BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79338_g1_i1 len=1041 path=[1:0-1040]

Length=1041
                                                                      Score     E

emb|CDP09227.1|  unnamed protein product                                169   6e-45   
ref|XP_002278456.1|  PREDICTED: uncharacterized protein LOC100246669    162   1e-42   Vitis vinifera
ref|XP_010257080.1|  PREDICTED: two-component response regulator ...    162   2e-42   
emb|CBI15915.3|  unnamed protein product                                154   1e-41   
ref|XP_002313237.2|  hypothetical protein POPTR_0009s07890g             157   6e-41   Populus trichocarpa [western balsam poplar]
ref|XP_010264567.1|  PREDICTED: uncharacterized protein LOC104602...    157   1e-40   
ref|XP_011024915.1|  PREDICTED: probable transcription factor KAN...    157   2e-40   
ref|XP_002299997.1|  hypothetical protein POPTR_0001s28690g             156   2e-40   Populus trichocarpa [western balsam poplar]
gb|KDO66970.1|  hypothetical protein CISIN_1g041956mg                   145   4e-39   
ref|XP_011024914.1|  PREDICTED: probable transcription factor KAN...    152   9e-39   
ref|XP_007016942.1|  Myb HTH transcriptional regulator family pro...    151   1e-38   
ref|XP_006425115.1|  hypothetical protein CICLE_v10029989mg             151   1e-38   
ref|XP_009621839.1|  PREDICTED: uncharacterized protein LOC104113394    151   3e-38   
ref|XP_010264568.1|  PREDICTED: uncharacterized protein LOC104602...    149   5e-38   
ref|XP_011003744.1|  PREDICTED: probable transcription factor KAN4      149   8e-38   
ref|XP_011024916.1|  PREDICTED: probable transcription factor KAN...    149   9e-38   
ref|XP_006852395.1|  hypothetical protein AMTR_s00021p00013790          150   2e-37   
ref|XP_002268055.1|  PREDICTED: putative Myb family transcription...    148   3e-37   Vitis vinifera
ref|XP_010264566.1|  PREDICTED: two-component response regulator ...    147   5e-37   
emb|CBI18131.3|  unnamed protein product                                147   6e-37   
ref|XP_008369283.1|  PREDICTED: uncharacterized protein LOC103432854    147   7e-37   
ref|XP_008806053.1|  PREDICTED: putative Myb family transcription...    140   1e-36   
ref|XP_010257082.1|  PREDICTED: uncharacterized protein LOC104597310    146   1e-36   
ref|XP_007008903.1|  Myb-like HTH transcriptional regulator famil...    146   2e-36   
ref|XP_004302585.1|  PREDICTED: uncharacterized protein LOC101295055    145   2e-36   
ref|XP_008363851.1|  PREDICTED: uncharacterized protein LOC103427569    144   3e-36   
ref|XP_009376409.1|  PREDICTED: two-component response regulator ...    144   4e-36   
ref|XP_010922593.1|  PREDICTED: uncharacterized protein LOC105045...    144   6e-36   
emb|CDP13985.1|  unnamed protein product                                145   6e-36   
ref|XP_008243158.1|  PREDICTED: transcription repressor KAN1-like       144   6e-36   
ref|XP_007159455.1|  hypothetical protein PHAVU_002G239100g             144   7e-36   
ref|XP_011076824.1|  PREDICTED: uncharacterized protein LOC105160975    142   1e-35   
emb|CBI21992.3|  unnamed protein product                                141   1e-35   
ref|XP_010505450.1|  PREDICTED: two-component response regulator ...    142   2e-35   
ref|XP_002273049.2|  PREDICTED: uncharacterized protein LOC100263821    143   2e-35   Vitis vinifera
ref|XP_006294540.1|  hypothetical protein CARUB_v10023575mg             142   2e-35   
ref|XP_010517118.1|  PREDICTED: two-component response regulator ...    142   4e-35   
ref|XP_009804663.1|  PREDICTED: two-component response regulator ...    142   4e-35   
ref|XP_008439740.1|  PREDICTED: transcription repressor KAN1-like...    139   5e-35   
ref|XP_009369202.1|  PREDICTED: uncharacterized protein LOC103958635    142   6e-35   
ref|XP_002534265.1|  conserved hypothetical protein                     137   6e-35   Ricinus communis
ref|XP_006585172.1|  PREDICTED: uncharacterized protein LOC100787...    142   7e-35   
ref|XP_008448246.1|  PREDICTED: probable transcription factor KAN...    136   7e-35   
ref|XP_002881577.1|  DNA binding protein                                140   8e-35   
ref|XP_008233790.1|  PREDICTED: uncharacterized protein LOC103332813    141   8e-35   
ref|XP_006411030.1|  hypothetical protein EUTSA_v10016890mg             140   9e-35   
ref|XP_003524206.1|  PREDICTED: two-component response regulator ...    142   9e-35   
gb|KHN06404.1|  Putative Myb family transcription factor                142   1e-34   
gb|KEH38868.1|  myb-like DNA-binding domain, shaqkyf class protein      140   1e-34   
ref|XP_010509196.1|  PREDICTED: two-component response regulator ...    140   1e-34   
gb|KEH38867.1|  myb-like DNA-binding domain, shaqkyf class protein      141   1e-34   
ref|XP_008439738.1|  PREDICTED: myb-like protein H isoform X2           139   1e-34   
ref|XP_007220942.1|  hypothetical protein PRUPE_ppa025397mg             140   1e-34   
gb|KDP44725.1|  hypothetical protein JCGZ_01225                         140   1e-34   
ref|XP_010031180.1|  PREDICTED: uncharacterized protein LOC104421051    141   2e-34   
gb|KGN49310.1|  hypothetical protein Csa_6G519620                       140   2e-34   
ref|XP_010032996.1|  PREDICTED: uncharacterized protein LOC104422379    141   2e-34   
emb|CBI25446.3|  unnamed protein product                                142   2e-34   
ref|XP_006449512.1|  hypothetical protein CICLE_v10017867mg             136   2e-34   
ref|XP_004305446.1|  PREDICTED: uncharacterized protein LOC101299510    141   2e-34   
gb|KDO77871.1|  hypothetical protein CISIN_1g035517mg                   134   2e-34   
ref|XP_011035900.1|  PREDICTED: putative two-component response r...    140   3e-34   
ref|XP_006585171.1|  PREDICTED: uncharacterized protein LOC100787...    141   3e-34   
ref|XP_008439737.1|  PREDICTED: myb-like protein H isoform X1           139   3e-34   
ref|XP_010907869.1|  PREDICTED: transcription activator GLK2-like...    139   3e-34   
ref|XP_007149732.1|  hypothetical protein PHAVU_005G094600g             139   3e-34   
ref|XP_010109885.1|  Putative Myb family transcription factor           139   4e-34   
ref|XP_007026615.1|  Myb-like HTH transcriptional regulator famil...    139   4e-34   
ref|XP_006594818.1|  PREDICTED: probable transcription factor KAN...    139   4e-34   
ref|XP_010937910.1|  PREDICTED: uncharacterized protein LOC105057131    139   4e-34   
emb|CDP06448.1|  unnamed protein product                                139   4e-34   
gb|KDP21103.1|  hypothetical protein JCGZ_21574                         139   4e-34   
ref|XP_004504295.1|  PREDICTED: two-component response regulator ...    140   5e-34   
ref|XP_010922591.1|  PREDICTED: uncharacterized protein LOC105045...    139   5e-34   
ref|XP_010105426.1|  Putative Myb family transcription factor           140   5e-34   
ref|XP_010517119.1|  PREDICTED: uncharacterized protein LOC104792...    138   5e-34   
ref|XP_011085124.1|  PREDICTED: uncharacterized protein LOC105167199    138   5e-34   
gb|KHN36703.1|  Putative Myb family transcription factor                139   5e-34   
ref|XP_010505451.1|  PREDICTED: two-component response regulator ...    138   5e-34   
ref|XP_011001163.1|  PREDICTED: uncharacterized protein LOC105108499    139   5e-34   
ref|XP_010509197.1|  PREDICTED: uncharacterized protein LOC104785...    138   5e-34   
ref|XP_010657046.1|  PREDICTED: uncharacterized protein LOC104880828    140   8e-34   
gb|EPS58795.1|  hypothetical protein M569_16018                         135   8e-34   
emb|CDX74898.1|  BnaA05g06440D                                          138   8e-34   
ref|XP_009143403.1|  PREDICTED: putative Myb family transcription...    138   8e-34   
ref|XP_006592875.1|  PREDICTED: uncharacterized protein LOC102668520    138   9e-34   
ref|XP_006378651.1|  hypothetical protein POPTR_0010s19310g             138   9e-34   
emb|CDX91442.1|  BnaC04g07080D                                          138   1e-33   
gb|KHN27949.1|  Putative Myb family transcription factor                138   1e-33   
ref|XP_010276999.1|  PREDICTED: uncharacterized protein LOC104611575    139   1e-33   
ref|XP_003532757.2|  PREDICTED: uncharacterized protein LOC100787...    139   1e-33   
ref|XP_004487568.1|  PREDICTED: uncharacterized protein LOC101500041    138   1e-33   
ref|XP_008228924.1|  PREDICTED: uncharacterized protein LOC103328...    139   1e-33   
ref|XP_009791663.1|  PREDICTED: uncharacterized protein LOC104238...    138   1e-33   
ref|XP_002312172.1|  myb family transcription factor family protein     137   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007025361.1|  Myb-like HTH transcriptional regulator famil...    138   1e-33   
ref|XP_011095220.1|  PREDICTED: uncharacterized protein LOC105174731    138   1e-33   
gb|KDP22851.1|  hypothetical protein JCGZ_00438                         137   2e-33   
gb|KCW52514.1|  hypothetical protein EUGRSUZ_J01904                     131   2e-33   
ref|XP_007216041.1|  hypothetical protein PRUPE_ppa017500mg             134   2e-33   
emb|CAN60070.1|  hypothetical protein VITISV_022944                     132   2e-33   Vitis vinifera
ref|XP_009791664.1|  PREDICTED: uncharacterized protein LOC104238...    137   2e-33   
ref|XP_009611229.1|  PREDICTED: uncharacterized protein LOC104104...    137   2e-33   
ref|XP_011046839.1|  PREDICTED: putative Myb family transcription...    137   2e-33   
ref|XP_007048707.1|  Myb-like HTH transcriptional regulator famil...    137   3e-33   
ref|XP_008464219.1|  PREDICTED: probable transcription factor KAN...    135   3e-33   
ref|XP_008781403.1|  PREDICTED: probable transcription factor KAN2      132   3e-33   
ref|XP_009611230.1|  PREDICTED: putative two-component response r...    137   4e-33   
ref|XP_002323602.2|  hypothetical protein POPTR_0016s12940g             137   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010693076.1|  PREDICTED: two-component response regulator ...    137   4e-33   
ref|XP_008359800.1|  PREDICTED: uncharacterized protein LOC103423495    135   4e-33   
ref|XP_010529031.1|  PREDICTED: uncharacterized protein LOC104806008    136   4e-33   
ref|XP_004307667.1|  PREDICTED: uncharacterized protein LOC101309095    137   4e-33   
ref|XP_010052783.1|  PREDICTED: uncharacterized protein LOC104441352    137   4e-33   
ref|XP_007148039.1|  hypothetical protein PHAVU_006G175300g             136   4e-33   
ref|NP_181364.2|  myb-like HTH transcriptional regulator-like pro...    136   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464217.1|  PREDICTED: probable transcription factor KAN...    135   5e-33   
gb|KHN01942.1|  Putative Myb family transcription factor                135   5e-33   
ref|XP_006573379.1|  PREDICTED: uncharacterized protein LOC102660...    135   5e-33   
ref|XP_009345244.1|  PREDICTED: uncharacterized protein LOC103937...    136   6e-33   
ref|XP_007207102.1|  hypothetical protein PRUPE_ppa021179mg             135   6e-33   
ref|XP_010092813.1|  Putative Myb family transcription factor           136   6e-33   
emb|CDO96808.1|  unnamed protein product                                136   6e-33   
gb|AAT64038.1|  putative MYB transcription factor                       135   6e-33   Gossypium hirsutum [American cotton]
ref|XP_003629774.1|  Myb family transcription factor APL                137   7e-33   
ref|XP_006435783.1|  hypothetical protein CICLE_v10032941mg             130   7e-33   
gb|KEH20674.1|  MYB-like transcription factor family protein            137   7e-33   
ref|XP_008225297.1|  PREDICTED: transcription activator GLK1-like       136   8e-33   
ref|XP_006411281.1|  hypothetical protein EUTSA_v10016733mg             136   9e-33   
ref|XP_006597479.1|  PREDICTED: uncharacterized protein LOC100787...    135   1e-32   
gb|KHF99142.1|  hypothetical protein F383_20210                         135   1e-32   
ref|XP_008448244.1|  PREDICTED: uncharacterized protein LOC103490...    136   1e-32   
ref|XP_007134813.1|  hypothetical protein PHAVU_010G078400g             134   1e-32   
gb|KDO68898.1|  hypothetical protein CISIN_1g029903mg                   130   1e-32   
ref|XP_004162479.1|  PREDICTED: uncharacterized LOC101205384            135   1e-32   
ref|XP_004150753.1|  PREDICTED: uncharacterized protein LOC101205384    135   1e-32   
gb|ACD56656.1|  putative MYB transcription factor                       135   1e-32   Gossypioides kirkii
ref|XP_003577159.1|  PREDICTED: two-component response regulator ...    134   1e-32   
emb|CBI30694.3|  unnamed protein product                                136   1e-32   
ref|XP_002528326.1|  DNA binding protein, putative                      135   1e-32   Ricinus communis
ref|XP_010925633.1|  PREDICTED: uncharacterized protein LOC105048124    136   2e-32   
ref|XP_006467640.1|  PREDICTED: uncharacterized protein LOC102609915    135   2e-32   
ref|XP_009337761.1|  PREDICTED: LOW QUALITY PROTEIN: putative two...    134   2e-32   
ref|XP_006663711.1|  PREDICTED: transcription activator GLK2-like       133   2e-32   
ref|XP_010999741.1|  PREDICTED: uncharacterized protein LOC105107499    135   2e-32   
ref|XP_010655530.1|  PREDICTED: uncharacterized protein LOC104880...    136   2e-32   
ref|XP_010274476.1|  PREDICTED: uncharacterized protein LOC104609785    135   2e-32   
ref|XP_004233059.1|  PREDICTED: two-component response regulator ...    134   2e-32   
ref|XP_009767509.1|  PREDICTED: two-component response regulator ...    134   2e-32   
ref|XP_010655529.1|  PREDICTED: uncharacterized protein LOC104880...    135   2e-32   
ref|XP_010037685.1|  PREDICTED: uncharacterized protein LOC104426365    134   3e-32   
ref|XP_008374230.1|  PREDICTED: uncharacterized protein LOC103437...    135   3e-32   
ref|XP_006663145.1|  PREDICTED: transcription activator GLK2-like       133   3e-32   
ref|XP_002316821.1|  myb family transcription factor family protein     129   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008790063.1|  PREDICTED: uncharacterized protein LOC103707382    136   3e-32   
ref|XP_006362389.1|  PREDICTED: uncharacterized protein LOC102585011    134   3e-32   
ref|XP_004148628.1|  PREDICTED: probable transcription factor KAN...    130   3e-32   
ref|XP_004492477.1|  PREDICTED: putative Myb family transcription...    133   3e-32   
gb|EMT27812.1|  Putative Myb family transcription factor                135   4e-32   
ref|XP_006597478.1|  PREDICTED: uncharacterized protein LOC100787...    134   4e-32   
ref|XP_009607761.1|  PREDICTED: putative Myb family transcription...    134   4e-32   
ref|XP_003520352.1|  PREDICTED: uncharacterized protein LOC100801120    133   4e-32   
gb|EMT11720.1|  Putative Myb family transcription factor                133   5e-32   
ref|XP_006583665.1|  PREDICTED: uncharacterized protein LOC102662...    133   5e-32   
ref|XP_002988200.1|  hypothetical protein SELMODRAFT_426960             134   6e-32   
ref|XP_009759227.1|  PREDICTED: putative Myb family transcription...    133   6e-32   
ref|XP_008228923.1|  PREDICTED: uncharacterized protein LOC103328...    134   6e-32   
ref|XP_011101395.1|  PREDICTED: two-component response regulator ...    134   6e-32   
gb|KDO63386.1|  hypothetical protein CISIN_1g038268mg                   131   6e-32   
ref|XP_009421270.1|  PREDICTED: uncharacterized protein LOC104000...    134   7e-32   
ref|XP_009421269.1|  PREDICTED: uncharacterized protein LOC104000...    134   7e-32   
ref|XP_002963490.1|  hypothetical protein SELMODRAFT_438636             134   8e-32   
ref|XP_009352761.1|  PREDICTED: uncharacterized protein LOC103944086    133   8e-32   
gb|KGN54397.1|  hypothetical protein Csa_4G312300                       132   9e-32   
ref|XP_009350428.1|  PREDICTED: uncharacterized protein LOC103941921    133   9e-32   
ref|XP_008356062.1|  PREDICTED: uncharacterized protein LOC103419745    132   1e-31   
ref|XP_006594551.1|  PREDICTED: uncharacterized protein LOC102669757    132   1e-31   
emb|CDP05632.1|  unnamed protein product                                132   1e-31   
ref|XP_010907868.1|  PREDICTED: transcription activator GLK2-like...    132   1e-31   
dbj|BAK04843.1|  predicted protein                                      132   1e-31   
ref|XP_006486285.1|  PREDICTED: uncharacterized protein LOC102620939    132   1e-31   
ref|XP_008794301.1|  PREDICTED: uncharacterized protein LOC103710387    132   1e-31   
ref|XP_010322167.1|  PREDICTED: putative two-component response r...    132   1e-31   
ref|XP_006602682.1|  PREDICTED: two-component response regulator ...    132   1e-31   
ref|XP_006469002.1|  PREDICTED: uncharacterized protein LOC102628788    132   1e-31   
ref|XP_010104403.1|  Putative Myb family transcription factor           133   1e-31   
ref|XP_006429461.1|  hypothetical protein CICLE_v10011992mg             132   1e-31   
ref|XP_010920993.1|  PREDICTED: uncharacterized protein LOC105044...    131   2e-31   
gb|KDO56741.1|  hypothetical protein CISIN_1g017464mg                   132   2e-31   
ref|XP_008353366.1|  PREDICTED: uncharacterized protein LOC103416937    132   2e-31   
ref|XP_008341218.1|  PREDICTED: uncharacterized protein LOC103404135    132   2e-31   
ref|XP_008805079.1|  PREDICTED: uncharacterized protein LOC103718164    130   2e-31   
ref|XP_006446804.1|  hypothetical protein CICLE_v10015819mg             131   2e-31   
ref|XP_004234092.1|  PREDICTED: uncharacterized protein LOC101251954    130   2e-31   
ref|XP_010322168.1|  PREDICTED: putative two-component response r...    132   2e-31   
ref|XP_006583667.1|  PREDICTED: uncharacterized protein LOC102662...    131   2e-31   
gb|AES79549.2|  MYB-like transcription factor family protein            131   2e-31   
ref|XP_004492478.1|  PREDICTED: putative Myb family transcription...    130   2e-31   
ref|XP_010915504.1|  PREDICTED: two-component response regulator ...    133   2e-31   
ref|XP_003623331.1|  Two-component response regulator ARR10             131   3e-31   
ref|XP_010915503.1|  PREDICTED: two-component response regulator ...    133   3e-31   
ref|XP_010554678.1|  PREDICTED: two-component response regulator ...    132   3e-31   
ref|XP_008371480.1|  PREDICTED: uncharacterized protein LOC103434890    132   3e-31   
ref|XP_006353444.1|  PREDICTED: uncharacterized protein LOC102588048    131   3e-31   
ref|XP_009802187.1|  PREDICTED: uncharacterized protein LOC104247786    132   3e-31   
ref|XP_009141879.1|  PREDICTED: two-component response regulator ...    132   3e-31   
ref|XP_010907870.1|  PREDICTED: transcription activator GLK2-like...    130   4e-31   
ref|XP_009141878.1|  PREDICTED: serine/threonine-protein kinase p...    132   4e-31   
ref|XP_010534614.1|  PREDICTED: uncharacterized protein LOC104810118    131   4e-31   
ref|XP_002442650.1|  hypothetical protein SORBIDRAFT_08g000510          131   4e-31   Sorghum bicolor [broomcorn]
emb|CDY07070.1|  BnaA04g22450D                                          131   4e-31   
ref|XP_004249715.1|  PREDICTED: uncharacterized protein LOC101244920    129   4e-31   
ref|XP_006363620.1|  PREDICTED: putative Myb family transcription...    129   4e-31   
emb|CDY52431.1|  BnaC03g72550D                                          131   6e-31   
ref|XP_009622809.1|  PREDICTED: uncharacterized protein LOC104114139    129   6e-31   
ref|XP_011039440.1|  PREDICTED: uncharacterized protein LOC105136003    130   7e-31   
ref|XP_007140226.1|  hypothetical protein PHAVU_008G094800g             130   8e-31   
ref|XP_011025033.1|  PREDICTED: putative Myb family transcription...    129   8e-31   
ref|XP_010680052.1|  PREDICTED: uncharacterized protein LOC104895284    130   8e-31   
ref|XP_009410557.1|  PREDICTED: uncharacterized protein LOC103992543    129   9e-31   
ref|XP_002985847.1|  hypothetical protein SELMODRAFT_424890             129   9e-31   
ref|XP_002984784.1|  hypothetical protein SELMODRAFT_423935             129   1e-30   
ref|XP_006648492.1|  PREDICTED: centrosomal and chromosomal facto...    131   1e-30   
gb|KFK36916.1|  hypothetical protein AALP_AA4G189400                    130   1e-30   
ref|XP_010918327.1|  PREDICTED: transcription repressor KAN1-like...    128   1e-30   
emb|CDX93206.1|  BnaC04g46900D                                          130   1e-30   
ref|XP_010676795.1|  PREDICTED: uncharacterized protein LOC104892...    129   2e-30   
ref|XP_009613587.1|  PREDICTED: uncharacterized protein LOC104106691    129   2e-30   
ref|XP_010508888.1|  PREDICTED: putative two-component response r...    130   2e-30   
ref|NP_001065933.1|  Os12g0105600                                       128   2e-30   Oryza sativa Japonica Group [Japonica rice]
gb|KEH20675.1|  MYB-like transcription factor family protein            130   2e-30   
emb|CDP05400.1|  unnamed protein product                                128   2e-30   
ref|XP_002881704.1|  hypothetical protein ARALYDRAFT_321718             129   2e-30   
ref|XP_010517442.1|  PREDICTED: uncharacterized protein LOC104792882    129   2e-30   
ref|XP_010234086.1|  PREDICTED: uncharacterized protein LOC104583488    130   2e-30   
gb|AAD25941.1|AF085279_14  hypothetical cytoskeletal protein            129   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|EAY81968.1|  hypothetical protein OsI_37145                          128   2e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_009409397.1|  PREDICTED: uncharacterized protein LOC103991...    130   3e-30   
ref|XP_009409396.1|  PREDICTED: uncharacterized protein LOC103991...    130   3e-30   
ref|XP_010918329.1|  PREDICTED: transcription repressor KAN1-like...    127   3e-30   
ref|XP_003577903.2|  PREDICTED: two-component response regulator ...    129   3e-30   
ref|XP_010505750.1|  PREDICTED: putative two-component response r...    129   3e-30   
ref|XP_006378423.1|  hypothetical protein POPTR_0010s10990g             124   3e-30   
gb|EAY85155.1|  hypothetical protein OsI_06510                          130   3e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_009409395.1|  PREDICTED: uncharacterized protein LOC103991...    130   3e-30   
ref|NP_181555.1|  myb family transcription factor                       129   3e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD28879.1|  myb family transcription factor-like                   130   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004951340.1|  PREDICTED: uncharacterized protein LOC101755438    129   4e-30   
ref|XP_006294294.1|  hypothetical protein CARUB_v10023302mg             129   4e-30   
ref|XP_006855946.1|  hypothetical protein AMTR_s00037p00221530          122   4e-30   
ref|XP_009345251.1|  PREDICTED: uncharacterized protein LOC103937...    128   4e-30   
ref|XP_006355021.1|  PREDICTED: putative Myb family transcription...    127   4e-30   
ref|XP_006355020.1|  PREDICTED: putative Myb family transcription...    127   4e-30   
ref|XP_004965558.1|  PREDICTED: uncharacterized protein LOC101779064    129   4e-30   
ref|XP_007153120.1|  hypothetical protein PHAVU_003G008400g             127   4e-30   
ref|XP_001762580.1|  predicted protein                                  130   5e-30   
ref|XP_011070508.1|  PREDICTED: putative Myb family transcription...    126   5e-30   
ref|XP_009133426.1|  PREDICTED: uncharacterized protein LOC103857923    128   6e-30   
ref|XP_010920938.1|  PREDICTED: uncharacterized protein LOC105044662    129   6e-30   
gb|EAZ01264.1|  hypothetical protein OsI_23288                          129   6e-30   Oryza sativa Indica Group [Indian rice]
gb|KEH36604.1|  myb-like DNA-binding domain, shaqkyf class protein      127   6e-30   
ref|XP_003636803.1|  Myb family transcription factor APL                127   7e-30   
ref|XP_010270741.1|  PREDICTED: putative Myb family transcription...    126   7e-30   
ref|XP_010676796.1|  PREDICTED: uncharacterized protein LOC104892...    127   7e-30   
gb|EMT09351.1|  Putative Myb family transcription factor                126   7e-30   
ref|XP_008645578.1|  PREDICTED: uncharacterized protein LOC103627002    129   7e-30   
ref|XP_004246781.1|  PREDICTED: probable transcription factor KAN2      122   7e-30   
emb|CDY07612.1|  BnaA03g18990D                                          127   8e-30   
ref|XP_002451851.1|  hypothetical protein SORBIDRAFT_04g008670          129   8e-30   Sorghum bicolor [broomcorn]
gb|KHG15273.1|  hypothetical protein F383_06292                         126   8e-30   
ref|XP_009345257.1|  PREDICTED: uncharacterized protein LOC103937...    127   9e-30   
ref|XP_002438524.1|  hypothetical protein SORBIDRAFT_10g021360          128   9e-30   Sorghum bicolor [broomcorn]
ref|XP_002450099.1|  hypothetical protein SORBIDRAFT_05g000480          127   9e-30   Sorghum bicolor [broomcorn]
ref|XP_002983552.1|  hypothetical protein SELMODRAFT_422768             127   1e-29   
ref|XP_002973839.1|  hypothetical protein SELMODRAFT_414222             127   1e-29   
ref|XP_010920992.1|  PREDICTED: uncharacterized protein LOC105044...    126   1e-29   
ref|XP_010651000.1|  PREDICTED: putative Myb family transcription...    125   1e-29   
ref|NP_001057810.1|  Os06g0543200                                       128   1e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EYU41938.1|  hypothetical protein MIMGU_mgv1a020265mg                127   1e-29   
ref|XP_006656146.1|  PREDICTED: uncharacterized protein LOC102715027    128   1e-29   
gb|KDP38204.1|  hypothetical protein JCGZ_04847                         125   1e-29   
ref|XP_002521884.1|  conserved hypothetical protein                     125   2e-29   
ref|XP_007213573.1|  hypothetical protein PRUPE_ppa015662mg             120   2e-29   
ref|XP_008374237.1|  PREDICTED: uncharacterized protein LOC103437...    127   2e-29   
ref|XP_008649161.1|  PREDICTED: uncharacterized protein LOC103629847    127   2e-29   
emb|CAN63286.1|  hypothetical protein VITISV_025194                     125   2e-29   
ref|XP_008659607.1|  PREDICTED: uncharacterized protein LOC103638481    127   2e-29   
ref|XP_011021697.1|  PREDICTED: putative Myb family transcription...    125   2e-29   
ref|XP_008374244.1|  PREDICTED: transcription factor LUX-like iso...    126   2e-29   
gb|AFW76554.1|  putative MYB DNA-binding domain superfamily protein     127   2e-29   
gb|AFW86750.1|  putative MYB DNA-binding domain superfamily protein     127   2e-29   
ref|XP_002281928.1|  PREDICTED: myb family transcription factor A...    125   2e-29   
ref|XP_010517804.1|  PREDICTED: putative two-component response r...    122   2e-29   
ref|XP_007045387.1|  Homeodomain-like superfamily protein, putati...    125   3e-29   
ref|XP_004236899.2|  PREDICTED: putative Myb family transcription...    124   4e-29   
ref|NP_001136957.1|  putative MYB DNA-binding domain superfamily ...    125   4e-29   
gb|ABA91074.1|  myb-like DNA-binding domain, SHAQKYF class family...    124   4e-29   
ref|XP_010940260.1|  PREDICTED: uncharacterized protein LOC105058895    124   4e-29   
gb|ADO79619.1|  myb-like DNA-binding domain-containing protein          124   4e-29   
ref|NP_001169950.1|  uncharacterized protein LOC100383849               125   4e-29   
ref|XP_009605835.1|  PREDICTED: putative Myb family transcription...    124   5e-29   
ref|XP_010043897.1|  PREDICTED: uncharacterized protein LOC104432988    124   5e-29   
ref|XP_010517802.1|  PREDICTED: two-component response regulator ...    123   5e-29   
ref|XP_008804408.1|  PREDICTED: putative Myb family transcription...    124   5e-29   
ref|XP_009386097.1|  PREDICTED: uncharacterized protein LOC103973299    124   5e-29   
ref|XP_004293956.1|  PREDICTED: uncharacterized protein LOC101298396    125   5e-29   
ref|XP_010529836.1|  PREDICTED: putative Myb family transcription...    122   5e-29   
ref|XP_002518461.1|  DNA binding protein, putative                      124   6e-29   
ref|XP_009383036.1|  PREDICTED: transcription repressor KAN1-like       124   6e-29   
ref|XP_010935361.1|  PREDICTED: uncharacterized protein LOC105055282    124   6e-29   
ref|XP_007147718.1|  hypothetical protein PHAVU_006G149000g             123   7e-29   
ref|XP_010057109.1|  PREDICTED: uncharacterized protein LOC104445014    125   7e-29   
ref|XP_008340525.1|  PREDICTED: putative Myb family transcription...    123   8e-29   
ref|XP_008667376.1|  PREDICTED: uncharacterized protein LOC100217...    124   8e-29   
ref|XP_008812783.1|  PREDICTED: putative Myb family transcription...    123   8e-29   
ref|XP_009389791.1|  PREDICTED: putative two-component response r...    124   8e-29   
ref|XP_004486311.1|  PREDICTED: probable transcription factor KAN...    121   9e-29   
emb|CBI14787.3|  unnamed protein product                                117   9e-29   
ref|XP_006420714.1|  hypothetical protein CICLE_v100054661mg            121   1e-28   
gb|EMT28079.1|  Putative Myb family transcription factor                125   1e-28   
ref|NP_001280888.1|  putative Myb family transcription factor At1...    122   1e-28   
emb|CEA10059.1|  putative transcription repressor KAN1-like             116   1e-28   
ref|XP_010227658.1|  PREDICTED: uncharacterized protein LOC100830272    125   1e-28   
ref|XP_008220975.1|  PREDICTED: putative Myb family transcription...    122   1e-28   
ref|XP_008220974.1|  PREDICTED: putative Myb family transcription...    123   1e-28   
ref|XP_006295407.1|  hypothetical protein CARUB_v10024503mg             121   1e-28   
ref|XP_010508544.1|  PREDICTED: putative two-component response r...    122   2e-28   
ref|XP_009143231.1|  PREDICTED: uncharacterized protein LOC103866...    124   2e-28   
gb|EYU20041.1|  hypothetical protein MIMGU_mgv1a0209401mg               117   2e-28   
emb|CDX74803.1|  BnaA05g05490D                                          123   2e-28   
ref|XP_002881865.1|  myb family transcription factor                    121   2e-28   
ref|XP_009408891.1|  PREDICTED: two-component response regulator ...    124   2e-28   
ref|XP_010093351.1|  Putative Myb family transcription factor           123   2e-28   
ref|XP_008793164.1|  PREDICTED: uncharacterized protein LOC103709531    124   2e-28   
emb|CDY18860.1|  BnaC04g04900D                                          124   2e-28   
gb|KDO53576.1|  hypothetical protein CISIN_1g020303mg                   122   2e-28   
ref|XP_010908308.1|  PREDICTED: transcription repressor KAN1-like       122   2e-28   
ref|XP_009408892.1|  PREDICTED: two-component response regulator ...    124   2e-28   
ref|XP_003534706.2|  PREDICTED: probable transcription factor KAN...    121   2e-28   
ref|XP_006470870.1|  PREDICTED: uncharacterized protein LOC102607614    122   3e-28   
gb|KHN40881.1|  Putative Myb family transcription factor                121   3e-28   
ref|NP_181794.1|  homeodomain-like superfamily protein                  120   3e-28   
gb|KCW89649.1|  hypothetical protein EUGRSUZ_A01921                     118   3e-28   
ref|XP_006379799.1|  hypothetical protein POPTR_0008s14140g             116   3e-28   
ref|XP_009133548.1|  PREDICTED: uncharacterized protein LOC103858025    120   3e-28   
ref|XP_004233787.1|  PREDICTED: uncharacterized protein LOC101255...    120   3e-28   
ref|XP_010676797.1|  PREDICTED: uncharacterized protein LOC104892...    122   4e-28   
gb|EYU33887.1|  hypothetical protein MIMGU_mgv1a019410mg                116   5e-28   
ref|XP_009351623.1|  PREDICTED: LOW QUALITY PROTEIN: putative Myb...    120   5e-28   
ref|XP_008439999.1|  PREDICTED: probable transcription factor KAN...    119   5e-28   
ref|XP_010647532.1|  PREDICTED: putative two-component response r...    120   6e-28   
gb|KEH36605.1|  myb-like DNA-binding domain, shaqkyf class protein      122   6e-28   
gb|ACU23450.1|  unknown                                                 117   6e-28   
ref|XP_001773705.1|  predicted protein                                  123   7e-28   
ref|XP_009402093.1|  PREDICTED: uncharacterized protein LOC103985966    121   8e-28   
gb|KEH36878.1|  myb-like DNA-binding domain, shaqkyf class protein      119   8e-28   
ref|XP_004155628.1|  PREDICTED: two-component response regulator-...    117   9e-28   
ref|XP_009803423.1|  PREDICTED: transcription repressor KAN1-like       119   9e-28   
ref|XP_009766440.1|  PREDICTED: putative Myb family transcription...    121   1e-27   
gb|KHN20340.1|  Putative Myb family transcription factor                120   1e-27   
ref|XP_010506102.1|  PREDICTED: putative Myb family transcription...    119   1e-27   
ref|XP_007221856.1|  hypothetical protein PRUPE_ppa021540mg             120   1e-27   
gb|KHN23034.1|  Putative Myb family transcription factor                120   1e-27   
emb|CDY67147.1|  BnaA03g56690D                                          120   1e-27   
ref|XP_009766441.1|  PREDICTED: putative Myb family transcription...    120   1e-27   
ref|XP_009398908.1|  PREDICTED: uncharacterized protein LOC103983419    120   1e-27   
emb|CDY42825.1|  BnaC03g23810D                                          120   1e-27   
gb|KHN28868.1|  Putative transcription factor KAN2                      120   1e-27   
ref|XP_007045388.1|  Homeodomain-like superfamily protein, putati...    120   1e-27   
gb|KGN49100.1|  hypothetical protein Csa_6G513640                       118   1e-27   
gb|KGN50826.1|  hypothetical protein Csa_5G276460                       119   2e-27   
gb|KHG02728.1|  hypothetical protein F383_24858                         119   2e-27   
ref|XP_008460209.1|  PREDICTED: putative Myb family transcription...    119   2e-27   
ref|XP_006411533.1|  hypothetical protein EUTSA_v10017090mg             119   2e-27   
ref|XP_007142823.1|  hypothetical protein PHAVU_007G019900g             119   2e-27   
ref|XP_010316579.1|  PREDICTED: putative two-component response r...    118   2e-27   
ref|XP_008384248.1|  PREDICTED: uncharacterized protein LOC103446871    121   2e-27   
ref|XP_007026111.1|  Homeodomain-like superfamily protein               114   2e-27   
gb|KFK37114.1|  myb family transcription factor                         118   3e-27   
ref|XP_008460208.1|  PREDICTED: putative Myb family transcription...    119   3e-27   
ref|XP_011008685.1|  PREDICTED: uncharacterized protein LOC105114001    119   3e-27   
ref|XP_011047027.1|  PREDICTED: uncharacterized protein LOC105141490    119   3e-27   
ref|XP_004498202.1|  PREDICTED: uncharacterized protein LOC101495986    118   4e-27   
ref|XP_010099195.1|  Putative Myb family transcription factor           119   4e-27   
ref|XP_009623365.1|  PREDICTED: putative Myb family transcription...    117   4e-27   
ref|XP_006597590.1|  PREDICTED: putative Myb family transcription...    118   4e-27   
gb|KHN33018.1|  Putative Myb family transcription factor                117   4e-27   
gb|EYU28094.1|  hypothetical protein MIMGU_mgv1a011823mg                117   5e-27   
ref|XP_011086192.1|  PREDICTED: uncharacterized protein LOC105167992    118   5e-27   
gb|KCW76997.1|  hypothetical protein EUGRSUZ_D01346                     113   5e-27   
ref|XP_006605453.1|  PREDICTED: putative Myb family transcription...    118   5e-27   
gb|KHN37404.1|  Putative Myb family transcription factor                118   5e-27   
gb|KHN11480.1|  Putative Myb family transcription factor                118   5e-27   
ref|XP_008340524.1|  PREDICTED: putative Myb family transcription...    117   6e-27   
gb|KEH16339.1|  myb-like DNA-binding domain, shaqkyf class protein      117   6e-27   
ref|XP_009784028.1|  PREDICTED: uncharacterized protein LOC104232501    118   6e-27   
ref|XP_004297794.1|  PREDICTED: uncharacterized protein LOC101309246    118   7e-27   
ref|XP_003589673.1|  Myb family transcription factor APL                116   7e-27   
ref|XP_010524068.1|  PREDICTED: uncharacterized protein LOC104802...    118   7e-27   
ref|XP_006389592.1|  hypothetical protein POPTR_0021s00430g             113   7e-27   
gb|KEH44343.1|  myb-like DNA-binding domain, shaqkyf class protein      118   7e-27   
ref|XP_003530316.1|  PREDICTED: putative Myb family transcription...    117   8e-27   
ref|XP_009129176.1|  PREDICTED: putative Myb family transcription...    117   9e-27   
ref|XP_004497172.1|  PREDICTED: putative Myb family transcription...    117   1e-26   
ref|XP_009129177.1|  PREDICTED: putative Myb family transcription...    115   1e-26   
ref|XP_006855580.1|  hypothetical protein AMTR_s00044p00042560          118   1e-26   
ref|XP_009782820.1|  PREDICTED: transcription repressor KAN1-like       116   1e-26   
ref|XP_006383901.1|  hypothetical protein POPTR_0004s01060g             112   2e-26   
ref|XP_010066524.1|  PREDICTED: putative Myb family transcription...    115   2e-26   
emb|CDY71094.1|  BnaCnng71310D                                          110   3e-26   
ref|XP_006289552.1|  hypothetical protein CARUB_v10003097mg             110   3e-26   
ref|XP_009610208.1|  PREDICTED: putative Myb family transcription...    115   3e-26   
ref|XP_007212374.1|  hypothetical protein PRUPE_ppa014847mg             117   4e-26   
emb|CDY70922.1|  BnaCnng70380D                                          115   4e-26   
ref|XP_009143230.1|  PREDICTED: uncharacterized protein LOC103866...    117   4e-26   
gb|KFK33423.1|  hypothetical protein AALP_AA5G011100                    114   5e-26   
ref|XP_009143232.1|  PREDICTED: uncharacterized protein LOC103866...    116   5e-26   
ref|XP_006652650.1|  PREDICTED: uncharacterized protein LOC102700890    115   6e-26   
ref|XP_002305066.2|  hypothetical protein POPTR_0004s05660g             115   6e-26   
gb|KHN28615.1|  Putative Myb family transcription factor                115   6e-26   
ref|XP_001766166.1|  predicted protein                                  117   7e-26   
gb|KCW74118.1|  hypothetical protein EUGRSUZ_E02754                     112   7e-26   
ref|NP_565281.2|  putative transcription factor                         114   7e-26   
ref|XP_008440000.1|  PREDICTED: probable transcription factor KAN...    113   8e-26   
ref|XP_006662561.1|  PREDICTED: putative Myb family transcription...    112   8e-26   
gb|AAP54852.2|  myb-like DNA-binding domain, SHAQKYF class family...    115   9e-26   
gb|EEE51335.1|  hypothetical protein OsJ_32321                          115   1e-25   
gb|EEC67378.1|  hypothetical protein OsI_34508                          115   1e-25   
ref|XP_008439998.1|  PREDICTED: probable transcription factor KAN...    112   1e-25   
gb|AAC28774.1|  unknown protein                                         114   2e-25   
ref|XP_002875110.1|  hypothetical protein ARALYDRAFT_484129             113   2e-25   
emb|CDP04416.1|  unnamed protein product                                114   2e-25   
gb|EEE58269.1|  hypothetical protein OsJ_09275                          114   2e-25   
ref|NP_001053582.1|  Os04g0566600                                       114   2e-25   
ref|XP_009144511.1|  PREDICTED: uncharacterized protein LOC103868161    111   2e-25   
ref|XP_008224747.1|  PREDICTED: probable transcription factor KAN4      112   2e-25   
gb|ADX60114.1|  G2-like transcription factor                            115   2e-25   
ref|XP_002465930.1|  hypothetical protein SORBIDRAFT_01g048420          114   2e-25   
ref|XP_004155673.1|  PREDICTED: probable transcription factor KAN...    112   2e-25   
ref|NP_001142882.1|  uncharacterized protein LOC100275291               115   2e-25   
ref|XP_004987194.1|  PREDICTED: uncharacterized protein LOC101766248    114   3e-25   
ref|NP_001048850.1|  Os03g0129800                                       114   3e-25   
gb|AAN17397.1|  Unknown protein                                         114   3e-25   
ref|XP_004134975.1|  PREDICTED: probable transcription factor KAN...    111   3e-25   
gb|EAY95194.1|  hypothetical protein OsI_17013                          113   3e-25   
ref|XP_009114210.1|  PREDICTED: putative Myb family transcription...    112   3e-25   
gb|EAY88381.1|  hypothetical protein OsI_09839                          114   3e-25   
ref|XP_001771430.1|  predicted protein                                  116   3e-25   
ref|XP_009114209.1|  PREDICTED: putative Myb family transcription...    112   4e-25   
ref|XP_006449755.1|  hypothetical protein CICLE_v10018145mg             112   4e-25   
ref|XP_010424973.1|  PREDICTED: putative Myb family transcription...    112   4e-25   
ref|XP_006651003.1|  PREDICTED: uncharacterized protein LOC102722843    114   5e-25   
ref|XP_010424971.1|  PREDICTED: putative Myb family transcription...    112   6e-25   
ref|XP_010424972.1|  PREDICTED: putative Myb family transcription...    112   6e-25   
ref|XP_004295277.1|  PREDICTED: uncharacterized protein LOC101299365    112   6e-25   
ref|XP_010455748.1|  PREDICTED: uncharacterized protein LOC104737...    110   6e-25   
ref|XP_010527844.1|  PREDICTED: putative Myb family transcription...    112   6e-25   
ref|XP_010527845.1|  PREDICTED: putative Myb family transcription...    112   6e-25   
gb|KDP20732.1|  hypothetical protein JCGZ_21203                         111   7e-25   
ref|XP_010502218.1|  PREDICTED: putative Myb family transcription...    112   7e-25   
ref|XP_010502217.1|  PREDICTED: putative Myb family transcription...    111   8e-25   
ref|XP_010502216.1|  PREDICTED: putative Myb family transcription...    111   8e-25   
ref|XP_006395816.1|  hypothetical protein EUTSA_v10004791mg             111   9e-25   
ref|XP_003590285.1|  hypothetical protein MTR_1g051035                  107   1e-24   
ref|XP_008660542.1|  PREDICTED: uncharacterized protein LOC103639589    112   1e-24   
gb|AFW89731.1|  putative MYB DNA-binding domain superfamily protein     112   1e-24   
ref|XP_006291400.1|  hypothetical protein CARUB_v10017538mg             112   1e-24   
ref|XP_010455747.1|  PREDICTED: uncharacterized protein LOC104737...    109   1e-24   
ref|XP_006291399.1|  hypothetical protein CARUB_v10017538mg             112   1e-24   
ref|XP_008789400.1|  PREDICTED: uncharacterized protein LOC103706912    113   1e-24   
ref|XP_010467966.1|  PREDICTED: uncharacterized protein LOC104747958    109   2e-24   
ref|XP_010424974.1|  PREDICTED: putative Myb family transcription...    110   2e-24   
ref|XP_010496263.1|  PREDICTED: putative Myb family transcription...    109   2e-24   
ref|XP_010496269.1|  PREDICTED: putative Myb family transcription...    109   3e-24   
ref|XP_010476522.1|  PREDICTED: putative Myb family transcription...    109   3e-24   
ref|XP_010476523.1|  PREDICTED: putative Myb family transcription...    109   3e-24   
ref|XP_010458965.1|  PREDICTED: putative Myb family transcription...    109   3e-24   
ref|XP_010458964.1|  PREDICTED: putative Myb family transcription...    109   3e-24   
ref|XP_006359562.1|  PREDICTED: putative Myb family transcription...    105   3e-24   
ref|XP_010554357.1|  PREDICTED: putative Myb family transcription...    109   3e-24   
ref|NP_172912.3|  putative Myb family transcription factor              109   4e-24   
gb|AAF63176.1|AC010657_12  T5E21.10                                     109   4e-24   
gb|AAS79548.1|  myb family transcription factor                         108   5e-24   
ref|XP_010539026.1|  PREDICTED: putative Myb family transcription...    108   5e-24   
emb|CDY17617.1|  BnaA06g34360D                                          108   5e-24   
ref|XP_009101280.1|  PREDICTED: putative Myb family transcription...    108   5e-24   
gb|AAD20098.1|  unknown protein                                         112   6e-24   
ref|XP_002892817.1|  DNA binding protein                                108   6e-24   
gb|KFK43702.1|  hypothetical protein AALP_AA1G162200                    108   7e-24   
ref|XP_006838104.1|  hypothetical protein AMTR_s00106p00040830          107   7e-24   
gb|KFK43703.1|  hypothetical protein AALP_AA1G162200                    108   7e-24   
emb|CDY17443.1|  BnaC09g20940D                                          108   7e-24   
ref|XP_010230232.1|  PREDICTED: transcription repressor KAN1-like       109   8e-24   
gb|EPS65872.1|  hypothetical protein M569_08906                         103   8e-24   
ref|XP_006303284.1|  hypothetical protein CARUB_v10010057mg             108   8e-24   
ref|XP_009101279.1|  PREDICTED: putative Myb family transcription...    108   8e-24   
gb|ADQ43192.1|  unknown                                                 107   2e-23   
ref|XP_011008035.1|  PREDICTED: uncharacterized protein LOC105113531    107   2e-23   
ref|XP_006416996.1|  hypothetical protein EUTSA_v10008620mg             107   2e-23   
ref|XP_009148840.1|  PREDICTED: putative Myb family transcription...    105   7e-23   



