BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7930_g1_i1 len=1320 path=[1:0-609 611:610-1319]

Length=1320
                                                                      Score     E

emb|CDP02931.1|  unnamed protein product                                436   3e-147   
ref|XP_010557579.1|  PREDICTED: GDSL esterase/lipase At5g03980          392   8e-130   
ref|XP_010251328.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     379   6e-125   
ref|XP_010241274.1|  PREDICTED: acetylajmalan esterase-like             370   1e-121   
ref|XP_011073870.1|  PREDICTED: acetylajmalan esterase-like             365   6e-120   
emb|CDO98569.1|  unnamed protein product                                360   1e-117   
ref|XP_010066434.1|  PREDICTED: acetylajmalan esterase                  356   1e-115   
ref|XP_010241275.1|  PREDICTED: acetylajmalan esterase-like             355   3e-115   
ref|XP_002279349.1|  PREDICTED: acetylajmalan esterase                  353   1e-114   Vitis vinifera
gb|KCW64327.1|  hypothetical protein EUGRSUZ_G01959                     352   2e-114   
sp|Q3MKY2.1|AAE_RAUSE  RecName: Full=Acetylajmalan esterase; Flag...    351   1e-113   Rauvolfia serpentina [devilpepper]
ref|XP_010918534.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    347   4e-112   
ref|XP_006344835.1|  PREDICTED: acetylajmalan esterase-like             346   7e-112   
ref|XP_008806794.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     346   7e-112   
ref|XP_010918533.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    347   3e-111   
ref|XP_010918532.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    347   5e-111   
ref|XP_010251983.1|  PREDICTED: acetylajmalan esterase-like             340   6e-110   
ref|XP_010929733.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     339   3e-109   
ref|XP_006344612.1|  PREDICTED: acetylajmalan esterase-like             339   3e-109   
ref|NP_001176564.1|  Os11g0521000                                       338   7e-109   
ref|XP_009786912.1|  PREDICTED: acetylajmalan esterase-like             337   2e-108   
ref|XP_009627361.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    333   5e-107   
ref|XP_006663479.1|  PREDICTED: acetylajmalan esterase-like             333   1e-106   
ref|XP_009613369.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    329   2e-105   
ref|XP_006357059.1|  PREDICTED: acetylajmalan esterase-like             328   7e-105   
ref|XP_010692476.1|  PREDICTED: acetylajmalan esterase-like             327   1e-104   
ref|XP_009773453.1|  PREDICTED: acetylajmalan esterase-like             327   2e-104   
ref|XP_009602651.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    327   2e-104   
ref|XP_008454485.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     327   3e-104   
ref|XP_009782266.1|  PREDICTED: acetylajmalan esterase-like             326   4e-104   
gb|EAZ18532.1|  hypothetical protein OsJ_34061                          325   4e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008791125.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     326   5e-104   
ref|XP_006382466.1|  hypothetical protein POPTR_0005s02420g             325   1e-103   
gb|EAY81107.1|  hypothetical protein OsI_36286                          324   2e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_009383158.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     324   2e-103   
ref|XP_009767428.1|  PREDICTED: acetylajmalan esterase-like isofo...    324   2e-103   
ref|XP_010692472.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     324   2e-103   
ref|XP_010690534.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     324   2e-103   
ref|XP_011036970.1|  PREDICTED: acetylajmalan esterase-like             322   2e-102   
ref|XP_004156989.1|  PREDICTED: LOW QUALITY PROTEIN: acetylajmala...    321   3e-102   
ref|XP_009776096.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     321   4e-102   
ref|XP_004152298.1|  PREDICTED: acetylajmalan esterase-like             321   4e-102   
gb|EYU34257.1|  hypothetical protein MIMGU_mgv1a008288mg                320   1e-101   
ref|XP_003577537.1|  PREDICTED: acetylajmalan esterase                  320   1e-101   
ref|XP_008465497.1|  PREDICTED: acetylajmalan esterase-like             319   1e-101   
ref|XP_009587413.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    320   1e-101   
gb|KDO83163.1|  hypothetical protein CISIN_1g037165mg                   320   2e-101   
ref|XP_007018722.1|  SGNH hydrolase-type esterase superfamily pro...    319   2e-101   
ref|XP_009757390.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     319   2e-101   
ref|XP_004979339.1|  PREDICTED: acetylajmalan esterase-like             319   3e-101   
ref|XP_004230198.1|  PREDICTED: GDSL esterase/lipase At5g03980          318   4e-101   
ref|XP_009608978.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     317   7e-101   
ref|XP_004171165.1|  PREDICTED: acetylajmalan esterase-like             317   9e-101   
emb|CDM82009.1|  unnamed protein product                                317   1e-100   
ref|XP_009765904.1|  PREDICTED: acetylajmalan esterase-like isofo...    317   2e-100   
ref|XP_004159174.1|  PREDICTED: acetylajmalan esterase-like             317   2e-100   
gb|KHG07034.1|  Acetylajmalan esterase                                  316   2e-100   
ref|XP_009629651.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    315   2e-100   
ref|XP_011073879.1|  PREDICTED: acetylajmalan esterase-like             313   3e-100   
ref|XP_011071662.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     316   3e-100   
ref|XP_004158757.1|  PREDICTED: acetylajmalan esterase-like             316   3e-100   
ref|XP_004230194.1|  PREDICTED: acetylajmalan esterase-like isofo...    316   4e-100   
ref|XP_009797172.1|  PREDICTED: acetylajmalan esterase-like             315   5e-100   
ref|XP_006367845.1|  PREDICTED: acetylajmalan esterase-like             315   7e-100   
ref|XP_011097738.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     315   7e-100   
ref|XP_004144819.1|  PREDICTED: acetylajmalan esterase-like             314   8e-100   
ref|XP_011097730.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     315   8e-100   
ref|NP_001152155.1|  esterase precursor                                 315   9e-100   Zea mays [maize]
ref|XP_009765907.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     313   5e-99    
ref|XP_006367844.1|  PREDICTED: acetylajmalan esterase-like             312   1e-98    
ref|XP_010681318.1|  PREDICTED: acetylajmalan esterase-like             312   1e-98    
ref|XP_011096137.1|  PREDICTED: acetylajmalan esterase-like             311   2e-98    
ref|XP_006344611.1|  PREDICTED: acetylajmalan esterase-like             311   2e-98    
ref|XP_003560500.1|  PREDICTED: acetylajmalan esterase-like             311   4e-98    
ref|XP_010025245.1|  PREDICTED: acetylajmalan esterase-like isofo...    310   8e-98    
ref|XP_009615529.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     309   1e-97    
ref|XP_002450809.1|  hypothetical protein SORBIDRAFT_05g018910          308   3e-97    Sorghum bicolor [broomcorn]
ref|XP_006361896.1|  PREDICTED: acetylajmalan esterase-like             308   5e-97    
ref|XP_011087062.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     308   5e-97    
ref|XP_007030130.1|  SGNH hydrolase-type esterase superfamily pro...    308   5e-97    
ref|XP_007021821.1|  SGNH hydrolase-type esterase superfamily pro...    307   6e-97    
emb|CBV37053.1|  GDSL lipase-like chlorogenate-dependent caffeoyl...    307   8e-97    
ref|XP_004251965.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     306   1e-96    
emb|CDP17196.1|  unnamed protein product                                309   1e-96    
ref|XP_006483686.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     303   2e-96    
ref|XP_004230193.1|  PREDICTED: acetylajmalan esterase                  306   3e-96    
ref|XP_010672326.1|  PREDICTED: acetylajmalan esterase-like             306   3e-96    
ref|XP_010672325.1|  PREDICTED: acetylajmalan esterase-like             305   5e-96    
ref|XP_006433429.1|  hypothetical protein CICLE_v10003375mg             305   5e-96    
ref|XP_010672328.1|  PREDICTED: acetylajmalan esterase-like             305   9e-96    
gb|ABD98038.1|  acetylajmalan acetylesterase                            305   9e-96    Striga asiatica [witchweed]
ref|XP_010672330.1|  PREDICTED: acetylajmalan esterase-like             304   1e-95    
emb|CDP15821.1|  unnamed protein product                                303   4e-95    
ref|XP_010692365.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     303   7e-95    
ref|XP_010683532.1|  PREDICTED: acetylajmalan esterase-like             302   8e-95    
