bifunctional inhibitor/lipid-transfer protein/s...  58.9    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|EYU41301.1|  hypothetical protein MIMGU_mgv1a021579mg              58.9    3e-07   
gb|KHN25489.1|  Non-specific lipid-transfer protein 2                 58.9    4e-07   
emb|CDY47738.1|  BnaA02g16570D                                        58.9    4e-07   
emb|CDM81734.1|  unnamed protein product                              58.5    4e-07   
ref|XP_009128011.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    4e-07   
gb|AAB47967.1|  nonspecific lipid transfer protein                    58.5    5e-07   Hordeum vulgare [barley]
emb|CDY45874.1|  BnaC02g22460D                                        58.5    5e-07   
ref|XP_004961319.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-07   
ref|XP_006405797.1|  hypothetical protein EUTSA_v10028232mg           58.5    5e-07   
emb|CBI33621.3|  unnamed protein product                              58.2    6e-07   
ref|XP_009599113.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    6e-07   
ref|XP_002284213.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    6e-07   Vitis vinifera
gb|ACM78625.1|  non-specific lipid-transfer protein type 2            57.8    6e-07   Tamarix hispida
ref|XP_009388790.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    6e-07   
ref|XP_008243280.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    6e-07   
ref|XP_007226001.1|  hypothetical protein PRUPE_ppa013833mg           58.2    6e-07   
gb|KGN53813.1|  hypothetical protein Csa_4G141210                     57.8    7e-07   
ref|XP_010317726.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    8e-07   
ref|XP_006362363.1|  PREDICTED: probable non-specific lipid-trans...  57.8    8e-07   
ref|XP_010534224.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    9e-07   
ref|XP_006300368.1|  hypothetical protein CARUB_v10022343mg           57.8    9e-07   
gb|AAC28263.1|  7 kDa lipid transfer protein                          57.4    9e-07   Hordeum vulgare [barley]
emb|CDF66372.1|  lipid transfer protein                               57.4    1e-06   
ref|XP_009113462.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    1e-06   
ref|NP_177519.1|  bifunctional inhibitor/lipid-transfer protein/s...  57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010317751.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    1e-06   
ref|NP_198633.1|  bifunctional inhibitor/lipid-transfer protein/s...  57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KGN53815.1|  hypothetical protein Csa_4G141230                     57.4    1e-06   
ref|XP_006304705.1|  hypothetical protein CARUB_v10011969mg           57.0    1e-06   
gb|KFK33268.1|  hypothetical protein AALP_AA6G352500                  57.0    2e-06   
ref|NP_001056241.1|  Os05g0550300                                     57.0    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006305952.1|  hypothetical protein CARUB_v10011199mg           56.6    2e-06   
ref|XP_011099530.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    2e-06   
ref|XP_002889660.1|  hypothetical protein ARALYDRAFT_887992           56.6    2e-06   
ref|XP_006286025.1|  hypothetical protein CARUB_v10007556mg           56.6    2e-06   
ref|XP_002887008.1|  hypothetical protein ARALYDRAFT_894246           56.6    2e-06   
ref|XP_006855789.1|  hypothetical protein AMTR_s00044p00213430        56.6    2e-06   
emb|CDG03099.1|  LTP (lipid transfer protein)                         56.6    2e-06   
ref|XP_009418081.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    3e-06   
ref|XP_009386356.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    3e-06   
gb|AAT08737.1|  auxin-induced lipid transfer protein                  55.8    3e-06   Hyacinthus orientalis [common hyacinth]
gb|EMS52281.1|  Non-specific lipid-transfer protein 2G                56.2    3e-06   
emb|CDG03100.1|  LTP (lipid transfer protein)                         56.2    3e-06   
ref|XP_010445476.1|  PREDICTED: uncharacterized protein LOC104728145  56.6    4e-06   
emb|CDY60143.1|  BnaA07g39070D                                        55.8    4e-06   
ref|XP_006468752.1|  PREDICTED: probable non-specific lipid-trans...  55.8    4e-06   
ref|XP_006448406.1|  hypothetical protein CICLE_v10017614mg           55.5    4e-06   
ref|XP_009139763.1|  PREDICTED: non-specific lipid-transfer prote...  55.8    4e-06   
gb|AAP37973.1|  seed specific protein Bn15D80B                        55.8    4e-06   Brassica napus [oilseed rape]
gb|EMT28561.1|  Non-specific lipid-transfer protein 2                 55.8    4e-06   
ref|XP_006405794.1|  hypothetical protein EUTSA_v10028094mg           55.8    4e-06   
gb|AAT08689.1|  lipid transfer protein                                55.5    5e-06   Hyacinthus orientalis [common hyacinth]
ref|NP_001078379.1|  protease inhibitor/seed storage/LTP family p...  55.5    5e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ACM78626.1|  non-specific lipid-transfer protein type 2            55.5    5e-06   Tamarix hispida
ref|NP_001150566.1|  nonspecific lipid-transfer protein precursor     55.5    5e-06   Zea mays [maize]
ref|XP_002440195.1|  hypothetical protein SORBIDRAFT_09g027590        55.1    6e-06   Sorghum bicolor [broomcorn]
sp|P82901.1|NLT2P_WHEAT  RecName: Full=Non-specific lipid-transfe...  54.7    6e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010279351.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    7e-06   
ref|XP_002466001.1|  hypothetical protein SORBIDRAFT_01g049830        54.7    8e-06   Sorghum bicolor [broomcorn]
ref|XP_010475550.1|  PREDICTED: probable non-specific lipid-trans...  55.1    8e-06   
gb|EMS52279.1|  Non-specific lipid-transfer protein 2G                54.7    9e-06   
ref|XP_003624381.1|  Non-specific lipid-transfer protein              54.7    9e-06   
ref|NP_973968.1|  bifunctional inhibitor/lipid-transfer protein/s...  54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444081.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    1e-05   
ref|XP_002889661.1|  hypothetical protein ARALYDRAFT_887993           54.3    1e-05   
emb|CDO98409.1|  unnamed protein product                              54.3    1e-05   
ref|XP_010320740.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    1e-05   
gb|EYU41302.1|  hypothetical protein MIMGU_mgv1a019842mg              53.9    1e-05   
emb|CAH69201.1|  type 2 non specific lipid transfer protein precu...  53.9    2e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003558992.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    2e-05   
ref|XP_008339633.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    2e-05   
ref|XP_009613748.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    2e-05   
ref|XP_009357223.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    2e-05   
ref|XP_010665172.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    2e-05   
ref|XP_002528081.1|  lipid binding protein, putative                  53.1    2e-05   Ricinus communis
ref|NP_683375.1|  Bifunctional inhibitor/lipid-transfer protein/s...  53.9    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198632.1|  Bifunctional inhibitor/lipid-transfer protein/s...  53.5    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ68107.1|  lipid transfer-like protein                           53.5    3e-05   Brassica napus [oilseed rape]
ref|XP_010436675.1|  PREDICTED: uncharacterized protein LOC104720475  54.7    3e-05   
ref|XP_008389256.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    3e-05   
ref|XP_008809160.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    3e-05   
ref|XP_010440916.1|  PREDICTED: probable non-specific lipid-trans...  53.5    3e-05   
gb|AAS68185.1|  lipid transfer-like protein                           53.1    3e-05   Brassica napus var. napus [annual rape]
gb|EAY79134.1|  hypothetical protein OsI_34241                        53.1    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006417774.1|  hypothetical protein EUTSA_v10009184mg           53.1    3e-05   
ref|XP_003567950.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    3e-05   
ref|XP_010108881.1|  hypothetical protein L484_027075                 52.8    4e-05   
ref|XP_002458343.1|  hypothetical protein SORBIDRAFT_03g031716        52.8    4e-05   Sorghum bicolor [broomcorn]
ref|XP_010034442.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    4e-05   
emb|CDY01688.1|  BnaC04g30640D                                        53.1    4e-05   
ref|NP_001077480.1|  protease inhibitor/seed storage/LTP family p...  52.8    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528083.1|  Nonspecific lipid-transfer protein, putative     52.8    5e-05   Ricinus communis
pdb|1N89|A  Chain A, Solution Structure Of A Liganded Type 2 Whea...  52.0    5e-05   
ref|NP_001148293.1|  LOC100281901 precursor                           52.8    5e-05   
ref|XP_010450960.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    5e-05   
gb|EMS65828.1|  putative non-specific lipid-transfer protein AKCS9    52.4    5e-05   
ref|XP_004288629.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    6e-05   
gb|EMT06944.1|  Non-specific lipid-transfer protein 2G                52.4    6e-05   
emb|CDY04317.1|  BnaC05g25790D                                        52.4    6e-05   
emb|CDF66370.1|  lipid transfer protein                               52.4    6e-05   
emb|CDG03097.1|  LTP (lipid transfer protein)                         52.4    6e-05   
gb|EMT06945.1|  Non-specific lipid-transfer protein 2G                52.0    6e-05   
ref|XP_006292428.1|  hypothetical protein CARUB_v10018643mg           52.4    7e-05   
ref|XP_006855793.1|  hypothetical protein AMTR_s00044p00214770        52.0    7e-05   
ref|XP_008462815.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    9e-05   
ref|NP_001065008.1|  Os10g0505700                                     51.6    9e-05   
ref|XP_008459140.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    1e-04   
sp|P82900.2|NLT2G_WHEAT  RecName: Full=Non-specific lipid-transfe...  51.6    1e-04   
ref|XP_010450959.1|  PREDICTED: probable non-specific lipid-trans...  51.6    1e-04   
emb|CAH69202.1|  type 2 non specific lipid transfer protein precu...  51.6    1e-04   
gb|KGN53811.1|  hypothetical protein Csa_4G135200                     51.6    1e-04   
ref|XP_008444075.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    1e-04   
ref|NP_001148304.1|  LOC100281913 precursor                           51.2    1e-04   
emb|CAH69205.1|  type 2 non specific lipid transfer protein precu...  51.2    1e-04   
ref|NP_001268090.1|  alcohol dehydrogenase 7                          53.9    2e-04   
gb|EMT30485.1|  Non-specific lipid-transfer protein 2G                50.8    2e-04   
ref|XP_010480382.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    2e-04   
tpg|DAA42889.1|  TPA: nonspecific lipid-transfer protein              50.8    2e-04   
ref|XP_002464407.1|  hypothetical protein SORBIDRAFT_01g017700        50.8    2e-04   
ref|XP_003567951.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    2e-04   
ref|XP_002889663.1|  hypothetical protein ARALYDRAFT_887996           50.8    2e-04   
gb|KGN53817.1|  putative lipid transfer protein family protein        50.8    2e-04   
ref|XP_002875492.1|  hypothetical protein ARALYDRAFT_905202           50.4    2e-04   
ref|XP_010227440.1|  PREDICTED: probable non-specific lipid-trans...  50.4    2e-04   
ref|XP_010232168.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    2e-04   
gb|AGC08430.1|  lipid transfer protein                                50.4    2e-04   
ref|NP_001043932.1|  Os01g0691100                                     50.4    3e-04   
ref|XP_002443686.1|  hypothetical protein SORBIDRAFT_07g000330        50.4    3e-04   
ref|NP_001058516.1|  Os06g0705400                                     50.4    3e-04   
ref|XP_008444079.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    3e-04   
pdb|1L6H|A  Chain A, Solution Structure Of Plant Nsltp2 Purified ...  49.7    3e-04   
gb|EMT19327.1|  Putative non-specific lipid-transfer protein AKCS9    50.1    3e-04   
ref|XP_004234622.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    4e-04   
gb|AAM63788.1|  lipid transfer-like protein                           49.7    4e-04   
ref|XP_002878145.1|  protease inhibitor/seed storage/lipid transf...  49.7    5e-04   
ref|NP_191290.1|  bifunctional inhibitor/lipid-transfer protein/s...  49.3    6e-04   
emb|CDM83892.1|  unnamed protein product                              49.3    6e-04   
ref|XP_009148019.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    6e-04   
ref|XP_002464408.1|  hypothetical protein SORBIDRAFT_01g017710        49.3    6e-04   
dbj|BAJ86749.1|  predicted protein                                    48.9    8e-04   
ref|XP_007216172.1|  hypothetical protein PRUPE_ppa015726mg           49.3    8e-04   
gb|EAY75443.1|  hypothetical protein OsI_03343                        50.4    8e-04   
sp|A2XBN5.2|NLTPX_ORYSI  RecName: Full=Non-specific lipid-transfe...  48.9    0.001   
gb|EAY88245.1|  hypothetical protein OsI_09696                        48.9    0.001   
gb|AAC50030.1|  lipid transfer protein                                48.9    0.001   
ref|XP_006292917.1|  hypothetical protein CARUB_v10019183mg           48.5    0.001   



>ref|XP_011021288.1| PREDICTED: non-specific lipid-transfer protein 2 [Populus euphratica]
Length=94

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  182  KMKAFNLMIvavllvvlaeaQFSSA-ACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPC  358
            KM +F ++++ V  ++LAEAQ S A  C+ +QL+PCL A TS +PPS  CC +L EQKPC
Sbjct  2    KMASFFMIVMVVTTMLLAEAQVSQAETCNPEQLSPCLGAITSSTPPSTTCCSKLKEQKPC  61

Query  359  FCQYLKNPSLKQYL  400
             C YLK+PSLKQY+
Sbjct  62   LCGYLKDPSLKQYV  75



>ref|XP_007139181.1| hypothetical protein PHAVU_008G008200g [Phaseolus vulgaris]
 gb|ESW11175.1| hypothetical protein PHAVU_008G008200g [Phaseolus vulgaris]
Length=98