>emb|CDP09227.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 151/256 (59%), Gaps = 44/256 (17%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVRQYVRSK+PRLRWTPDLH CFVQAV++LGGQERATPKLVLQLMNVKGL+IAHVKSHLQ
Sbjct  56   GVRQYVRSKMPRLRWTPDLHRCFVQAVEKLGGQERATPKLVLQLMNVKGLSIAHVKSHLQ  115

Query  186  MYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMFDRRIRS---------------N  320
            MYRS+ +DDHGQVINER GY   + ++ L+N WQ    DR IRS                
Sbjct  116  MYRSRNIDDHGQVINER-GYPFRSMDHFLRNGWQFATLDRGIRSSFSYSYSDDNWTSNMT  174

Query  321  FRYMNNSWSCSNANWMSARNNNSI--INGGLGMNK---------------NMI--FTGGP  443
            +R M  +   +N    +  +N S+  I GG+G N                N +  FT  P
Sbjct  175  WRAMPGTVDDTNIKRGTVFHNTSLGRIYGGIGANAINGSLFGTQERRKSYNYMEDFTWLP  234

Query  444  EWKRGHEAL---REANNAKPTQLQSGESLIPSFINGVSSPDIKWSSFSP----AMKRNGG  602
            + K  H+ +   R   N++ TQ+   E  + S +N  +SP+ K S          KR   
Sbjct  235  DTKINHKGIWPSRGETNSELTQVYK-EKRVESIVN-AASPETKCSGTKTEKANTAKRKAP  292