emb|CDP16034.1|  unnamed protein product                                300   1e-94    
emb|CDP09073.1|  unnamed protein product                                301   2e-94    
ref|XP_004230192.1|  PREDICTED: acetylajmalan esterase isoform X1       301   3e-94    
emb|CDO98571.1|  unnamed protein product                                300   3e-94    
gb|EYU27495.1|  hypothetical protein MIMGU_mgv1a020136mg                300   7e-94    
ref|XP_006382478.1|  hypothetical protein POPTR_0005s02510g             298   3e-93    
ref|XP_004151789.1|  PREDICTED: acetylajmalan esterase-like             297   3e-93    
ref|XP_004230196.1|  PREDICTED: GDSL esterase/lipase At5g03980 is...    298   3e-93    
ref|XP_006382477.1|  hypothetical protein POPTR_0005s02500g             298   4e-93    
gb|EMT13183.1|  hypothetical protein F775_52505                         296   1e-92    
ref|XP_006367846.1|  PREDICTED: acetylajmalan esterase-like             296   1e-92    
dbj|BAK05927.1|  predicted protein                                      296   2e-92    
ref|XP_006472123.1|  PREDICTED: acetylajmalan esterase-like             296   2e-92    
ref|XP_002528395.1|  Alpha-L-fucosidase 2 precursor, putative           295   3e-92    Ricinus communis
ref|XP_011095809.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     295   4e-92    
ref|XP_010684946.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     293   1e-91    
ref|XP_011087121.1|  PREDICTED: acetylajmalan esterase-like             291   2e-91    
ref|XP_010695793.1|  PREDICTED: acetylajmalan esterase-like             293   2e-91    
ref|XP_010673153.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     293   3e-91    
gb|ADQ08655.1|  GDSL-lipase                                             293   3e-91    
ref|XP_010696564.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     293   5e-91    
ref|XP_007029519.1|  SGNH hydrolase-type esterase superfamily pro...    292   8e-91    
ref|XP_010673156.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     291   8e-91    
ref|XP_010673174.1|  PREDICTED: acetylajmalan esterase-like             291   8e-91    
gb|ADQ08656.1|  GDSL-lipase                                             291   1e-90    
ref|XP_006286793.1|  hypothetical protein CARUB_v10003448mg             287   5e-90    
ref|XP_011095811.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     287   2e-89    
ref|XP_003572697.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     289   2e-89    
ref|XP_010312718.1|  PREDICTED: acetylajmalan esterase isoform X2       288   2e-89    
dbj|BAK06896.1|  predicted protein                                      289   2e-89    
ref|XP_006382474.1|  hypothetical protein POPTR_0005s02480g             286   6e-89    
ref|XP_006656415.1|  PREDICTED: acetylajmalan esterase-like             288   6e-89    
gb|EMT24134.1|  GDSL esterase/lipase                                    287   8e-89    
ref|XP_006342691.1|  PREDICTED: acetylajmalan esterase-like             286   1e-88    
ref|XP_006844513.1|  hypothetical protein AMTR_s00016p00145970          286   2e-88    
ref|XP_004966154.1|  PREDICTED: acetylajmalan esterase-like             285   5e-88    
ref|XP_010314861.1|  PREDICTED: acetylajmalan esterase-like             284   7e-88    
ref|XP_003565496.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     284   9e-88    
ref|XP_004230195.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    283   1e-87    
ref|XP_006398909.1|  hypothetical protein EUTSA_v10015988mg             281   1e-87    
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...    284   1e-87    
emb|CDP13680.1|  unnamed protein product                                283   2e-87    
ref|NP_001058440.1|  Os06g0694200                                       281   7e-87    Oryza sativa Japonica Group [Japonica rice]
gb|AFW69252.1|  alpha-L-fucosidase 2                                    283   7e-87    
ref|NP_001151231.1|  alpha-L-fucosidase 2 precursor                     281   2e-86    Zea mays [maize]
emb|CDO96771.1|  unnamed protein product                                280   2e-86    
gb|EAZ02202.1|  hypothetical protein OsI_24297                          280   2e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_004955060.1|  PREDICTED: acetylajmalan esterase-like             281   4e-86    
ref|XP_010682072.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     280   4e-86    
emb|CDO96766.1|  unnamed protein product                                279   8e-86    
ref|XP_004955061.1|  PREDICTED: acetylajmalan esterase-like             279   2e-85    
dbj|BAJ90990.1|  predicted protein                                      278   2e-85    
gb|EAZ38126.1|  hypothetical protein OsJ_22475                          278   2e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666442.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     279   2e-85    
ref|XP_009767429.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    276   7e-85    
gb|EAY86633.1|  hypothetical protein OsI_08013                          275   5e-84    Oryza sativa Indica Group [Indian rice]
ref|NP_001173068.1|  Os02g0608801                                       275   5e-84    
ref|XP_002452415.1|  hypothetical protein SORBIDRAFT_04g025350          275   7e-84    Sorghum bicolor [broomcorn]
ref|XP_010674065.1|  PREDICTED: acetylajmalan esterase-like isofo...    274   9e-84    
ref|XP_009765905.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    273   1e-83    
ref|XP_003572686.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     275   1e-83    
ref|NP_001172233.1|  Os01g0216900                                       273   1e-83    
ref|XP_010674066.1|  PREDICTED: acetylajmalan esterase-like isofo...    273   1e-83    
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280          273   1e-83    
dbj|BAJ86481.1|  predicted protein                                      273   1e-83    
ref|XP_009587414.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    272   2e-83    
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     273   2e-83    
ref|XP_006828273.1|  hypothetical protein AMTR_s00023p00217880          272   3e-83    
ref|XP_006844517.1|  hypothetical protein AMTR_s00016p00148320          272   3e-83    
ref|XP_002512444.1|  Alpha-L-fucosidase 2 precursor, putative           271   5e-83    Ricinus communis
ref|XP_002457134.1|  hypothetical protein SORBIDRAFT_03g001820          271   5e-83    Sorghum bicolor [broomcorn]
ref|XP_004955062.1|  PREDICTED: acetylajmalan esterase-like             273   6e-83    
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     271   8e-83    
ref|XP_009122651.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    269   1e-82    
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    270   2e-82    
gb|EAZ11035.1|  hypothetical protein OsJ_00879                          270   2e-82    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042399.1|  Os01g0216400                                       270   2e-82    Oryza sativa Japonica Group [Japonica rice]
gb|EEE54111.1|  hypothetical protein OsJ_00875                          270   3e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     269   4e-82    
ref|XP_010683534.1|  PREDICTED: acetylajmalan esterase-like             269   4e-82    
ref|XP_009589774.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    269   6e-82    
ref|XP_004968628.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     268   8e-82    
emb|CDX70269.1|  BnaA10g26180D                                          267   8e-82    
dbj|BAA94228.1|  putative esterase                                      268   9e-82    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042396.1|  Os01g0215700                                       268   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001149156.1|  esterase precursor                                 268   2e-81    Zea mays [maize]
ref|NP_174181.1|  GDSL esterase/lipase                                  268   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     269   2e-81    
ref|XP_002873127.1|  GDSL-motif lipase/hydrolase family protein         265   3e-81    
ref|XP_009767427.1|  PREDICTED: acetylajmalan esterase-like             265   3e-81    
ref|XP_004952881.1|  PREDICTED: acetylajmalan esterase-like             268   4e-81    
ref|XP_004952880.1|  PREDICTED: acetylajmalan esterase-like             268   4e-81    
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     266   5e-81    
ref|XP_010683535.1|  PREDICTED: acetylajmalan esterase-like             266   5e-81    
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     266   7e-81    
gb|EMT16237.1|  GDSL esterase/lipase                                    266   8e-81    