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C   QLTPCLSA T GS PSQ CCQ+L EQKPC C Y+ NP+LKQY+
Sbjct  30   AATCSPTQLTPCLSAITGGSAPSQACCQKLKEQKPCLCSYINNPALKQYV  79



>ref|XP_003552717.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Glycine max]
 gb|KHN17291.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
 gb|KHN33030.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=95

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C+  QLTPCL A  SGS PS  CCQ+L EQKPCFC YLKNPSLKQY+
Sbjct  26   AAVTCNPTQLTPCLPAINSGSAPSSACCQKLKEQKPCFCGYLKNPSLKQYV  76



>gb|AGC08422.1| lipid transfer protein [Gossypium hirsutum]
Length=96

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  CD+ +L+PCL+A TS  PPS  CC +L EQKPCFCQYL+NP+ KQ++
Sbjct  28   AVTCDLXELSPCLAAITSSKPPSSTCCSKLTEQKPCFCQYLRNPTXKQFV  77



>gb|AGC08429.1| lipid transfer protein [Gossypium hirsutum]
Length=96

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  +L+PCLSAFTS SPPS  CC +L  QKPC C Y+KNPSLKQY+
Sbjct  28   AVTCNPTELSPCLSAFTSSSPPSAACCSKLKAQKPCLCGYIKNPSLKQYV  77



>ref|XP_009589620.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=93

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PCL A TS SPPS LCC ++ EQKPC CQYLKNP+L+ Y+
Sbjct  25   AVTCSAIQLSPCLGAITSNSPPSGLCCSKIREQKPCLCQYLKNPNLRNYV  74



>ref|XP_010461704.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=97

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +LTPC +A TS SPPSQ CC +L EQKPC C YL+NPSL+QY+
Sbjct  32   CSPMELTPCAAAMTSSSPPSQACCAKLREQKPCLCGYLRNPSLRQYI  78



>ref|XP_010500416.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=97

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +LTPC +A TS SPPSQ CC +L EQKPC C YL+NPSL+QY+
Sbjct  32   CSPMELTPCAAAMTSSSPPSQACCAKLREQKPCLCGYLRNPSLRQYI  78



>gb|ACU14682.1| unknown [Glycine max]
Length=85

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C+  QLTP L A  SGS PS  CCQ+L EQKPCFC YLKNPSLKQY+
Sbjct  26   AAVTCNPTQLTPRLPAINSGSAPSSACCQKLKEQKPCFCGYLKNPSLKQYV  76



>ref|XP_009346593.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  191  AFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQY  370
            AF LM+  V+ +        +  C   +L+PCL A  SG+PPS  CC++L EQ+PCFC+Y
Sbjct  9    AFCLMVAMVVALCDEARTVEAVTCSPLELSPCLEAIRSGAPPSATCCEKLKEQQPCFCEY  68

Query  371  LKNPSLKQYL  400
            +KNP LK Y+
Sbjct  69   IKNPVLKPYI  78



>ref|XP_006365399.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=94

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C   QL+PCL A  S SPPS+LCC ++ +QKPC CQYLKNP+LK+Y+
Sbjct  26   AATCSPVQLSPCLGAIRSSSPPSKLCCSKIKQQKPCLCQYLKNPTLKKYV  75



>ref|XP_006383409.1| hypothetical protein POPTR_0005s15210g [Populus trichocarpa]
 gb|ERP61206.1| hypothetical protein POPTR_0005s15210g [Populus trichocarpa]
Length=94

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  182  KMKAFNLMIvavllvvlaeaQFSSA-ACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPC  358
            KM +F ++++ V  ++LAEAQ S A  C+  QL+PCL A  S +PPS  CC +L EQKPC
Sbjct  2    KMASFFMIVMVVATMLLAEAQVSQAQTCNPGQLSPCLGAIMSSTPPSTTCCSKLKEQKPC  61

Query  359  FCQYLKNPSLKQYL  400
             C YLK+PSLKQ++
Sbjct  62   LCGYLKDPSLKQFV  75



>ref|XP_007217198.1| hypothetical protein PRUPE_ppa013890mg [Prunus persica]
 gb|EMJ18397.1| hypothetical protein PRUPE_ppa013890mg [Prunus persica]
Length=98

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +2

Query  161  ITYSNIPKMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRL  340
            ++YS +    A  ++++  +++        +  C   QL+PCL    SGSPPS  CCQ+L
Sbjct  4    LSYSGV----ALCVVVMVAVMLSEEARMAEAVTCSPVQLSPCLGPINSGSPPSTTCCQKL  59

Query  341  NEQKPCFCQYLKNPSLKQYL  400
             EQ+PC C YLKNPSL+QY+
Sbjct  60   REQRPCLCGYLKNPSLRQYV  79



>ref|XP_009804140.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=93

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PCL A TS SPPS LCC ++ EQKPC CQYLKNP+L+ Y+
Sbjct  25   AVTCSAIQLSPCLGAITSKSPPSILCCSKIREQKPCLCQYLKNPNLRNYV  74



>ref|XP_004241634.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=94

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C   QL+PCL A  S SPPS+LCC ++ +QKPC CQYLKNP+LK+Y+
Sbjct  26   AATCSPVQLSPCLGAIRSSSPPSKLCCTKIKQQKPCLCQYLKNPTLKKYV  75



>ref|XP_010279350.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nelumbo 
nucifera]
Length=93

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            S  C+  QL+PC +A  + SPPS+LCC +L EQ+PCFCQYL++PSL QY+
Sbjct  25   SVTCNFSQLSPCSNALVNNSPPSKLCCDKLREQRPCFCQYLRDPSLGQYV  74



>emb|CDY51937.1| BnaAnng11140D [Brassica napus]
Length=96

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 8/79 (10%)
 Frame = +2

Query  164  TYSNIPKMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLN  343
            T+ +I  + AF L+++             +  C   QL+PC +A TS SPPS LCC +L 
Sbjct  7    TWVSILALAAFLLVVLVPAA--------EAVTCSPMQLSPCAAAITSSSPPSALCCAKLK  58

Query  344  EQKPCFCQYLKNPSLKQYL  400
            EQKPC C Y++NPSL++Y+
Sbjct  59   EQKPCICGYMRNPSLRRYI  77



>ref|XP_009596861.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=97

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +   CDV++L+PC  AFTS  PP+  CC +LNEQKPC C+Y+K+P+L+ Y+
Sbjct  28   AKVKCDVKELSPCAPAFTSSQPPTAKCCDKLNEQKPCLCKYVKDPNLRPYV  78



>ref|XP_010479305.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=97

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +L PC +A TS SPPSQ CC +L EQKPC C YL+NPSL+QY+
Sbjct  32   CSPMELAPCAAAMTSSSPPSQACCAKLREQKPCLCGYLRNPSLRQYI  78



>ref|XP_008444080.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=96

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  182  KMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            +  + +L++VA++ ++       +  C+  QL+PC+ A TS +PPS  CC +L EQ+PCF
Sbjct  5    RFTSLHLLVVAIVALLTGARVAEAVTCNTMQLSPCIGAITSTAPPSTTCCSKLREQQPCF  64

Query  362  CQYLKNPSLKQYL  400
            C Y+KNPSL  Y+
Sbjct  65   CGYMKNPSLGGYV  77



>ref|XP_010506694.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=96

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            S  C   QL+PC +A TS SPPS LCC RL EQKPC C Y++NPSL++++
Sbjct  28   SVTCSPMQLSPCAAAITSSSPPSALCCARLKEQKPCLCGYMRNPSLRRFV  77



>ref|XP_009804692.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=94

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   QL+PCL A TSG+PPSQ CC RL  Q+PC C Y+++P+L+QY+
Sbjct  29   CSATQLSPCLGAITSGTPPSQACCARLRAQQPCLCGYMRDPNLRQYV  75



>ref|XP_009792617.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=93

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C   QL+PCL A  S +PPS+LCC ++ +QKPC CQYLKNP+LK+Y+
Sbjct  25   AATCSPVQLSPCLGAIRSSTPPSKLCCSKIKQQKPCLCQYLKNPNLKKYV  74



>ref|XP_009589151.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=93

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C   QL+PCL A  S +PPS+LCC ++ +QKPC CQYLKNP+LK+Y+
Sbjct  25   AATCSPVQLSPCLGAIRSSTPPSKLCCSKIKQQKPCLCQYLKNPNLKKYV  74



>ref|XP_008374782.1| PREDICTED: non-specific lipid-transfer protein 2 [Malus domestica]
Length=98

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C+  QL+PC  A TS +PPS+LCC ++ EQKPC CQYLKNP+LK+ +
Sbjct  29   TAVTCNAIQLSPCAGAITSSTPPSKLCCSKIKEQKPCLCQYLKNPNLKKLV  79



>ref|XP_009613979.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=94

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   QL+PCL A TSG+PPSQ CC RL  Q+PC C Y+++P+L+QY+
Sbjct  29   CSATQLSPCLGAITSGTPPSQACCARLRGQQPCLCGYMRDPNLRQYV  75



>emb|CDX75963.1| BnaC03g40460D [Brassica napus]
Length=96

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   QL+PC +A TS SPPS LCC +L EQKPC C Y++NPSL++Y+
Sbjct  31   CSPMQLSPCAAAITSSSPPSALCCAKLKEQKPCICGYMRNPSLRRYI  77



>ref|XP_006406624.1| hypothetical protein EUTSA_v10021828mg [Eutrema salsugineum]
 gb|ESQ48077.1| hypothetical protein EUTSA_v10021828mg [Eutrema salsugineum]
Length=97

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC SA TS SPPS LCC +L EQKPC C Y++NPSL++++
Sbjct  29   AVTCSPMQLSPCASAITSSSPPSALCCAKLKEQKPCLCGYMRNPSLRRFV  78



>ref|XP_010108883.1| hypothetical protein L484_027077 [Morus notabilis]
 gb|EXC20523.1| hypothetical protein L484_027077 [Morus notabilis]
Length=98

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C    L+PCLSA T G+ PS +CC RL EQ+PC C YLK+P+L+QY+
Sbjct  29   AATCSAVALSPCLSAITGGTAPSSVCCSRLREQRPCLCGYLKDPNLRQYV  78



>gb|ABK92836.1| unknown [Populus trichocarpa]
Length=93

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  242  QFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            + S+  C   QL+ C+SA TS +PPS+LCC ++ EQKPC CQYLKNP+L++++
Sbjct  22   KVSAVTCSPAQLSSCVSAITSSTPPSKLCCSKIKEQKPCLCQYLKNPNLQKFI  74



>ref|XP_003555069.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Glycine max]
 gb|KHN19692.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=97

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +2

Query  182  KMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            K+  F ++++A L +V       +  C   +L+PCL A TS SPPS  CCQ++ EQ+PC 
Sbjct  6    KVCGFAIVVMAALFLVEMSPMAEAVTCSPVELSPCLGAITSSSPPSTTCCQKVREQRPCL  65

Query  362  CQYLKNPSLKQYL  400
            C YLKNPSL+ Y+
Sbjct  66   CGYLKNPSLRPYV  78



>ref|NP_001275625.1| probable non-specific lipid-transfer protein AKCS9-like precursor 
[Solanum tuberosum]
 dbj|BAC23052.1| putative lipid transfer protein [Solanum tuberosum]
Length=93

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PCL A TS S PS LCC R+ EQKPC C YLKNP+L+ Y+
Sbjct  25   AVTCSAIQLSPCLGAITSNSAPSTLCCSRIREQKPCLCTYLKNPTLRNYV  74



>ref|XP_002322068.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|EEF06195.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=93

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  242  QFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            + S+  C   QL+ C+SA TS +PPS+LCC ++ EQKPC CQYLKNP+L++++
Sbjct  22   KVSAVTCSPAQLSSCVSAITSSTPPSKLCCSKIKEQKPCLCQYLKNPNLQKFI  74



>ref|XP_006299714.1| hypothetical protein CARUB_v10015906mg [Capsella rubella]
 gb|EOA32612.1| hypothetical protein CARUB_v10015906mg [Capsella rubella]
Length=97

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC SA TS SPPS LCC++L EQKPC C Y++NPSL++++
Sbjct  29   AVTCSPMQLSPCASAITSSSPPSALCCKKLKEQKPCLCGYMRNPSLRRFV  78



>gb|AAA33933.1| lipid transfer protein, partial [Senecio odorus]
Length=89

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++A C V +L PC SAFTS + P+  CC +L EQ PC C YLKNP+LKQY+
Sbjct  20   TAATCSVTELMPCSSAFTSSAAPTAQCCTKLKEQSPCLCGYLKNPTLKQYI  70



>ref|XP_010506674.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
 ref|XP_010497756.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=96

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   QL+PC +A TS SPPS LCC RL EQKPC C Y++NPSL++++
Sbjct  31   CSPMQLSPCAAAITSSSPPSALCCARLKEQKPCLCGYMRNPSLRRFV  77



>ref|XP_007152725.1| hypothetical protein PHAVU_004G154200g [Phaseolus vulgaris]
 gb|ESW24719.1| hypothetical protein PHAVU_004G154200g [Phaseolus vulgaris]
Length=92

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +2

Query  185  MKAFNLMIvavllvvlaeaQFSSAA-CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            MKA ++ +  ++++++AE Q S A  C   QL+ C+SA TS +PPS LCC ++ EQKPC 
Sbjct  1    MKAAHIALCTLVVLLVAEVQVSMAVTCSPVQLSSCVSAITSSTPPSNLCCSKIKEQKPCL  60