Query  603  EKAVDLNLTLSMNLKR  650
            +  VDLNL+LSMNL++
Sbjct  293  DNGVDLNLSLSMNLRQ  308



>ref|XP_002278456.1| PREDICTED: uncharacterized protein LOC100246669 [Vitis vinifera]
Length=356

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 96/123 (78%), Gaps = 2/123 (2%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVRQYVRSKVPRLRWTP+LHLCFV+AV+RLGGQERATPKLV QLMN+KGL+IAHVKSHLQ
Sbjct  57   GVRQYVRSKVPRLRWTPNLHLCFVRAVERLGGQERATPKLVQQLMNIKGLSIAHVKSHLQ  116

Query  186  MYRSKKVDDHGQVINERAGYH-TGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSNAN  362
            MYRSKK+DD GQVIN R   H  G+  + L  L      D+R+  NFRY N SW   + +
Sbjct  117  MYRSKKIDDKGQVINSRGQLHPNGSAVHNLWQLPTFESIDQRVGFNFRYSNISWG-GHGD  175

Query  363  WMS  371
            W+S
Sbjct  176  WIS  178



>ref|XP_010257080.1| PREDICTED: two-component response regulator ARR14-like [Nelumbo 
nucifera]
 ref|XP_010257081.1| PREDICTED: two-component response regulator ARR14-like [Nelumbo 
nucifera]
Length=370

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 100/126 (79%), Gaps = 4/126 (3%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK+PRLRWTPDLHLCFV AV+RLGGQ+RATPKLVL LMN+KGL IAHVKSHL
Sbjct  55   GSVRQYVRSKMPRLRWTPDLHLCFVHAVERLGGQDRATPKLVLNLMNIKGLTIAHVKSHL  114

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWSCS  353
            QMYRSKK+DD GQVI ++  ++    +  + NL QLPM   F++R  S+FRY   SW+ +
Sbjct  115  QMYRSKKIDDAGQVITDQQRHYVEAADRHIYNLSQLPMLQGFNQRPASSFRYEEASWN-N  173

Query  354  NANWMS  371
            + NWMS
Sbjct  174  HGNWMS  179



>emb|CBI15915.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVRQYVRSKVPRLRWTP+LHLCFV+AV+RLGGQERATPKLV QLMN+KGL+IAHVKSHLQ
Sbjct  57   GVRQYVRSKVPRLRWTPNLHLCFVRAVERLGGQERATPKLVQQLMNIKGLSIAHVKSHLQ  116

Query  186  MYRSKKVDDHGQVINERAGYH-TGntnnllqnlwqlPMFDRRIRSNFRY  329
            MYRSKK+DD GQVIN R   H  G+  + L  L      D+R+  NFRY
Sbjct  117  MYRSKKIDDKGQVINSRGQLHPNGSAVHNLWQLPTFESIDQRVGFNFRY  165



>ref|XP_002313237.2| hypothetical protein POPTR_0009s07890g, partial [Populus trichocarpa]
 gb|EEE87192.2| hypothetical protein POPTR_0009s07890g, partial [Populus trichocarpa]
Length=324

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 132/236 (56%), Gaps = 27/236 (11%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVR Y RSKVPRLRWTPDLHLCFVQAV+RLGG ERATPKLVLQLMN KGL+IAHVKSHLQ
Sbjct  48   GVRPYARSKVPRLRWTPDLHLCFVQAVERLGGHERATPKLVLQLMNFKGLSIAHVKSHLQ  107

Query  186  MYRSKKVDDHGQVINERAGY--HTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSNA  359
            MYRSKK+DD GQVIN        +   ++       LP  D    SNFRY N  WS  + 
Sbjct  108  MYRSKKIDDQGQVINGTGDLIGSSDKFSHEFWQHSLLPNIDHNHNSNFRYGNVPWS-GHG  166

Query  360  NWMSARNNNSIINGGLGMNKNMIFTGGPEWKRGHEALREAN---------NAKPTQLQSG  512
            NW++  +    IN   G      ++   E   G + ++E+          N++  + Q+ 
Sbjct  167  NWITNPSVPDSINVRRGAG---FYSLMAEKISGEKLMQESQDTEYHKSMYNSESIRSQTS  223

Query  513  ESLI-PSFINGVS----------SPDIKWSSFSPAMKRNGGEKAVDLNLTLSMNLK  647
             ++  P F+  +S          S + KW SF+         K  DL+LTLS+  K
Sbjct  224  STIKQPYFVAQLSKRRGEANESVSLETKW-SFNVEKCNKAKRKVDDLDLTLSLCTK  278



>ref|XP_010264567.1| PREDICTED: uncharacterized protein LOC104602538 isoform X1 [Nelumbo 
nucifera]
Length=358

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 124/196 (63%), Gaps = 16/196 (8%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY+RSK+PRLRWTP+LHLCFVQAV+RLGGQE+ATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  56   GKVRQYIRSKMPRLRWTPELHLCFVQAVERLGGQEKATPKLVLQLMNIKGLSIAHVKSHL  115

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM----FDRRIRSNFRYMNNSWSC  350
            QMYRSKKVDD GQVI ++ G+     ++ + N  Q+PM     D+RIRSN     +    
Sbjct  116  QMYRSKKVDDQGQVITDK-GFFLQTWDHRIYNPCQVPMLHSLLDQRIRSNIIRYTDLLRS  174

Query  351  SNANWM---SARNNNSIINGGLGMNKNMIFTGGPEWKRGHEALREAN---NAKPTQLQSG  512
             + NW+       + +  N    M+ +M FT     +R HE   E     + +P + Q+ 
Sbjct  175  RHGNWIPIPCVDGDANTSNRDFYMD-DMTFTEQT-GRRTHEYPNEYQLLYDREPYKTQAN  232

Query  513  ESLIPSFINGVSSPDI  560
               IPS++  +    I
Sbjct  233  ---IPSYVTQLQETGI  245



>ref|XP_011024915.1| PREDICTED: probable transcription factor KAN2 isoform X2 [Populus 
euphratica]
Length=365

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 93/125 (74%), Gaps = 2/125 (2%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVR YVRSKVPRLRWTPDLHLCFVQAV+RLGG ERATPKLVLQLMN+KGL+IAHVKSHLQ
Sbjct  52   GVRPYVRSKVPRLRWTPDLHLCFVQAVERLGGYERATPKLVLQLMNIKGLSIAHVKSHLQ  111

Query  186  MYRSKKVDDHGQVINERAGY--HTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSNA  359
            MYRSKK+DD GQVI+ R      +G  ++       LP  D    S+FR  + S S  + 
Sbjct  112  MYRSKKIDDQGQVIDSRGDLIGCSGYYSHNFWQHSLLPNIDHNRSSDFRSRSVSRSTGHG  171

Query  360  NWMSA  374
            NW+++
Sbjct  172  NWITS  176



>ref|XP_002299997.1| hypothetical protein POPTR_0001s28690g [Populus trichocarpa]
 gb|EEE84802.1| hypothetical protein POPTR_0001s28690g [Populus trichocarpa]
Length=364

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVR YVRSKVPRLRW PDLHLCFVQAV+RLGG ERATPKLVLQLMN+KGL+IAHVKSHLQ
Sbjct  52   GVRPYVRSKVPRLRWIPDLHLCFVQAVERLGGYERATPKLVLQLMNIKGLSIAHVKSHLQ  111

Query  186  MYRSKKVDDHGQVINERAGY--HTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSNA  359
            MYRSKK+DD GQVIN R      +G  ++       LP  D    S+FR  + S S  + 
Sbjct  112  MYRSKKIDDQGQVINSRGDLIGSSGYFSHNFWQHSLLPNIDHNRSSDFRSRSVSRSTGHG  171

Query  360  NWMSA  374
            NW+++
Sbjct  172  NWITS  176



>gb|KDO66970.1| hypothetical protein CISIN_1g041956mg, partial [Citrus sinensis]
Length=119

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVR YVRSKVPRLRWTPDLH CFVQAV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHLQ
Sbjct  37   GVRPYVRSKVPRLRWTPDLHRCFVQAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQ  96

Query  186  MYRSKKVDDHGQ  221
            MYRSKK+DDHGQ
Sbjct  97   MYRSKKIDDHGQ  108



>ref|XP_011024914.1| PREDICTED: probable transcription factor KAN2 isoform X1 [Populus 
euphratica]
Length=366

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL-  182
            GVR YVRSKVPRLRWTPDLHLCFVQAV+RLGG ERATPKLVLQLMN+KGL+IAHVKSHL 
Sbjct  52   GVRPYVRSKVPRLRWTPDLHLCFVQAVERLGGYERATPKLVLQLMNIKGLSIAHVKSHLQ  111

Query  183  QMYRSKKVDDHGQVINERAGY--HTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSN  356
            QMYRSKK+DD GQVI+ R      +G  ++       LP  D    S+FR  + S S  +
Sbjct  112  QMYRSKKIDDQGQVIDSRGDLIGCSGYYSHNFWQHSLLPNIDHNRSSDFRSRSVSRSTGH  171

Query  357  ANWMSA  374
             NW+++
Sbjct  172  GNWITS  177



>ref|XP_007016942.1| Myb HTH transcriptional regulator family protein, putative [Theobroma 
cacao]
 gb|EOY34561.1| Myb HTH transcriptional regulator family protein, putative [Theobroma 
cacao]
Length=332

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 142/248 (57%), Gaps = 42/248 (17%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
             GVR YVRSK+PRLRWTP+LHLCFV+AV+RLGGQE+ATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  34   SGVRPYVRSKMPRLRWTPELHLCFVRAVERLGGQEKATPKLVLQLMNIKGLSIAHVKSHL  93

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF-DRRIRSNFRYMNNSWSCSNA  359
            QMYRSKK+DD GQV+N +     G+ +NL QNLW   M  D+R+ S+F  +  S S    
Sbjct  94   QMYRSKKIDDQGQVLNNKQLL--GSVDNLSQNLWHQSMLHDQRVSSDFSDI--SMSAFRG  149

Query  360  NWMS-------------ARNNNSIINGGLG---------MNKNMIFTGGPEWKRG--HEA  467
            N MS             A +  S +N  LG         MN N IF   P  K     + 
Sbjct  150  NRMSEPYLTNCINSRREAGSGGSDMNEELGSNVSNEVFYMNNNFIFNQRPARKMEDLQDK  209

Query  468  LREANNAKPTQLQSGESLI-PSFINGVSSPDIKW-----SSFSPAMKRNGGEKAVDLNLT  629
            L+  ++ +  Q Q    L+ PSF N       KW     +      KR      +DL+L+
Sbjct  210  LQLPDDCETIQAQMQPILMHPSFAN-------KWLGGRGAERQRIAKRKALGGDLDLSLS  262

Query  630  LSMNLKRE  653
            LS  L++E
Sbjct  263  LSTKLRQE  270



>ref|XP_006425115.1| hypothetical protein CICLE_v10029989mg [Citrus clementina]
 gb|ESR38355.1| hypothetical protein CICLE_v10029989mg [Citrus clementina]
Length=365

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVR YVRSKVPRLRWTPDLH CFVQAV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHLQ
Sbjct  61   GVRPYVRSKVPRLRWTPDLHRCFVQAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQ  120

Query  186  MYRSKKVDDHGQVINERA  239
            MYRSKK+DDHGQV N R 
Sbjct  121  MYRSKKIDDHGQVFNSRG  138



>ref|XP_009621839.1| PREDICTED: uncharacterized protein LOC104113394 [Nicotiana tomentosiformis]
 ref|XP_009621844.1| PREDICTED: uncharacterized protein LOC104113394 [Nicotiana tomentosiformis]
Length=375

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL F+ AV+RLGGQ+RATPKLVLQ+MN+KGLNIAHVKSHLQM
Sbjct  52   VRPYVRSKMPRLRWTPDLHLRFIHAVERLGGQDRATPKLVLQMMNIKGLNIAHVKSHLQM  111

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlw--qlPMFDRRIRSNFRYMNNSWSCSNAN  362
            YRSKK+DD  Q I   + +  G   N+         P F +R+ S FRY N SW+C + N
Sbjct  112  YRSKKMDDQSQGIAHHSLFMEGGDPNIYNLNQLPMFPTFHQRLNSTFRYENASWNC-HGN  170

Query  363  W  365
            W
Sbjct  171  W  171



>ref|XP_010264568.1| PREDICTED: uncharacterized protein LOC104602538 isoform X2 [Nelumbo 
nucifera]
Length=355

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 120/196 (61%), Gaps = 19/196 (10%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY+RSK+PRLRWTP+LHLCFVQAV+RLGGQE+ATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  56   GKVRQYIRSKMPRLRWTPELHLCFVQAVERLGGQEKATPKLVLQLMNIKGLSIAHVKSHL  115

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM----FDRRIRSNFRYMNNSWSC  350
            QMYRSKKVDD GQ      G+     ++ + N  Q+PM     D+RIRSN     +    
Sbjct  116  QMYRSKKVDDQGQ----DKGFFLQTWDHRIYNPCQVPMLHSLLDQRIRSNIIRYTDLLRS  171

Query  351  SNANWM---SARNNNSIINGGLGMNKNMIFTGGPEWKRGHEALREAN---NAKPTQLQSG  512
             + NW+       + +  N    M+ +M FT     +R HE   E     + +P + Q+ 
Sbjct  172  RHGNWIPIPCVDGDANTSNRDFYMD-DMTFTEQT-GRRTHEYPNEYQLLYDREPYKTQAN  229

Query  513  ESLIPSFINGVSSPDI  560
               IPS++  +    I
Sbjct  230  ---IPSYVTQLQETGI  242



>ref|XP_011003744.1| PREDICTED: probable transcription factor KAN4 [Populus euphratica]
Length=337

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 128/237 (54%), Gaps = 28/237 (12%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVR Y RSKVPRLRWTPDLHLCFVQAV+RLGG ERATPKLVLQLMN KGL IA VKSHLQ
Sbjct  51   GVRPYARSKVPRLRWTPDLHLCFVQAVERLGGHERATPKLVLQLMNFKGLRIADVKSHLQ  110

Query  186  MYRSKKVDDHGQVINERAGY--HTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSNA  359
            MYRSKK+DD GQVIN        +   ++       LP  D    SNFR  N  WS  + 
Sbjct  111  MYRSKKIDDQGQVINGMGDLIRSSDKFSHDFWQHSLLPNIDHNHNSNFRCGNVPWS-GHG  169

Query  360  NWMSARNNNSIINGGLGMNKNMIFTGGPEWKRGHEALREAN---------NAKPTQLQSG  512
            NW++  +    I    G      ++   E   G + ++E+          N++  + Q+ 
Sbjct  170  NWITKPSVPDSITTRRGAG---FYSSMAEKISGEKLMQESQDTQYHKSIYNSESIRSQTS  226

Query  513  ESLI-PSFINGVS-----------SPDIKWSSFSPAMKRNGGEKAVDLNLTLSMNLK  647
             ++  P F+  +S           S + KW SF+         K  DL+LTLS+  K
Sbjct  227  STIKQPYFVAQLSKRRGEAANKSISLETKW-SFNVEKCNKAKRKVDDLDLTLSLCTK  282



>ref|XP_011024916.1| PREDICTED: probable transcription factor KAN2 isoform X3 [Populus 
euphratica]
Length=364

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL-  182
            GVR YVRSKVPRLRWTPDLHLCFVQAV+RLGG ERATPKLVLQLMN+KGL+IAHVKSHL 
Sbjct  52   GVRPYVRSKVPRLRWTPDLHLCFVQAVERLGGYERATPKLVLQLMNIKGLSIAHVKSHLQ  111

Query  183  QMYRSKKVDDHGQVINERAGY--HTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSN  356
            QMYRSKK+DD GQVI+ R      +G  ++       LP  D    S+FR +  S S  +
Sbjct  112  QMYRSKKIDDQGQVIDSRGDLIGCSGYYSHNFWQHSLLPNIDHNRSSDFRSV--SRSTGH  169

Query  357  ANWMSA  374
             NW+++
Sbjct  170  GNWITS  175



>ref|XP_006852395.1| hypothetical protein AMTR_s00021p00013790 [Amborella trichopoda]
 gb|ERN13862.1| hypothetical protein AMTR_s00021p00013790 [Amborella trichopoda]
Length=471

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK+PRLRWTPDLHLCFV AV+RLGGQ+RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  51   GGVRQYVRSKMPRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQLMNVKGLSIAHVKSHL  110

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKKVDD GQVI++
Sbjct  111  QMYRSKKVDDSGQVISQ  127



>ref|XP_002268055.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Vitis vinifera]
 emb|CAN73581.1| hypothetical protein VITISV_002087 [Vitis vinifera]
Length=370

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR YVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMN+KGLNIAHVKSHL
Sbjct  54   GAVRPYVRSKMPRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNIKGLNIAHVKSHL  113

Query  183  QMYRSKKVDDHGQVI-NERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWSC  350
            QMYRSKK++D GQV+ + R    +G  +  + NL QLPM    ++R  S+FRY + SWS 
Sbjct  114  QMYRSKKIEDPGQVLADHRHLVESG--DPNIYNLSQLPMLQGLNQRPTSSFRYGDASWS-  170

Query  351  SNANWM  368
            ++ NWM
Sbjct  171  AHENWM  176



>ref|XP_010264566.1| PREDICTED: two-component response regulator ARR18-like [Nelumbo 
nucifera]
Length=381

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 95/128 (74%), Gaps = 6/128 (5%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY RSK+PRLRWTPDLHLCFV AV+RLGGQ+RATPKL+L LMN+KGL IAHVKSHL
Sbjct  70   GSVRQYNRSKLPRLRWTPDLHLCFVHAVERLGGQDRATPKLLLNLMNIKGLTIAHVKSHL  129

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRS-NFRYMNNSWSC  350
            QMYRSKK+D+ GQVI E   +     +  + NL QLPM   F++R  S +FRY   SW  
Sbjct  130  QMYRSKKIDEAGQVIPEHRHF-VEVGDRHMYNLTQLPMLQRFNQRTSSCSFRYEETSWR-  187

Query  351  SNANWMSA  374
             N NW+S 
Sbjct  188  GNGNWISC  195



>emb|CBI18131.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR YVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMN+KGLNIAHVKSHL
Sbjct  87   GAVRPYVRSKMPRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNIKGLNIAHVKSHL  146

Query  183  QMYRSKKVDDHGQVI-NERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWSC  350
            QMYRSKK++D GQV+ + R    +G  +  + NL QLPM    ++R  S+FRY + SWS 
Sbjct  147  QMYRSKKIEDPGQVLADHRHLVESG--DPNIYNLSQLPMLQGLNQRPTSSFRYGDASWS-  203

Query  351  SNANWM  368
            ++ NWM
Sbjct  204  AHENWM  209



>ref|XP_008369283.1| PREDICTED: uncharacterized protein LOC103432854 [Malus domestica]
Length=372

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK  RLRWTPDLHLCF++AV+RLGGQERATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  65   GSVRQYVRSKTSRLRWTPDLHLCFIRAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHL  124

Query  183  QMYRSKKVDDHGQVINERAGY  245
            QMYRSKK +DH QV+ ++AG+
Sbjct  125  QMYRSKKTEDHNQVVTDQAGF  145



>ref|XP_008806053.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Phoenix dactylifera]
Length=159

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK PRLRWTP+LHLCFV AV+RLGGQ+RATPK+VLQLMNVKGL+IAHVKSHL
Sbjct  48   GAVRQYVRSKNPRLRWTPELHLCFVHAVERLGGQDRATPKMVLQLMNVKGLSIAHVKSHL  107

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK+D+ GQVI
Sbjct  108  QMYRSKKIDESGQVI  122



>ref|XP_010257082.1| PREDICTED: uncharacterized protein LOC104597310 [Nelumbo nucifera]
Length=350

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 94/127 (74%), Gaps = 3/127 (2%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G +RQY+RSK+PRLRWTP+LHLCFVQAV+RLGGQ+RATPKLVLQLMN+KGL+I+HVKSHL
Sbjct  54   GKMRQYIRSKMPRLRWTPELHLCFVQAVERLGGQDRATPKLVLQLMNIKGLSISHVKSHL  113

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWSCS  353
            QMYRSKK DD GQV+N+         +++  N  +LPM    + R  SN RY +   +  
Sbjct  114  QMYRSKKTDDPGQVLNDNEYLLENWNHHIYNNPCRLPMLPSLNPRFSSNIRYPDVLRTTG  173

Query  354  NANWMSA  374
            + NW  +
Sbjct  174  HGNWFPS  180



>ref|XP_007008903.1| Myb-like HTH transcriptional regulator family protein, putative 
[Theobroma cacao]
 gb|EOY17713.1| Myb-like HTH transcriptional regulator family protein, putative 
[Theobroma cacao]
Length=382

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY RSK PRLRWTPDLHLCFV AV+RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  58   GSVRQYNRSKTPRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHL  117

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FD-RRIRSNFRYMNNSW  344
            QMYRSKK+DD  Q + E+     G  ++    L  LPM   FD +R  S+FRY + SW
Sbjct  118  QMYRSKKIDDPNQAMTEQGLLFEG-GDHPTYKLSHLPMLHSFDNQRPSSSFRYGDVSW  174



>ref|XP_004302585.1| PREDICTED: uncharacterized protein LOC101295055 [Fragaria vesca 
subsp. vesca]
Length=352

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 100/144 (69%), Gaps = 8/144 (6%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR YVRSK+PRLRWTPDLHL FV AV+RLGGQ+RATPK+VLQLMN+KGL+IAHVKSHL
Sbjct  59   GSVRPYVRSKMPRLRWTPDLHLRFVHAVERLGGQDRATPKMVLQLMNIKGLSIAHVKSHL  118

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMFDRRIRS----NFRY---MNNS  341
            QMYRSKK+DD GQVI ++  +     +  + NL QLPM     RS    +FRY    +NS
Sbjct  119  QMYRSKKIDDAGQVIGDQGHHLVECGDKNIYNLSQLPMLQGYNRSHMSTSFRYGYGDSNS  178

Query  342  WSCSN-ANWMSARNNNSIINGGLG  410
            WS S   N    R+ + I  G + 
Sbjct  179  WSTSAYENLRHPRSTSGIFQGTIA  202



>ref|XP_008363851.1| PREDICTED: uncharacterized protein LOC103427569 [Malus domestica]
Length=328

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 7/121 (6%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL F+ AV+RLGGQ+RATPKLVLQLMN+KGLNIAHVKSHLQM
Sbjct  60   VRPYVRSKMPRLRWTPDLHLRFIHAVERLGGQDRATPKLVLQLMNIKGLNIAHVKSHLQM  119

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMN----NSWS  347
            YRSKK+DD GQV+ +  G+     +  + NL QLPM   ++R   ++FRY +    NSW+
Sbjct  120  YRSKKIDDAGQVLADHQGHLVECGDKNIYNLSQLPMLQGYNRSHTTSFRYGSYGDTNSWT  179

Query  348  C  350
             
Sbjct  180  A  180



>ref|XP_009376409.1| PREDICTED: two-component response regulator ARR18-like [Pyrus 
x bretschneideri]
Length=329

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 7/121 (6%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL F+ AV+RLGGQ+RATPKLVLQLMN+KGLNIAHVKSHLQM
Sbjct  60   VRPYVRSKMPRLRWTPDLHLRFIHAVERLGGQDRATPKLVLQLMNIKGLNIAHVKSHLQM  119

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMN----NSWS  347
            YRSKK+DD GQV+ +  G+     +  + NL QLPM   ++R   ++FRY +    NSW+
Sbjct  120  YRSKKIDDTGQVLADHQGHLVECGDKNIYNLSQLPMLQGYNRSHSTSFRYGSYGDTNSWT  179

Query  348  C  350
             
Sbjct  180  A  180



>ref|XP_010922593.1| PREDICTED: uncharacterized protein LOC105045864 isoform X2 [Elaeis 
guineensis]
Length=359

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 105/247 (43%), Positives = 133/247 (54%), Gaps = 33/247 (13%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK PRLRWTP+LHLCFV A++ LGGQ+RATPK+VLQLMNVKGL+IAHVKSHL
Sbjct  48   GTVRQYVRSKNPRLRWTPELHLCFVHAIETLGGQDRATPKMVLQLMNVKGLSIAHVKSHL  107

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWSCS  353
            QMYRSKK+DD GQVI +      G     + NL  LPM   F +   SN R+ +  W+ S
Sbjct  108  QMYRSKKIDDSGQVIADPRSVMQG-REQHINNLSHLPMLHSFHQWPISNSRFDDYFWA-S  165