emb|CDY41414.1|  BnaCnng10500D                                          264   9e-81    
ref|XP_006398857.1|  hypothetical protein EUTSA_v10015547mg             264   9e-81    
gb|EPS66618.1|  hypothetical protein M569_08158                         265   1e-80    
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     266   1e-80    
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    266   1e-80    
gb|AFW80395.1|  esterase                                                265   2e-80    
ref|XP_004152872.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     264   3e-80    
ref|NP_196018.1|  GDSL esterase/lipase                                  262   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     264   5e-80    
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850          264   6e-80    Sorghum bicolor [broomcorn]
ref|XP_002457133.1|  hypothetical protein SORBIDRAFT_03g001810          263   1e-79    Sorghum bicolor [broomcorn]
ref|XP_009626701.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    261   2e-79    
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     263   2e-79    
emb|CDO96755.1|  unnamed protein product                                261   3e-79    
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     261   4e-79    
ref|XP_009626702.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    260   5e-79    
gb|KHN08454.1|  GDSL esterase/lipase                                    270   9e-79    
gb|ABK24921.1|  unknown                                                 261   1e-78    Picea sitchensis
emb|CDX90163.1|  BnaA08g18210D                                          260   1e-78    
ref|XP_002299039.1|  hypothetical protein POPTR_0001s46820g             259   2e-78    Populus trichocarpa [western balsam poplar]
dbj|BAK01569.1|  predicted protein                                      259   2e-78    
gb|AAF24548.2|AC007508_11  F1K23.17                                     271   2e-78    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001057786.1|  Os06g0531900                                       260   2e-78    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01210.1|  hypothetical protein OsI_23235                          259   2e-78    Oryza sativa Indica Group [Indian rice]
gb|EAZ37226.1|  hypothetical protein OsJ_21564                          259   2e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     259   2e-78    
dbj|BAD73016.1|  putative esterase                                      260   3e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg             260   3e-78    
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     259   3e-78    
gb|EYU34853.1|  hypothetical protein MIMGU_mgv1a021103mg                256   3e-78    
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    259   5e-78    
emb|CDX90162.1|  BnaA08g18220D                                          259   6e-78    
ref|XP_006656143.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     259   6e-78    
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    258   8e-78    
ref|XP_002893538.1|  predicted protein                                  269   8e-78    
gb|KDP21068.1|  hypothetical protein JCGZ_21539                         258   1e-77    
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078             258   1e-77    
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     258   1e-77    
ref|XP_004963464.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     258   1e-77    
ref|XP_010696562.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     256   1e-77    
emb|CDY43308.1|  BnaC03g58800D                                          258   2e-77    
ref|XP_010312731.1|  PREDICTED: acetylajmalan esterase-like isofo...    255   2e-77    
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     258   2e-77    
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     258   2e-77    
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg             257   3e-77    
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg             257   3e-77    
ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     257   3e-77    
ref|XP_004971765.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     256   3e-77    
emb|CDY43309.1|  BnaC03g58810D                                          257   3e-77    
emb|CDY15655.1|  BnaA07g08260D                                          257   3e-77    
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     257   3e-77    
ref|XP_009421257.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     256   3e-77    
emb|CDX94634.1|  BnaC07g10240D                                          257   4e-77    
gb|EMT33597.1|  GDSL esterase/lipase                                    256   4e-77    
gb|KDP44570.1|  hypothetical protein JCGZ_22152                         256   5e-77    
ref|NP_001242505.1|  uncharacterized protein LOC100815771 precursor     256   7e-77    
ref|NP_001042391.1|  Os01g0214800                                       255   7e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     255   7e-77    
emb|CDY30819.1|  BnaC05g21950D                                          256   8e-77    
ref|XP_010915608.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     255   8e-77    
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     256   8e-77    
ref|XP_002439451.1|  hypothetical protein SORBIDRAFT_09g006600          256   1e-76    Sorghum bicolor [broomcorn]
gb|EYU34358.1|  hypothetical protein MIMGU_mgv1a024690mg                252   1e-76    
emb|CDY64716.1|  BnaCnng44670D                                          255   1e-76    
ref|XP_010915609.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     254   1e-76    
emb|CDY63998.1|  BnaA07g36520D                                          255   2e-76    
ref|XP_002438501.1|  hypothetical protein SORBIDRAFT_10g020950          255   2e-76    Sorghum bicolor [broomcorn]
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     254   3e-76    
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     254   3e-76    
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like     254   3e-76    
ref|XP_010312722.1|  PREDICTED: GDSL esterase/lipase At5g03980 is...    253   3e-76    
gb|AAX62802.1|  lipase 2                                                254   4e-76    Brassica napus [oilseed rape]
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     254   4e-76    
ref|XP_009613370.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    250   5e-76    
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910          253   5e-76    
emb|CDP21061.1|  unnamed protein product                                254   5e-76    
sp|Q3ZFI4.1|SCE3_BRANA  RecName: Full=Sinapine esterase; Short=Bn...    253   9e-76    Brassica napus [oilseed rape]
gb|KHG30334.1|  hypothetical protein F383_10781                         253   9e-76    
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                   252   1e-75    
ref|NP_174185.2|  GDSL esterase/lipase                                  253   1e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     251   2e-75    
sp|P0C8Z7.1|GDL91_ARATH  RecName: Full=GDSL esterase/lipase At1g2...    252   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     252   2e-75    
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     252   2e-75    
ref|XP_004248142.1|  PREDICTED: GDSL esterase/lipase At1g28610          252   3e-75    
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925    262   4e-75    
ref|XP_004968624.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     251   4e-75    
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     252   4e-75    
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg             251   4e-75    
ref|XP_004960619.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     251   4e-75    
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg             261   4e-75    
dbj|BAJ97605.1|  predicted protein                                      250   4e-75    
ref|XP_004968627.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    252   5e-75    
gb|EYU27459.1|  hypothetical protein MIMGU_mgv1a008956mg                250   5e-75    
ref|XP_009601721.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     251   6e-75    
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    251   7e-75    
ref|XP_011039366.1|  PREDICTED: acetylajmalan esterase-like             250   8e-75    
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     250   8e-75    
emb|CDY30822.1|  BnaC05g21980D                                          251   8e-75    
dbj|BAJ99647.1|  predicted protein                                      250   9e-75    
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     251   1e-74    
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     251   1e-74    