Query  362  CQYLKNPSLKQYL  400
            C+YLKNP+LK+++
Sbjct  61   CKYLKNPNLKKFV  73



>ref|XP_009347476.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=98

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  QL+PC  A TS +PPS+LCC ++ EQKPC CQYLKNP+LK+ +
Sbjct  30   AVTCNAIQLSPCAGAITSSTPPSKLCCSKIKEQKPCLCQYLKNPNLKKLV  79



>ref|XP_009360132.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C+  QL+PC  A TS +PPS LCC ++ EQKPC CQYLKNP+LK+ +
Sbjct  28   TAVTCNAIQLSPCAGAITSSTPPSTLCCSKIKEQKPCLCQYLKNPNLKKLV  78



>ref|XP_010528992.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=92

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             + AAC V +LTPCL+A T+G  PS  CC +L EQ+PC C Y KNP+  QY+
Sbjct  22   LTEAACVVTELTPCLTAITTGGKPSAACCSKLKEQQPCLCGYAKNPAFSQYV  73



>ref|XP_004235834.1| PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Length=93

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PCLSA TS S PS+LCC R+ +QKPC C YLKNP+L+ Y+
Sbjct  25   AVTCSAIQLSPCLSAITSKSAPSKLCCSRIRQQKPCLCTYLKNPTLRNYV  74



>ref|XP_010110085.1| hypothetical protein L484_013260 [Morus notabilis]
 gb|EXC25172.1| hypothetical protein L484_013260 [Morus notabilis]
Length=94

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+ C+SA T+ SPP+QLCC ++ EQKPC CQYLKNP+LK+++
Sbjct  26   AVTCSPVQLSACVSAITTSSPPTQLCCTKIKEQKPCLCQYLKNPNLKKFV  75



>ref|XP_006442592.1| hypothetical protein CICLE_v10023053mg [Citrus clementina]
 ref|XP_006477780.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
 gb|ESR55832.1| hypothetical protein CICLE_v10023053mg [Citrus clementina]
 gb|KDO49801.1| hypothetical protein CISIN_1g034465mg [Citrus sinensis]
Length=94

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+ C+SA TS +PPS+LCC ++ EQKPC CQYL+NPSL++++
Sbjct  26   AVTCSPTQLSSCVSAITSSTPPSRLCCSKIKEQKPCLCQYLRNPSLRKFI  75



>ref|XP_008393327.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=97

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C+  QL+PC  A TS +PPS LCC ++ EQKPC CQYLKNP+LK+ +
Sbjct  28   TAVTCNAIQLSPCAGAITSSTPPSTLCCSKIKEQKPCLCQYLKNPNLKKLV  78



>ref|XP_011035101.1| PREDICTED: non-specific lipid-transfer protein 2-like [Populus 
euphratica]
Length=94

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  QL+PCL A TS SPPS  CC +L EQKPC C YLK+PSLKQ++
Sbjct  26   AVTCNPGQLSPCLPAITSSSPPSTACCSKLKEQKPCLCGYLKDPSLKQFV  75



>ref|XP_006304814.1| hypothetical protein CARUB_v10012448mg [Capsella rubella]
 gb|EOA37712.1| hypothetical protein CARUB_v10012448mg [Capsella rubella]
Length=95

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
               C V +L PC  A+TS SPPS+ CC +L EQ PCFC YL+NPSL+ Y+
Sbjct  27   GVTCTVSELFPCAPAYTSSSPPSRTCCTKLREQTPCFCGYLRNPSLRGYI  76



>gb|KGN53816.1| hypothetical protein Csa_4G141240 [Cucumis sativus]
Length=96

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+   L+PC+ A TS +PPS  CC +L EQ+PCFCQY+KNPSL  Y+
Sbjct  31   CNTMGLSPCIGAMTSTAPPSTTCCSKLREQQPCFCQYMKNPSLGGYV  77



>gb|KGN53818.1| hypothetical protein Csa_4G146250 [Cucumis sativus]
Length=96

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+   L+PC+ A TS +PPS  CC +L EQ+PCFCQY+KNPSL  Y+
Sbjct  31   CNTMGLSPCIGAMTSTAPPSTTCCSKLREQQPCFCQYMKNPSLGGYV  77



>ref|XP_004234577.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=92

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C V +L PC +A  S  PPS+ CC +L EQKPC C YLKNPSLKQY+
Sbjct  24   AVTCSVTELVPCAAAILSSQPPSKECCNKLKEQKPCLCGYLKNPSLKQYV  73



>ref|XP_003624386.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES80604.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK45216.1| unknown [Medicago truncatula]
Length=94

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  182  KMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            KMK    +++ V+L+V       +A C   +L+PCL A TS +PPS  CC +L EQ+PC 
Sbjct  3    KMKVVCALMIMVVLIVEVATIAEAANCSPIELSPCLGAITSNAPPSTNCCSKLREQRPCL  62

Query  362  CQYLKNPSLKQYL  400
            C Y+KNP+L+QY+
Sbjct  63   CGYIKNPNLRQYV  75



>ref|NP_001235108.1| uncharacterized protein LOC100306442 precursor [Glycine max]
 gb|ACU14623.1| unknown [Glycine max]
 gb|KHN23756.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=93

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+ C+SA TS +PPS LCC ++ EQKPC CQYLKNP+LK+++
Sbjct  25   AVTCSPVQLSACVSAITSSTPPSNLCCSKIKEQKPCLCQYLKNPNLKKFV  74



>emb|CDY40833.1| BnaC01g31230D [Brassica napus]
 emb|CDY32103.1| BnaC04g44630D [Brassica napus]
Length=97

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C V +L+PCL+AF S S PS  CC +L EQKPC C Y++NPSL+QY+
Sbjct  32   CSVTELSPCLAAFMSSSQPSASCCAKLREQKPCLCGYMRNPSLRQYV  78



>gb|KHN44569.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=93

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+ C+SA TS +PPS LCC ++ EQKPC CQYLKNP+LK+++
Sbjct  25   AVTCSPVQLSACVSAITSSTPPSNLCCSKIKEQKPCLCQYLKNPNLKKFV  74



>gb|KDP32978.1| hypothetical protein JCGZ_13009 [Jatropha curcas]
Length=99

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +2

Query  242  QFSSAA-CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +FS+A  C   QL+PCL A  S SPPS  CC +L EQ+PCFC Y+KNPSL+QY+
Sbjct  27   RFSNAVNCSPAQLSPCLPAIKSSSPPSNDCCVKLREQRPCFCGYVKNPSLRQYV  80



>ref|XP_006589067.1| PREDICTED: non-specific lipid-transfer protein 2-like [Glycine 
max]
Length=100

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+PCL A TS SPPS  CCQ++ EQ+PC C YL+NPSL+QY+
Sbjct  32   AVTCSPVELSPCLGAITSSSPPSTTCCQKVREQRPCLCGYLQNPSLRQYV  81



>gb|KHN41531.1| Non-specific lipid-transfer protein 2 [Glycine soja]
Length=98

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+PCL A TS SPPS  CCQ++ EQ+PC C YL+NPSL+QY+
Sbjct  30   AVTCSPVELSPCLGAITSSSPPSTTCCQKVREQRPCLCGYLQNPSLRQYV  79



>sp|P86809.1|NLTP2_APIGA RecName: Full=Non-specific lipid-transfer protein 2; AltName: 
Full=Allergen Api g 6.0101; AltName: Allergen=Api g 6 [Apium 
graveolens Rapaceum Group]
Length=67

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            A C   QL+PCL+A T  +PPS  CC +L EQKPC C YLK+P+LK Y+
Sbjct  1    ATCSAVQLSPCLAAITKNTPPSAACCNKLKEQKPCLCGYLKDPNLKNYV  49



>ref|NP_188456.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 dbj|BAB01177.1| lipid transfer protein [Arabidopsis thaliana]
 gb|AAK64007.1| AT3g18280/MIE15_7 [Arabidopsis thaliana]
 gb|AAL76158.1| AT3g18280/MIE15_7 [Arabidopsis thaliana]
 gb|AEE76075.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=96

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC +A TS SPPS LCC +L EQ+PC C Y++NPSL++++
Sbjct  28   AVTCSPMQLSPCATAITSSSPPSALCCAKLKEQRPCLCGYMRNPSLRRFV  77



>emb|CDY24453.1| BnaC05g35010D [Brassica napus]
Length=96

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC  A TS SPPS LCC +L EQKPC C Y++NPSL++++
Sbjct  28   AVTCSPMQLSPCAQAITSSSPPSALCCAKLKEQKPCLCGYMRNPSLRRFV  77



>gb|AFP49331.1| non-specific lipid-transfer protein type 2, partial [Olea europaea]
Length=82

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  QL+PCL A TSG PPS  CC++L EQKPC C Y+K+P+L +Y+
Sbjct  14   AVTCNPLQLSPCLGAITSGQPPSAACCKKLQEQKPCLCGYIKDPNLGKYV  63



>ref|XP_009145909.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=96

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC  A TS SPPS LCC +L EQKPC C Y++NPSL++++
Sbjct  28   AVTCSPMQLSPCAQAITSSSPPSALCCAKLKEQKPCLCGYMRNPSLRRFV  77



>gb|KFK39166.1| hypothetical protein AALP_AA3G208800 [Arabis alpina]
Length=95

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   QL+PC +A TS SPPS LCC +L EQKPC C Y++NPSL++++
Sbjct  30   CSPMQLSPCAAAITSSSPPSALCCAKLKEQKPCLCGYMRNPSLRRFV  76



>emb|CDX92224.1| BnaA05g21830D [Brassica napus]
Length=96

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC  A TS SPPS LCC +L EQKPC C Y++NPSL++++
Sbjct  28   AVTCSPMQLSPCAQAITSSSPPSALCCAKLKEQKPCLCGYMRNPSLRRFV  77



>ref|XP_008229267.1| PREDICTED: non-specific lipid-transfer protein 2 [Prunus mume]
Length=98

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 4/80 (5%)
 Frame = +2

Query  161  ITYSNIPKMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRL  340
            ++YS +    A  ++++  +++        +  C   QL+PCL    SG+ PS  CCQ+L
Sbjct  4    LSYSGV----ALCVVVMVAVMLSEEARMAEAVTCSPVQLSPCLGPINSGARPSTTCCQKL  59

Query  341  NEQKPCFCQYLKNPSLKQYL  400
             EQ+PC C YLKNPSL+QY+
Sbjct  60   REQRPCLCGYLKNPSLRQYV  79



>ref|XP_004512892.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Cicer arietinum]
Length=92

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  185  MKAFNLMIvavllvvlaeaQFSSAA-CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            MKA  + I   L+++L E Q S A  C   QL+ C+SA TS +PPS LCC ++ EQ+PC 
Sbjct  1    MKASQIAICTFLMLLLIEVQVSMAVTCSPLQLSSCVSAITSSTPPSNLCCSKIKEQRPCL  60

Query  362  CQYLKNPSLKQYL  400
            CQYLKNP+L++++
Sbjct  61   CQYLKNPNLRKFV  73



>gb|ACM78621.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=92

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  185  MKAFNLMIvavllvvlaeaQFSSAA-CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            MKA    + AV++++L++ Q S+A  C   QL+PC+ A TS SPPS LCC ++ +QKPC 
Sbjct  1    MKASYAAVFAVVMLLLSQTQVSTAVTCSPAQLSPCVGAITSSSPPSGLCCSKVRQQKPCL  60

Query  362  CQYLKNPSLKQYL  400
            CQY+KNP L++++
Sbjct  61   CQYMKNPYLRKFV  73



>ref|XP_009145000.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
 emb|CDY68337.1| BnaAnng26930D [Brassica napus]
Length=97

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C V +L+PCL+AF S S PS  CC +L EQKPC C Y++NP L+QY+
Sbjct  32   CSVTELSPCLAAFMSSSQPSASCCAKLREQKPCLCGYMRNPGLRQYV  78



>gb|KFK26688.1| hypothetical protein AALP_AA8G280300 [Arabis alpina]
Length=97

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
                 C    L PC +A TS SPPS  CC RL EQ+PC C Y++NPSL+QY+
Sbjct  27   VEGVTCSPMALAPCAAAMTSSSPPSATCCTRLREQQPCLCGYMRNPSLRQYV  78



>ref|XP_003620406.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|ACJ85882.1| unknown [Medicago truncatula]
 gb|AES76624.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=92

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  185  MKAFNLMIvavllvvlaeaQFSSAA-CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            MKA  + I   L+++L   Q S A  C   QL+ C+SA TS +PPS LCC ++ EQ+PC 
Sbjct  1    MKASQIAICTFLVLLLINVQVSMAVTCSPVQLSSCVSAITSSTPPSNLCCSKIKEQRPCL  60

Query  362  CQYLKNPSLKQYL  400
            CQY+KNP+L++++
Sbjct  61   CQYMKNPNLRKFV  73



>ref|XP_006362367.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=92

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C V +L PC  A  S  PPS  CC +L EQKPC C YLKNPSLKQY+
Sbjct  24   AVTCSVTELFPCAGAIMSSQPPSSACCIKLREQKPCLCGYLKNPSLKQYV  73



>emb|CDY52889.1| BnaC06g27820D [Brassica napus]
Length=96

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             AACD +QL PCL+A T G  PS  CC +L EQ+PC C + KNP+  QY+
Sbjct  28   GAACDAKQLQPCLAAITGGGQPSGDCCAKLKEQQPCLCGFAKNPAFAQYI  77



>ref|XP_010667862.1| PREDICTED: non-specific lipid-transfer protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=96