Query  354  NANWMSARNNNSIING-----GLGMNKNMIFTGGPEWKR-----------GHEALREANN  485
              NWM  +     +N        G    M+F GG   K             H A RE   
Sbjct  166  PRNWMHNQVLGRAMNSTGEPRSYGSITEMVFRGGDRLKSNQDFHTKDSSLDHRASRELCE  225

Query  486  AK--------PTQLQSGESLIPSFINGVSSPDIKWSSFSPAMKRNGGEKAVDLNLTLSMN  641
            A          TQ +  E     FI      + +  S   +M+    +   DLNL+L++ 
Sbjct  226  ASGLHDYRLAATQYRPQERET-CFITQFQETNPQGQS---SMRWKADDHGPDLNLSLNIG  281

Query  642  LKREREQ  662
             +RE++Q
Sbjct  282  PRREKKQ  288



>emb|CDP13985.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY+RSK PRLRWTP+LHLCF+ AV+RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  66   GSVRQYIRSKTPRLRWTPELHLCFIHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHL  125

Query  183  QMYRSKKVDDHGQVINER  236
            QMYRSKK+DD  QVI+E+
Sbjct  126  QMYRSKKIDDPNQVISEQ  143



>ref|XP_008243158.1| PREDICTED: transcription repressor KAN1-like [Prunus mume]
Length=339

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 101/157 (64%), Gaps = 15/157 (10%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSK+PRLRWTPDLHL F+ AV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  56   ASVRPYVRSKMPRLRWTPDLHLRFIHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHL  115

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMN-NSWSC  350
            QMYRSKK+DD GQV+ +  G+     +  + NL QLPM   ++R   ++FRY +  SW+ 
Sbjct  116  QMYRSKKIDDAGQVLADHQGHLVECGDKNIYNLSQLPMLQGYNRSHSTSFRYGDAKSWTA  175

Query  351  SN-----------ANWMSARNNNSIINGGLGMNKNMI  428
                          NW S+   N +     G   + I
Sbjct  176  YENPRYPRSTGFQGNWSSSSAYNYLTTCSFGEQSSWI  212



>ref|XP_007159455.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris]
 ref|XP_007159456.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris]
 gb|ESW31449.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris]
 gb|ESW31450.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris]
Length=390

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK+PRLRWTP+LHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  71   GGVRQYVRSKMPRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  130

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKK+D+ GQV++E
Sbjct  131  QMYRSKKLDEAGQVLSE  147



>ref|XP_011076824.1| PREDICTED: uncharacterized protein LOC105160975 [Sesamum indicum]
Length=328

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY RSK PRLRWTP+LHLCFV AV+RLGG+ERATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  48   GSVRQYTRSKTPRLRWTPELHLCFVHAVERLGGEERATPKLVLQLMNVKGLSIAHVKSHL  107

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKK+DD  QV++E
Sbjct  108  QMYRSKKIDDPNQVLSE  124



>emb|CBI21992.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY+RSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  84   VRQYIRSKMPRLRWTPDLHLAFVNAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  143

Query  189  YRSKKVDDHGQVIN  230
            YRSKK+DD GQV++
Sbjct  144  YRSKKLDDSGQVLS  157



>ref|XP_010505450.1| PREDICTED: two-component response regulator ARR18-like isoform 
X1 [Camelina sativa]
Length=341

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  42   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  101

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF---DRRIRSNFRYMNNSWSCSNA  359
            YRSKK+DDHGQ I++       +T+  +  L QLPMF   +    S FRY +   + S  
Sbjct  102  YRSKKIDDHGQAISDHKHLFDTSTDRNIYKLSQLPMFRGYNHNSDSPFRYGSKFPNASLW  161

Query  360  NWMSARNNNSIIN  398
            +  S   N S+I+
Sbjct  162  SSSSHETNRSLID  174



>ref|XP_002273049.2| PREDICTED: uncharacterized protein LOC100263821 [Vitis vinifera]
Length=376

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR+YVRSK+PRLRWTPDLHLCF+ AV+RLGGQ+RATPKLVLQLM++KGL+I+HVKSHL
Sbjct  60   GSVRRYVRSKMPRLRWTPDLHLCFLHAVERLGGQDRATPKLVLQLMDIKGLSISHVKSHL  119

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRI-RSNFRY--MNNSW  344
            QMYRSKK+DD  QV+ E+  +  G  ++ +  L  LPM   F+RR   S FRY   + SW
Sbjct  120  QMYRSKKIDDPNQVMMEQGLFIEG-GDHHIYKLSHLPMLQSFNRRPDTSGFRYDSASASW  178

Query  345  SCSNAN  362
              S AN
Sbjct  179  RASMAN  184



>ref|XP_006294540.1| hypothetical protein CARUB_v10023575mg [Capsella rubella]
 gb|EOA27438.1| hypothetical protein CARUB_v10023575mg [Capsella rubella]
Length=338

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  44   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  103

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF  299
            YRSKK+DDHGQ I++       +T+  +  L QLPMF
Sbjct  104  YRSKKIDDHGQAISDHKHLFETSTDRNIYKLSQLPMF  140



>ref|XP_010517118.1| PREDICTED: two-component response regulator ARR18-like isoform 
X1 [Camelina sativa]
Length=341

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  42   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  101

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF  299
            YRSKK+DDHGQ I++       +T+  +  L QLPMF
Sbjct  102  YRSKKIDDHGQAISDDKYLFDTSTDRNIYKLSQLPMF  138



>ref|XP_009804663.1| PREDICTED: two-component response regulator ARR10-like [Nicotiana 
sylvestris]
Length=374

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL F+ AV+RLGGQ+RATPKLVLQ+MN+KGLNIAHVKSHLQM
Sbjct  52   VRPYVRSKMPRLRWTPDLHLRFIHAVERLGGQDRATPKLVLQMMNIKGLNIAHVKSHLQM  111

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlw--qlPMFDRRIRSNFRYMNNSWSCSNAN  362
            YRSKK+DD  Q       +  G   N+         P F +R+ S FRY + SW+  + N
Sbjct  112  YRSKKMDDQSQGTAHHRLFMEGGDPNIYNLSQLPMFPTFHQRLNSTFRYEDASWNF-HGN  170

Query  363  W  365
            W
Sbjct  171  W  171



>ref|XP_008439740.1| PREDICTED: transcription repressor KAN1-like isoform X3 [Cucumis 
melo]
Length=261

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSKVPRLRWTP+LHL FV AVQRLGGQERATPKLVLQLMNVKGL+IAHVKSHLQ
Sbjct  103  AVRQYVRSKVPRLRWTPELHLNFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQ  162

Query  186  MYRSKKVDDHGQVINE  233
            MYRSKK+D  GQVI E
Sbjct  163  MYRSKKLDQSGQVIRE  178



>ref|XP_009369202.1| PREDICTED: uncharacterized protein LOC103958635 [Pyrus x bretschneideri]
Length=373

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR YVRSK  RLRWTPDLHLCFV+AV+RLGGQERATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  65   GSVRHYVRSKTSRLRWTPDLHLCFVRAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHL  124

Query  183  QMYRSKKVDDHGQVINERAGY  245
            QMYRSKK +D  QV+ ++AG+
Sbjct  125  QMYRSKKTEDPNQVLTDQAGF  145



>ref|XP_002534265.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28118.1| conserved hypothetical protein [Ricinus communis]
Length=182

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 6/118 (5%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTP+LHLCFV+AV+RLGGQ+RATPKLVLQLMNV GL+IAHVKSHLQM
Sbjct  55   VRPYVRSKMPRLRWTPELHLCFVKAVERLGGQDRATPKLVLQLMNVNGLSIAHVKSHLQM  114

Query  189  YRSKKVDDHGQVI-NERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWSC  350
            YRSKK+DD  QV+ + R    +G  +  + NL QLPM   + +R  S++RY + SW+ 
Sbjct  115  YRSKKIDDPSQVMADHRHLMKSG--DRNIYNLSQLPMLQGYHQRHASSYRYGDASWNA  170



>ref|XP_006585172.1| PREDICTED: uncharacterized protein LOC100787138 isoform X3 [Glycine 
max]
 gb|KHN48000.1| Putative Myb family transcription factor [Glycine soja]
Length=402

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK+PRLRWTP+LHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  72   GGVRQYVRSKMPRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  131

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK+D+ GQV+
Sbjct  132  QMYRSKKLDEAGQVL  146



>ref|XP_008448246.1| PREDICTED: probable transcription factor KAN2 isoform X2 [Cucumis 
melo]
Length=180

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR+Y RSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  54   GSVRKYSRSKMPRLRWTPDLHLAFVNAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  113

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKK+D+ GQV+++
Sbjct  114  QMYRSKKLDESGQVLSQ  130



>ref|XP_002881577.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57836.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  41   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  100

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF---DRRIRSNFRY  329
            YRSKK+DD GQ I +       +T+  +  L QLPMF   +R   S FRY
Sbjct  101  YRSKKIDDQGQAIADHKHLFETSTDRNIYKLSQLPMFRGYNRNYDSPFRY  150



>ref|XP_008233790.1| PREDICTED: uncharacterized protein LOC103332813 [Prunus mume]
Length=360

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK  RLRWTPDLHLCFV AV+RLGGQERATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  66   GSVRQYVRSKTSRLRWTPDLHLCFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHL  125

Query  183  QMYRSKKVDDHGQVINERAGYHTG  254
            QMYRSKK++D  QV++E+  +  G
Sbjct  126  QMYRSKKMEDPDQVMSEQGFFMEG  149



>ref|XP_006411030.1| hypothetical protein EUTSA_v10016890mg [Eutrema salsugineum]
 gb|ESQ52483.1| hypothetical protein EUTSA_v10016890mg [Eutrema salsugineum]
Length=340

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 94/135 (70%), Gaps = 3/135 (2%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHL
Sbjct  42   AKVRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHL  101

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF---DRRIRSNFRYMNNSWSCS  353
            QMYRSKK+DD GQ I +   +   +T+  +  L QLPMF        S FRY +   + S
Sbjct  102  QMYRSKKIDDQGQAIADHRHFIETSTDRNIYKLSQLPMFRGNTHNHDSQFRYGSMFSNAS  161

Query  354  NANWMSARNNNSIIN  398
              N  S   N S+I+
Sbjct  162  LRNSSSHETNRSLID  176



>ref|XP_003524206.1| PREDICTED: two-component response regulator ARR14-like [Glycine 
max]
Length=401

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK+PRLRWTP+LHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  71   GGVRQYVRSKMPRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  130

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK+D+ GQV+
Sbjct  131  QMYRSKKLDEAGQVL  145



>gb|KHN06404.1| Putative Myb family transcription factor [Glycine soja]
Length=401

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK+PRLRWTP+LHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  71   GGVRQYVRSKMPRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  130

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK+D+ GQV+
Sbjct  131  QMYRSKKLDEAGQVL  145



>gb|KEH38868.1| myb-like DNA-binding domain, shaqkyf class protein [Medicago 
truncatula]
Length=310

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 104/168 (62%), Gaps = 15/168 (9%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL IAHVKSHLQM
Sbjct  89   VRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLRIAHVKSHLQM  148

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMFDR-RIRSNFRYMNNSWSCSNA--  359
            YRSKK+D+ GQV++++     G  + +        M+ R  ++ +F   NN    S+   
Sbjct  149  YRSKKLDESGQVLSQKNRAMQGRHHIMD-------MYGRFNVQGHFGVENNYLHPSSPLL  201

Query  360  -----NWMSARNNNSIINGGLGMNKNMIFTGGPEWKRGHEALREANNA  488
                 N + A + +     G+  N ++IF     W +    L +  +A
Sbjct  202  KQSSYNEIKAHDTSRFHESGVFNNNHVIFRSSSVWDKDFSHLFDVKDA  249



>ref|XP_010509196.1| PREDICTED: two-component response regulator ARR18-like isoform 
X1 [Camelina sativa]
Length=338

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  38   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  97

Query  189  YRSKKVDDHGQVIN  230
            YRSKK+DDHGQ I+
Sbjct  98   YRSKKIDDHGQAIS  111



>gb|KEH38867.1| myb-like DNA-binding domain, shaqkyf class protein [Medicago 
truncatula]
Length=377

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 103/168 (61%), Gaps = 15/168 (9%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL IAHVKSHLQM
Sbjct  89   VRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLRIAHVKSHLQM  148

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMFDR-RIRSNFRYMNNS-------W  344
            YRSKK+D+ GQV++++     G           + M+ R  ++ +F   NN         
Sbjct  149  YRSKKLDESGQVLSQKNRAMQG-------RHHIMDMYGRFNVQGHFGVENNYLHPSSPLL  201

Query  345  SCSNANWMSARNNNSIINGGLGMNKNMIFTGGPEWKRGHEALREANNA  488
              S+ N + A + +     G+  N ++IF     W +    L +  +A
Sbjct  202  KQSSYNEIKAHDTSRFHESGVFNNNHVIFRSSSVWDKDFSHLFDVKDA  249



>ref|XP_008439738.1| PREDICTED: myb-like protein H isoform X2 [Cucumis melo]
Length=304

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSKVPRLRWTP+LHL FV AVQRLGGQERATPKLVLQLMNVKGL+IAHVKSHLQ
Sbjct  62   AVRQYVRSKVPRLRWTPELHLNFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQ  121

Query  186  MYRSKKVDDHGQVINE  233
            MYRSKK+D  GQVI E
Sbjct  122  MYRSKKLDQSGQVIRE  137



>ref|XP_007220942.1| hypothetical protein PRUPE_ppa025397mg [Prunus persica]
 gb|EMJ22141.1| hypothetical protein PRUPE_ppa025397mg [Prunus persica]
Length=351

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK  RLRWTPDLHLCFV AV+RLGGQERATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  59   GSVRQYVRSKTSRLRWTPDLHLCFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHL  118

Query  183  QMYRSKKVDDHGQVINERAGYHTG  254
            QMYRSKK++D  QV++E+  +  G
Sbjct  119  QMYRSKKMEDPDQVMSEQGFFMEG  142



>gb|KDP44725.1| hypothetical protein JCGZ_01225 [Jatropha curcas]
Length=367

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQY+RSK+PRLRWTPDLHLCFV AV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHLQ
Sbjct  70   SVRQYIRSKMPRLRWTPDLHLCFVHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQ  129

Query  186  MYRSKKVDDHGQ  221
            MYRSKK+DD  Q
Sbjct  130  MYRSKKIDDANQ  141



>ref|XP_010031180.1| PREDICTED: uncharacterized protein LOC104421051 [Eucalyptus grandis]
 gb|KCW50444.1| hypothetical protein EUGRSUZ_J00182 [Eucalyptus grandis]
Length=404

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR+YVRSK+PRLRWTPDLHLCF+ AV+RLGG ERATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  70   GSVRKYVRSKMPRLRWTPDLHLCFLHAVERLGGHERATPKLVLQLMNVKGLSIAHVKSHL  129

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM--FDRRIRSNFRYMNNSW  344
            QMYRSKK DD  Q I +   +  G  +++        +  F+ R  S+ R+M+ SW
Sbjct  130  QMYRSKKTDDPNQAIKDHGFFGDGGDHHVYNLSQLPLLQTFNHRP-SSLRFMDASW  184



>gb|KGN49310.1| hypothetical protein Csa_6G519620 [Cucumis sativus]
Length=346

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSKVPRLRWTP+LHL FV AVQRLGGQERATPKLVLQLMNVKGL+IAHVKSHLQ
Sbjct  103  AVRQYVRSKVPRLRWTPELHLNFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQ  162

Query  186  MYRSKKVDDHGQVINE  233
            MYRSKK+D  GQVI E
Sbjct  163  MYRSKKLDQSGQVIRE  178



>ref|XP_010032996.1| PREDICTED: uncharacterized protein LOC104422379 [Eucalyptus grandis]
Length=404

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 91/125 (73%), Gaps = 6/125 (5%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            G+R YVR++VPRLRWTP+LHL F+QAV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHLQ
Sbjct  68   GLRPYVRTQVPRLRWTPELHLRFIQAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQ  127

Query  186  MYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM--FDRRIRSNFRYMNNSWSCSNA  359
            MYRSKK++D G+VIN R  +                +   DR+I SN R  +  WS S+ 
Sbjct  128  MYRSKKINDRGEVINSRQDFMGSADQLPHAFWRHSILQNLDRKI-SNIR--DFRWS-SDR  183

Query  360  NWMSA  374
            NWMS 
Sbjct  184  NWMSG  188



>emb|CBI25446.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR+YVRSK+PRLRWTPDLHLCF+ AV+RLGGQ+RATPKLVLQLM++KGL+I+HVKSHL
Sbjct  153  GSVRRYVRSKMPRLRWTPDLHLCFLHAVERLGGQDRATPKLVLQLMDIKGLSISHVKSHL  212

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRI-RSNFRY--MNNSW  344
            QMYRSKK+DD  QV+ E+  +  G  ++ +  L  LPM   F+RR   S FRY   + SW
Sbjct  213  QMYRSKKIDDPNQVMMEQGLFIEG-GDHHIYKLSHLPMLQSFNRRPDTSGFRYDSASASW  271

Query  345  SCSNAN  362
              S AN
Sbjct  272  RASMAN  277



>ref|XP_006449512.1| hypothetical protein CICLE_v10017867mg [Citrus clementina]
 gb|ESR62752.1| hypothetical protein CICLE_v10017867mg [Citrus clementina]
Length=225

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQE+ATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  83   VRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQM  142

Query  189  YRSKKVDDHGQVIN  230
            YRSKK+D+ GQV++
Sbjct  143  YRSKKLDEAGQVLS  156



>ref|XP_004305446.1| PREDICTED: uncharacterized protein LOC101299510 [Fragaria vesca 
subsp. vesca]
Length=431

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK+PRLRWTPDLHL F+ AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  79   GAVRQYVRSKMPRLRWTPDLHLAFIHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  138

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK+D+ GQV+
Sbjct  139  QMYRSKKLDESGQVL  153



>gb|KDO77871.1| hypothetical protein CISIN_1g035517mg [Citrus sinensis]
Length=161

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQE+ATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  83   VRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQM  142

Query  189  YRSKKVDDHGQ  221
            YRSKK+D+ GQ
Sbjct  143  YRSKKLDEAGQ  153



>ref|XP_011035900.1| PREDICTED: putative two-component response regulator ARR21 [Populus 
euphratica]
Length=362

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 88/117 (75%), Gaps = 7/117 (6%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY+RSK+PRLRWTPDLHLCFV AV+RLGGQERATPKLVLQ+MN+KGL+IAHVKSHL
Sbjct  59   GSVRQYIRSKMPRLRWTPDLHLCFVHAVERLGGQERATPKLVLQMMNIKGLSIAHVKSHL  118

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSW  344
            QMYRSK+ D+     N+  G      + L+ N  QLP+   F++R   N RY N SW
Sbjct  119  QMYRSKRSDE----PNQGQGLFLEGGDRLIYNHSQLPVLQNFNQRSSCNLRYGNASW  171



>ref|XP_006585171.1| PREDICTED: uncharacterized protein LOC100787138 isoform X2 [Glycine 
max]
Length=447

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK+PRLRWTP+LHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  117  GGVRQYVRSKMPRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  176

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK+D+ GQV+
Sbjct  177  QMYRSKKLDEAGQVL  191



>ref|XP_008439737.1| PREDICTED: myb-like protein H isoform X1 [Cucumis melo]
Length=345

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSKVPRLRWTP+LHL FV AVQRLGGQERATPKLVLQLMNVKGL+IAHVKSHLQ
Sbjct  103  AVRQYVRSKVPRLRWTPELHLNFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQ  162

Query  186  MYRSKKVDDHGQVINE  233
            MYRSKK+D  GQVI E
Sbjct  163  MYRSKKLDQSGQVIRE  178



>ref|XP_010907869.1| PREDICTED: transcription activator GLK2-like isoform X2 [Elaeis 
guineensis]
Length=336

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 105/252 (42%), Positives = 137/252 (54%), Gaps = 39/252 (15%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK PRLRWTP+LHLCFVQAV+RLGGQ+RATPK+VL+LM VKGL+IAHVKSHL
Sbjct  48   GTVRQYVRSKNPRLRWTPELHLCFVQAVERLGGQDRATPKMVLELMKVKGLSIAHVKSHL  107

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF----DRRIRSNFRYMNNSWSC  350
            QMYRSKK+D+ GQVI +      G T   + NL  LPM      R    N R   +SW  
Sbjct  108  QMYRSKKIDESGQVIADPWSVMKG-TKQHIYNLGHLPMLHGCHQRPTIPNLRSDGSSW-F  165

Query  351  SNANW-----MSARNNNSIINGGLGMNKNMIFTGGPEWK-----------RGHEA---LR  473
             + NW     +S   N+++ +   G    MIF G    K             H+A   LR
Sbjct  166  GHRNWTQNPVLSRAMNSTVGSRSHGSINEMIFRGSDRLKSNQDFHINTSSSNHQAICELR  225

Query  474  EANNAK---------PTQLQSGESLIPSFINGVSSPDIKWSSFSPAMKRNGGEKAVDLNL  626
            EA              TQ Q+ E        G++ P+ + S      +    ++  DLNL
Sbjct  226  EATGESHLLHNCRLGTTQYQAEERGAYLQERGLTGPEGQSSE-----RWKANDQGPDLNL  280

Query  627  TLSMNLKREREQ  662
            +L +  ++E++Q
Sbjct  281  SLHIGPRQEKKQ  292



>ref|XP_007149732.1| hypothetical protein PHAVU_005G094600g [Phaseolus vulgaris]
 gb|ESW21726.1| hypothetical protein PHAVU_005G094600g [Phaseolus vulgaris]
Length=364

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQ
Sbjct  77   AVRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQ  136

Query  186  MYRSKKVDDHGQVINE  233
            MYRSKK+D+ GQV+++
Sbjct  137  MYRSKKLDESGQVLSQ  152



>ref|XP_010109885.1| Putative Myb family transcription factor [Morus notabilis]
 gb|EXC24838.1| Putative Myb family transcription factor [Morus notabilis]
Length=347

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQE+ATPKLVLQLMNV+GL+I HVKSHL
Sbjct  81   GRVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIGHVKSHL  140

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK+DD GQ++
Sbjct  141  QMYRSKKLDDAGQLV  155



>ref|XP_007026615.1| Myb-like HTH transcriptional regulator family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007026616.1| Myb-like HTH transcriptional regulator family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY07117.1| Myb-like HTH transcriptional regulator family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY07118.1| Myb-like HTH transcriptional regulator family protein, putative 
isoform 1 [Theobroma cacao]
Length=368

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL F+ AV+RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  54   VRPYVRSKMPRLRWTPDLHLRFIHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQM  113

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+DD GQVI E
Sbjct  114  YRSKKIDDPGQVITE  128



>ref|XP_006594818.1| PREDICTED: probable transcription factor KAN2-like isoform X1 
[Glycine max]
 ref|XP_006594819.1| PREDICTED: probable transcription factor KAN2-like isoform X2 
[Glycine max]
Length=369

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNVKGL+IAHVKSHLQM
Sbjct  84   VRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHLQM  143

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQV+
Sbjct  144  YRSKKLDESGQVL  156



>ref|XP_010937910.1| PREDICTED: uncharacterized protein LOC105057131 [Elaeis guineensis]
Length=360

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK PRLRWTPDLHLCFV AV+RLGGQ+RATPKLVLQLMNVKGL+I HVKSHL
Sbjct  45   GSVRQYVRSKNPRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQLMNVKGLSIGHVKSHL  104

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKK+D  G+VI +
Sbjct  105  QMYRSKKIDASGRVIAD  121



>emb|CDP06448.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 90/125 (72%), Gaps = 3/125 (2%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMN+KGLNIAHVKSHLQM
Sbjct  49   VRPYVRSKMPRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNIKGLNIAHVKSHLQM  108

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllq--nlwqlPMFDRRIRSNFRYMNNSWS-CSNA  359
            YRSKK+DD  Q + + +    G   N+     +  LP   +  +S FRY + SW+   N+
Sbjct  109  YRSKKIDDPSQGVTDHSHLWEGVDRNIFNLGQIPMLPGLHQNQKSTFRYGDASWNGLENS  168

Query  360  NWMSA  374
              MSA
Sbjct  169  MQMSA  173



>gb|KDP21103.1| hypothetical protein JCGZ_21574 [Jatropha curcas]
Length=366

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  78   VRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  137

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D+ GQV+++
Sbjct  138  YRSKKLDEAGQVLSQ  152



>ref|XP_004504295.1| PREDICTED: two-component response regulator ARR14-like [Cicer 
arietinum]
Length=426

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVRQYVRSK+PRLRWTPDLH  FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQ
Sbjct  94   GVRQYVRSKMPRLRWTPDLHHSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQ  153