gb|AFK42362.1|  unknown                                                 250   1e-74    
ref|NP_174180.1|  GDSL esterase/lipase                                  250   1e-74    
ref|XP_009765841.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     250   1e-74    
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    250   2e-74    
ref|XP_008783973.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     249   2e-74    
ref|XP_009409411.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     249   2e-74    
emb|CAG27610.1|  esterase                                               249   2e-74    
ref|NP_001241470.1|  uncharacterized protein LOC100816865               249   3e-74    
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     249   3e-74    
gb|ACF85857.1|  unknown                                                 249   3e-74    
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580          249   3e-74    
ref|XP_011023915.1|  PREDICTED: acetylajmalan esterase-like             249   3e-74    
ref|XP_003593736.1|  GDSL esterase/lipase                               249   3e-74    
ref|NP_001150078.1|  esterase                                           249   4e-74    
ref|NP_001031122.1|  GDSL esterase/lipase                               249   4e-74    
dbj|BAJ85333.1|  predicted protein                                      248   5e-74    
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     249   5e-74    
gb|EMT30557.1|  GDSL esterase/lipase                                    248   5e-74    
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     249   5e-74    
dbj|BAD95190.1|  hypothetical protein                                   248   6e-74    
ref|XP_008655208.1|  PREDICTED: uncharacterized protein LOC100382...    248   6e-74    
ref|XP_002457139.1|  hypothetical protein SORBIDRAFT_03g001870          248   6e-74    
ref|XP_003593737.1|  GDSL esterase/lipase                               248   7e-74    
ref|XP_010668064.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     245   7e-74    
ref|XP_006643906.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     248   9e-74    
ref|XP_007148063.1|  hypothetical protein PHAVU_006G177400g             247   9e-74    
ref|NP_174440.2|  GDSL esterase/lipase                                  248   1e-73    
ref|XP_011096421.1|  PREDICTED: GDSL esterase/lipase At5g45910          248   1e-73    
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600          248   1e-73    
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     248   1e-73    
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                     246   1e-73    
gb|EPS71267.1|  hypothetical protein M569_03493                         248   2e-73    
ref|XP_010540487.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     248   2e-73    
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   2e-73    
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   2e-73    
ref|XP_004968644.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   2e-73    
ref|XP_010499396.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     247   2e-73    
ref|XP_008783975.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   3e-73    
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   3e-73    
gb|KCW76148.1|  hypothetical protein EUGRSUZ_D00525                     246   3e-73    
gb|KCW44565.1|  hypothetical protein EUGRSUZ_L01922                     245   3e-73    
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     246   4e-73    
ref|XP_004968622.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   4e-73    
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670          246   5e-73    
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     245   5e-73    
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     245   5e-73    
gb|EEC80750.1|  hypothetical protein OsI_23233                          245   6e-73    
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   6e-73    
ref|XP_002439448.1|  hypothetical protein SORBIDRAFT_09g006570          245   6e-73    
ref|XP_010499707.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    246   8e-73    
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     246   8e-73    
gb|KCW61856.1|  hypothetical protein EUGRSUZ_H04541                     243   9e-73    
gb|EEE65121.1|  hypothetical protein OsJ_20187                          244   9e-73    
ref|XP_002267222.2|  PREDICTED: GDSL esterase/lipase At5g45910          244   9e-73    
ref|XP_009140758.1|  PREDICTED: GDSL esterase/lipase At5g45910          245   9e-73    
ref|XP_002319509.1|  hypothetical protein POPTR_0013s01670g             245   9e-73    
dbj|BAF02148.1|  putative lipase                                        244   1e-72    
ref|XP_004964800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     244   1e-72    
ref|XP_002454932.1|  hypothetical protein SORBIDRAFT_03g001650          244   1e-72    
ref|XP_004291631.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     245   1e-72    
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     246   1e-72    
gb|EMT23217.1|  GDSL esterase/lipase                                    244   1e-72    
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    244   2e-72    
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     244   2e-72    
ref|XP_007148064.1|  hypothetical protein PHAVU_006G177500g             244   2e-72    
ref|XP_007025434.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    244   2e-72    
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     244   2e-72    
ref|NP_174186.1|  GDSL esterase/lipase                                  244   2e-72    
ref|XP_002437861.1|  hypothetical protein SORBIDRAFT_10g003930          244   2e-72    
ref|NP_001132224.1|  alpha-L-fucosidase 2 precursor                     244   2e-72    
gb|EAY96951.1|  hypothetical protein OsI_18870                          243   2e-72    
gb|AAS91011.1|  putative lipase                                         243   2e-72    
gb|EMT16275.1|  GDSL esterase/lipase                                    243   3e-72    
ref|XP_010445802.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     244   3e-72    
ref|NP_001054914.2|  Os05g0210400                                       244   3e-72    
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    244   3e-72    
ref|NP_001054912.2|  Os05g0209600                                       243   3e-72    
ref|XP_002436507.1|  hypothetical protein SORBIDRAFT_10g003900          244   3e-72    
ref|NP_174179.3|  GDSL esterase/lipase                                  244   3e-72    
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550          244   3e-72    
ref|XP_009413940.1|  PREDICTED: uncharacterized protein LOC103995136    253   3e-72    
ref|XP_003568743.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     243   3e-72    
gb|EAZ23767.1|  hypothetical protein OsJ_07474                          244   3e-72    
ref|NP_174188.1|  lipase ARAB-1                                         244   3e-72    
gb|ABL11233.1|  UCW116, putative lipase                                 243   3e-72    
dbj|BAJ90380.1|  predicted protein                                      243   4e-72    
ref|XP_008673524.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     243   4e-72    
ref|NP_174182.1|  GDSL esterase/lipase                                  244   4e-72    
ref|XP_003564303.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     243   4e-72    
gb|EAZ11036.1|  hypothetical protein OsJ_00880                          244   5e-72    
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     244   5e-72    
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    244   5e-72    
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    243   5e-72    
ref|NP_001057785.1|  Os06g0531600                                       243   6e-72    
ref|XP_010925693.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    243   6e-72    
ref|XP_002461110.1|  hypothetical protein SORBIDRAFT_02g040940          243   7e-72    
gb|KDP23466.1|  hypothetical protein JCGZ_23299                         249   8e-72    
ref|XP_004148311.1|  PREDICTED: LOW QUALITY PROTEIN: acetylajmala...    242   8e-72    
ref|XP_004965532.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    242   1e-71    
emb|CDO96753.1|  unnamed protein product                                243   1e-71    
gb|ACG28261.1|  alpha-L-fucosidase 2 precursor                          242   1e-71    
gb|EPS65730.1|  hypothetical protein M569_09048                         240   1e-71    
ref|XP_007212957.1|  hypothetical protein PRUPE_ppa021000mg             241   1e-71    
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     242   1e-71    