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  257  ACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +C   QL+PC+SA TS SPP+ +CC ++ EQ+PC CQY+KNP LK+++
Sbjct  30   SCSPVQLSPCVSAITSSSPPTAICCTKIKEQRPCLCQYMKNPYLKKFV  77



>ref|XP_006482207.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=100

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C+  +L+PCL+A TS +PPS  CC +L +Q+PC C YL++P+LKQY+
Sbjct  32   AATCNPTELSPCLAALTSSAPPSGPCCNKLRQQRPCLCGYLRDPNLKQYV  81



>gb|KDP35032.1| hypothetical protein JCGZ_09320 [Jatropha curcas]
Length=94

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  +LTPC  A TS SPPS +CC +L EQKPC CQYLKNP L++ +
Sbjct  25   AVTCNPVELTPCAKAITSSSPPSTICCSKLKEQKPCLCQYLKNPYLQKLV  74



>ref|XP_002317903.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|ABK92986.1| unknown [Populus trichocarpa]
 gb|EEE96123.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=93

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  242  QFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  +  C   QL+ C+SA TS +PP+ LCC ++ EQKPC CQYLKNP L++++
Sbjct  22   KVDAVTCSPAQLSSCVSAITSSTPPTNLCCSKIKEQKPCLCQYLKNPKLQKFI  74



>gb|AFK37583.1| unknown [Lotus japonicus]
Length=93

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             ++  C   QL+ C+SA TS +PP+ LCC ++ EQKPC CQYLKNP L++++
Sbjct  23   MATVTCSPVQLSSCVSAITSSTPPTNLCCSKIKEQKPCLCQYLKNPYLRKFV  74



>gb|KDP32977.1| hypothetical protein JCGZ_13008 [Jatropha curcas]
Length=96

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C    L+PCL A  S SPPS  CC +L EQKPC C YLKNPSLKQY+
Sbjct  27   NAVTCSPLALSPCLPAINSSSPPSNDCCVKLREQKPCLCGYLKNPSLKQYV  77



>ref|XP_009107339.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=97

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +LT C SAF S SPPS  CC +L EQKPC C YL+NP+L QY+
Sbjct  32   CSPTELTSCSSAFMSASPPSATCCAKLREQKPCLCGYLRNPALSQYV  78



>ref|XP_010062205.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW69297.1| hypothetical protein EUGRSUZ_F02788 [Eucalyptus grandis]
Length=103

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +L+ C+SA TS +PPS LCC +L EQ+PC C Y++NP+L+QY+
Sbjct  38   CSATELSSCVSAITSSAPPSALCCSKLREQRPCLCGYIRNPNLRQYV  84



>gb|KHN42434.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=95

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             ++  C+  QL+ C SA TS +PPS LCC +L EQ+PC CQYLK+P+LK+ +
Sbjct  25   MAAVTCNALQLSACASAITSSTPPSALCCSKLKEQRPCLCQYLKDPNLKKLV  76



>gb|AFK34114.1| unknown [Medicago truncatula]
Length=92

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +2

Query  185  MKAFNLMIvavllvvlaeaQFSSAA-CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            MKA  + I   L+++L   Q S A  C   QL+ C+SA TS +PPS LCC ++ EQ+PC 
Sbjct  1    MKASQIAICTFLVLLLINVQVSMAVTCSPVQLSSCVSAITSSTPPSNLCCSKIKEQRPCL  60

Query  362  CQYLKNPSLKQYL  400
            CQY+KNP+L +++
Sbjct  61   CQYMKNPNLTKFV  73



>ref|NP_001236829.1| uncharacterized protein LOC100500614 precursor [Glycine max]
 gb|ACU15740.1| unknown [Glycine max]
Length=95

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             ++  C+  QL+ C SA TS +PPS LCC +L EQ+PC CQYLK+P+LK+ +
Sbjct  25   MAAVTCNALQLSACASAITSSTPPSALCCSKLKEQRPCLCQYLKDPNLKKLV  76



>gb|KEH21557.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=98

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   + +PCL + T+ SPP+  CCQ+L EQ+PC C YLKNPSLK+Y+
Sbjct  33   CTPVEFSPCLGSITTSSPPTSACCQKLREQRPCLCGYLKNPSLKKYI  79



>gb|ACI26699.1| lipid transfer protein [Gossypium hirsutum]
Length=111

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQY  397
            ++  C+  +L PCL+A  S +PPS+ CC RL EQ PCFC YL +PSL+Q+
Sbjct  42   AAVTCNPIELIPCLAAVMSSTPPSETCCSRLREQTPCFCGYLNDPSLRQF  91



>ref|XP_006430725.1| hypothetical protein CICLE_v10013188mg [Citrus clementina]
 gb|ESR43965.1| hypothetical protein CICLE_v10013188mg [Citrus clementina]
 gb|KDO63207.1| hypothetical protein CISIN_1g034237mg [Citrus sinensis]
Length=100

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+PCL+A TS +PPS  CC +L +Q+PC C YL+NP+L+QY+
Sbjct  32   AVTCSPTELSPCLAALTSSAPPSGACCNKLRQQRPCLCGYLRNPNLRQYV  81



>ref|XP_008362493.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=97

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +2

Query  191  AFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQY  370
             F LM+   + +        +  C   +L+PCL A  S +PPS  CC++L EQ+PC C+Y
Sbjct  9    VFCLMVAVXVALCDEVRTTEAVTCSPLELSPCLEAIRSXTPPSATCCEKLKEQQPCLCEY  68

Query  371  LKNPSLKQYL  400
            +KNP+LK Y+
Sbjct  69   IKNPALKPYI  78



>ref|XP_004299573.1| PREDICTED: non-specific lipid-transfer protein 2-like [Fragaria 
vesca subsp. vesca]
Length=96

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             ++  C   QL+ C SA +S +PPS LCC +L EQKPC CQYL NP+LK+++
Sbjct  25   MAAVTCSPVQLSSCASAISSNTPPSSLCCTKLREQKPCLCQYLNNPNLKKFV  76



>gb|AFK45248.1| unknown [Lotus japonicus]
Length=104

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C    L+PCL A +S +PPS  CCQ+L EQKPC C YL+NPSL  Y+
Sbjct  39   CSPVALSPCLGAISSSTPPSAACCQKLREQKPCLCGYLRNPSLAPYV  85



>ref|XP_009781752.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=94

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +2

Query  182  KMKAFNLMIvavllvvlaeaQFSSAA-CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPC  358
            K  +F  MI  V LV+L E Q S A  C+  QL+ C+ A TS  PPS  CC ++ EQ+PC
Sbjct  2    KAGSFLAMIFVVTLVLLGELQASEAVTCNASQLSECVGAVTSSQPPSSACCSKMREQQPC  61

Query  359  FCQYLKNPSLKQYL  400
             C Y+K+PSL+QY+
Sbjct  62   LCGYMKDPSLRQYV  75



>ref|XP_004492965.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Cicer arietinum]
Length=92

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+   L+PCL A TS SPPS  CC +L EQ PC C YLKNP+L+QY+
Sbjct  27   CNPLALSPCLGAITSNSPPSANCCSKLKEQTPCLCGYLKNPNLRQYV  73



>ref|XP_009418385.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +S  C+  +L+PC SA  SG+ PS  CC +L EQ+PCFCQY KNPSLK Y+
Sbjct  22   ASVTCNPLELSPCSSAVLSGARPSAACCAKLKEQQPCFCQYKKNPSLKDYV  72



>ref|XP_004137484.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
sativus]
 ref|XP_004166305.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
sativus]
 gb|KGN64146.1| hypothetical protein Csa_1G042560 [Cucumis sativus]
Length=90

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+ C+SA TS  PPS+LCC ++ EQKPC C+Y++NP+LK+++
Sbjct  22   AVTCSPVQLSSCVSAITSSVPPSKLCCSKIKEQKPCLCKYMQNPTLKKFV  71



>dbj|BAM05643.1| lipid transfer protein [Eucalyptus pyrocarpa]
Length=95

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++ AC   +L+ C++A TS +PP+ LCC ++ EQKPC CQYL+NP+LK+++
Sbjct  26   AAVACRPIELSACVNAITSATPPTTLCCSKIKEQKPCLCQYLQNPNLKKFI  76



>emb|CAH04982.1| type 2 non-specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69204.1| type 2 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=93

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  185  MKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFC  364
            M+   L++  +L +V+A    + AAC+V QLT C+ A T+G+ PS  CC  L  Q+ CFC
Sbjct  3    MRKEVLLVAMMLALVVAAPGGARAACEVGQLTVCMPAITTGAKPSGACCGNLRAQQACFC  62

Query  365  QYLKNPSLKQYL  400
            QY K+PSL +Y+
Sbjct  63   QYAKDPSLARYI  74



>ref|XP_009626576.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
tomentosiformis]
Length=97

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+PC+ A TS  PPS  CC +L EQKPC C YLKNP+L+ Y+
Sbjct  29   AVTCSAVELSPCVGAITSSQPPSSACCAKLREQKPCLCGYLKNPNLRPYV  78



>dbj|BAM05641.1| lipid transfer protein [Eucalyptus pilularis]
 dbj|BAM05642.1| lipid transfer protein [Eucalyptus pilularis]
Length=95

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++ AC   +L+ C++A TS +PP+ LCC ++ EQKPC CQYL+NP+LK+++
Sbjct  26   AAVACRPIELSACVNAITSATPPTTLCCSKIKEQKPCLCQYLQNPNLKKFV  76



>emb|CDY50600.1| BnaC02g16970D [Brassica napus]
Length=98

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             AACD +QL PCL+A T G  PS  CC +L EQ+PC C + KNP+  QY+
Sbjct  30   EAACDPKQLQPCLAAITGGGQPSGDCCAKLKEQQPCLCGFAKNPAFAQYI  79



>ref|XP_010062206.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW69298.1| hypothetical protein EUGRSUZ_F02789 [Eucalyptus grandis]
Length=103

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +L+PCL A TS + PS LCC +L EQ+PC C Y+K+P+LKQY 
Sbjct  38   CSATELSPCLPAITSSAAPSALCCSKLREQRPCLCGYIKDPNLKQYF  84



>ref|XP_008229268.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=98

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+ CL    SG+PPS  CCQ+L EQKPC C YLK+P+LKQY+
Sbjct  30   AVTCSPLELSSCLEPIRSGTPPSTTCCQKLREQKPCLCGYLKDPALKQYV  79



>ref|XP_009135573.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=96

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 8/79 (10%)
 Frame = +2

Query  164  TYSNIPKMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLN  343
            T+ +I  + AF L+++             +  C   QL+P   A  S SPPS LCC +L 
Sbjct  7    TWVSILALAAFLLVVLVPAA--------EAVTCSPMQLSPGAGAIPSSSPPSALCCAKLK  58

Query  344  EQKPCFCQYLKNPSLKQYL  400
            EQKPC C Y++NPSL++Y+
Sbjct  59   EQKPCICGYMRNPSLRRYI  77



>gb|KFK41090.1| hypothetical protein AALP_AA2G084400 [Arabis alpina]
Length=102

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             AACD  QL PCLSA T G  PS  CC +L EQ+PC C + K P+  QY+
Sbjct  34   GAACDASQLQPCLSAITGGGQPSGACCAKLKEQQPCLCGFAKIPAFAQYI  83



>ref|XP_007150889.1| hypothetical protein PHAVU_004G002700g [Phaseolus vulgaris]
 gb|ESW22883.1| hypothetical protein PHAVU_004G002700g [Phaseolus vulgaris]
Length=88

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQY  397
            C   +L+PCL A +S SPP+ +CCQ++ EQ+PC C YLK+PS+K Y
Sbjct  22   CSPAELSPCLEAMSSSSPPTSICCQKVREQRPCLCGYLKSPSIKNY  67



>ref|NP_001238401.1| uncharacterized protein LOC100306409 precursor [Glycine max]
 gb|ACU14566.1| unknown [Glycine max]
 gb|KHN47234.1| Putative non-specific lipid-transfer protein AKCS9-like protein 
[Glycine soja]
Length=95

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+PCL A TSG+ PS  CC +L +QKPC C YLKN SLKQY+
Sbjct  27   AVTCTPTELSPCLPAITSGAKPSNACCTKLKQQKPCLCGYLKNASLKQYV  76



>ref|XP_010032280.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 dbj|BAM05644.1| lipid transfer protein [Eucalyptus globulus subsp. globulus]
 gb|KCW83938.1| hypothetical protein EUGRSUZ_B00824 [Eucalyptus grandis]
 emb|CEG03556.1| unnamed protein product [Fusarium acuminatum CS5907]
Length=95

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C   +L+ C+SA TS +PP+ LCC ++ EQKPC CQYL+NP+LK+++
Sbjct  26   AAVTCRPIELSACVSAITSATPPTTLCCSKIKEQKPCLCQYLQNPNLKKFV  76



>ref|XP_006654745.1| PREDICTED: non-specific lipid-transfer protein 2-like [Oryza 
brachyantha]
Length=98

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            + AACD  QLTPC  A    + P+  CC R+ EQ+PC CQY ++P+L++Y+
Sbjct  29   AEAACDAMQLTPCAGAIIGNAAPTAACCSRMKEQQPCLCQYARDPNLQRYV  79



>gb|KHN27477.1| Non-specific lipid-transfer protein 2 [Glycine soja]
Length=96

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  182  KMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            K+  F +++VAV L+V    +  +  C   +L+PCL A TS  PPS +CCQ++ EQ+ C 
Sbjct  5    KVCGFAIVMVAVQLLVEVSPKAEAVTCTPVELSPCLGAITSSQPPSTICCQKVREQRQCL  64