Query  186  MYRSKKVDDHGQVIN--ERAGYHTG  254
            MYRSKK+D+ GQV++   R+ Y  G
Sbjct  154  MYRSKKLDESGQVLSPTHRSTYELG  178



>ref|XP_010922591.1| PREDICTED: uncharacterized protein LOC105045864 isoform X1 [Elaeis 
guineensis]
Length=361

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 133/249 (53%), Gaps = 35/249 (14%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERA--TPKLVLQLMNVKGLNIAHVKS  176
            G VRQYVRSK PRLRWTP+LHLCFV A++ LGGQ+RA  TPK+VLQLMNVKGL+IAHVKS
Sbjct  48   GTVRQYVRSKNPRLRWTPELHLCFVHAIETLGGQDRAGATPKMVLQLMNVKGLSIAHVKS  107

Query  177  HLQMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWS  347
            HLQMYRSKK+DD GQVI +      G     + NL  LPM   F +   SN R+ +  W+
Sbjct  108  HLQMYRSKKIDDSGQVIADPRSVMQG-REQHINNLSHLPMLHSFHQWPISNSRFDDYFWA  166

Query  348  CSNANWMSARNNNSIING-----GLGMNKNMIFTGGPEWKR-----------GHEALREA  479
             S  NWM  +     +N        G    M+F GG   K             H A RE 
Sbjct  167  -SPRNWMHNQVLGRAMNSTGEPRSYGSITEMVFRGGDRLKSNQDFHTKDSSLDHRASREL  225

Query  480  NNAK--------PTQLQSGESLIPSFINGVSSPDIKWSSFSPAMKRNGGEKAVDLNLTLS  635
              A          TQ +  E     FI      + +  S   +M+    +   DLNL+L+
Sbjct  226  CEASGLHDYRLAATQYRPQERET-CFITQFQETNPQGQS---SMRWKADDHGPDLNLSLN  281

Query  636  MNLKREREQ  662
            +  +RE++Q
Sbjct  282  IGPRREKKQ  290



>ref|XP_010105426.1| Putative Myb family transcription factor [Morus notabilis]
 gb|EXC04701.1| Putative Myb family transcription factor [Morus notabilis]
Length=422

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY+RSK PRLRWTPDLHLCFV+AV+RLGGQERATPKLVLQ+MN+KGL+IAHVKSHL
Sbjct  79   GSVRQYIRSKTPRLRWTPDLHLCFVRAVERLGGQERATPKLVLQMMNIKGLSIAHVKSHL  138

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK++D  Q
Sbjct  139  QMYRSKKIEDPNQ  151



>ref|XP_010517119.1| PREDICTED: uncharacterized protein LOC104792627 isoform X2 [Camelina 
sativa]
Length=328

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  42   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  101

Query  189  YRSKKVDDHGQ  221
            YRSKK+DDHGQ
Sbjct  102  YRSKKIDDHGQ  112



>ref|XP_011085124.1| PREDICTED: uncharacterized protein LOC105167199 [Sesamum indicum]
Length=316

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTPDLHLCF+ AV+RLGGQERATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  36   GSVRHYTRSKTPRLRWTPDLHLCFLHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHL  95

Query  183  QMYRSKKVDD-HGQVINER  236
            QMYRSKK+DD + QVI+E+
Sbjct  96   QMYRSKKIDDPNHQVISEQ  114



>gb|KHN36703.1| Putative Myb family transcription factor [Glycine soja]
Length=369

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNVKGL+IAHVKSHLQM
Sbjct  84   VRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHLQM  143

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQV+
Sbjct  144  YRSKKLDESGQVL  156



>ref|XP_010505451.1| PREDICTED: two-component response regulator ARR18-like isoform 
X2 [Camelina sativa]
Length=328

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  42   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  101

Query  189  YRSKKVDDHGQ  221
            YRSKK+DDHGQ
Sbjct  102  YRSKKIDDHGQ  112



>ref|XP_011001163.1| PREDICTED: uncharacterized protein LOC105108499 [Populus euphratica]
 ref|XP_011001232.1| PREDICTED: uncharacterized protein LOC105108499 [Populus euphratica]
Length=367

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 141/276 (51%), Gaps = 46/276 (17%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G  RQY+RSK+PRLRWTPDLHLCFV AV+RLGGQ+RATPKLVLQ+MN+K LNIAHVKSHL
Sbjct  58   GSFRQYIRSKMPRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQMMNIKDLNIAHVKSHL  117

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM-FDRRIRSNFRYMNNSW-----  344
            QMYRSK+ +D GQ   +   +  G+          +P  F++R   N RY + SW     
Sbjct  118  QMYRSKRSEDPGQ--GQGLLFEGGDNPICNLRQLAMPQDFNQRSPFNLRYGDASWIGHDH  175

Query  345  -SCSNANWMSARNNNSIINGGLGM-----NKNMIFTG---------GPEWKRGHEALR--  473
              CS   +M     N + +G  G      N N +  G         G    R H++L   
Sbjct  176  MMCS--AYMGGTALNRVKHGLYGSEIGCNNHNSLNYGSSVHIPSLNGKVTGRTHQSLEAV  233

Query  474  ------EANNAKP--------TQLQSGESLIP--SFINGVSSPDIKWSSFSPAMKRNGGE  605
                  + N + P        T+LQ    ++    F+N  S  D  W +    M++    
Sbjct  234  QLFQVSQQNESTPSSMESDFITKLQERSGILDQVDFLNTSSCADRNWRTIQ-EMQKGLKR  292

Query  606  KAV--DLNLTLSMNLKREREQDDSNSRHCKRRCLDG  707
            K +  D NL L+++LK   + DD   +  +   +DG
Sbjct  293  KTLDPDCNLDLNLSLKLATKDDDELEKFVEGCEVDG  328



>ref|XP_010509197.1| PREDICTED: uncharacterized protein LOC104785641 isoform X2 [Camelina 
sativa]
Length=324

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  38   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  97

Query  189  YRSKKVDDHGQ  221
            YRSKK+DDHGQ
Sbjct  98   YRSKKIDDHGQ  108



>ref|XP_010657046.1| PREDICTED: uncharacterized protein LOC104880828 [Vitis vinifera]
Length=464

 Score =   140 bits (352),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY+RSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  84   VRQYIRSKMPRLRWTPDLHLAFVNAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  143

Query  189  YRSKKVDDHGQVIN  230
            YRSKK+DD GQV++
Sbjct  144  YRSKKLDDSGQVLS  157



>gb|EPS58795.1| hypothetical protein M569_16018 [Genlisea aurea]
Length=230

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY+RSK+PRLRWTPDLHL FV A++RLGGQERATPK VLQLMNV+GL+I+HVKSHLQM
Sbjct  71   VRQYIRSKMPRLRWTPDLHLSFVHAIERLGGQERATPKAVLQLMNVRGLSISHVKSHLQM  130

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D+ G+VI +
Sbjct  131  YRSKKLDESGKVIGQ  145



>emb|CDX74898.1| BnaA05g06440D [Brassica napus]
Length=342

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 95/135 (70%), Gaps = 5/135 (4%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  53   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  112

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF-----DRRIRSNFRYMNNSWSCS  353
            YRSKK+DD GQ I +   +   +T+  +  L QLPMF     +    S FRY +   + S
Sbjct  113  YRSKKMDDQGQAIADNRHFIESSTDRNIYKLSQLPMFRGYNTNHSHDSPFRYGSRFSNAS  172

Query  354  NANWMSARNNNSIIN  398
              N  S   N S+I+
Sbjct  173  LWNSSSHETNRSLID  187



>ref|XP_009143403.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Brassica rapa]
Length=337

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 95/135 (70%), Gaps = 5/135 (4%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  48   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  107

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF-----DRRIRSNFRYMNNSWSCS  353
            YRSKK+DD GQ I +   +   +T+  +  L QLPMF     +    S FRY +   + S
Sbjct  108  YRSKKMDDQGQAIADNRHFIESSTDRNIYKLSQLPMFRGYNTNHSHDSPFRYGSRFSNAS  167

Query  354  NANWMSARNNNSIIN  398
              N  S   N S+I+
Sbjct  168  LWNSSSHETNRSLID  182



>ref|XP_006592875.1| PREDICTED: uncharacterized protein LOC102668520 [Glycine max]
Length=368

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  81   VRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  140

Query  189  YRSKKVDDHGQVIN  230
            YRSKK+D+ GQV++
Sbjct  141  YRSKKLDESGQVLS  154



>ref|XP_006378651.1| hypothetical protein POPTR_0010s19310g [Populus trichocarpa]
 gb|ERP56448.1| hypothetical protein POPTR_0010s19310g [Populus trichocarpa]
Length=366

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 11/119 (9%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY+RSK+PRLRWTPDLHLCFV AV+RLGGQ+RATPKLVLQ+MN+KGL+IAHVKSHL
Sbjct  59   GSVRQYIRSKMPRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQMMNIKGLSIAHVKSHL  118

Query  183  QMYRSKKVDD--HGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSW  344
            QMYRSK+ D+   GQ +    G H       + NL QLP+   F++R   N RY + SW
Sbjct  119  QMYRSKRSDEPNQGQGLFFEGGDH------QIYNLSQLPVLQNFNQRSSCNLRYGDASW  171



>emb|CDX91442.1| BnaC04g07080D [Brassica napus]
Length=350

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 95/135 (70%), Gaps = 5/135 (4%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  60   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  119

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF-----DRRIRSNFRYMNNSWSCS  353
            YRSKK+DD GQ I +   +   +T+  +  L QLPMF     +    S FRY +   + S
Sbjct  120  YRSKKMDDQGQAIGDNRHFIESSTDRNIYKLSQLPMFRGYNTNHSHDSPFRYGSRFSNAS  179

Query  354  NANWMSARNNNSIIN  398
              N  S   N S+I+
Sbjct  180  LWNSSSHETNRSLID  194



>gb|KHN27949.1| Putative Myb family transcription factor [Glycine soja]
Length=368

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  81   VRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  140

Query  189  YRSKKVDDHGQVIN  230
            YRSKK+D+ GQV++
Sbjct  141  YRSKKLDESGQVLS  154



>ref|XP_010276999.1| PREDICTED: uncharacterized protein LOC104611575 [Nelumbo nucifera]
 ref|XP_010277000.1| PREDICTED: uncharacterized protein LOC104611575 [Nelumbo nucifera]
Length=467

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV++LGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  77   VRQYVRSKMPRLRWTPDLHLSFVHAVEKLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  136

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D+ GQV++E
Sbjct  137  YRSKKLDESGQVLSE  151



>ref|XP_003532757.2| PREDICTED: uncharacterized protein LOC100787138 isoform X1 [Glycine 
max]
Length=429

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 3/87 (3%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK+PRLRWTP+LHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  117  GGVRQYVRSKMPRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  176

Query  183  QMYRSKKVDDHGQV---INERAGYHTG  254
            QMYRSKK+D+ GQ    +N R  +  G
Sbjct  177  QMYRSKKLDEAGQAHQSMNPRQHFKMG  203



>ref|XP_004487568.1| PREDICTED: uncharacterized protein LOC101500041 [Cicer arietinum]
Length=401

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  93   VRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  152

Query  189  YRSKKVDDHGQVINER  236
            YRSKK+D  GQV++++
Sbjct  153  YRSKKLDASGQVLSQK  168



>ref|XP_008228924.1| PREDICTED: uncharacterized protein LOC103328312 isoform X2 [Prunus 
mume]
Length=431

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSK+PRLRWTPDLHL FV AV RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQ
Sbjct  100  AVRQYVRSKMPRLRWTPDLHLAFVHAVDRLGGQERATPKLVLQLMNVRGLSIAHVKSHLQ  159

Query  186  MYRSKKVDDHGQVINE  233
            MYRSKK+D+ GQVI++
Sbjct  160  MYRSKKLDESGQVISQ  175



>ref|XP_009791663.1| PREDICTED: uncharacterized protein LOC104238869 isoform X1 [Nicotiana 
sylvestris]
Length=382

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK PRLRWTP+LHL F+ AV+RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  66   GGVRQYVRSKTPRLRWTPELHLRFIHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHL  125

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlP----MFDRRIRSNFRYMNNSW  344
            QMYRSKK DD  Q ++    +   N ++ + NL QLP     F++   S+ RY ++ W
Sbjct  126  QMYRSKKTDDPNQTVSTDGRFLIENGDHHIFNLSQLPRLQGTFNQTSSSSLRYEDSLW  183



>ref|XP_002312172.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE89539.1| myb family transcription factor family protein [Populus trichocarpa]
Length=329

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G  RQY+RSK+PRLRWTPDLHLCFV AV+RLGGQ+RATPKLVLQ+MN+K LNIAHVKSHL
Sbjct  58   GSFRQYIRSKMPRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQMMNIKDLNIAHVKSHL  117

Query  183  QMYRSKKVDDHGQVINERAGYH  248
            QMYRSK+ DD GQ  + R   H
Sbjct  118  QMYRSKRSDDPGQDASWRGHDH  139



>ref|XP_007025361.1| Myb-like HTH transcriptional regulator family protein, putative 
[Theobroma cacao]
 gb|EOY27983.1| Myb-like HTH transcriptional regulator family protein, putative 
[Theobroma cacao]
Length=406

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  78   VRQYVRSKLPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  137

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D+ GQV+ +
Sbjct  138  YRSKKLDEAGQVLRQ  152



>ref|XP_011095220.1| PREDICTED: uncharacterized protein LOC105174731 [Sesamum indicum]
Length=375

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 94/133 (71%), Gaps = 6/133 (5%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLH+ FV AV+RLGGQ+RATPKLVLQLMN+KGLNIAHVKSHLQM
Sbjct  52   VRPYVRSKMPRLRWTPDLHMRFVHAVERLGGQDRATPKLVLQLMNIKGLNIAHVKSHLQM  111

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlw--qlPMFDRRIR-SNFRYMNNSWSCSNA  359
            YRSKK+D+  Q + +   +  G   N+        LP F++R   SN RY + SWS  + 
Sbjct  112  YRSKKIDESNQGLMDHRLFMEGGDRNVYNLSQLPLLPSFNQRQNYSNLRYGDPSWS-PHG  170

Query  360  NWM--SARNNNSI  392
             WM  SA   N+I
Sbjct  171  KWMHNSAPGQNTI  183



>gb|KDP22851.1| hypothetical protein JCGZ_00438 [Jatropha curcas]
Length=359

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VR YVRSK+PRLRWTP+LHLCFV+AV+RLGGQ+RATPKLVLQLMNV GL+IAHVKSHLQ
Sbjct  53   SVRPYVRSKMPRLRWTPELHLCFVKAVERLGGQDRATPKLVLQLMNVNGLSIAHVKSHLQ  112

Query  186  MYRSKKVDDHGQVINE-RAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSW  344
            MYRSKK+DD  Q +++ R    +G  +  + NL QLPM   +++   SN+RY + SW
Sbjct  113  MYRSKKIDDPSQAMSDHRHLVESG--DRNIYNLSQLPMLQGYNQHYGSNYRYGDASW  167



>gb|KCW52514.1| hypothetical protein EUGRSUZ_J01904 [Eucalyptus grandis]
Length=136

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            G+R YVR++VPRLRWTP+LHL F+QAV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHLQ
Sbjct  56   GLRPYVRTQVPRLRWTPELHLRFIQAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQ  115

Query  186  MYRSKKVDDHGQ  221
            MYRSKK++D G+
Sbjct  116  MYRSKKINDRGE  127



>ref|XP_007216041.1| hypothetical protein PRUPE_ppa017500mg, partial [Prunus persica]
 gb|EMJ17240.1| hypothetical protein PRUPE_ppa017500mg, partial [Prunus persica]
Length=234

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSK+PRLRWTPDLHL F+ AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQ
Sbjct  88   AVRQYVRSKMPRLRWTPDLHLAFIHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQ  147

Query  186  MYRSKKVDDHGQ  221
            MYRSKK+D+ GQ
Sbjct  148  MYRSKKLDESGQ  159



>emb|CAN60070.1| hypothetical protein VITISV_022944 [Vitis vinifera]
Length=175

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQ RATPKLVL+LMNVKGL+IAHVKSHLQM
Sbjct  75   VRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQARATPKLVLELMNVKGLSIAHVKSHLQM  134

Query  189  YRSKKVDDHGQ  221
            YRSK++D+ GQ
Sbjct  135  YRSKRLDESGQ  145



>ref|XP_009791664.1| PREDICTED: uncharacterized protein LOC104238869 isoform X2 [Nicotiana 
sylvestris]
Length=381

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK PRLRWTP+LHL F+ AV+RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  66   GGVRQYVRSKTPRLRWTPELHLRFIHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHL  125

Query  183  QMYRSKKVDDHGQV  224
            QMYRSKK DD  Q+
Sbjct  126  QMYRSKKTDDPNQI  139



>ref|XP_009611229.1| PREDICTED: uncharacterized protein LOC104104777 isoform X1 [Nicotiana 
tomentosiformis]
Length=382

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK PRLRWTP+LHL F+ AV+RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  66   GGVRQYVRSKTPRLRWTPELHLRFIHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHL  125

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK DD  Q +
Sbjct  126  QMYRSKKTDDPNQTV  140



>ref|XP_011046839.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Populus euphratica]
 ref|XP_011046840.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Populus euphratica]
Length=378

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 91/120 (76%), Gaps = 8/120 (7%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTP+LHLCFV+AV+RLGGQERATPKLVLQLMNV GL+IAHVKSHLQM
Sbjct  54   VRPYVRSKLPRLRWTPELHLCFVKAVERLGGQERATPKLVLQLMNVNGLSIAHVKSHLQM  113

Query  189  YRSKKVDDHGQ-VINERAGYHTGntnnllqnlwqlPMFD-----RRIRSNFRYMNNSWSC  350
            YRSKKVDD  Q + + R    +G  +  + NL QLPM       +R  S+FRY + SW+ 
Sbjct  114  YRSKKVDDPSQGMADHRHLMESG--DRNIYNLSQLPMLQGYNQYQRQNSSFRYGDASWNA  171



>ref|XP_007048707.1| Myb-like HTH transcriptional regulator family protein [Theobroma 
cacao]
 gb|EOX92864.1| Myb-like HTH transcriptional regulator family protein [Theobroma 
cacao]
Length=381

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  60   VRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  119

Query  189  YRSKKVDDHGQVINERAGY  245
            YRSKK+++ GQVI++ + +
Sbjct  120  YRSKKLNESGQVISQTSRF  138



>ref|XP_008464219.1| PREDICTED: probable transcription factor KAN4 isoform X2 [Cucumis 
melo]
Length=306

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 4/126 (3%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL FV AV+RLGGQE ATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  61   VRPYVRSKLPRLRWTPDLHLRFVHAVERLGGQENATPKLVLQLMNIKGLSIAHVKSHLQM  120

Query  189  YRSKKVDDHGQVINERA-GYHTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSNANW  365
            YRSKK ++ GQV ++R     + N +  + N+ Q+PMF R    N  Y +N +    ++W
Sbjct  121  YRSKKTNEPGQVGDQRVLMAESNNGDRNIFNVSQIPMFQRY---NSSYTSNLFRLGGSSW  177

Query  366  MSARNN  383
             +  NN
Sbjct  178  NAIENN  183



>ref|XP_008781403.1| PREDICTED: probable transcription factor KAN2 [Phoenix dactylifera]
Length=199

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQY+RSK+PRLRWTPDLHL F++AV+RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQ
Sbjct  52   AVRQYIRSKMPRLRWTPDLHLSFIRAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQ  111

Query  186  MYRSKKVDDHGQ  221
            MYRSKK+DD G+
Sbjct  112  MYRSKKLDDTGR  123



>ref|XP_009611230.1| PREDICTED: putative two-component response regulator ARR20 isoform 
X2 [Nicotiana tomentosiformis]
Length=381

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK PRLRWTP+LHL F+ AV+RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  66   GGVRQYVRSKTPRLRWTPELHLRFIHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHL  125

Query  183  QMYRSKKVDDHGQV  224
            QMYRSKK DD  Q+
Sbjct  126  QMYRSKKTDDPNQI  139



>ref|XP_002323602.2| hypothetical protein POPTR_0016s12940g [Populus trichocarpa]
 gb|EEF05363.2| hypothetical protein POPTR_0016s12940g [Populus trichocarpa]
Length=378

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 91/120 (76%), Gaps = 8/120 (7%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTP+LHLCF++AV+RLGGQERATPKLVLQLMNV GL+IAHVKSHLQM
Sbjct  54   VRPYVRSKLPRLRWTPELHLCFIKAVERLGGQERATPKLVLQLMNVNGLSIAHVKSHLQM  113

Query  189  YRSKKVDDHGQ-VINERAGYHTGntnnllqnlwqlPMFD-----RRIRSNFRYMNNSWSC  350
            YRSKKVDD  Q + + R    +G  +  + NL QLPM       +R  S+FRY + SW+ 
Sbjct  114  YRSKKVDDPSQGMADHRHLVESG--DRNIYNLSQLPMLQGYNQYQRQNSSFRYGDASWNA  171



>ref|XP_010693076.1| PREDICTED: two-component response regulator ARR10-like [Beta 
vulgaris subsp. vulgaris]
Length=399

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK+PRLRWTPDLHLCFV AV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  74   GSVRPYNRSKMPRLRWTPDLHLCFVHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHL  133

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK+D+  Q
Sbjct  134  QMYRSKKIDESNQ  146



>ref|XP_008359800.1| PREDICTED: uncharacterized protein LOC103423495 [Malus domestica]
Length=331

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 93/122 (76%), Gaps = 10/122 (8%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWT +LHL F+ A++RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  60   VRPYVRSKMPRLRWTXBLHLRFIHAMERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQM  119

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM------FDRRIRSNFRYMN----N  338
            YRSKK++D GQV+ +R G+     +  + NL QLPM      ++RR  ++FRY +    N
Sbjct  120  YRSKKINDAGQVLPDRQGHLGECGDKNIYNLSQLPMLQGYKLYNRRHTTSFRYGSYGDAN  179

Query  339  SW  344
            SW
Sbjct  180  SW  181



>ref|XP_010529031.1| PREDICTED: uncharacterized protein LOC104806008 [Tarenaya hassleriana]
Length=360

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV AV RLGGQERATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  58   VRPYVRSKVPRLRWTPDLHLRFVHAVDRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQM  117

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF---DRRIRSNFRYMNNS-WSCSN  356
            YRSKK DD  Q + E        T+  + NL QLPMF        S FRY N S W+ S+
Sbjct  118  YRSKKTDDQCQAMAEHRHLIESTTDRNIYNLSQLPMFRAYSHDHDSPFRYGNASMWNSSS  177



>ref|XP_004307667.1| PREDICTED: uncharacterized protein LOC101309095 [Fragaria vesca 
subsp. vesca]
Length=392

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK  RLRWTPDLHL F+ AV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  93   GSVRQYVRSKNSRLRWTPDLHLRFIHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHL  152

Query  183  QMYRSKKVDDHGQVINERAGYHTG  254
            QMYRSKK++D  QV++E+  Y  G
Sbjct  153  QMYRSKKMEDPNQVLSEQGFYTEG  176



>ref|XP_010052783.1| PREDICTED: uncharacterized protein LOC104441352 [Eucalyptus grandis]
Length=430

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY+RSK+PRLRWTP+LHL FV AV+RLGGQE+ATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  98   VRQYMRSKMPRLRWTPELHLAFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQM  157

Query  189  YRSKKVDDHGQVIN  230
            YRSKK+DD GQV++
Sbjct  158  YRSKKLDDSGQVLS  171



>ref|XP_007148039.1| hypothetical protein PHAVU_006G175300g [Phaseolus vulgaris]
 ref|XP_007148040.1| hypothetical protein PHAVU_006G175300g [Phaseolus vulgaris]
 gb|ESW20033.1| hypothetical protein PHAVU_006G175300g [Phaseolus vulgaris]
 gb|ESW20034.1| hypothetical protein PHAVU_006G175300g [Phaseolus vulgaris]
Length=364

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK+PRLRWTP+LH  F+ AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  78   GTVRQYVRSKMPRLRWTPELHHSFMHAVERLGGQERATPKLVLQLMNVEGLSIAHVKSHL  137

Query  183  QMYRSKKVDDHGQVINERA  239
            QMYRSKK+D+ GQV+++R+
Sbjct  138  QMYRSKKLDEVGQVLSQRS  156



>ref|NP_181364.2| myb-like HTH transcriptional regulator-like protein [Arabidopsis 
thaliana]
 dbj|BAC42341.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50506.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09520.1| myb-like HTH transcriptional regulator-like protein [Arabidopsis 
thaliana]
Length=340