ref|XP_010915607.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     242   1e-71    
gb|AAM65183.1|  lipase, putative                                        243   1e-71    
ref|XP_003565527.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     242   1e-71    
ref|XP_003593742.1|  GDSL esterase/lipase                               242   1e-71    
ref|XP_004971763.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     241   2e-71    
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein         242   2e-71    
ref|XP_003569350.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     242   2e-71    
ref|XP_008655207.1|  PREDICTED: uncharacterized protein LOC100382...    242   2e-71    
ref|XP_009414900.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     242   2e-71    
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     242   2e-71    
ref|XP_009421256.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     241   2e-71    
ref|XP_008655643.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     241   2e-71    
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                    241   3e-71    
gb|KFK31510.1|  hypothetical protein AALP_AA6G122100                    241   3e-71    
gb|EAZ12674.1|  hypothetical protein OsJ_02589                          242   3e-71    
ref|XP_002512239.1|  Zeta-carotene desaturase, chloroplast precur...    253   3e-71    
emb|CDY15657.1|  BnaA07g08280D                                          241   3e-71    
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     241   4e-71    
ref|XP_010315008.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    236   4e-71    
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     241   4e-71    
ref|XP_007148066.1|  hypothetical protein PHAVU_006G177700g             241   4e-71    
ref|NP_180304.1|  GDSL esterase/lipase                                  241   4e-71    
ref|NP_001242867.1|  uncharacterized protein LOC100794616 precursor     241   4e-71    
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                     239   4e-71    
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     240   4e-71    
ref|XP_009102894.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     241   4e-71    
ref|NP_973932.1|  GDSL esterase/lipase                                  241   5e-71    
ref|NP_199403.1|  GDSL esterase/lipase                                  240   5e-71    
dbj|BAD44668.1|  putative lipase                                        241   5e-71    
ref|XP_003565495.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     240   5e-71    
gb|EYU34258.1|  hypothetical protein MIMGU_mgv1a009776mg                239   5e-71    
dbj|BAD61220.1|  lanatoside 15'-O-acetylesterase-like                   240   6e-71    
ref|XP_004964803.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    239   7e-71    
ref|XP_008785278.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     240   7e-71    
ref|XP_008227195.1|  PREDICTED: acetylajmalan esterase-like             240   8e-71    
ref|XP_010915610.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    241   8e-71    
ref|XP_010495736.1|  PREDICTED: GDSL esterase/lipase At5g45910          240   9e-71    
gb|AAT11017.1|  lipase 1                                                240   9e-71    
ref|XP_011036871.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     237   1e-70    
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    240   1e-70    
ref|XP_009352808.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     239   1e-70    
emb|CDM82194.1|  unnamed protein product                                239   1e-70    
gb|EMT23758.1|  GDSL esterase/lipase                                    239   1e-70    
ref|XP_009380501.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     239   1e-70    
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like     239   1e-70    
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     240   1e-70    
ref|XP_009390675.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     240   1e-70    
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    239   2e-70    
ref|XP_006656659.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     241   2e-70    
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878    250   2e-70    
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase                 239   2e-70    
gb|EAY73024.1|  hypothetical protein OsI_00896                          239   2e-70    
ref|XP_003593740.1|  GDSL esterase/lipase                               239   2e-70    
ref|NP_001042397.1|  Os01g0216000                                       239   2e-70    
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     239   3e-70    
dbj|BAK02638.1|  predicted protein                                      238   3e-70    
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     238   3e-70    
ref|XP_008655774.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     238   3e-70    
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                     238   3e-70    
ref|XP_002879083.1|  predicted protein                                  239   3e-70    
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     238   3e-70    
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592    248   4e-70    
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     238   4e-70    
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    239   4e-70    
gb|AAM62801.1|  GDSL-motif lipase/hydrolase-like protein                238   4e-70    
ref|NP_001150126.1|  esterase precursor                                 238   5e-70    
ref|NP_001151338.1|  LOC100284971 precursor                             238   5e-70    
dbj|BAJ90120.1|  predicted protein                                      238   5e-70    
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     238   5e-70    
ref|XP_002454933.1|  hypothetical protein SORBIDRAFT_03g001670          238   5e-70    
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     238   5e-70    
dbj|BAK02457.1|  predicted protein                                      238   5e-70    
ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     238   6e-70    
ref|XP_002438500.1|  hypothetical protein SORBIDRAFT_10g020940          238   6e-70    
gb|AAF24544.2|AC007508_7  F1K23.13                                      252   6e-70    
ref|NP_001168581.1|  hypothetical protein precursor                     237   6e-70    
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479    248   7e-70    
gb|EEC70173.1|  hypothetical protein OsI_00899                          238   7e-70    
ref|XP_002863442.1|  GDSL-motif lipase/hydrolase family protein         237   7e-70    
ref|XP_010231603.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     238   7e-70    
ref|XP_006645634.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     237   7e-70    
ref|XP_002455947.1|  hypothetical protein SORBIDRAFT_03g027770          239   8e-70    
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924    247   8e-70    
ref|XP_010250902.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     238   8e-70    
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     238   9e-70    
dbj|BAK05007.1|  predicted protein                                      237   9e-70    
ref|NP_001042398.1|  Os01g0216300                                       237   9e-70    
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                     236   1e-69    
ref|XP_003563800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     237   1e-69    
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     236   1e-69    
ref|XP_004966744.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     237   1e-69    
gb|EYU33429.1|  hypothetical protein MIMGU_mgv1a022098mg                236   1e-69    
emb|CDX94632.1|  BnaC07g10260D                                          237   1e-69    
gb|AAG60153.1|AC074360_18  lipase, putative                             237   2e-69    
gb|KHN31271.1|  GDSL esterase/lipase                                    236   2e-69    
ref|XP_010057068.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     237   2e-69    
gb|EMT06231.1|  GDSL esterase/lipase                                    236   2e-69    
gb|AFW80390.1|  esterase                                                236   3e-69    
dbj|BAD73014.1|  putative esterase                                      237   3e-69    
ref|XP_010052211.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     235   3e-69    
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     235   3e-69    
ref|XP_002457135.1|  hypothetical protein SORBIDRAFT_03g001830          237   3e-69    
ref|XP_008812182.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     234   3e-69    