Query  362  CQYLKNPSLKQY  397
            C YLKNPSL+ Y
Sbjct  65   CGYLKNPSLRPY  76



>ref|XP_008240231.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=96

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  +L+PC  A TS +PPS +CC ++ +QKPC CQYL NP+LK+++
Sbjct  28   AVTCNPTELSPCAGAITSSTPPSTICCTKIKQQKPCLCQYLNNPNLKKFV  77



>ref|XP_003524566.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Glycine max]
Length=100

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  182  KMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCF  361
            K+  F +++VAV L+V    +  +  C   +L+PCL A TS  PPS +CCQ++ EQ+ C 
Sbjct  9    KVCGFAIVMVAVQLLVEVSPKAEAVTCTPVELSPCLGAITSSQPPSTICCQKVREQRQCL  68

Query  362  CQYLKNPSLKQY  397
            C YLKNPSL+ Y
Sbjct  69   CGYLKNPSLRPY  80



>ref|XP_006482397.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=103

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQY  397
            +  C+  QL PCL AFTS +PPS +CC  L +Q+PC C YL+NP  KQY
Sbjct  35   AVTCNPSQLIPCLPAFTSTAPPSTVCCNSLRQQRPCLCTYLRNPLYKQY  83



>ref|XP_007211115.1| hypothetical protein PRUPE_ppa025024mg, partial [Prunus persica]
 gb|EMJ12314.1| hypothetical protein PRUPE_ppa025024mg, partial [Prunus persica]
Length=94

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  +L+PC  A TS +PPS +CC ++ +QKPC CQYL NP+LK+++
Sbjct  26   AVTCNPTELSPCAGAITSSTPPSTICCTKIKQQKPCLCQYLNNPNLKKFV  75



>ref|XP_006367505.1| PREDICTED: uncharacterized protein LOC102587705 [Solanum tuberosum]
Length=174

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
              SA C+V +L PC  A  SG PPS++CC +L EQ PC C Y  +P+LK Y+
Sbjct  26   VESATCNVMELVPCSPAIISGQPPSEVCCAKLKEQVPCLCGYFNDPTLKPYV  77



>ref|XP_004232333.1| PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Length=96

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C   QL+PCL A   G+ PSQ CC RL  Q+PC C ++K+P+L+QY+
Sbjct  28   AATCSASQLSPCLGAIQGGTAPSQDCCARLKNQQPCICGFMKDPNLRQYV  77



>gb|KDO63208.1| hypothetical protein CISIN_1g036197mg [Citrus sinensis]
Length=103

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQY  397
            +  C+  QLTPCL AFT  +PPS +CC  L +Q+PC C YL+NP  KQY
Sbjct  35   AVTCNPSQLTPCLPAFTWTAPPSTVCCNSLRQQRPCLCTYLRNPLYKQY  83



>ref|XP_006430727.1| hypothetical protein CICLE_v10013181mg [Citrus clementina]
 gb|ESR43967.1| hypothetical protein CICLE_v10013181mg [Citrus clementina]
Length=103

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQY  397
            +  C+  QLTPCL AFT  +PPS +CC  L +Q+PC C YL+NP  KQY
Sbjct  35   AVTCNPSQLTPCLPAFTWTAPPSTVCCNSLRQQRPCLCTYLRNPLYKQY  83



>ref|XP_009127492.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
 emb|CDY12591.1| BnaA02g12590D [Brassica napus]
Length=98

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             AACD +QL PCL+A T G  PS  CC +L EQ+PC C + KNP+  QY+
Sbjct  30   EAACDPKQLQPCLAAITGGGQPSGDCCAKLKEQQPCLCGFSKNPAFAQYI  79



>sp|P82353.1|NLTP2_PRUAR RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2 [Prunus armeniaca]
Length=68

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
              C   QL+PCL    SG+P    CCQ+L EQ+PC C YLKNPSL+QY+
Sbjct  1    VTCSPVQLSPCLGPINSGAPSPTTCCQKLREQRPCLCGYLKNPSLRQYV  49



>ref|XP_006391441.1| hypothetical protein EUTSA_v10019362mg [Eutrema salsugineum]
 gb|ESQ28727.1| hypothetical protein EUTSA_v10019362mg [Eutrema salsugineum]
Length=98

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD +QL PCL+A T G  PS  CC +L EQ+PC C + KNP+  QY+
Sbjct  33   CDAKQLQPCLAAITGGGQPSGDCCAKLKEQQPCLCGFAKNPAFAQYI  79



>ref|XP_009357787.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +LTPC+    SGS PS  CCQ+L EQ+PC C Y+KNP+L+ Y+
Sbjct  29   AVTCSPVELTPCMGPIRSGSAPSGTCCQKLREQRPCLCGYIKNPALRTYV  78



>gb|ABK95885.1| unknown [Populus trichocarpa]
Length=93

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  272  QLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            QL+ C+SA TS +PP+ LCC ++ EQKPC CQYLKNP L++++
Sbjct  32   QLSSCVSAITSSTPPTNLCCSKIKEQKPCLCQYLKNPKLQKFI  74



>emb|CDY16462.1| BnaA08g03050D [Brassica napus]
Length=97

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +LT C SAF S SPPS  CC +L EQ PC C YL+NP+L QY+
Sbjct  32   CSPTELTSCSSAFMSASPPSATCCAKLREQNPCLCGYLRNPALSQYV  78



>ref|XP_006367504.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=96

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
              S  C+V +L PC  A  SG PPS++CC +L EQ PC C Y  +P+LK Y+
Sbjct  26   IESVTCNVMELVPCSPAIISGQPPSEVCCAKLKEQVPCLCGYFNDPTLKPYV  77



>dbj|BAJ25798.1| putative non-specific lipid-transfer protein type 2 subfamily 
[Nicotiana tabacum]
Length=97

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C V +L+PC  A +S  PPS  CC +L EQKPC C YLKNP+L+ Y+
Sbjct  29   AVTCSVVELSPCAGAISSPQPPSSACCAKLKEQKPCLCGYLKNPNLRPYV  78



>ref|XP_008810040.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=92

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            S  CD  +L+PC  A  S +PP+  CC +L EQ PCFCQY KNP L+ Y+
Sbjct  24   SVTCDPMELSPCAGAILSSAPPTAACCAKLKEQTPCFCQYKKNPKLQNYI  73



>ref|XP_009777694.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=97

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C V +L+PC  A +S  PPS  CC +L EQKPC C YLKNP+L+ Y+
Sbjct  29   AVTCSVVELSPCAGAISSPQPPSSACCAKLKEQKPCLCGYLKNPNLRPYV  78



>gb|EMT00048.1| Putative non-specific lipid-transfer protein AKCS9 [Aegilops 
tauschii]
Length=96

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
              +A CD  QL+PC  A    + P+ +CC R+  Q+PC CQY ++P+LKQY+
Sbjct  26   VDAATCDALQLSPCAGAIVGNAAPTAVCCSRMKAQRPCMCQYARDPNLKQYV  77



>ref|XP_010044111.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW86149.1| hypothetical protein EUGRSUZ_B02852 [Eucalyptus grandis]
Length=90

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  +L+ C SA TS SPPS +CC +L EQ+PC CQY+KNP+L++++
Sbjct  22   AVTCNPIELSSCASAITSSSPPSAMCCAKLKEQRPCLCQYMKNPNLQKFI  71



>ref|XP_008460998.1| PREDICTED: non-specific lipid-transfer protein 2 [Cucumis melo]
Length=90

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+ C+SA TS  PPS LCC ++ EQ+PC C+Y++NP+LK+++
Sbjct  22   AVTCSPVQLSSCVSAITSSVPPSSLCCSKIKEQRPCLCKYMQNPTLKKFV  71



>emb|CDP02752.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +L+PC++AF S  PPS  CC +L EQ+PCFC YL++P L+QY+
Sbjct  25   CSPTELSPCVAAFISQQPPSGACCSKLREQRPCFCGYLRDPYLRQYV  71



>emb|CDP02750.1| unnamed protein product [Coffea canephora]
Length=96

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkvasac  430
            +  C + +L+PCLSA    +PPS  CC +L EQ+PCFC Y++NP+  QY+++ K    A 
Sbjct  28   AVTCSIAELSPCLSAINGPNPPSAPCCAKLKEQRPCFCGYIQNPTYAQYVNSPKAKGIAK  87

Query  431  k--vsIPNC  451
               VSIPNC
Sbjct  88   ACQVSIPNC  96



>dbj|BAA25680.1| Lipid transfer protein [Brassica rapa]
Length=86

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            AACD +QL PCL+A T G  PS  CC +L EQ+PC C + KNP+  QY+
Sbjct  19   AACDPKQLQPCLAAITGGGQPSGDCCAKLKEQQPCLCGFSKNPAFAQYI  67



>ref|XP_007033193.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY04119.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=118

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +LT CL A TS SPPS  CC +L EQKPC C YL+NP+LKQ++
Sbjct  53   CSPSELTSCLPAITSSSPPSTTCCSKLREQKPCLCGYLQNPNLKQFV  99



>ref|XP_010528502.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=97

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C V +L PCL A T+G  PS  CC +L EQ+PC C Y+KNP+L QY+
Sbjct  32   CVVTELRPCLPAITTGGAPSAECCGKLKEQQPCLCGYIKNPALSQYV  78



>ref|XP_006855792.1| hypothetical protein AMTR_s00044p00213670 [Amborella trichopoda]
 gb|ERN17259.1| hypothetical protein AMTR_s00044p00213670 [Amborella trichopoda]
Length=92

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++ ACDV  LTPC  AF    PP+  CC RL +QKPC+CQYLK+P    ++
Sbjct  23   ANGACDVSTLTPCGRAFYYSQPPTATCCSRLQDQKPCYCQYLKDPRYSGFI  73



>gb|EMS52280.1| Non-specific lipid-transfer protein 2G [Triticum urartu]
Length=88

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            AAC+V QLT C+ A T+G+ PS  CC  L  Q+ CFCQY K+PSL  Y+
Sbjct  21   AACEVGQLTVCMPAITTGAKPSDACCGNLRAQQACFCQYAKDPSLGAYI  69



>gb|EMS64122.1| Non-specific lipid-transfer protein 2G [Triticum urartu]
Length=93

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            AAC+V QLT C+ A T+G+ PS  CC  L  Q+ CFCQY K+PSL  Y+
Sbjct  26   AACEVGQLTVCMPAITTGAKPSDACCGNLRAQQACFCQYAKDPSLGAYI  74



>ref|XP_010528993.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=92

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             + AAC V +L PCL A T+G  PS  CC +L EQ+ C C Y+KNP+  QY+
Sbjct  22   LTEAACVVAELAPCLPAITTGGNPSAECCGKLKEQESCLCGYIKNPAFAQYV  73



>gb|EYU40792.1| hypothetical protein MIMGU_mgv1a022792mg, partial [Erythranthe 
guttata]
Length=77

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkvasa  427
             + +C+  QL+PC SA TS S PS  CC +L EQ+PC CQY++NP+L++++ ++     A
Sbjct  8    GAVSCNPLQLSPCASAITSSSKPSATCCAKLKEQRPCLCQYMRNPNLQKFIKSSGAKKVA  67

Query  428  ckvsIP  445
                IP
Sbjct  68   SSCRIP  73



>ref|NP_564532.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAK76553.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AAM14109.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AEE32344.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=94

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   QL  C +A TS SPPS+ CC +L EQ+PC C Y++NP+L+QY+
Sbjct  29   CSPMQLASCAAAMTSSSPPSEACCTKLREQQPCLCGYMRNPTLRQYV  75



>ref|XP_010036906.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW48562.1| hypothetical protein EUGRSUZ_K02234 [Eucalyptus grandis]
Length=92

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+ C ++  S +PPS+LCC ++ EQKPC CQYLKNPSLK+++
Sbjct  24   AVTCKPTELSSCANSIVSSTPPSRLCCTKIKEQKPCLCQYLKNPSLKKFV  73



>gb|KEH44195.1| Lipid transfer protein [Medicago truncatula]
Length=92

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+  QL+ C +A  S +PPS +CC +L EQKPC CQYLK+P+LK+++
Sbjct  27   CNALQLSACANAIISSNPPSAICCSKLKEQKPCLCQYLKDPNLKKFV  73



>ref|XP_003633726.1| PREDICTED: non-specific lipid-transfer protein 2 [Vitis vinifera]
 emb|CBI33623.3| unnamed protein product [Vitis vinifera]
Length=92

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C  Q+L+ C +AFTS +PPS  CC +L EQKPC C YLK+P+  QY+
Sbjct  24   AVTCSPQELSSCSAAFTSSAPPSSTCCSKLKEQKPCLCGYLKDPNFSQYV  73



>ref|XP_009357786.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=95

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+PCL    SGS PS  CCQ+L EQ+PC C Y+KNP+L+ Y+
Sbjct  27   AVTCSPVELSPCLGPIRSGSAPSGTCCQKLREQRPCLCGYIKNPALRTYV  76



>gb|ACM78623.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=95

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C+   L+PC  A +   PPS+LCC +L EQKPC C Y ++P+L+QY+
Sbjct  28   AATCNPVGLSPCAGAMSGSGPPSKLCCSKLREQKPCLCGYYRDPNLRQYV  77



>ref|XP_010528501.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Tarenaya hassleriana]
Length=92