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSKVPRLRWTPDLHL FV+AV+RLGGQERATPKLV Q+MN+KGL+IAHVKSHLQM
Sbjct  46   VRPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQM  105

Query  189  YRSKKVDDHGQVI  227
            YRSKK+DD GQ I
Sbjct  106  YRSKKIDDQGQAI  118



>ref|XP_008464217.1| PREDICTED: probable transcription factor KAN3 isoform X1 [Cucumis 
melo]
 ref|XP_008464218.1| PREDICTED: probable transcription factor KAN3 isoform X1 [Cucumis 
melo]
Length=307

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 92/127 (72%), Gaps = 5/127 (4%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL FV AV+RLGGQE ATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  61   VRPYVRSKLPRLRWTPDLHLRFVHAVERLGGQENATPKLVLQLMNIKGLSIAHVKSHLQM  120

Query  189  YRSKKVDDHGQVINERAGY--HTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSNAN  362
            YRSKK ++ GQV+ ++      + N +  + N+ Q+PMF R    N  Y +N +    ++
Sbjct  121  YRSKKTNEPGQVVGDQRVLMAESNNGDRNIFNVSQIPMFQRY---NSSYTSNLFRLGGSS  177

Query  363  WMSARNN  383
            W +  NN
Sbjct  178  WNAIENN  184



>gb|KHN01942.1| Putative Myb family transcription factor [Glycine soja]
Length=343

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            +R YVRSK+PRLRWTPDLHL FV AVQRLGGQERATPKLVLQLMNVKGL+IAHVKSHLQM
Sbjct  53   IRPYVRSKMPRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQM  112

Query  189  YRSKKVDDHGQVI  227
            +RSKKVDD  QV 
Sbjct  113  FRSKKVDDRNQVF  125



>ref|XP_006573379.1| PREDICTED: uncharacterized protein LOC102660246 isoform X1 [Glycine 
max]
 ref|XP_006573380.1| PREDICTED: uncharacterized protein LOC102660246 isoform X2 [Glycine 
max]
Length=343

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            +R YVRSK+PRLRWTPDLHL FV AVQRLGGQERATPKLVLQLMNVKGL+IAHVKSHLQM
Sbjct  53   IRPYVRSKMPRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQM  112

Query  189  YRSKKVDDHGQVI  227
            +RSKKVDD  QV 
Sbjct  113  FRSKKVDDRNQVF  125



>ref|XP_009345244.1| PREDICTED: uncharacterized protein LOC103937055 isoform X1 [Pyrus 
x bretschneideri]
Length=379

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK  RLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  65   GSVRQYVRSKTSRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHL  124

Query  183  QMYRSKKVDDHGQVINERAGY  245
            QM+RSKK++D  QV+ ++AG+
Sbjct  125  QMHRSKKMEDPNQVLTDQAGF  145



>ref|XP_007207102.1| hypothetical protein PRUPE_ppa021179mg [Prunus persica]
 gb|EMJ08301.1| hypothetical protein PRUPE_ppa021179mg [Prunus persica]
Length=333

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSK+PRLRWTPDLHL F+ AV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  56   ASVRPYVRSKMPRLRWTPDLHLRFIHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHL  115

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK+DD GQ
Sbjct  116  QMYRSKKIDDAGQ  128



>ref|XP_010092813.1| Putative Myb family transcription factor [Morus notabilis]
 gb|EXB52399.1| Putative Myb family transcription factor [Morus notabilis]
Length=368

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSK PRLRW PDLHL FV AV+RLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  58   SSVRPYVRSKAPRLRWMPDLHLRFVHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHL  117

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK+DD GQV+
Sbjct  118  QMYRSKKIDDAGQVL  132



>emb|CDO96808.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK+PRLRWTPDLHL FV A++RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  82   VRQYNRSKLPRLRWTPDLHLSFVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  141

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQVI
Sbjct  142  YRSKKLDESGQVI  154



>gb|AAT64038.1| putative MYB transcription factor [Gossypium hirsutum]
Length=349

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLH  FV+AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  71   VRQYVRSKLPRLRWTPDLHYSFVRAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  130

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D+ GQV+++
Sbjct  131  YRSKKLDEAGQVLSQ  145



>ref|XP_003629774.1| Myb family transcription factor APL [Medicago truncatula]
 gb|AET04250.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=426

 Score =   137 bits (344),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVRQYVRSK+PRLRWTPDLH  F+ AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQ
Sbjct  100  GVRQYVRSKMPRLRWTPDLHHSFMHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQ  159

Query  186  MYRSKKVDDHGQVI  227
            MYRSKK+D+ GQV+
Sbjct  160  MYRSKKLDEAGQVL  173



>ref|XP_006435783.1| hypothetical protein CICLE_v10032941mg [Citrus clementina]
 gb|ESR49023.1| hypothetical protein CICLE_v10032941mg [Citrus clementina]
Length=162

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G  RQY RSK PRLRWTP+LHLCFVQAV+RLGGQ+RATPKLVLQ MN+KGL+I+HVKSHL
Sbjct  58   GSTRQYNRSKTPRLRWTPELHLCFVQAVERLGGQDRATPKLVLQFMNIKGLSISHVKSHL  117

Query  183  QMYRSKKVDDHGQVI  227
            QMYR+KK+DD  Q I
Sbjct  118  QMYRNKKIDDPNQGI  132



>gb|KEH20674.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=428

 Score =   137 bits (344),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVRQYVRSK+PRLRWTPDLH  F+ AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQ
Sbjct  102  GVRQYVRSKMPRLRWTPDLHHSFMHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQ  161

Query  186  MYRSKKVDDHGQVI  227
            MYRSKK+D+ GQV+
Sbjct  162  MYRSKKLDEAGQVL  175



>ref|XP_008225297.1| PREDICTED: transcription activator GLK1-like [Prunus mume]
 ref|XP_008225298.1| PREDICTED: transcription activator GLK1-like [Prunus mume]
Length=417

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK+PRLRWTP LHL FV A++RLGGQ+RATPKLVLQLMNVKGL+I+HVKSHL
Sbjct  77   GKVRQYVRSKMPRLRWTPQLHLSFVHAIERLGGQDRATPKLVLQLMNVKGLSISHVKSHL  136

Query  183  QMYRSKKVDDHGQVINER  236
            QMYRSKK+D  GQV++E+
Sbjct  137  QMYRSKKLDGDGQVVSEK  154



>ref|XP_006411281.1| hypothetical protein EUTSA_v10016733mg [Eutrema salsugineum]
 gb|ESQ52734.1| hypothetical protein EUTSA_v10016733mg [Eutrema salsugineum]
Length=409

 Score =   136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 85/118 (72%), Gaps = 6/118 (5%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LHLCF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  76   GSVRPYNRSKTPRLRWTPELHLCFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  135

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWS  347
            QMYRSKK DD  Q      G+  G       NL QLPM   FD+R  ++  Y + SW+
Sbjct  136  QMYRSKKTDDPNQ---GDQGFSFGEGAGYTYNLSQLPMLQSFDQRPSTSLGYGSGSWT  190



>ref|XP_006597479.1| PREDICTED: uncharacterized protein LOC100787474 isoform X2 [Glycine 
max]
Length=365

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK+PRLRWTP+LH  FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  71   GTVRQYVRSKMPRLRWTPELHHSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  130

Query  183  QMYRSKKVDDHGQVINERA  239
            QMYRSKK+D+ GQV+++ +
Sbjct  131  QMYRSKKLDEVGQVLSQTS  149



>gb|KHF99142.1| hypothetical protein F383_20210 [Gossypium arboreum]
Length=348

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLH  FV+AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  70   VRQYVRSKLPRLRWTPDLHHSFVRAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  129

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D+ GQV+++
Sbjct  130  YRSKKLDEAGQVLSQ  144



>ref|XP_008448244.1| PREDICTED: uncharacterized protein LOC103490495 isoform X1 [Cucumis 
melo]
 ref|XP_008448245.1| PREDICTED: uncharacterized protein LOC103490495 isoform X1 [Cucumis 
melo]
Length=406

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR+Y RSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  54   GSVRKYSRSKMPRLRWTPDLHLAFVNAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  113

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKK+D+ GQV+++
Sbjct  114  QMYRSKKLDESGQVLSQ  130



>ref|XP_007134813.1| hypothetical protein PHAVU_010G078400g [Phaseolus vulgaris]
 gb|ESW06807.1| hypothetical protein PHAVU_010G078400g [Phaseolus vulgaris]
Length=312

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            +R Y+RSK+PRLRWTPDLHL F+ AVQRLGGQERATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  52   IRPYIRSKLPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNMKGLSIAHVKSHLQM  111

Query  189  YRSKKVDDHGQVIN  230
            +RSKKVDD  QV +
Sbjct  112  FRSKKVDDRNQVFS  125



>gb|KDO68898.1| hypothetical protein CISIN_1g029903mg [Citrus sinensis]
Length=185

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G  RQY RSK PRLRWTP+LHLCFVQAV+RLGGQ+RATPKLVLQ MN+KGL+I+HVKSHL
Sbjct  81   GSTRQYNRSKTPRLRWTPELHLCFVQAVERLGGQDRATPKLVLQFMNIKGLSISHVKSHL  140

Query  183  QMYRSKKVDDHGQVI  227
            QMYR+KK+DD  Q I
Sbjct  141  QMYRNKKIDDPNQGI  155



>ref|XP_004162479.1| PREDICTED: uncharacterized LOC101205384 [Cucumis sativus]
Length=408

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR+Y RSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  54   GNVRKYSRSKMPRLRWTPDLHLAFVNAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  113

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKK+D+ GQV+++
Sbjct  114  QMYRSKKLDESGQVLSQ  130



>ref|XP_004150753.1| PREDICTED: uncharacterized protein LOC101205384 [Cucumis sativus]
 gb|KGN46990.1| hypothetical protein Csa_6G157640 [Cucumis sativus]
Length=408

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR+Y RSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  54   GNVRKYSRSKMPRLRWTPDLHLAFVNAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  113

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKK+D+ GQV+++
Sbjct  114  QMYRSKKLDESGQVLSQ  130



>gb|ACD56656.1| putative MYB transcription factor [Gossypioides kirkii]
Length=348

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLH  FV+AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  71   VRQYVRSKLPRLRWTPDLHHSFVRAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  130

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D+ GQV+++
Sbjct  131  YRSKKLDEAGQVLSQ  145



>ref|XP_003577159.1| PREDICTED: two-component response regulator ARR18-like [Brachypodium 
distachyon]
Length=298

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK PRLRWTP+LHLCF++AVQRLGGQ+RATPKLVLQLMNV+GL+I HVKSHLQM
Sbjct  50   VRPYVRSKNPRLRWTPELHLCFLRAVQRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQM  109

Query  189  YRSKKVDDHGQVI  227
            YRSK++DD GQ+I
Sbjct  110  YRSKRIDDSGQII  122



>emb|CBI30694.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQ RATPKLVL+LMNVKGL+IAHVKSHLQ
Sbjct  74   SVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQARATPKLVLELMNVKGLSIAHVKSHLQ  133

Query  186  MYRSKKVDDHGQVI  227
            MYRSK++D+ GQV+
Sbjct  134  MYRSKRLDESGQVL  147



>ref|XP_002528326.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF34084.1| DNA binding protein, putative [Ricinus communis]
Length=375

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQY RSK+PRLRWTPDLHLCFV AV+RLGG+ERATPKLVLQ+MN+KGL+IAHVKSHLQ
Sbjct  64   SVRQYNRSKMPRLRWTPDLHLCFVHAVERLGGEERATPKLVLQMMNIKGLSIAHVKSHLQ  123

Query  186  MYRSKKVDD  212
            MYRSKK+DD
Sbjct  124  MYRSKKIDD  132



>ref|XP_010925633.1| PREDICTED: uncharacterized protein LOC105048124 [Elaeis guineensis]
Length=530

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY+RSK+PRLRWTPDLHL F+ AV+RLGGQERATPKLVLQ+MNVKGL+IAHVKSHLQM
Sbjct  106  VRQYIRSKMPRLRWTPDLHLSFIHAVERLGGQERATPKLVLQMMNVKGLSIAHVKSHLQM  165

Query  189  YRSKKVDDHGQ  221
            YRSKK+DD GQ
Sbjct  166  YRSKKLDDSGQ  176



>ref|XP_006467640.1| PREDICTED: uncharacterized protein LOC102609915 [Citrus sinensis]
Length=428

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQE+ATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  83   VRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQM  142

Query  189  YRSKKVDDHGQVIN  230
            YRSKK+D+ GQV++
Sbjct  143  YRSKKLDEAGQVLS  156



>ref|XP_009337761.1| PREDICTED: LOW QUALITY PROTEIN: putative two-component response 
regulator ARR13 [Pyrus x bretschneideri]
Length=331

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 103/152 (68%), Gaps = 22/152 (14%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWT DLHL F+ A++RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  60   VRPYVRSKMPRLRWTTDLHLRFIHAMERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQM  119

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM------FDRRIRSNFRYMN----N  338
            YRSKK++D GQV+ +R G+     +  + NL QLPM      +++   ++FRY +    N
Sbjct  120  YRSKKINDAGQVLPDRQGHLGECGDKNIYNLSQLPMLQGYKLYNQSHTTSFRYGSYGDAN  179

Query  339  SWS---------CSN---ANWMSARNNNSIIN  398
            SW+         CS     NW ++  +N+  N
Sbjct  180  SWNAFENPGFSRCSTGFQGNWRTSSTSNNAYN  211



>ref|XP_006663711.1| PREDICTED: transcription activator GLK2-like [Oryza brachyantha]
Length=300

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK PRLRWTP+LHLCFV+AV RLGGQ+RATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  46   VRPYVRSKNPRLRWTPELHLCFVRAVDRLGGQDRATPKLVLQLMNVRGLSIAHVKSHLQM  105

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQVI
Sbjct  106  YRSKKIDESGQVI  118



>ref|XP_010999741.1| PREDICTED: uncharacterized protein LOC105107499 [Populus euphratica]
Length=393

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRS++PRLRWTPDLHL FV AV+RLGGQE+ATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  75   VRQYVRSRMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQM  134

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQV+
Sbjct  135  YRSKKLDEAGQVL  147



>ref|XP_010655530.1| PREDICTED: uncharacterized protein LOC104880489 isoform X2 [Vitis 
vinifera]
Length=457

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQ RATPKLVL+LMNVKGL+IAHVKSHLQ
Sbjct  74   SVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQARATPKLVLELMNVKGLSIAHVKSHLQ  133

Query  186  MYRSKKVDDHGQVI  227
            MYRSK++D+ GQV+
Sbjct  134  MYRSKRLDESGQVL  147



>ref|XP_010274476.1| PREDICTED: uncharacterized protein LOC104609785 [Nelumbo nucifera]
 ref|XP_010274477.1| PREDICTED: uncharacterized protein LOC104609785 [Nelumbo nucifera]
Length=462

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL F+ AV++LGGQERATPKLVLQLMNV+GL+I+HVKSHLQM
Sbjct  80   VRQYVRSKMPRLRWTPDLHLSFLHAVEKLGGQERATPKLVLQLMNVRGLSISHVKSHLQM  139

Query  189  YRSKKVDDHGQVIN  230
            YRSKK+D+ GQV++
Sbjct  140  YRSKKLDESGQVLS  153



>ref|XP_004233059.1| PREDICTED: two-component response regulator ARR18-like [Solanum 
lycopersicum]
Length=348

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLH  FV A++RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  61   VRQYVRSKLPRLRWTPDLHRSFVHAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  120

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQV+
Sbjct  121  YRSKKLDESGQVL  133



>ref|XP_009767509.1| PREDICTED: two-component response regulator ARR18-like [Nicotiana 
sylvestris]
Length=330

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+ RLRWT DLHL FVQAV++LGGQERATPKLVLQ MN+KGLNIAHVKSHLQM
Sbjct  52   VRPYVRSKMVRLRWTTDLHLRFVQAVEKLGGQERATPKLVLQSMNIKGLNIAHVKSHLQM  111

Query  189  YRSKKVDDHGQVINERAGYHTGnt--nnllqnlwqlPMFDRRIRSNFRYMNNSWSC  350
            YRSKK+DD  Q I     +  G       +  L  LP F +R  S FRY + S +C
Sbjct  112  YRSKKIDDLTQGIANYRPFMEGGDPNIYNMSELPVLPTFIQRFNSTFRYGDASRNC  167



>ref|XP_010655529.1| PREDICTED: uncharacterized protein LOC104880489 isoform X1 [Vitis 
vinifera]
Length=470

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQ RATPKLVL+LMNVKGL+IAHVKSHLQ
Sbjct  106  SVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQARATPKLVLELMNVKGLSIAHVKSHLQ  165

Query  186  MYRSKKVDDHGQVI  227
            MYRSK++D+ GQV+
Sbjct  166  MYRSKRLDESGQVL  179



>ref|XP_010037685.1| PREDICTED: uncharacterized protein LOC104426365 [Eucalyptus grandis]
 gb|KCW49432.1| hypothetical protein EUGRSUZ_K02966 [Eucalyptus grandis]
 gb|KCW49433.1| hypothetical protein EUGRSUZ_K02966 [Eucalyptus grandis]
Length=366

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL F+ A++RLGGQ+RATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  66   VRPYVRSKMPRLRWTPDLHLRFIHAIERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQM  125

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMFDRRI--RSNFRYMNNSW  344
            YR+KK+DD+GQV+ +         NN +  L QLPM        SNFRY +  W
Sbjct  126  YRNKKIDDNGQVLADHRHLVECGENNNVYKLSQLPMLQGYSGQTSNFRYGDPCW  179



>ref|XP_008374230.1| PREDICTED: uncharacterized protein LOC103437524 isoform X1 [Malus 
domestica]
 ref|XP_008362730.1| PREDICTED: uncharacterized protein LOC103426420 isoform X1 [Malus 
domestica]
Length=410

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK  RLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  96   GSVRQYVRSKTSRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHL  155

Query  183  QMYRSKKVDDHGQVINERAGY  245
            QM+RSKK++D  QV+ + AG+
Sbjct  156  QMHRSKKMEDPNQVLTDXAGF  176



>ref|XP_006663145.1| PREDICTED: transcription activator GLK2-like [Oryza brachyantha]
Length=306

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 121/240 (50%), Gaps = 42/240 (18%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK PRLRWTP+LHLCFV+AV RLGGQ+RATPKLVLQLMNV+GL+I HVKSHLQM
Sbjct  49   VRPYVRSKNPRLRWTPELHLCFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQM  108

Query  189  YRSKKVDDHGQVIN-----ERAGY----HTGntnnllqnlwqlPMFDRRI------RSNF  323
            YRSKK+D+ GQVI      E   Y    H G   N+        +  R I      R  F
Sbjct  109  YRSKKIDESGQVIGGGSWREEHQYVHHGHGGQAYNVGHISLPALLHHRHITAGSGTRPRF  168

Query  324  RYMNNSWSCSNANWMSARNNNSIINGGLGMNKNMIFTGGPEWKRGHEALREANNAKPTQL  503
                + W C  + W  A ++              +F G   +     A  EA++A     
Sbjct  169  GNAWSPWRCHASYWTHAGHH--------------LFVGSKPYYPP-PAAAEAHDA----F  209

Query  504  QSGESLIPSFINGVSSPDIKWSSFSPAMKRNGGEKAVDLNLTLSMNL--------KRERE  659
             +  S +P F+   SS   +       +      +   LNL LS+N+        KR+RE
Sbjct  210  HTASSHLPDFVVQGSSNHQRAVVLKEIICNEDEGEGPHLNLDLSLNIVNAGPRREKRKRE  269



>ref|XP_002316821.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE97433.1| myb family transcription factor family protein [Populus trichocarpa]
Length=155

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQE+ATPKLV QLMNV+ L+IAHVKSHLQ 
Sbjct  80   VRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQEKATPKLVFQLMNVRELSIAHVKSHLQR  139

Query  189  YRSKKVDDHGQ  221
            YRSKK+D+ GQ
Sbjct  140  YRSKKLDEAGQ  150



>ref|XP_008790063.1| PREDICTED: uncharacterized protein LOC103707382 [Phoenix dactylifera]
Length=555

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY+RSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  139  VRQYIRSKMPRLRWTPDLHLSFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  198

Query  189  YRSKKVDDHGQ  221
            YRSKK+DD GQ
Sbjct  199  YRSKKLDDSGQ  209



>ref|XP_006362389.1| PREDICTED: uncharacterized protein LOC102585011 [Solanum tuberosum]
Length=348

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK PRLRWTPDLH  FV A++RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  61   VRQYVRSKFPRLRWTPDLHRSFVHAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  120

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQV+
Sbjct  121  YRSKKLDESGQVL  133



>ref|XP_004148628.1| PREDICTED: probable transcription factor KAN2-like [Cucumis sativus]
Length=201

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL FV AV+RLGGQE ATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  61   VRPYVRSKLPRLRWTPDLHLRFVHAVERLGGQENATPKLVLQLMNIKGLSIAHVKSHLQM  120

Query  189  YRSKKVDDHGQVINER  236
            YRSKK ++ GQV+ ++
Sbjct  121  YRSKKTNEPGQVVGDQ  136



>ref|XP_004492477.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X1 [Cicer arietinum]
Length=325

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSK PRLRWTPDLHL F+ AVQRLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  62   SSVRPYVRSKFPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHL  121

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKKV D  QV+
Sbjct  122  QMYRSKKVVDTNQVL  136



>gb|EMT27812.1| Putative Myb family transcription factor [Aegilops tauschii]
Length=508

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK+PRLRWTPDLH+ F++AV+RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  97   VRQYNRSKLPRLRWTPDLHMAFIRAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  156

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D HGQ I
Sbjct  157  YRSKKLDHHGQRI  169



>ref|XP_006597478.1| PREDICTED: uncharacterized protein LOC100787474 isoform X1 [Glycine 
max]
Length=372

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK+PRLRWTP+LH  FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHL
Sbjct  71   GTVRQYVRSKMPRLRWTPELHHSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHL  130

Query  183  QMYRSKKVDDHGQV  224
            QMYRSKK+D+ GQV
Sbjct  131  QMYRSKKLDEVGQV  144



>ref|XP_009607761.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Nicotiana tomentosiformis]
Length=373

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV+A++RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  76   VRQYVRSKLPRLRWTPDLHLSFVRAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  135

Query  189  YRSKKVDDHGQVI  227
            YRSKK+ + GQV+
Sbjct  136  YRSKKLGEFGQVL  148



>ref|XP_003520352.1| PREDICTED: uncharacterized protein LOC100801120 [Glycine max]
Length=346

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            +R YVRSK+PRLRWTPDLHL F+ AVQRLGGQERATPKLVLQLMN+K L+IAHVKSHLQM
Sbjct  53   IRPYVRSKMPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKSLSIAHVKSHLQM  112

Query  189  YRSKKVDDHGQVI  227
            +RSKKVDD  QV 
Sbjct  113  FRSKKVDDRNQVF  125



>gb|EMT11720.1| Putative Myb family transcription factor [Aegilops tauschii]
Length=363

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK PRLRWTP+LH CFV+A+ RLGGQ+RATPKLVLQLMNV+GL+I HVKSHLQM
Sbjct  85   VRPYVRSKNPRLRWTPELHHCFVRAIHRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQM  144

Query  189  YRSKKVDDHGQVI  227
            YRSKK+DD GQVI
Sbjct  145  YRSKKIDDSGQVI  157



>ref|XP_006583665.1| PREDICTED: uncharacterized protein LOC102662997 isoform X1 [Glycine 
max]
 ref|XP_006583666.1| PREDICTED: uncharacterized protein LOC102662997 isoform X2 [Glycine 
max]
Length=366

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL F+ AVQRLGGQERATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  58   VRPYVRSKMPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQM  117

Query  189  YRSKKVDDHGQVINERAGYHTG  254
            YRSKKVD +  + + R    TG
Sbjct  118  YRSKKVDTNQVLADPRLLVETG  139



>ref|XP_002988200.1| hypothetical protein SELMODRAFT_426960 [Selaginella moellendorffii]
 gb|EFJ10619.1| hypothetical protein SELMODRAFT_426960 [Selaginella moellendorffii]
Length=424

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK+PRLRWTPDLH CFV AV+RLGGQ+RATPKLVLQLM+VKGL IAHVKSHL
Sbjct  75   GGVRQYVRSKMPRLRWTPDLHHCFVNAVERLGGQDRATPKLVLQLMDVKGLTIAHVKSHL  134

Query  183  QMYRSKKVDD-HGQVINERAGYH  248
            QMYRS K D+ HGQ  +E    H
Sbjct  135  QMYRSMKNDENHGQASSEAGQDH  157



>ref|XP_009759227.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Nicotiana sylvestris]
 ref|XP_009759228.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Nicotiana sylvestris]
Length=350