>emb|CDP02931.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   436 bits (1121),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 208/362 (57%), Positives = 266/362 (73%), Gaps = 3/362 (1%)
 Frame = +2

Query  134   LLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFP  313
             LL+ +  S     +++  VCPF S+YQFG S+ DTGN+IRV  +GPTLPAAR PYG T  
Sbjct  12    LLIGSYISVAATASRRNFVCPFDSLYQFGDSISDTGNVIRVPGVGPTLPAARFPYGQTI-  70

Query  314   GRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGV  493
             GRPTGRWSDGLLI+DF A  + LPLLNPYLD+NASF NGVNFAV  STALD  F   +G+
Sbjct  71    GRPTGRWSDGLLIIDFTAMDLHLPLLNPYLDRNASFNNGVNFAVAGSTALDFAFFTARGI  130

Query  494   VVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTI  673
              VP +T PL  Q+N  K YLSS IC +P++C  +L++SLF+VGEIG NDI +A  QG+++
Sbjct  131   AVPIVTSPLGVQVNSFKQYLSS-ICCSPTECSTKLRQSLFWVGEIGGNDINYAFTQGKSL  189

Query  674   QEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGC  853
             QE+  ++P IT ++IN  R++IQ+G +RIVVPG FPLGC P  L+       +++DE GC
Sbjct  190   QEIRTYIPSITQAIINNTRQIIQLGAKRIVVPGNFPLGCIPVALNFVSNASSQEFDEFGC  249

Query  854   LRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMT  1033
              RS N+L  ++N++LQ AL SLRKEFPDAVI+YAD+Y +F+S L RA  LGF    L   
Sbjct  250   SRSFNDLARYQNSYLQNALNSLRKEFPDAVIVYADFYGSFRSVLTRASFLGFDAGSLLKA  309

Query  1034  CCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQ  1213
             CCG  GG YNYD N+ CGS GV  CPNP ++IHWDG+HLTQ+A+  IS+ +IP+ILSRIQ
Sbjct  310   CCGI-GGPYNYDMNRACGSPGVPVCPNPRRFIHWDGLHLTQQAYRRISEFLIPDILSRIQ  368