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             + AAC V +L PCL A T+G  PS  CC +L EQ+ C C Y+KNP+  QY+
Sbjct  22   LTEAACVVTELAPCLPAITTGGNPSAECCGKLKEQESCLCGYVKNPAFAQYV  73



>gb|KGN63840.1| hypothetical protein Csa_1G024245 [Cucumis sativus]
Length=100

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
               AC+  QL+ C+++  SG+PPS  CC ++ EQKPC C YLKNP LK ++
Sbjct  31   DGVACNPMQLSSCMNSIISGAPPSTQCCSKIKEQKPCLCGYLKNPILKSFV  81



>ref|XP_008381283.1| PREDICTED: non-specific lipid-transfer protein 2 [Malus domestica]
Length=95

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+PCL    SGS PS  CCQ+L EQ+PC C Y+KNP+L+ Y+
Sbjct  27   AVTCSPVELSPCLGPIRSGSAPSGTCCQKLREQRPCLCGYIKNPALRTYV  76



>emb|CDX77289.1| BnaC08g03340D [Brassica napus]
Length=97

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +LT C  AF S SPPS  CC +L EQKPC C YL+NP+L QY+
Sbjct  32   CSPTELTSCSPAFMSASPPSATCCAKLREQKPCLCGYLRNPTLSQYV  78



>ref|XP_011076327.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=96

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C+  QL+PC SA TS S PS  CC ++ EQ+PC CQY+KNP+L++++
Sbjct  27   NAVTCNPLQLSPCASAITSSSKPSAACCAKIKEQRPCLCQYMKNPNLQKFI  77



>emb|CDM81735.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
              +A CD  QL+PC  A    + P+ +CC R+  Q+PC CQY  +P+LKQY+
Sbjct  26   VDAATCDALQLSPCAGAIVGNAAPTAVCCSRMKAQRPCMCQYAHDPNLKQYV  77



>ref|XP_006430726.1| hypothetical protein CICLE_v10013191mg [Citrus clementina]
 gb|ESR43966.1| hypothetical protein CICLE_v10013191mg [Citrus clementina]
Length=99

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C+  +L+PC  A TS +PPS+ CC ++ +Q+PC C +L++P+LKQY+
Sbjct  31   AATCNPTELSPCAPAITSSAPPSRACCNKMRQQRPCLCGFLRDPNLKQYV  80



>ref|XP_002887506.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63765.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=98

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD  +L+PCL   T GS PS+LCC ++ EQ+ C CQYLKNP+ K +L
Sbjct  33   CDPMKLSPCLDTITKGSEPSELCCTKVKEQQHCVCQYLKNPNFKSFL  79



>ref|XP_004986022.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=93

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            S+A+C+V QLTPC SA  +G+ PS  CC  L  Q+ CFC Y KNP+  +Y+
Sbjct  24   SAASCNVGQLTPCASALATGATPSASCCSSLKAQQGCFCTYAKNPTYARYI  74



>ref|XP_007044235.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY00067.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=95

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+  QL+PC SA TS +PPS LCC +L EQ+PC C Y+K+P+L++ +
Sbjct  30   CNALQLSPCASAITSSTPPSPLCCSKLKEQRPCLCNYVKDPNLQKLV  76



>gb|EYU41300.1| hypothetical protein MIMGU_mgv1a024516mg [Erythranthe guttata]
Length=83

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+  +L+PCL A      PS +CCQ+L EQ PCFC YLKNP+L+Q++
Sbjct  18   CNPMELSPCLGAMMGTDNPSAVCCQKLKEQVPCFCNYLKNPTLRQFI  64



>ref|XP_010474155.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD +QL PCL+A T G  PS  CC +L EQ+ C C + KNP+  QY+
Sbjct  37   CDARQLQPCLAAITGGGQPSGACCAKLTEQQSCLCGFAKNPAFAQYI  83



>ref|XP_002527025.1| Nonspecific lipid-transfer protein, putative [Ricinus communis]
 gb|EEF35397.1| Nonspecific lipid-transfer protein, putative [Ricinus communis]
Length=91

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            S+  CD  +L+ C +A TS SPPS +CC +L +Q+PC CQY+KNP+L++ +
Sbjct  22   SAVTCDPVELSACANAITSSSPPSAICCSKLKQQRPCLCQYVKNPNLQKLV  72



>ref|XP_002887080.1| hypothetical protein ARALYDRAFT_475781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63339.1| hypothetical protein ARALYDRAFT_475781 [Arabidopsis lyrata subsp. 
lyrata]
Length=103

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD +QL PCL+A T G  PS  CC +L EQ+ C C + KNP+  QY+
Sbjct  38   CDARQLQPCLAAITGGGQPSGACCAKLTEQQSCLCGFAKNPAFAQYI  84



>ref|XP_010450660.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=90

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQY  397
            + AACD+Q +  CL A   GSPPS  CC +LN    CFC YLKNP +  Y
Sbjct  23   AEAACDIQDIKVCLPAVIGGSPPSTECCTKLNHNHSCFCDYLKNPLVVPY  72



>ref|XP_008782311.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=94

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C+  +L+PC  A    SPP+  CC +L  Q+PCFCQY KNPSL+ Y+
Sbjct  26   AATCNPSELSPCAGAILRSSPPTSACCAKLKAQQPCFCQYTKNPSLRGYI  75



>ref|XP_008453433.1| PREDICTED: non-specific lipid-transfer protein 2 [Cucumis melo]
Length=100

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             AC+  Q++ C+++  SG+PPS  CC ++ EQKPC C YLKNP LK ++
Sbjct  33   VACNPMQMSSCMNSIVSGTPPSSQCCSKIKEQKPCLCGYLKNPFLKSFV  81



>ref|XP_006390508.1| hypothetical protein EUTSA_v10019361mg [Eutrema salsugineum]
 gb|ESQ27794.1| hypothetical protein EUTSA_v10019361mg [Eutrema salsugineum]
Length=98

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD  QL+PC+ A   GS P++LCC R+ +QK C CQYLKNP+ K ++
Sbjct  33   CDPTQLSPCVDAIQRGSTPTRLCCTRVKKQKHCVCQYLKNPTFKSFI  79



>ref|XP_010926507.1| PREDICTED: non-specific lipid-transfer protein 2-like [Elaeis 
guineensis]
Length=92

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+  +L+PC  A    SPP+  CC +L  Q+PCFCQY KNPSLK Y+
Sbjct  27   CNPSELSPCAGAILGSSPPTSACCAKLKAQQPCFCQYAKNPSLKGYI  73



>ref|XP_010511588.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD +QL PCL+A T G  PS  CC +L EQ+ C C + KNP+  QY+
Sbjct  37   CDARQLQPCLAAITGGGQPSGACCAKLTEQQSCLCGFAKNPAFAQYI  83



>gb|EMT25475.1| Non-specific lipid-transfer protein 2G [Aegilops tauschii]
Length=82

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            + AAC++ QLT C+ A T+G+ PS  CC  L+ Q+ CFC+Y K+PSL  Y+
Sbjct  13   ARAACEMGQLTVCMPAITTGAKPSGACCANLHAQQACFCEYAKDPSLGAYI  63



>ref|XP_011097163.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53930.1| lipid transfer protein [Sesamum indicum]
Length=96

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  242  QFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  +A C+  +L+PCL+A +   PPS  CC +L EQ PCFC Y+KNP  K Y+
Sbjct  25   ETGAAPCNPVELSPCLAAISGSQPPSAECCSKLKEQVPCFCDYVKNPVFKPYV  77



>ref|NP_176857.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAG60074.1|AC013288_8 lipid transfer protein, putative [Arabidopsis thaliana]
 gb|AAM63437.1| lipid transfer protein, putative [Arabidopsis thaliana]
 dbj|BAC42500.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42934.1| At1g66850 [Arabidopsis thaliana]
 gb|AEE34562.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=102

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD +QL PCL+A T G  PS  CC +L EQ+ C C + KNP+  QY+
Sbjct  37   CDARQLQPCLAAITGGGQPSGACCAKLTEQQSCLCGFAKNPAFAQYI  83



>gb|ACM78620.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=94

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  182  KMKAFNLMIvavllvvlaeaQFSSAA-CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPC  358
            K+  F L+ V V   +L EA+ + A  C   QL+PC  A T   PPS  CC RL EQ PC
Sbjct  3    KVVFFTLLAVVVATTLLGEAEIAEAVTCSPLQLSPCAGAITGSGPPSATCCSRLREQTPC  62

Query  359  FCQYLKNPSLKQYL  400
             C Y ++P+L+QY+
Sbjct  63   LCGYYRDPNLRQYV  76



>gb|ACG48207.1| nonspecific lipid-transfer protein precursor [Zea mays]
Length=101

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  257  ACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ACD  QLTPC  A   G  PS  CC RL EQ+PC C Y ++P+L++Y+
Sbjct  35   ACDATQLTPCAGAIIIGRSPSAACCSRLKEQQPCLCTYARDPNLQRYV  82



>ref|XP_006301055.1| hypothetical protein CARUB_v10021448mg [Capsella rubella]
 gb|EOA33953.1| hypothetical protein CARUB_v10021448mg [Capsella rubella]
Length=98

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +2

Query  179  PKMKAFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPC  358
            PK   F   I+ + +V       +   CD  QL+PCL     GS PS LCC+++ EQK C
Sbjct  6    PKQVVFTCAILLIFIVAQENRVAAEEPCDPMQLSPCLDTIQKGSYPSNLCCKKVREQKHC  65

Query  359  FCQYLKNPSLKQYL  400
             CQYL+NP+ K +L
Sbjct  66   VCQYLRNPNFKSFL  79



>emb|CDY48021.1| BnaA04g26690D [Brassica napus]
 emb|CDX95546.1| BnaC01g34380D [Brassica napus]
Length=96

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC SA TS S PS LCC +L EQKPC C Y++N SL++++
Sbjct  28   AVTCSPMQLSPCASAITSSSQPSALCCAKLKEQKPCLCGYMRNRSLRRFV  77



>ref|XP_006357827.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=96

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC+ A   G+ PSQ CC RL  Q+PC C ++K+P+LKQY+
Sbjct  28   AVTCSASQLSPCVGAIQGGTAPSQDCCARLKSQQPCICGFMKDPNLKQYV  77



>ref|XP_010419026.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD +QL PCL+A T G  PS  CC +L EQ+ C C + KNP+  QY+
Sbjct  37   CDARQLQPCLAAITGGGQPSGECCAKLTEQQSCLCGFAKNPAFAQYI  83



>ref|XP_008444077.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=102

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+  ++ PCL A  S  PP+  CC++L EQ+PCFC+YLK+P  K+YL
Sbjct  37   CNPTEMRPCLPALESSVPPTAECCEKLKEQEPCFCEYLKSPIFKRYL  83



>ref|XP_008809159.1| PREDICTED: non-specific lipid-transfer protein 2 [Phoenix dactylifera]
Length=93

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++A CD  +L+PC  A    SPPS  CC  L  Q+PCFCQY KNP+L  Y+
Sbjct  24   TAATCDPSELSPCAGAILFSSPPSSACCAELKAQQPCFCQYAKNPNLSGYI  74



>ref|XP_003535202.1| PREDICTED: non-specific lipid-transfer protein 2-like [Glycine 
max]
Length=107

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQ-KPCFCQYLKNPSLKQYL  400
            C+V +L PC +AFT+ +PPS  CCQRL EQ + C CQY+K+P+L++++
Sbjct  40   CNVMELVPCAAAFTTSTPPSPECCQRLREQPRSCICQYMKDPTLEKFI  87



>emb|CDP02751.1| unnamed protein product [Coffea canephora]
Length=95

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+PC+ A  S  PPS  CC +L EQ+PC C YL++P+L+QY+
Sbjct  27   AVTCSPTELSPCVGAIISNQPPSPACCSKLREQRPCLCGYLRDPNLRQYV  76



>gb|KFK43095.1| hypothetical protein AALP_AA1G079200 [Arabis alpina]
Length=99

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +2

Query  191  AFNLMIvavllvvlaeaQFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQY  370
            AF +++V+ L    A       AC+V +L PCL+A  SG  PS  CC +L EQ+ C C+Y
Sbjct  10   AFVVVVVSSLAPTKAVVGSEKVACNVMELQPCLAALQSGGNPSPDCCGKLKEQESCLCEY  69

Query  371  LKNPSLKQYL  400
            +KNP   QY+
Sbjct  70   IKNPLFGQYV  79



>ref|XP_006482208.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=99

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C   +L+PC  A TS +PPS  CC ++ +Q+PC C +L++P+LKQY+
Sbjct  31   AATCSPTELSPCAPAITSSAPPSGACCNKMRQQRPCLCGFLRDPNLKQYV  80



>ref|XP_002870865.1| hypothetical protein ARALYDRAFT_916549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47124.1| hypothetical protein ARALYDRAFT_916549 [Arabidopsis lyrata subsp. 
lyrata]
Length=104

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  CD  +L+ CL  FT+G  PS  CC +L EQ+PCFC Y+K+P   QY+
Sbjct  35   NVTCDANELSSCLLPFTTGVSPSTTCCTKLKEQQPCFCTYIKDPKYSQYV  84



>ref|XP_008444076.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=94

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQY  397
            +A+C+  +L+PC+SA TS + P+  CCQ+L +Q+PC+C YLK+P  K Y
Sbjct  26   AASCNPTELSPCVSAITSSTAPTAACCQKLRQQEPCYCGYLKDPKYKAY  74



>ref|XP_009105236.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=96

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             AACD +QL PCL+A T G   S  CC  L EQ+PC C + KNP+  QY+
Sbjct  28   GAACDAKQLQPCLAAITGGGHRSVCCCANLKEQQPCLCGFSKNPAFAQYV  77