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV+A++RLGGQERATPKLVLQ MNV+GL+IAHVKSHLQM
Sbjct  53   VRQYVRSKLPRLRWTPDLHLSFVRAIERLGGQERATPKLVLQTMNVRGLSIAHVKSHLQM  112

Query  189  YRSKKVDDHGQVI  227
            YRSKK+ + GQV+
Sbjct  113  YRSKKLGEFGQVL  125



>ref|XP_008228923.1| PREDICTED: uncharacterized protein LOC103328312 isoform X1 [Prunus 
mume]
Length=432

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL-  182
             VRQYVRSK+PRLRWTPDLHL FV AV RLGGQERATPKLVLQLMNV+GL+IAHVKSHL 
Sbjct  100  AVRQYVRSKMPRLRWTPDLHLAFVHAVDRLGGQERATPKLVLQLMNVRGLSIAHVKSHLQ  159

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKK+D+ GQVI++
Sbjct  160  QMYRSKKLDESGQVISQ  176



>ref|XP_011101395.1| PREDICTED: two-component response regulator ARR1-like [Sesamum 
indicum]
Length=408

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQY+RSK+PRLRWTPDLHL FV A++RLGGQERATPK VLQLMNV+GL+I+HVKSHLQ
Sbjct  86   SVRQYIRSKMPRLRWTPDLHLSFVHAIERLGGQERATPKAVLQLMNVRGLSISHVKSHLQ  145

Query  186  MYRSKKVDDHGQVI  227
            MYRSKK+D+ G+VI
Sbjct  146  MYRSKKLDESGKVI  159



>gb|KDO63386.1| hypothetical protein CISIN_1g038268mg, partial [Citrus sinensis]
Length=260

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
             RQYVRSK+PRLRWT DLHL FV AV+RLGGQERATPK VLQLMNVKGL+IAHVKSHLQM
Sbjct  74   ARQYVRSKMPRLRWTQDLHLAFVHAVERLGGQERATPKSVLQLMNVKGLSIAHVKSHLQM  133

Query  189  YRSKKVDDHGQVINER  236
            YRSKK+D  GQV++ R
Sbjct  134  YRSKKLDASGQVLSNR  149



>ref|XP_009421270.1| PREDICTED: uncharacterized protein LOC104000854 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=518

 Score =   134 bits (338),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  106  VRQYVRSKLPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  165

Query  189  YRSKKVDDHGQ  221
            YRSKK+D  GQ
Sbjct  166  YRSKKLDGSGQ  176



>ref|XP_009421269.1| PREDICTED: uncharacterized protein LOC104000854 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=519

 Score =   134 bits (338),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  106  VRQYVRSKLPRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  165

Query  189  YRSKKVDDHGQ  221
            YRSKK+D  GQ
Sbjct  166  YRSKKLDGSGQ  176



>ref|XP_002963490.1| hypothetical protein SELMODRAFT_438636 [Selaginella moellendorffii]
 gb|EFJ35361.1| hypothetical protein SELMODRAFT_438636 [Selaginella moellendorffii]
Length=427

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQYVRSK+PRLRWTPDLH CFV AV+RLGGQ+RATPKLVLQLM+VKGL IAHVKSHL
Sbjct  75   GGVRQYVRSKMPRLRWTPDLHHCFVNAVERLGGQDRATPKLVLQLMDVKGLTIAHVKSHL  134

Query  183  QMYRSKKVDD-HGQVINERAGYH  248
            QMYRS K D+ HGQ  +E    H
Sbjct  135  QMYRSMKNDENHGQASSEAGQDH  157



>ref|XP_009352761.1| PREDICTED: uncharacterized protein LOC103944086 [Pyrus x bretschneideri]
 ref|XP_009352762.1| PREDICTED: uncharacterized protein LOC103944086 [Pyrus x bretschneideri]
 ref|XP_009352763.1| PREDICTED: uncharacterized protein LOC103944086 [Pyrus x bretschneideri]
Length=397

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTP LHL FV AV+RLGGQ+RATPKLVLQLMNV+GL+I+HVKSHLQM
Sbjct  72   VRQYVRSKMPRLRWTPQLHLSFVHAVERLGGQDRATPKLVLQLMNVRGLSISHVKSHLQM  131

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D +GQV++E
Sbjct  132  YRSKKLDGNGQVLSE  146



>gb|KGN54397.1| hypothetical protein Csa_4G312300 [Cucumis sativus]
Length=331

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL FV AV+RLGGQE ATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  61   VRPYVRSKLPRLRWTPDLHLRFVHAVERLGGQENATPKLVLQLMNIKGLSIAHVKSHLQM  120

Query  189  YRSKKVDDHGQVINERAGY--HTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSNAN  362
            YRSKK ++ GQV+ ++      + N +  + N+ Q+PMF R    N  Y +N +    ++
Sbjct  121  YRSKKTNEPGQVVGDQRVLMAESNNGDRNIFNVSQIPMFQRY---NSSYPSNLFRFGGSS  177

Query  363  WMSARN  380
            W +  N
Sbjct  178  WKAIEN  183



>ref|XP_009350428.1| PREDICTED: uncharacterized protein LOC103941921 [Pyrus x bretschneideri]
Length=395

 Score =   133 bits (335),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTP LHL FV AV+RLGGQ+RATPKL+LQLMNV+GL+I+HVKSHLQM
Sbjct  70   VRQYVRSKMPRLRWTPQLHLSFVHAVERLGGQDRATPKLILQLMNVRGLSISHVKSHLQM  129

Query  189  YRSKKVDDHGQVINER  236
            YRSKK+D +GQV++E+
Sbjct  130  YRSKKLDGNGQVLSEK  145



>ref|XP_008356062.1| PREDICTED: uncharacterized protein LOC103419745 [Malus domestica]
Length=352

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTP LHL FV AV+RLGGQ+RATPKL+LQLMNV+GL+I+HVKSHLQM
Sbjct  70   VRQYVRSKMPRLRWTPQLHLSFVHAVERLGGQDRATPKLILQLMNVRGLSISHVKSHLQM  129

Query  189  YRSKKVDDHGQVINER  236
            YR+KK+D +GQV++E+
Sbjct  130  YRNKKLDGNGQVLSEK  145



>ref|XP_006594551.1| PREDICTED: uncharacterized protein LOC102669757 [Glycine max]
 gb|KHN08429.1| Putative Myb family transcription factor [Glycine soja]
Length=373

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTP+LH  F  AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  78   VRQYVRSKMPRLRWTPELHHSFAHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  137

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D+ GQV+++
Sbjct  138  YRSKKLDEAGQVLSQ  152



>emb|CDP05632.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL F+ AV+RLGGQERATPK VLQLMN KGLNI HVKSHLQM
Sbjct  60   VRPYVRSKMPRLRWTPDLHLRFLHAVERLGGQERATPKSVLQLMNTKGLNITHVKSHLQM  119

Query  189  YRSKKVDDHGQVINERAGYHTGntnnllqnlw--qlPMFDRRIRSNFRYMNNSW  344
            YRSKK+DD  Q I +      G   N+         P F    +S FRY   +W
Sbjct  120  YRSKKIDDPSQGITDHRQVFEGVDPNIFNLSQIPMFPGFHHNHKSTFRYGEATW  173



>ref|XP_010907868.1| PREDICTED: transcription activator GLK2-like isoform X1 [Elaeis 
guineensis]
Length=338

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 104/254 (41%), Positives = 136/254 (54%), Gaps = 41/254 (16%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQER--ATPKLVLQLMNVKGLNIAHVKS  176
            G VRQYVRSK PRLRWTP+LHLCFVQAV+RLGGQ+   ATPK+VL+LM VKGL+IAHVKS
Sbjct  48   GTVRQYVRSKNPRLRWTPELHLCFVQAVERLGGQDHAGATPKMVLELMKVKGLSIAHVKS  107

Query  177  HLQMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF----DRRIRSNFRYMNNSW  344
            HLQMYRSKK+D+ GQVI +      G T   + NL  LPM      R    N R   +SW
Sbjct  108  HLQMYRSKKIDESGQVIADPWSVMKG-TKQHIYNLGHLPMLHGCHQRPTIPNLRSDGSSW  166

Query  345  SCSNANW-----MSARNNNSIINGGLGMNKNMIFTGGPEWK-----------RGHEA---  467
               + NW     +S   N+++ +   G    MIF G    K             H+A   
Sbjct  167  -FGHRNWTQNPVLSRAMNSTVGSRSHGSINEMIFRGSDRLKSNQDFHINTSSSNHQAICE  225

Query  468  LREANNAK---------PTQLQSGESLIPSFINGVSSPDIKWSSFSPAMKRNGGEKAVDL  620
            LREA              TQ Q+ E        G++ P+ + S      +    ++  DL
Sbjct  226  LREATGESHLLHNCRLGTTQYQAEERGAYLQERGLTGPEGQSSE-----RWKANDQGPDL  280

Query  621  NLTLSMNLKREREQ  662
            NL+L +  ++E++Q
Sbjct  281  NLSLHIGPRQEKKQ  294



>dbj|BAK04843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK PRLRWTP+LH CFV+A+ RLGGQ+RATPKLVLQLMNV+GL+I HVKSHLQM
Sbjct  45   VRPYVRSKNPRLRWTPELHHCFVRAIHRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQM  104

Query  189  YRSKKVDDHGQVI  227
            YRSKK+DD GQVI
Sbjct  105  YRSKKIDDSGQVI  117



>ref|XP_006486285.1| PREDICTED: uncharacterized protein LOC102620939 [Citrus sinensis]
Length=387

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G  RQY RSK PRLRWTP+LHLCFVQAV+RLGGQ+RATPKLVLQ MN+KGL+I+HVKSHL
Sbjct  81   GSTRQYNRSKTPRLRWTPELHLCFVQAVERLGGQDRATPKLVLQFMNIKGLSISHVKSHL  140

Query  183  QMYRSKKVDDHGQ  221
            QMYR+KK+DD  Q
Sbjct  141  QMYRNKKIDDPNQ  153



>ref|XP_008794301.1| PREDICTED: uncharacterized protein LOC103710387 [Phoenix dactylifera]
Length=351

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY+RS  PRLRWTPDLHLCFV+AV+RLGGQ+RATPKLVLQLMNVKGL+I+HVKSHL
Sbjct  44   GFVRQYIRSNNPRLRWTPDLHLCFVRAVERLGGQDRATPKLVLQLMNVKGLSISHVKSHL  103

Query  183  QMYRSKKVDD  212
            QMYRSKK+D+
Sbjct  104  QMYRSKKIDE  113



>ref|XP_010322167.1| PREDICTED: putative two-component response regulator ARR21 isoform 
X1 [Solanum lycopersicum]
Length=375

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VRQYVRSK PRLRWTP+LHL FV AV+RLGGQ+RATPKLVLQ MN+KGL+IAHVKSHL
Sbjct  59   ASVRQYVRSKTPRLRWTPELHLRFVHAVERLGGQDRATPKLVLQFMNIKGLSIAHVKSHL  118

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKK DD  Q +
Sbjct  119  QMYRSKKTDDPNQTV  133



>ref|XP_006602682.1| PREDICTED: two-component response regulator ARR14-like [Glycine 
max]
Length=360

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL FV AVQRLGGQERATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  58   VRPYVRSKMPRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQM  117

Query  189  YRSKKVD  209
            YRSKKVD
Sbjct  118  YRSKKVD  124



>ref|XP_006469002.1| PREDICTED: uncharacterized protein LOC102628788 [Citrus sinensis]
Length=340

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
             RQYVRSK+PRLRWT DLHL FV AV+RLGGQERATPK VLQLMNVKGL+IAHVKSHLQM
Sbjct  74   ARQYVRSKMPRLRWTQDLHLAFVHAVERLGGQERATPKSVLQLMNVKGLSIAHVKSHLQM  133

Query  189  YRSKKVDDHGQVINER  236
            YRSKK+D  GQV++ R
Sbjct  134  YRSKKLDASGQVLSNR  149



>ref|XP_010104403.1| Putative Myb family transcription factor [Morus notabilis]
 gb|EXC00248.1| Putative Myb family transcription factor [Morus notabilis]
Length=468

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSK+PRLRWTPDLHL FV AV+RLGGQERATPKLV QLM+VKGL+IAHVKSHL
Sbjct  78   SSVRPYVRSKMPRLRWTPDLHLAFVHAVERLGGQERATPKLVQQLMDVKGLSIAHVKSHL  137

Query  183  QMYRSKKVDDHGQVINE  233
            QMYRSKK+D+ GQV+++
Sbjct  138  QMYRSKKLDESGQVLSQ  154



>ref|XP_006429461.1| hypothetical protein CICLE_v10011992mg [Citrus clementina]
 ref|XP_006481085.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X1 [Citrus sinensis]
 ref|XP_006481086.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X2 [Citrus sinensis]
 gb|ESR42701.1| hypothetical protein CICLE_v10011992mg [Citrus clementina]
Length=371

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 91/125 (73%), Gaps = 7/125 (6%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL FV AV++LGGQERATPKLVLQ+M++KGL+IAHVKSHLQM
Sbjct  57   VRPYVRSKMPRLRWTPDLHLRFVHAVEKLGGQERATPKLVLQMMDIKGLSIAHVKSHLQM  116

Query  189  YRSKKVDDHGQVI-NERAGYHTGntnnllqnlwqlPMF----DRRIRSNFRYMNNSWSCS  353
            YRSKK+DD G+ + + R    +G  +  + NL QLPM     ++   S FRY   SWS +
Sbjct  117  YRSKKIDDPGRAMADHRHLVESG--DRNIYNLSQLPMLQGYNNQSQASGFRYGEASWSTA  174

Query  354  NANWM  368
                M
Sbjct  175  REYLM  179



>ref|XP_010920993.1| PREDICTED: uncharacterized protein LOC105044705 isoform X2 [Elaeis 
guineensis]
Length=330

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY+RS  PRLRWTPDLHLCFV+AVQRLGGQ+RATPKLVLQLMNVKGL+IAHVKSHLQM
Sbjct  24   VRQYIRSTNPRLRWTPDLHLCFVRAVQRLGGQDRATPKLVLQLMNVKGLSIAHVKSHLQM  83

Query  189  YRSKKVDD  212
            YRSKK+D+
Sbjct  84   YRSKKMDE  91



>gb|KDO56741.1| hypothetical protein CISIN_1g017464mg [Citrus sinensis]
Length=371

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 91/125 (73%), Gaps = 7/125 (6%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL FV AV++LGGQERATPKLVLQ+M++KGL+IAHVKSHLQM
Sbjct  57   VRPYVRSKMPRLRWTPDLHLRFVNAVEKLGGQERATPKLVLQMMDIKGLSIAHVKSHLQM  116

Query  189  YRSKKVDDHGQVI-NERAGYHTGntnnllqnlwqlPMF----DRRIRSNFRYMNNSWSCS  353
            YRSKK+DD G+ + + R    +G  +  + NL QLPM     ++   S FRY   SWS +
Sbjct  117  YRSKKIDDPGRAMADHRHLVESG--DRNIYNLSQLPMLQGYNNQSQASGFRYGEASWSTA  174

Query  354  NANWM  368
                M
Sbjct  175  REYLM  179



>ref|XP_008353366.1| PREDICTED: uncharacterized protein LOC103416937 [Malus domestica]
 ref|XP_008353367.1| PREDICTED: uncharacterized protein LOC103416937 [Malus domestica]
 ref|XP_008353368.1| PREDICTED: uncharacterized protein LOC103416937 [Malus domestica]
 ref|XP_008353369.1| PREDICTED: uncharacterized protein LOC103416937 [Malus domestica]
Length=395

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTP LHL FV AV+RLGGQ+RATPKLVL+LMNV+GL+I+HVKSHLQM
Sbjct  72   VRQYVRSKMPRLRWTPQLHLSFVHAVERLGGQDRATPKLVLKLMNVRGLSISHVKSHLQM  131

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D +GQV++E
Sbjct  132  YRSKKLDGNGQVLSE  146



>ref|XP_008341218.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341219.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341220.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341221.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341223.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341224.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341225.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341226.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341227.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341228.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341229.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341230.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341231.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341232.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341233.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341234.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341235.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341236.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341237.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341238.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341239.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341240.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341241.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
 ref|XP_008341242.1| PREDICTED: uncharacterized protein LOC103404135 [Malus domestica]
Length=395

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTP LHL FV AV+RLGGQ+RATPKLVL+LMNV+GL+I+HVKSHLQM
Sbjct  72   VRQYVRSKMPRLRWTPQLHLSFVHAVERLGGQDRATPKLVLKLMNVRGLSISHVKSHLQM  131

Query  189  YRSKKVDDHGQVINE  233
            YRSKK+D +GQV++E
Sbjct  132  YRSKKLDGNGQVLSE  146



>ref|XP_008805079.1| PREDICTED: uncharacterized protein LOC103718164 [Phoenix dactylifera]
Length=305

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQY+RSKVPRLRWTPDLH CFV+A++RLGGQE+ATPKLVLQLMNV+GL I+HVKSHL
Sbjct  8    GGVRQYIRSKVPRLRWTPDLHHCFVRAIERLGGQEKATPKLVLQLMNVRGLTISHVKSHL  67

Query  183  QMYRSKKVDDHGQVINERAGYHT  251
            QMYRS + D   Q    +A  HT
Sbjct  68   QMYRSMRNDMGRQASELQARKHT  90



>ref|XP_006446804.1| hypothetical protein CICLE_v10015819mg [Citrus clementina]
 gb|ESR60044.1| hypothetical protein CICLE_v10015819mg [Citrus clementina]
Length=344

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
             RQYVRSK+PRLRWT DLHL FV AV+RLGGQERATPK VLQLMNVKGL+IAHVKSHLQM
Sbjct  74   ARQYVRSKMPRLRWTQDLHLAFVHAVERLGGQERATPKSVLQLMNVKGLSIAHVKSHLQM  133

Query  189  YRSKKVDDHGQVINERA  239
            YRSKK+D  GQV++ R 
Sbjct  134  YRSKKLDASGQVLSNRT  150



>ref|XP_004234092.1| PREDICTED: uncharacterized protein LOC101251954 [Solanum lycopersicum]
Length=307

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTP+LHL FV A+ RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  51   VRQYVRSKLPRLRWTPELHLSFVSAIDRLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  110

Query  189  YRSKKVDDHGQVI  227
            YRSKK+ + GQV+
Sbjct  111  YRSKKLGEFGQVL  123



>ref|XP_010322168.1| PREDICTED: putative two-component response regulator ARR21 isoform 
X2 [Solanum lycopersicum]
Length=374

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VRQYVRSK PRLRWTP+LHL FV AV+RLGGQ+RATPKLVLQ MN+KGL+IAHVKSHL
Sbjct  59   ASVRQYVRSKTPRLRWTPELHLRFVHAVERLGGQDRATPKLVLQFMNIKGLSIAHVKSHL  118

Query  183  QMYRSKKVDDHGQV  224
            QMYRSKK DD  Q+
Sbjct  119  QMYRSKKTDDPNQI  132



>ref|XP_006583667.1| PREDICTED: uncharacterized protein LOC102662997 isoform X3 [Glycine 
max]
Length=357

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTPDLHL F+ AVQRLGGQERATPKLVLQLMN+KGL+IAHVKSHLQM
Sbjct  58   VRPYVRSKMPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQM  117

Query  189  YRSKKVD  209
            YRSKKVD
Sbjct  118  YRSKKVD  124



>gb|AES79549.2| MYB-like transcription factor family protein [Medicago truncatula]
Length=352

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSK PRLRWTPDLH  F+ AVQRLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  61   SSVRPYVRSKFPRLRWTPDLHFRFLHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHL  120

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKKV D  QV+
Sbjct  121  QMYRSKKVVDTNQVL  135



>ref|XP_004492478.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X2 [Cicer arietinum]
Length=316

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 87/132 (66%), Gaps = 14/132 (11%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSK PRLRWTPDLHL F+ AVQRLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  62   SSVRPYVRSKFPRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHL  121

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWSCSNAN  362
            QMYRSKKV D  Q   ++  Y+            QLPM    ++      ++S+ C    
Sbjct  122  QMYRSKKVVDTNQDNGDKNVYNLS----------QLPM----LQGYTPNQSSSYRCGYEP  167

Query  363  WMSARNNNSIIN  398
             M  R+NN ++N
Sbjct  168  IMMERSNNHMVN  179



>ref|XP_010915504.1| PREDICTED: two-component response regulator ARR18-like isoform 
X2 [Elaeis guineensis]
Length=529

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR Y+RSK+PRLRWTPDLHL FV A++RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  110  VRPYIRSKMPRLRWTPDLHLSFVHAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  169

Query  189  YRSKKVDDHGQ  221
            YRSKK+DD GQ
Sbjct  170  YRSKKLDDSGQ  180



>ref|XP_003623331.1| Two-component response regulator ARR10 [Medicago truncatula]
Length=350

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSK PRLRWTPDLH  F+ AVQRLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  59   SSVRPYVRSKFPRLRWTPDLHFRFLHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHL  118

Query  183  QMYRSKKVDDHGQVI  227
            QMYRSKKV D  QV+
Sbjct  119  QMYRSKKVVDTNQVL  133



>ref|XP_010915503.1| PREDICTED: two-component response regulator ARR18-like isoform 
X1 [Elaeis guineensis]
Length=530

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR Y+RSK+PRLRWTPDLHL FV A++RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  110  VRPYIRSKMPRLRWTPDLHLSFVHAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  169

Query  189  YRSKKVDDHGQ  221
            YRSKK+DD GQ
Sbjct  170  YRSKKLDDSGQ  180



>ref|XP_010554678.1| PREDICTED: two-component response regulator ARR14-like [Tarenaya 
hassleriana]
Length=386

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 83/117 (71%), Gaps = 6/117 (5%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LHL FV AV+RLGGQ+RATPKLVLQLMN+KGL+IA VKSHL
Sbjct  69   GSVRPYNRSKTPRLRWTPELHLSFVHAVERLGGQDRATPKLVLQLMNIKGLSIAQVKSHL  128

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSW  344
            QMYRSKK D+H Q    + G+          NL Q+PM   FD+R  ++  Y + SW
Sbjct  129  QMYRSKKSDEHNQ---GQQGFSFETGTGYTCNLTQVPMLQSFDQRTSTSLGYGDTSW  182



>ref|XP_008371480.1| PREDICTED: uncharacterized protein LOC103434890 [Malus domestica]
 ref|XP_008371482.1| PREDICTED: uncharacterized protein LOC103434890 [Malus domestica]
 ref|XP_008371483.1| PREDICTED: uncharacterized protein LOC103434890 [Malus domestica]
Length=395

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSK+PRLRWTP LHL FV AV+RLGGQ+RATPKL+LQLMNV+GL+I+HVKSHLQM
Sbjct  70   VRQYVRSKMPRLRWTPQLHLSFVHAVERLGGQDRATPKLILQLMNVRGLSISHVKSHLQM  129

Query  189  YRSKKVDDHGQVINER  236
            YR KK+D +GQV++E+
Sbjct  130  YRXKKLDGNGQVLSEK  145



>ref|XP_006353444.1| PREDICTED: uncharacterized protein LOC102588048 [Solanum tuberosum]
Length=381

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VRQYVRSK PRLRWTP+LHL FV AV+RLGGQ+RATPKLVLQ MN+KGL+IAHVKSHL
Sbjct  66   ASVRQYVRSKTPRLRWTPELHLRFVHAVERLGGQDRATPKLVLQFMNIKGLSIAHVKSHL  125

Query  183  QMYRSKKVDDHGQV  224
            QMYRSKK DD  Q+
Sbjct  126  QMYRSKKTDDPNQI  139



>ref|XP_009802187.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
 ref|XP_009802188.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
 ref|XP_009802189.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
 ref|XP_009802190.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
 ref|XP_009802191.1| PREDICTED: uncharacterized protein LOC104247786 [Nicotiana sylvestris]
Length=398

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTP+LH  FV A++RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  90   VRHYVRSKMPRLRWTPELHRSFVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  149

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQV+
Sbjct  150  YRSKKLDESGQVL  162



>ref|XP_009141879.1| PREDICTED: two-component response regulator ARR1-like isoform 
X2 [Brassica rapa]
Length=417

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LHLCF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  82   GSVRPYNRSKTPRLRWTPELHLCFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  141

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK+DD  Q
Sbjct  142  QMYRSKKIDDLNQ  154



>ref|XP_010907870.1| PREDICTED: transcription activator GLK2-like isoform X3 [Elaeis 
guineensis]
Length=334