Query  1214  CF  1219
             CF
Sbjct  369   CF  370



>ref|XP_010557579.1| PREDICTED: GDSL esterase/lipase At5g03980 [Tarenaya hassleriana]
Length=373

 Score =   392 bits (1006),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 195/365 (53%), Positives = 248/365 (68%), Gaps = 9/365 (2%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             +L FL   AA S       +  +CPFRSIYQFG S+ DTGNLI  G +G    AAR PYG
Sbjct  16    LLGFLCFSAAGS-----QPQSTICPFRSIYQFGDSIADTGNLILNGPVGARSHAARFPYG  70

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLA  481
              TF  RPTGR S+G L++DF ARA+ LPLL PYL  + SF NGVNFAV  STAL+  F  
Sbjct  71    ETFFRRPTGRCSNGQLMIDFFARALQLPLLKPYLGNDKSFRNGVNFAVAGSTALNSSFFT  130

Query  482   QKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ  661
              +G+ VP+   PL  Q++W  ++L S +C   S+C +RL+RSLF VGEIG ND  +   Q
Sbjct  131   ARGLHVPATNTPLGKQLSWFNSHLRS-VCR--SNCSERLRRSLFMVGEIGGNDYNYGFFQ  187

Query  662   GRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD  841
             G+++ EV AF+P +  ++  AVREVI+ G  R+VVPG FP+GCFP  LS F   DP+ YD
Sbjct  188   GKSVDEVRAFIPHVVQTIAAAVREVIRHGAVRVVVPGNFPIGCFPIYLSSFPANDPRAYD  247

Query  842   ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNK  1021
             + GCLR +N   +  NN LQ A+ SLR+EFP AVI+Y DYYAAFQS L RA  LGF +  
Sbjct  248   DKGCLRHMNEFAVEHNNALQAAIASLRQEFPHAVIVYGDYYAAFQSVLGRASTLGFDERA  307

Query  1022  LYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNIL  1201
                +CCG GG  YNYD ++ CG++GV  CPNP +YI WDGVHLTQKA+  +S+ ++ NIL
Sbjct  308   ALRSCCGVGGA-YNYDGSRQCGASGVPVCPNPDRYISWDGVHLTQKAYRHMSEFLVYNIL  366

Query  1202  SRIQC  1216
             S+IQC
Sbjct  367   SQIQC  371



>ref|XP_010251328.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Nelumbo nucifera]
Length=372

 Score =   379 bits (974),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 3/346 (1%)
 Frame = +2

Query  185   VVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFI  364
              +CPF +IYQ G S+ DTGNLIR G  G    AAR PYG TF  RPTGR S+GLLI+D+I
Sbjct  26    TICPFEAIYQLGDSISDTGNLIREGPAGAMSYAARFPYGETFFHRPTGRCSNGLLIIDYI  85

Query  365   ARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLK  544
             A A+ L L+NPYL++  SF +GVNFAV  STALD  F + + + VP    PLS Q+NW +
Sbjct  86    AMALRLALVNPYLERGVSFDHGVNFAVAGSTALDASFFSARNLHVPLSNSPLSTQLNWFR  145

Query  545   TYLSSSICAAPSDC--KDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
             T+L+S      +DC   +RL+R+L  VGEIG ND  +A  QG+ I+E+  +VP +  ++ 
Sbjct  146   THLNSLCHTDQTDCGNNNRLERALVLVGEIGGNDYNYAFFQGKPIEEIRTYVPYVVGAIT  205

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
             NAVREVI +GG RIVVPG FP+GC P  L+ F   DP+ YD++GCL  +N+  +  NN+L
Sbjct  206   NAVREVIGMGGIRIVVPGNFPIGCIPIYLTSFRNNDPRAYDDMGCLSGLNDFAMLHNNYL  265

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             Q+AL  LR+++P+ VILYADYY AFQS L RAP LGF  + L   CCG  GG+YN+D ++
Sbjct  266   QRALDGLRRDYPNVVILYADYYTAFQSVLRRAPSLGFVASSLLKACCGI-GGEYNFDGSR  324

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             +CGS GV  CPNP   IHWDGVHLTQ+A+  ++  +  +ILSRIQC
Sbjct  325   MCGSPGVPVCPNPANRIHWDGVHLTQEAYRHMADWLTGDILSRIQC  370



>ref|XP_010241274.1| PREDICTED: acetylajmalan esterase-like [Nelumbo nucifera]
Length=372

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/342 (50%), Positives = 232/342 (68%), Gaps = 2/342 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F ++YQ G S+ DTGNLIR   IG     ARLPYG T+  +PTGR S+GLL+VDFIA 
Sbjct  31    CSFDAMYQLGDSISDTGNLIREAPIGTYSAFARLPYGETYFKKPTGRCSNGLLMVDFIAS  90

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             A+ LPLLNPYL+++A FT+GVNFAV  STALD  +LA+  ++ P     LS Q+ W K +
Sbjct  91    ALHLPLLNPYLERDADFTHGVNFAVAGSTALDTSYLAKSKIIAPVTNSSLSVQLGWFKDH  150

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S IC   ++C  +L+++LF VGEIG ND  +A  Q + I E+ ++VP I   + +A R
Sbjct  151   LQS-ICYTQTECAHKLEKALFLVGEIGGNDYNYAFFQAKRIGEIQSYVPHIVQKIKDAAR  209

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             +VI  G + ++VPG FP+GC P  L+ F + DP  YDEL CL  +NN+ +F N+HLQ+AL
Sbjct  210   KVIDHGAKTVIVPGNFPIGCLPIYLTAFRSDDPAAYDELKCLEGLNNMAMFHNDHLQRAL  269

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LRKE+PD  I+YADYY A Q  L+ AP LGF +  L   CCG+ GG YN+D  K+CG+
Sbjct  270   KQLRKEYPDVTIVYADYYTALQWVLSHAPSLGFEEKSLQKACCGT-GGDYNFDLTKMCGA  328

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              GV  CP+P  +I WDG+HLT+KA+  ++  ++ NI+  IQC
Sbjct  329   PGVPVCPDPETHISWDGIHLTEKAYKYMADFLMHNIMPEIQC  370