>sp|Q43681.1|NLTP_VIGUN RecName: Full=Probable non-specific lipid-transfer protein AKCS9; 
Short=LTP; Flags: Precursor [Vigna unguiculata]
 emb|CAA56113.1| lipid transfer like protein [Vigna unguiculata]
Length=99

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  +L+ C+ A T GS PS  CC +L  Q+PC C Y+KNPSLKQY+
Sbjct  31   AVTCNPTELSSCVPAITGGSKPSSTCCSKLKVQEPCLCNYIKNPSLKQYV  80



>ref|XP_006282777.1| hypothetical protein CARUB_v10006242mg [Capsella rubella]
 gb|EOA15675.1| hypothetical protein CARUB_v10006242mg [Capsella rubella]
Length=95

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  242  QFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkva  421
            +   A C V+ L  C SA T+ SPPS  CC +L E++ C C YLK+PS+ QY++AAK+V 
Sbjct  26   EIVKATCAVEDLQVCKSAVTTESPPSMECCAKLKEEQSCICDYLKDPSVSQYITAAKRVL  85

Query  422  sackvsIPNC  451
            +AC + +P+C
Sbjct  86   AACDIPLPSC  95



>gb|AAG60123.1|AC073555_7 lipid transfer protein, putative [Arabidopsis thaliana]
Length=87

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  269  QQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            + L  C +A TS SPPS+ CC +L EQ+PC C Y++NP+L+QY+
Sbjct  25   EGLASCAAAMTSSSPPSEACCTKLREQQPCLCGYMRNPTLRQYV  68



>emb|CDP00664.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C+  QL+PC +A TS S P+ +CC ++ EQ+PC C Y++NP+LK+++
Sbjct  22   AVTCNPLQLSPCANAITSSSSPTAICCSKIKEQRPCLCSYMRNPNLKKFI  71



>gb|AAS79106.1| probable lipid transfer protein family protein [Tamarix androssowii]
Length=94

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC  A T   PPS  CC RL EQ PC C Y ++P+L+QY+
Sbjct  27   AVTCSPLQLSPCAGAITGSGPPSATCCSRLREQTPCLCGYYRDPNLRQYV  76



>ref|NP_849769.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 dbj|BAC43108.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42935.1| At1g43668 [Arabidopsis thaliana]
 gb|AEE31984.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=98

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkvasack  433
             AC V +L PCL +   GS PS  CC++L EQ  CFC YL+NP   QY++AAK++ +ACK
Sbjct  33   VACTVTELQPCLPSVIDGSQPSTQCCEKLKEQNSCFCDYLQNPQFSQYITAAKQILAACK  92

Query  434  vsIPNC  451
            +  PNC
Sbjct  93   IPYPNC  98



>gb|EYU41301.1| hypothetical protein MIMGU_mgv1a021579mg [Erythranthe guttata]
Length=96

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++A C+  +L+PCL A      PS  CCQ+L EQ PCFC YLK+P+L+Q++
Sbjct  27   AAANCNPLELSPCLGAIMGSGQPSAECCQKLKEQVPCFCTYLKDPTLRQFI  77



>gb|KHN25489.1| Non-specific lipid-transfer protein 2 [Glycine soja]
Length=105

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQ-KPCFCQYLKNPSLKQYL  400
            C+V +L PC +AFT+ +PPS  CC+RL EQ + C CQY+K+P+L++++
Sbjct  38   CNVMELVPCAAAFTTSTPPSPECCERLREQPRSCICQYMKDPTLEKFI  85



>emb|CDY47738.1| BnaA02g16570D [Brassica napus]
Length=98

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             +  +CD  QL PC  A   GS PS  CC RLN+Q+ C CQY+KNP+ K +L
Sbjct  28   VAGQSCDPMQLIPCEEAILKGSKPSDTCCTRLNQQQHCVCQYMKNPNFKSFL  79



>emb|CDM81734.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C+  QLTPC  A    + P+  CC ++ EQ+PC CQY ++P+LKQY+
Sbjct  28   AATCNALQLTPCAGAIIGSAAPTASCCSKMKEQQPCMCQYARDPNLKQYV  77



>ref|XP_009128011.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=98

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             +  +CD  QL PC  A   GS PS  CC RLN+Q+ C CQY+KNP+ K +L
Sbjct  28   VAGQSCDPMQLIPCEEAILKGSKPSDTCCTRLNQQQHCVCQYMKNPNFKSFL  79



>gb|AAB47967.1| nonspecific lipid transfer protein [Hordeum vulgare]
 dbj|BAJ91523.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=96

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C+  QLTPC  A    + P+  CC ++ EQ+PC CQY ++P+LKQY+
Sbjct  28   AATCNALQLTPCAGAIMGNAAPTASCCSKMREQQPCMCQYARDPNLKQYV  77



>emb|CDY45874.1| BnaC02g22460D [Brassica napus]
Length=98

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             +  +CD  QL PC  A   GS PS  CC RLN+Q+ C CQY+KNP+ K +L
Sbjct  28   VAGQSCDPMQLIPCEEAILKGSKPSDTCCTRLNQQQHCVCQYMKNPNFKSFL  79



>ref|XP_004961319.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=95

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD  QLTPC  A    SPP+  CC ++ EQ+PC C Y ++P+L++Y+
Sbjct  30   CDATQLTPCAGAIIGNSPPTAACCSKMREQQPCMCTYARDPNLQRYV  76



>ref|XP_006405797.1| hypothetical protein EUTSA_v10028232mg [Eutrema salsugineum]
 gb|ESQ47250.1| hypothetical protein EUTSA_v10028232mg [Eutrema salsugineum]
Length=108

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   +L+PCL A T G  P+  CC +LNEQKPC C Y+KNP+   Y+
Sbjct  43   CVATELSPCLPAVTLGGTPTVDCCGKLNEQKPCLCGYIKNPAYSMYI  89



>emb|CBI33621.3| unnamed protein product [Vitis vinifera]
Length=81

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+ C +A TS +PPS +CC +L EQ+PC C Y+++P+L QY+
Sbjct  13   AVTCSPLELSSCFAAITSSAPPSSMCCSKLREQRPCLCGYIRDPNLSQYV  62



>ref|XP_009599113.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=94

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C   QL+ C+ A TS   PS  CC ++ EQ+PC C Y+K+PSL+QY+
Sbjct  29   CSASQLSECVGAVTSSQAPSSACCSKMREQQPCLCGYMKDPSLRQYV  75



>ref|XP_002284213.1| PREDICTED: non-specific lipid-transfer protein 2-like [Vitis 
vinifera]
Length=92

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+ C +A TS +PPS +CC +L EQ+PC C Y+++P+L QY+
Sbjct  24   AVTCSPLELSSCFAAITSSAPPSSMCCSKLREQRPCLCGYIRDPNLSQYV  73



>gb|ACM78625.1| non-specific lipid-transfer protein type 2, partial [Tamarix 
hispida]
Length=69

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLK  376
            ++  C   QL+PC+SA TS SPPS LCC ++ EQKPC CQY+K
Sbjct  27   TAVTCRPVQLSPCVSAITSSSPPSGLCCSKIREQKPCHCQYMK  69



>ref|XP_009388790.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=92

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkvasac  430
            S  CD   L PC +AF   + PS LCC R+  Q PC+CQYL +PSL  Y+S  KKVA+AC
Sbjct  26   SVTCDPTLLNPCAAAFLFSTRPSSLCCSRIKSQVPCYCQYLNDPSLSGYISGGKKVAAAC  85

Query  431  kvsIPNC  451
             VS+P+C
Sbjct  86   GVSLPSC  92



>ref|XP_008243280.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=100

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C   +L PC +A TS SPPS +CC +L EQ+PC C+Y+K+P+L++ +
Sbjct  29   AAVTCSPLELAPCATAITSSSPPSAICCGKLKEQRPCLCKYVKDPNLQKLV  79



>ref|XP_007226001.1| hypothetical protein PRUPE_ppa013833mg [Prunus persica]
 gb|EMJ27200.1| hypothetical protein PRUPE_ppa013833mg [Prunus persica]
Length=100

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C   +L PC +A TS SPPS +CC +L EQ+PC C+Y+K+P+L++ +
Sbjct  29   AAVTCSPLELAPCATAITSSSPPSAICCGKLKEQRPCLCKYVKDPNLQKLV  79



>gb|KGN53813.1| hypothetical protein Csa_4G141210 [Cucumis sativus]
Length=95

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQY  397
            + +C+  +L+PC+SA TS + P+  CCQ+L +Q+PC+C YLK+P  K Y
Sbjct  27   AVSCNPTELSPCVSAITSSTAPTAACCQKLRQQEPCYCGYLKDPKYKAY  75



>ref|XP_010317726.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=95

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +2

Query  260  CDVQQL-TPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+V +L +PC + F   SPPS  CC +L EQ+PC C+Y+KNP+  QY+
Sbjct  28   CNVNELISPCFATFAFSSPPSSACCTKLREQQPCLCEYIKNPAYAQYI  75



>ref|XP_006362363.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=100

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +2

Query  260  CDVQQL-TPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+V +L +PC + F   SPPS  CC +L EQ+PC C+Y+KNP+  QYL
Sbjct  28   CNVNELVSPCFATFAFSSPPSSACCTKLREQQPCLCEYIKNPAYAQYL  75



>ref|XP_010534224.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=94

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSG-SPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L+PC +A TS  +PPS  CCQ+L EQKPC C YLKNP+L+ ++
Sbjct  25   AVTCSPLELSPCAAAITSAKTPPSGQCCQKLREQKPCLCGYLKNPTLRSFV  75



>ref|XP_006300368.1| hypothetical protein CARUB_v10022343mg [Capsella rubella]
 gb|EOA33266.1| hypothetical protein CARUB_v10022343mg [Capsella rubella]
Length=102

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD +QL PCL A T G  PS  CC +L EQ+ C C + KNP+  QY+
Sbjct  37   CDARQLQPCLPAITGGGQPSGACCAKLTEQQTCLCGFSKNPAFAQYI  83



>gb|AAC28263.1| 7 kDa lipid transfer protein [Hordeum vulgare subsp. vulgare]
Length=92

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+V QLT C+ A T+G+ PS  CC  L  Q+ CFCQY K+P+L +Y+
Sbjct  27   CEVGQLTVCMPAITTGAKPSGACCANLGAQQGCFCQYAKDPALGRYI  73



>emb|CDF66372.1| lipid transfer protein [Coffea arabica]
Length=98

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  242  QFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  +A C+ Q L+PCL +  SG+PPS+ CC    EQ+PCFC ++K+P+  + +
Sbjct  26   EAEAAGCNAQALSPCLPSIISGTPPSKECCTNAKEQEPCFCNFIKDPAYGKII  78



>ref|XP_009113462.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=97

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   QL+PC SA TS S  S LCC +L EQKPC C Y++N SL++++
Sbjct  29   AVTCSPMQLSPCASAITSSSQTSALCCAKLKEQKPCLCGYMRNRSLRRFV  78



>ref|NP_177519.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAG52085.1|AC012679_23 putative lipid transfer protein; 71816-72112 [Arabidopsis thaliana]
 gb|AEE35508.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=98

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+  QL+PCL     GS PS LCC ++ EQ+ C CQYLKNP+ K +L
Sbjct  33   CNPAQLSPCLETIMKGSEPSDLCCSKVKEQQHCICQYLKNPNFKSFL  79



>ref|XP_010317751.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=96

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C V +L+PC  A  +G PP+  CC  L EQKPC C Y+K+P LK Y+
Sbjct  28   AITCSVSELSPCAEAILTGIPPTPTCCLVLIEQKPCLCGYIKDPKLKPYM  77



>ref|NP_198633.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 dbj|BAB11284.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42030.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AAO50624.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AED94275.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=103

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +   CD  QL+ C +   +G PPS  CC +L EQ+PCFC Y+K+P   QY+
Sbjct  34   ADVTCDAVQLSSCATPMLTGVPPSTECCGKLKEQQPCFCTYIKDPRYSQYV  84



>gb|KGN53815.1| hypothetical protein Csa_4G141230 [Cucumis sativus]
Length=102

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+  ++ PCL A  S  PP+  CC++L EQ+PCFC YLK+P  K YL
Sbjct  37   CNPMEMRPCLPALESSVPPTAECCEKLKEQEPCFCAYLKSPVFKPYL  83



>ref|XP_006304705.1| hypothetical protein CARUB_v10011969mg [Capsella rubella]
 gb|EOA37603.1| hypothetical protein CARUB_v10011969mg [Capsella rubella]
Length=89

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkvasack  433
            AAC V  L PCLSA   GS PS  CC +L + + CFC YLK+P +  +LSA KKV + C 
Sbjct  24   AACAVMDLAPCLSAVQGGSQPSAECCTKLKDNQSCFCDYLKDPLVGPFLSAGKKVLADCN  83

Query  434  vsIPNC  451
            V IP+C
Sbjct  84   VPIPSC  89



>gb|KFK33268.1| hypothetical protein AALP_AA6G352500 [Arabis alpina]
Length=105

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            C+  +L PC +A T+G PP+  CC +LNEQKPC C Y++NP    Y+
Sbjct  40   CNPLELFPCYTAVTTGVPPTTDCCAKLNEQKPCLCGYIQNPVFMVYV  86