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 103/252 (41%), Positives = 135/252 (54%), Gaps = 41/252 (16%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSK PRLRWTP+LHLCFVQAV+RLGGQ+RATPK+VL+LM VKGL+IAHVKSHL
Sbjct  48   GTVRQYVRSKNPRLRWTPELHLCFVQAVERLGGQDRATPKMVLELMKVKGLSIAHVKSHL  107

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMF----DRRIRSNFRYMNNSWSC  350
            QMYRSKK+D+   VI +      G T   + NL  LPM      R    N R   +SW  
Sbjct  108  QMYRSKKIDE--SVIADPWSVMKG-TKQHIYNLGHLPMLHGCHQRPTIPNLRSDGSSW-F  163

Query  351  SNANW-----MSARNNNSIINGGLGMNKNMIFTGGPEWK-----------RGHEA---LR  473
             + NW     +S   N+++ +   G    MIF G    K             H+A   LR
Sbjct  164  GHRNWTQNPVLSRAMNSTVGSRSHGSINEMIFRGSDRLKSNQDFHINTSSSNHQAICELR  223

Query  474  EANNAK---------PTQLQSGESLIPSFINGVSSPDIKWSSFSPAMKRNGGEKAVDLNL  626
            EA              TQ Q+ E        G++ P+ + S      +    ++  DLNL
Sbjct  224  EATGESHLLHNCRLGTTQYQAEERGAYLQERGLTGPEGQSSE-----RWKANDQGPDLNL  278

Query  627  TLSMNLKREREQ  662
            +L +  ++E++Q
Sbjct  279  SLHIGPRQEKKQ  290



>ref|XP_009141878.1| PREDICTED: serine/threonine-protein kinase pakF-like isoform 
X1 [Brassica rapa]
Length=418

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LHLCF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  82   GSVRPYNRSKTPRLRWTPELHLCFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  141

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK+DD  Q
Sbjct  142  QMYRSKKIDDLNQ  154



>ref|XP_010534614.1| PREDICTED: uncharacterized protein LOC104810118 [Tarenaya hassleriana]
Length=409

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 84/118 (71%), Gaps = 6/118 (5%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LH CF+QAV+RLGGQ+RATPKLVLQ MNVKGL+IAHVKSHL
Sbjct  69   GSVRPYNRSKTPRLRWTPELHRCFLQAVERLGGQDRATPKLVLQTMNVKGLSIAHVKSHL  128

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWS  347
            QMYRSKK D+  Q    + G+          +L Q+PM   FD+R  ++  Y + SWS
Sbjct  129  QMYRSKKADEPNQ---GQQGFSFETGTGYTCSLSQVPMLQSFDQRPSTSLGYDDPSWS  183



>ref|XP_002442650.1| hypothetical protein SORBIDRAFT_08g000510 [Sorghum bicolor]
 gb|EES16488.1| hypothetical protein SORBIDRAFT_08g000510 [Sorghum bicolor]
Length=364

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK PRLRWTP+LHLCF++AV RLGGQ+RATPKLVLQLMNVKGL+I HVKSHLQM
Sbjct  73   VRPYVRSKNPRLRWTPELHLCFLRAVDRLGGQDRATPKLVLQLMNVKGLSIGHVKSHLQM  132

Query  189  YRSKKVDDHGQ  221
            YRSKK+DD GQ
Sbjct  133  YRSKKIDDSGQ  143



>emb|CDY07070.1| BnaA04g22450D [Brassica napus]
Length=416

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LHLCF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  81   GSVRPYNRSKTPRLRWTPELHLCFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  140

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK+DD  Q
Sbjct  141  QMYRSKKIDDLNQ  153



>ref|XP_004249715.1| PREDICTED: uncharacterized protein LOC101244920 [Solanum lycopersicum]
Length=302

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 98/155 (63%), Gaps = 9/155 (6%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VR YVRSK+ RLRWTPDLH  FV AV+RLGG +RATPKLVLQLMN+KGLNIAHVKSHLQ
Sbjct  52   SVRPYVRSKMVRLRWTPDLHRRFVHAVERLGGHDRATPKLVLQLMNIKGLNIAHVKSHLQ  111

Query  186  MYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMN-NSWSCS  353
            MYRSKK+DD  Q I           ++ + NL QLPM   F +R    FRY + +S +C 
Sbjct  112  MYRSKKIDDPSQGITNHHKLCMEGGDSYIYNLSQLPMLSSFKQRFNPTFRYGDVSSMNCQ  171

Query  354  NANWM--SARNNNSIINGGLGMNKNM---IFTGGP  443
            + + M  S    ++I    +G+   +   IF   P
Sbjct  172  DHDLMHSSIMGQSTIDKARIGLYTTLNERIFGSNP  206



>ref|XP_006363620.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006363621.1| PREDICTED: putative Myb family transcription factor At1g14600-like 
isoform X2 [Solanum tuberosum]
Length=303

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VR YVRSK+ RLRWTPDLH  FV  V+RLGG +RATPKLVLQLMN+KGLNIAHVKSHLQ
Sbjct  52   SVRPYVRSKMVRLRWTPDLHRRFVHVVERLGGHDRATPKLVLQLMNIKGLNIAHVKSHLQ  111

Query  186  MYRSKKVDDHGQ-VINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMN-NSWSC  350
            MYRSKK+DD  Q + N       G    +  NL QLPM   F +R  S FRY + +S +C
Sbjct  112  MYRSKKIDDPAQGITNHHKLCMEGGDPYIYYNLSQLPMLSSFKQRFNSTFRYGDVSSRNC  171

Query  351  SNANWM--SARNNNSIINGGLGMNKNM---IFTGGP  443
             + + M  S    ++I    +G+   +   IF   P
Sbjct  172  QDHDLMHSSIMRQSTIDKARIGLYTTLNERIFGNNP  207



>emb|CDY52431.1| BnaC03g72550D [Brassica napus]
Length=389

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 69/86 (80%), Gaps = 5/86 (6%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LH+CF+QAV+RLGG +RATPKLVLQLMNVKGL+I HVKSHL
Sbjct  56   GSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIGHVKSHL  115

Query  183  QMYRSKKVDDHGQ-----VINERAGY  245
            QMYRSKK+DD  Q         RAGY
Sbjct  116  QMYRSKKIDDTNQGDQRFSFEHRAGY  141



>ref|XP_009622809.1| PREDICTED: uncharacterized protein LOC104114139 [Nicotiana tomentosiformis]
 ref|XP_009622810.1| PREDICTED: uncharacterized protein LOC104114139 [Nicotiana tomentosiformis]
 ref|XP_009622811.1| PREDICTED: uncharacterized protein LOC104114139 [Nicotiana tomentosiformis]
Length=295

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 83/117 (71%), Gaps = 3/117 (3%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+ RLRWT DLH  FV AV+RLGGQERATPKLVL+LM++KGLNIAHVKSHLQM
Sbjct  50   VRPYVRSKMVRLRWTTDLHRRFVHAVERLGGQERATPKLVLRLMDIKGLNIAHVKSHLQM  109

Query  189  YRSKKVDDHGQ-VINERAGYHTGntnnllqnlw--qlPMFDRRIRSNFRYMNNSWSC  350
            YRSKK+DD  Q V N    +  G   N+        LP F++R  S FRY + S +C
Sbjct  110  YRSKKIDDPTQGVANHHRLFMEGGDPNIYNLNELPMLPTFNQRFNSTFRYGDASRNC  166



>ref|XP_011039440.1| PREDICTED: uncharacterized protein LOC105136003 [Populus euphratica]
Length=405

 Score =   130 bits (328),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQYVRSKVPRLRWTPDLHL FV AV+RLGGQE+ATPKLV QLMNV+ L+IAHVKSHLQ 
Sbjct  80   VRQYVRSKVPRLRWTPDLHLSFVHAVERLGGQEKATPKLVFQLMNVRELSIAHVKSHLQR  139

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQV+
Sbjct  140  YRSKKLDEAGQVL  152



>ref|XP_007140226.1| hypothetical protein PHAVU_008G094800g [Phaseolus vulgaris]
 gb|ESW12220.1| hypothetical protein PHAVU_008G094800g [Phaseolus vulgaris]
Length=364

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VR YVRSK+PRLRWTPDLHL FV AVQRLGGQERATPKLVLQLMN+KGL+IAHVKSHL
Sbjct  57   ATVRPYVRSKLPRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHL  116

Query  183  QMYRSKKVDDHGQVINERAGYHTG  254
            QMYRSKKV+ +  + + R    TG
Sbjct  117  QMYRSKKVEANQVLGDPRLLVETG  140



>ref|XP_011025033.1| PREDICTED: putative Myb family transcription factor At1g14600 
[Populus euphratica]
Length=296

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSKVPRLRWTP+LH CFV A++RLGGQ++ATPKLVLQLM+VKGL I+HVKSHL
Sbjct  8    GAVRQYVRSKVPRLRWTPELHRCFVHAIERLGGQDKATPKLVLQLMDVKGLTISHVKSHL  67

Query  183  QMYRSKKVDDHGQ  221
            QMYRS + D  GQ
Sbjct  68   QMYRSMRSDLRGQ  80



>ref|XP_010680052.1| PREDICTED: uncharacterized protein LOC104895284 [Beta vulgaris 
subsp. vulgaris]
Length=412

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVRQYVRSKVPRLRWTPDLH CFV A++RLGGQE+ATPKLVLQLM+V+GL I+HVKSHLQ
Sbjct  13   GVRQYVRSKVPRLRWTPDLHRCFVHAIERLGGQEKATPKLVLQLMDVRGLTISHVKSHLQ  72

Query  186  MYRSKKVD  209
            MYRS K+D
Sbjct  73   MYRSMKID  80



>ref|XP_009410557.1| PREDICTED: uncharacterized protein LOC103992543 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VRQYVRSK PRLRWTPDLHLCFV AV+RLGG++RATPKLVLQLMNVKGL+IAHVKSHLQ
Sbjct  47   AVRQYVRSKNPRLRWTPDLHLCFVHAVERLGGKDRATPKLVLQLMNVKGLSIAHVKSHLQ  106

Query  186  MYRSKKVD  209
            MYRSK  D
Sbjct  107  MYRSKNED  114



>ref|XP_002985847.1| hypothetical protein SELMODRAFT_424890 [Selaginella moellendorffii]
 gb|EFJ13024.1| hypothetical protein SELMODRAFT_424890 [Selaginella moellendorffii]
Length=336

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VRQY+RSK+PRLRWTPDLH CFV+AV RLGGQ+RATPKLVLQLM VKGL IAHVKSHL
Sbjct  66   SSVRQYIRSKMPRLRWTPDLHECFVRAVDRLGGQDRATPKLVLQLMGVKGLTIAHVKSHL  125

Query  183  QMYRSKKVDDHGQVI-NERAG  242
            QMYRS K D++G V+  ER G
Sbjct  126  QMYRSMKNDENGPVVMEERKG  146



>ref|XP_002984784.1| hypothetical protein SELMODRAFT_423935 [Selaginella moellendorffii]
 gb|EFJ14034.1| hypothetical protein SELMODRAFT_423935 [Selaginella moellendorffii]
Length=340

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
              VRQY+RSK+PRLRWTPDLH CFV+AV RLGGQ+RATPKLVLQLM VKGL IAHVKSHL
Sbjct  66   SSVRQYIRSKMPRLRWTPDLHECFVRAVDRLGGQDRATPKLVLQLMGVKGLTIAHVKSHL  125

Query  183  QMYRSKKVDDHGQVI-NERAG  242
            QMYRS K D++G V+  ER G
Sbjct  126  QMYRSMKNDENGPVVMEERKG  146



>ref|XP_006648492.1| PREDICTED: centrosomal and chromosomal factor-like [Oryza brachyantha]
Length=564

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK+PRLRWTPDLH+ FV AV+RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  119  VRQYNRSKMPRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  178

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D  G+ I
Sbjct  179  YRSKKLDHEGRQI  191



>gb|KFK36916.1| hypothetical protein AALP_AA4G189400 [Arabis alpina]
Length=403

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LHLCF+QAV+RLGG +RATPKLVLQ+MNVKGL+IAHVKSHL
Sbjct  73   GSVRPYNRSKTPRLRWTPELHLCFLQAVERLGGPDRATPKLVLQMMNVKGLSIAHVKSHL  132

Query  183  QMYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPMFDRRIRSNFRYMNNSWS  347
            QM+RSKK DD  Q     +  H       L  L  L  FD+R  ++  Y   SW+
Sbjct  133  QMFRSKKTDDPSQGDQGFSFEHGTGYTYNLSQLPMLQSFDQRPSTSLGYGGGSWT  187



>ref|XP_010918327.1| PREDICTED: transcription repressor KAN1-like isoform X1 [Elaeis 
guineensis]
Length=310

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQY+RSKVPRLRWTPDLH CFV A+++LGGQE+ATPKLVLQLMNV+GL I+HVKSHL
Sbjct  8    GGVRQYIRSKVPRLRWTPDLHHCFVHAIEKLGGQEKATPKLVLQLMNVRGLTISHVKSHL  67

Query  183  QMYRSKKVDDHGQVINERAGYHT  251
            QMYRS + D   Q    +A  H+
Sbjct  68   QMYRSMRNDMGRQASESQARKHS  90



>emb|CDX93206.1| BnaC04g46900D [Brassica napus]
Length=418

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LHLCF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  77   GSVRPYNRSKTPRLRWTPELHLCFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  136

Query  183  QMYRSKKVDD  212
            QMYRSKK DD
Sbjct  137  QMYRSKKTDD  146



>ref|XP_010676795.1| PREDICTED: uncharacterized protein LOC104892532 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=361

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
             VR Y+RSK PRLRWTPDLHL F+ AV+RLGGQ++ATPKLVLQLMN+KGL+IAHVKSHLQ
Sbjct  67   AVRPYIRSKTPRLRWTPDLHLRFIHAVERLGGQDKATPKLVLQLMNIKGLSIAHVKSHLQ  126

Query  186  MYRSKKVDDHGQVINERAGYHTGntnnllqnlwqlPM---FDRRIRSNFRYMNNSWSCSN  356
            MYRSKK +D  Q       +     +  + NL QLP+   + +   SN+R ++  W+ +N
Sbjct  127  MYRSKKAEDQSQAATCDQKHIFEVRDCNIFNLSQLPLLQGYCQAPSSNYRSIDPMWTTTN  186

Query  357  ANW  365
             +W
Sbjct  187  PSW  189



>ref|XP_009613587.1| PREDICTED: uncharacterized protein LOC104106691 [Nicotiana tomentosiformis]
Length=400

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK+PRLRWTP+LH  FV A++ LGGQERATPKLVLQLMNV+GL+IAHVKSHLQM
Sbjct  93   VRHYVRSKMPRLRWTPELHRSFVHAIETLGGQERATPKLVLQLMNVRGLSIAHVKSHLQM  152

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQV+
Sbjct  153  YRSKKLDESGQVL  165



>ref|XP_010508888.1| PREDICTED: putative two-component response regulator-like APRR6 
[Camelina sativa]
Length=412

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LH+CF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  75   GSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  134

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK DD  Q
Sbjct  135  QMYRSKKTDDPNQ  147



>ref|NP_001065933.1| Os12g0105600 [Oryza sativa Japonica Group]
 gb|ABA95608.1| myb-like DNA-binding domain, SHAQKYF class family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28952.1| Os12g0105600 [Oryza sativa Japonica Group]
 gb|EAZ19374.1| hypothetical protein OsJ_34927 [Oryza sativa Japonica Group]
Length=314

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR Y+RSK PRLRWTP+LHL FV+AV RLGGQ+RATPKLVLQLMNV+GL+I HVKSHLQM
Sbjct  48   VRPYIRSKNPRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQM  107

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQVI
Sbjct  108  YRSKKIDESGQVI  120



>gb|KEH20675.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=435

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 7/81 (9%)
 Frame = +3

Query  6    GVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQ  185
            GVRQYVRSK+PRLRWTPDLH  F+ AV+RLGGQERATPKLVLQLMNV+GL+IAHVKSHLQ
Sbjct  102  GVRQYVRSKMPRLRWTPDLHHSFMHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQ  161

Query  186  -------MYRSKKVDDHGQVI  227
                   MYRSKK+D+ GQV+
Sbjct  162  VHKTKFEMYRSKKLDEAGQVL  182



>emb|CDP05400.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQY+RSKVPRLRWTPDLH CFV A++RLGGQE+ATPKLVLQ+M+V+GL I+HVKSHL
Sbjct  8    GGVRQYIRSKVPRLRWTPDLHHCFVHAIERLGGQEKATPKLVLQMMDVRGLTISHVKSHL  67

Query  183  QMYRSKKVD  209
            QMYRS K D
Sbjct  68   QMYRSMKND  76



>ref|XP_002881704.1| hypothetical protein ARALYDRAFT_321718 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57963.1| hypothetical protein ARALYDRAFT_321718 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LH+CF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  73   GSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  132

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK DD  Q
Sbjct  133  QMYRSKKTDDPNQ  145



>ref|XP_010517442.1| PREDICTED: uncharacterized protein LOC104792882 [Camelina sativa]
Length=411

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LH+CF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  75   GSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  134

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK DD  Q
Sbjct  135  QMYRSKKTDDPNQ  147



>ref|XP_010234086.1| PREDICTED: uncharacterized protein LOC104583488 [Brachypodium 
distachyon]
Length=492

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK+PRLRWTPDLH+ F+ AV+RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  98   VRQYNRSKLPRLRWTPDLHMAFIHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  157

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D  G+ I
Sbjct  158  YRSKKLDHDGRQI  170



>gb|AAD25941.1|AF085279_14 hypothetical cytoskeletal protein [Arabidopsis thaliana]
Length=401

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 68/86 (79%), Gaps = 5/86 (6%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LH+CF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  72   GSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  131

Query  183  QMYRSKKVD-----DHGQVINERAGY  245
            QMYRSKK D     D G      AGY
Sbjct  132  QMYRSKKTDEPNEGDQGFSFEHGAGY  157



>gb|EAY81968.1| hypothetical protein OsI_37145 [Oryza sativa Indica Group]
Length=313

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR Y+RSK PRLRWTP+LHL FV+AV RLGGQ+RATPKLVLQLMNV+GL+I HVKSHLQM
Sbjct  48   VRPYIRSKNPRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQM  107

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D+ GQVI
Sbjct  108  YRSKKIDESGQVI  120



>ref|XP_009409397.1| PREDICTED: uncharacterized protein LOC103991616 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=514

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK PRLRWTPDLHL FV AV+RLGGQ+RATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  106  VRQYNRSKTPRLRWTPDLHLSFVHAVERLGGQDRATPKLVLQMMNVRGLSIAHVKSHLQM  165

Query  189  YRSKKVDDHGQ  221
            YRSKK+DD G+
Sbjct  166  YRSKKLDDSGK  176



>ref|XP_009409396.1| PREDICTED: uncharacterized protein LOC103991616 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=516

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK PRLRWTPDLHL FV AV+RLGGQ+RATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  106  VRQYNRSKTPRLRWTPDLHLSFVHAVERLGGQDRATPKLVLQMMNVRGLSIAHVKSHLQM  165

Query  189  YRSKKVDDHGQ  221
            YRSKK+DD G+
Sbjct  166  YRSKKLDDSGK  176



>ref|XP_010918329.1| PREDICTED: transcription repressor KAN1-like isoform X2 [Elaeis 
guineensis]
Length=308

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            GGVRQY+RSKVPRLRWTPDLH CFV A+++LGGQE+ATPKLVLQLMNV+GL I+HVKSHL
Sbjct  8    GGVRQYIRSKVPRLRWTPDLHHCFVHAIEKLGGQEKATPKLVLQLMNVRGLTISHVKSHL  67

Query  183  QMYRSKKVD  209
            QMYRS + D
Sbjct  68   QMYRSMRND  76



>ref|XP_003577903.2| PREDICTED: two-component response regulator ARR14-like [Brachypodium 
distachyon]
Length=371

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VR YVRSK PRLRWTP+LH CF++AV+RLGGQ+ ATPKLVLQLMNV+GL+I HVKSHLQM
Sbjct  68   VRPYVRSKNPRLRWTPELHHCFLRAVERLGGQDHATPKLVLQLMNVRGLSIGHVKSHLQM  127

Query  189  YRSKKVDDHGQVI  227
            YRSKK++D GQVI
Sbjct  128  YRSKKIEDSGQVI  140



>ref|XP_010505750.1| PREDICTED: putative two-component response regulator-like APRR6 
[Camelina sativa]
Length=405

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LH+CF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  75   GSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  134

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK DD  Q
Sbjct  135  QMYRSKKTDDPNQ  147



>ref|XP_006378423.1| hypothetical protein POPTR_0010s10990g [Populus trichocarpa]
 gb|ERP56220.1| hypothetical protein POPTR_0010s10990g [Populus trichocarpa]
Length=185

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQYVRSKVPRLRWTP+LH CFV A++RLGGQ++ATPKLVLQ+M+VKGL I+HVKSHL
Sbjct  8    GAVRQYVRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKLVLQMMDVKGLTISHVKSHL  67

Query  183  QMYRSKKVDDHGQV  224
            QMYRS +  D G++
Sbjct  68   QMYRSMRSGDLGRL  81



>gb|EAY85155.1| hypothetical protein OsI_06510 [Oryza sativa Indica Group]
Length=545

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK+PRLRWTPDLH+ FV AV+RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  109  VRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  168

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D  G+ I
Sbjct  169  YRSKKLDHEGRQI  181



>ref|XP_009409395.1| PREDICTED: uncharacterized protein LOC103991616 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=518

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK PRLRWTPDLHL FV AV+RLGGQ+RATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  106  VRQYNRSKTPRLRWTPDLHLSFVHAVERLGGQDRATPKLVLQMMNVRGLSIAHVKSHLQM  165

Query  189  YRSKKVDDHGQ  221
            YRSKK+DD G+
Sbjct  166  YRSKKLDDSGK  176



>ref|NP_181555.1| myb family transcription factor [Arabidopsis thaliana]
 gb|AAD25661.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09803.1| myb family transcription factor [Arabidopsis thaliana]
Length=410

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 68/86 (79%), Gaps = 5/86 (6%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LH+CF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  72   GSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  131

Query  183  QMYRSKKVD-----DHGQVINERAGY  245
            QMYRSKK D     D G      AGY
Sbjct  132  QMYRSKKTDEPNEGDQGFSFEHGAGY  157



>dbj|BAD28879.1| myb family transcription factor-like [Oryza sativa Japonica Group]
 gb|EAZ22376.1| hypothetical protein OsJ_06034 [Oryza sativa Japonica Group]
Length=545

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK+PRLRWTPDLH+ FV AV+RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  109  VRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  168

Query  189  YRSKKVDDHGQVI  227
            YRSKK+D  G+ I
Sbjct  169  YRSKKLDHEGRQI  181



>ref|XP_004951340.1| PREDICTED: uncharacterized protein LOC101755438 [Setaria italica]
Length=513

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    VRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHLQM  188
            VRQY RSK+PRLRWTPDLH+ FV AV+RLGGQERATPKLVLQ+MNV+GL+IAHVKSHLQM
Sbjct  116  VRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQM  175

Query  189  YRSKKVDDHGQ  221
            YRSKK+D  G+
Sbjct  176  YRSKKLDQDGR  186



>ref|XP_006294294.1| hypothetical protein CARUB_v10023302mg [Capsella rubella]
 gb|EOA27192.1| hypothetical protein CARUB_v10023302mg [Capsella rubella]
Length=415

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VR Y RSK PRLRWTP+LH+CF+QAV+RLGG +RATPKLVLQLMNVKGL+IAHVKSHL
Sbjct  75   GSVRPYNRSKTPRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHL  134

Query  183  QMYRSKKVDDHGQ  221
            QMYRSKK DD  Q
Sbjct  135  QMYRSKKTDDPNQ  147



>ref|XP_006855946.1| hypothetical protein AMTR_s00037p00221530 [Amborella trichopoda]
 gb|ERN17413.1| hypothetical protein AMTR_s00037p00221530 [Amborella trichopoda]
Length=120

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  3    GGVRQYVRSKVPRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLNIAHVKSHL  182
            G VRQY+RSK+PRLRWT +LH  FV AV+RLGGQ +ATPKLVLQ+M+VKGL IAHVKSHL
Sbjct  41   GSVRQYIRSKMPRLRWTAELHHSFVNAVERLGGQSKATPKLVLQIMDVKGLTIAHVKSHL  100

Query  183  QMYRSKKVDDHGQV  224
            QMYRS K DD+G +
Sbjct  101  QMYRSMKNDDNGNL  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2376282946848