>ref|NP_001056241.1| Os05g0550300 [Oryza sativa Japonica Group]
 gb|AAT39264.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAF18155.1| Os05g0550300 [Oryza sativa Japonica Group]
 gb|EAY98926.1| hypothetical protein OsI_20881 [Oryza sativa Indica Group]
 dbj|BAG88327.1| unnamed protein product [Oryza sativa Japonica Group]
Length=94

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD  QL+PC SA    + PS  CC R+ EQ+PC CQY ++P+L++Y+
Sbjct  29   CDALQLSPCASAIIGNASPSASCCSRMKEQQPCLCQYARDPNLQRYV  75



>ref|XP_006305952.1| hypothetical protein CARUB_v10011199mg [Capsella rubella]
 gb|EOA38850.1| hypothetical protein CARUB_v10011199mg [Capsella rubella]
Length=83

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkvasack  433
            AACD+  L  C SA T+GSPPS  CC +L + K C C+YL +P + QY+ AAK+V +AC 
Sbjct  18   AACDLADLQICKSAVTTGSPPSTECCGKLKKHKSCLCKYLISPPISQYIGAAKRVIAACG  77

Query  434  vsIPNC  451
            +   NC
Sbjct  78   IHFHNC  83



>ref|XP_011099530.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=115

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLK-NPSLKQYL  400
            C +++L+ C+ A T   PP+  CC +L EQ+PC C+YLK +P+LKQY+
Sbjct  29   CSLEELSVCMEAVTGSEPPTSACCSKLAEQEPCLCEYLKVDPNLKQYV  76



>ref|XP_002889660.1| hypothetical protein ARALYDRAFT_887992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65919.1| hypothetical protein ARALYDRAFT_887992 [Arabidopsis lyrata subsp. 
lyrata]
Length=98

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  257  ACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            AC V +L PCL A T+ SPPS  CC++L EQ  CFC YL+NP    Y+
Sbjct  34   ACIVTKLQPCLPAVTNESPPSTECCRKLKEQHSCFCDYLQNPQFSPYI  81



>ref|XP_006286025.1| hypothetical protein CARUB_v10007556mg [Capsella rubella]
 gb|EOA18923.1| hypothetical protein CARUB_v10007556mg [Capsella rubella]
Length=92

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQY  397
            S AACDV+ +  CL A T G+PPS  CC  L   + CFC+YLK+P +  Y
Sbjct  21   SEAACDVKDVRVCLPAVTGGTPPSTECCTTLKAHQSCFCEYLKDPLVVPY  70



>ref|XP_002887008.1| hypothetical protein ARALYDRAFT_894246 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63267.1| hypothetical protein ARALYDRAFT_894246 [Arabidopsis lyrata subsp. 
lyrata]
Length=92

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkvasa  427
             +A+C ++ L  C +A T+G PPS  CC +L EQ+ CFC YLK+P + +Y++ AK++ +A
Sbjct  24   ENASCVLEDLQICKTAVTTGKPPSTECCDKLKEQQTCFCDYLKDPRVSRYITVAKQILAA  83

Query  428  ckvsIPNC  451
            C +  P+C
Sbjct  84   CGIPFPSC  91



>ref|XP_006855789.1| hypothetical protein AMTR_s00044p00213430 [Amborella trichopoda]
 gb|ERN17256.1| hypothetical protein AMTR_s00044p00213430 [Amborella trichopoda]
Length=92

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNP  382
            ++ ACD+  LTPC SAF +  PP+  CC RL +Q+ C+CQYLK+P
Sbjct  23   ANGACDISTLTPCGSAFYNSQPPTPTCCSRLLDQQSCYCQYLKDP  67



>emb|CDG03099.1| LTP (lipid transfer protein) [Coffea arabica]
Length=98

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  242  QFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  +A C+ Q L+PCL +  +G+PPS+ CC    EQ+PCFC ++K+P+  + +
Sbjct  26   EAEAAGCNAQALSPCLPSIINGTPPSKECCTNAKEQEPCFCNFIKDPAYGKII  78



>ref|XP_009418081.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            S  C+  +L+ C  A  + +PP+  CC +L EQ+PCFCQY +NP+LK Y+
Sbjct  23   SVTCNPVELSSCAGAILTAAPPTAGCCAKLKEQRPCFCQYKQNPNLKGYI  72



>ref|XP_009386356.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            S  C+  +L+ C  A  + +PP+  CC +L EQ+PC C+Y KNP+LK Y+
Sbjct  23   SVTCNPSELSSCAGAILTSAPPTAACCAKLKEQRPCLCEYRKNPNLKGYI  72



>gb|AAT08737.1| auxin-induced lipid transfer protein [Hyacinthus orientalis]
Length=85

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            AAC+  +L  C S+     PP+  CC +L EQ+PCFCQY K+PSLK Y+
Sbjct  19   AACNPSELMACASSILQSKPPTAQCCAKLKEQQPCFCQYKKDPSLKGYI  67



>gb|EMS52281.1| Non-specific lipid-transfer protein 2G [Triticum urartu]
Length=93

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            AAC+V QLT C+ A T+G+ PS  CC  L  Q+ CFCQY K+PSL  Y+
Sbjct  26   AACEVGQLTVCMPAITTGAKPSGACCGNLRAQQACFCQYAKDPSLGAYI  74



>emb|CDG03100.1| LTP (lipid transfer protein) [Coffea canephora]
Length=98

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  242  QFSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  +A C+ Q L+PCL +  +G+PPS+ CC    EQ+PCFC ++K+P+  + +
Sbjct  26   EAEAAGCNAQALSPCLPSIINGTPPSKQCCTNAKEQEPCFCNFIKDPAYGKII  78



>ref|XP_010445476.1| PREDICTED: uncharacterized protein LOC104728145 [Camelina sativa]
Length=161

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            AAC    L  C SA T+ SPPS+ CC +L EQ+ CFC YLK+PS  QY+
Sbjct  96   AACVPADLLICKSAVTTKSPPSKECCAKLKEQQSCFCDYLKDPSAGQYI  144



>emb|CDY60143.1| BnaA07g39070D [Brassica napus]
Length=97

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++  C+  QL PC  A   GS PS  CC RLN Q+ C CQY+KNP+ K +L
Sbjct  29   AAEQCNPMQLMPCEDAIMKGSIPSNECCTRLNHQQHCICQYMKNPNFKSFL  79



>ref|XP_006468752.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
 gb|KDO76904.1| hypothetical protein CISIN_1g035485mg [Citrus sinensis]
Length=93

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
              +  C+  +L+PC SA T  + PS +CC +L EQ+ C CQY+K+P+L++++
Sbjct  23   MGAMTCNPLELSPCASAITGANAPSAICCSKLKEQRICLCQYMKDPNLRKFV  74



>ref|XP_006448406.1| hypothetical protein CICLE_v10017614mg, partial [Citrus clementina]
 gb|ESR61646.1| hypothetical protein CICLE_v10017614mg, partial [Citrus clementina]
Length=86

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  245  FSSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
              +  C+  +L+PC SA T  + PS +CC +L EQ+ C CQY+K+P+L++++
Sbjct  16   MGAMTCNPLELSPCASAITGANAPSAICCSKLKEQRICLCQYMKDPNLRKFV  67



>ref|XP_009139763.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=102

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  257  ACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +C V +L PCL A T+   P+  CC +L EQKPC C Y++NP+   Y+
Sbjct  36   SCVVTELAPCLPAMTTAGDPTTECCDKLVEQKPCLCGYIRNPAYSMYV  83



>gb|AAP37973.1| seed specific protein Bn15D80B [Brassica napus]
Length=102

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  257  ACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +C V +L PCL A T+   P+  CC +L EQKPC C Y++NP+   Y+
Sbjct  36   SCVVTELAPCLPAMTTAGDPTTECCDKLVEQKPCLCGYIRNPAYSMYV  83



>gb|EMT28561.1| Non-specific lipid-transfer protein 2 [Aegilops tauschii]
Length=96

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C+  QLTPC  A    + P+  CC ++ EQ+ C CQY ++P+LKQY+
Sbjct  28   AATCNALQLTPCAGAIIGNAAPTASCCSKMKEQQTCMCQYARDPNLKQYV  77



>ref|XP_006405794.1| hypothetical protein EUTSA_v10028094mg [Eutrema salsugineum]
 gb|ESQ47247.1| hypothetical protein EUTSA_v10028094mg [Eutrema salsugineum]
Length=102

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            ++ +C   +L PCL A T G  P++ CC +L EQ+PCFC Y+KNP    Y+
Sbjct  33   TAQSCVPTELLPCLPAITIGGEPAKDCCDKLKEQQPCFCDYIKNPMYSMYV  83



>gb|AAT08689.1| lipid transfer protein [Hyacinthus orientalis]
Length=85

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            AAC+  +L  C S+     PP+  CC +L EQ+PCFCQY K+PSLK Y+
Sbjct  19   AACNPSELMACSSSILQSKPPTAQCCAKLKEQQPCFCQYKKDPSLKGYI  67



>ref|NP_001078379.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
 gb|AEE83189.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
Length=95

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkvasa  427
             +A C +  L  C SA T+G+P S+ CC++L EQ+ CFC+YLK+P +  Y++ AK + +A
Sbjct  28   ENATCVMANLQICKSAVTTGNPHSKECCEKLKEQQSCFCEYLKDPLVVPYITYAKIILAA  87

Query  428  ckvsIPNC  451
            C +S PNC
Sbjct  88   CGLSFPNC  95



>gb|ACM78626.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=94

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +A C+  QL+ C  A T G  PS+ CC +L  Q+PC C+Y ++P L++Y+
Sbjct  27   AATCNPIQLSACAGAITGGGSPSRSCCSKLRAQRPCLCRYYRDPRLRRYV  76



>ref|NP_001150566.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACF85955.1| unknown [Zea mays]
 gb|ACF88293.1| unknown [Zea mays]
 gb|ACG39591.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|AFW79027.1| nonspecific lipid-transfer protein [Zea mays]
Length=101

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  272  QLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            QLTPC  A    SPP+  CC RL EQ+PC C Y ++P L++Y+
Sbjct  40   QLTPCAGAIIGSSPPTAACCSRLREQQPCLCTYARDPKLQRYV  82



>ref|XP_002440195.1| hypothetical protein SORBIDRAFT_09g027590 [Sorghum bicolor]
 gb|EES18625.1| hypothetical protein SORBIDRAFT_09g027590 [Sorghum bicolor]
Length=97

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  272  QLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            QLTPC  A    SPP+  CC RL EQ+PC C Y ++P+L++Y+
Sbjct  36   QLTPCAGAIIGSSPPTAACCSRLKEQQPCLCTYARDPNLQRYV  78



>sp|P82901.1|NLT2P_WHEAT RecName: Full=Non-specific lipid-transfer protein 2P; Short=LTP2P; 
AltName: Full=7 kDa lipid transfer protein 2; AltName: 
Full=Lipid transfer protein 2 isoform 2; Short=LTP2-2 [Triticum 
aestivum]
Length=67

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  257  ACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            AC   QL  C SA  SG+ PS  CC  L  Q+PCFCQY K+P+  QY+
Sbjct  1    ACQASQLAVCASAILSGAKPSGECCGNLRAQQPCFCQYAKDPTYGQYI  48



>ref|XP_010279351.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nelumbo 
nucifera]
Length=92

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  SAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            +  C   +L  C SA TS + PS++CC +L EQ+PC C+YLK+P+L++ +
Sbjct  24   AVVCRPTELASCASAITSSAAPSKMCCSKLKEQRPCLCKYLKDPNLQKLI  73



>ref|XP_002466001.1| hypothetical protein SORBIDRAFT_01g049830 [Sorghum bicolor]
 gb|EER92999.1| hypothetical protein SORBIDRAFT_01g049830 [Sorghum bicolor]
Length=92

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            S+A+C+  QLT C SA  SG+ PS  CC  L  Q+ C CQ+ KNP+  +Y+
Sbjct  23   SAASCNAGQLTVCASAMLSGAAPSAACCSNLKAQQGCLCQFAKNPAYARYV  73



>ref|XP_010475550.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=99

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
             AC V  L  CL A  +G PPS  CC+ L +Q+ C C Y+KNPS+ +YL
Sbjct  34   VACVVTDLQVCLPALETGRPPSTECCRNLKKQQSCLCDYMKNPSIDKYL  82



>gb|EMS52279.1| Non-specific lipid-transfer protein 2G [Triticum urartu]
Length=92

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  248  SSAACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            + AAC+V QL  C SA   G+ PS  CC  L  Q+ CFCQY+K+P+   Y+
Sbjct  23   ARAACEVTQLAMCASAILGGTKPSGECCGNLRAQQGCFCQYVKDPNYGHYV  73



>ref|XP_003624381.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES80599.1| Lipid transfer protein [Medicago truncatula]
Length=95

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +2

Query  260  CDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYL  400
            CD  +L PC  A    S PS  CC +L EQ PCFC+Y+++P   QY+
Sbjct  29   CDPNELLPCAGAIIFNSTPSAECCSKLREQTPCFCEYIRDPDYSQYV  75



>ref|NP_973968.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 dbj|BAD94457.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31983.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=96

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  254  AACDVQQLTPCLSAFTSGSPPSQLCCQRLNEQKPCFCQYLKNPSLKQYLsaakkvasack  433
            A CD  +   C     +GSPPS+ CC++L EQ+ C C YL +PS+ QY+  AK+V  AC 
Sbjct  30   ATCDFTKFQVCKPEIITGSPPSEECCEKLKEQQSCLCAYLISPSISQYIGNAKRVIRACG  89

Query  434  vsIPNC  451
            +  PNC
Sbjct  90   IPFPNC  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3721193409042