>ref|XP_011073870.1| PREDICTED: acetylajmalan esterase-like [Sesamum indicum]
Length=349

 Score =   365 bits (938),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/341 (53%), Positives = 232/341 (68%), Gaps = 6/341 (2%)
 Frame = +2

Query  176   QKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIV  355
              + + CP +S+YQFG S+ DTGN IR   I P L A+R PYG TFPG+PTGRWSDG LI+
Sbjct  9     SQTIRCPIQSLYQFGDSISDTGNAIR---IVPLLAASRRPYGETFPGKPTGRWSDGRLII  65

Query  356   DFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQIN  535
             D+IA  +GLPLLNPYLDK ASF NGVNFAV ++TALD  F   +G++ P +   L+ Q++
Sbjct  66    DYIAMTLGLPLLNPYLDKTASFNNGVNFAVASATALDPSFYLVRGIINPPLPA-LASQLS  124

Query  536   WLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSV  715
             W KTY+ S IC+ P+DC D+L  SLFFVGE G NDI +   QGR++QE+  +VP +   +
Sbjct  125   WFKTYIRS-ICSTPTDCADKLNGSLFFVGEFGYNDIYYPYTQGRSVQEIQTYVPLVNQLI  183

Query  716   INAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNH  895
             IN+ RE+IQ+G  ++VVPG FPLGCFP  L   G      YD+ GC++S+N+LT + N+ 
Sbjct  184   INSTRELIQLGVSQVVVPGNFPLGCFPTFLVVAGRNRSTAYDDFGCVKSVNDLTSYENDD  243

Query  896   LQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRN  1075
              Q+AL SLR EFP+ VILYADYY AF S L +A   GF    L   CCG   G YN    
Sbjct  244   RQRALNSLRMEFPNTVILYADYYNAFLSLLRQATTFGFDTENLLTPCCGD-DGVYNALLP  302

Query  1076  KVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNI  1198
               CG  GV  C NP   IHWDG+HLTQ+A+  +S+I+I N+
Sbjct  303   TFCGGLGVPVCSNPNARIHWDGIHLTQEAYRRMSEIIIRNL  343



>emb|CDO98569.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 236/359 (66%), Gaps = 4/359 (1%)
 Frame = +2

Query  125   LCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGI  304
               FL+V++    V +  +     PF+ IYQFG SL DTGN IR   +      +RLPYG+
Sbjct  7     FSFLIVFSLLCTVSSAKENA--SPFKIIYQFGDSLADTGNRIRQSGVTSVFNVSRLPYGM  64

Query  305   TFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQ  484
             T+  +PTGR+S+GLL++DF+A+A+ LPLL PYL+ NASF +GVNFAV  STALD  F   
Sbjct  65    TYFHKPTGRFSNGLLVIDFVAKALHLPLLRPYLETNASFISGVNFAVGGSTALDNSFFYD  124

Query  485   KGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQG  664
             + + VPS  VPLS Q+ W K +L   +    S C++RLKR+LF +GEIG ND + A  QG
Sbjct  125   RNISVPSTNVPLSQQLKWFKKHLKL-VSDNRSQCEERLKRALFMMGEIGGNDFSTAFSQG  183

Query  665   RTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDE  844
             ++I+E   +VP +  ++  A+REVIQ G R I+VPG  P+GC P+ L+ F + DPK YD+
Sbjct  184   KSIKESRNYVPYVVDAISLAIREVIQFGARIIIVPGIIPMGCLPSFLASFPSADPKAYDD  243

Query  845   LGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKL  1024
              GCL+ +N   +F NN+LQ+ L +LR EFP  VI Y DYY AFQ  L  A  LGF Q  L
Sbjct  244   KGCLKKLNKFVLFYNNYLQKNLAALRLEFPGVVIRYYDYYNAFQYILHNAGSLGFDQRSL  303

Query  1025  YMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNIL  1201
                CCG  GG+YNY  + +C S GV +C  P +++HWDGVHLTQ+A+  IS  +I +IL
Sbjct  304   LKACCGK-GGKYNYSNDMICASNGVKACLQPERFVHWDGVHLTQEAYRYISDHLIRDIL  361



>ref|XP_010066434.1| PREDICTED: acetylajmalan esterase [Eucalyptus grandis]
Length=385

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 245/387 (63%), Gaps = 8/387 (2%)
 Frame = +2

Query  59    QCVHPAMLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDT  238
             Q +H  M+       +TL++ +L F     +++G  +       CP  +IYQFG S  DT
Sbjct  4     QAIHATMMS----SKITLHFLLLTFASFLLSSAGRVHGEAARRPCPIDAIYQFGDSTSDT  59

Query  239   GNLIR-VGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNA  415
             GNLIR VG  G    AARLPYG TF GRPTGR+SDG LIVD+ A A+GLPL+NP L KN 
Sbjct  60    GNLIRIVGPNGSGSQAARLPYGETF-GRPTGRFSDGRLIVDYFAIALGLPLVNPSLGKNL  118

Query  416   SFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDR  595
             SF +GVNFAV  ST L+  F A + V V +  VPL  Q+NW + YL+S+ C + ++C ++
Sbjct  119   SFEHGVNFAVAGSTVLNSSFYAARNVSVSASDVPLRLQLNWFRNYLNST-CRSKTECGEK  177

Query  596   LKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGT  775
             LKRSL  VGE+G ND  ++ + G++IQEV  +VP +    IN  RE+I++G  ++VV G 
Sbjct  178   LKRSLVIVGEMGSNDFLYSFLNGKSIQEVMTYVPPVVEETINVTRELIKMGASKVVVFGD  237

Query  776   FPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYA  955
             F +GC P  L+ F + D   YDE GCL++ N  + FRN H+Q AL  LR+E P A ILY 
Sbjct  238   FAIGCSPIYLTLFKSNDSDAYDEKGCLKAYNAFSQFRNTHVQVALAKLRRELPQATILYG  297

Query  956   DYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHW  1135
             DYY  ++  L +A  LGF        CCG+ GG YN++ +++CGSTGV +CPNP ++I W
Sbjct  298   DYYNGYKYVLDQASHLGFDPESALKACCGT-GGSYNFNFSQMCGSTGVTACPNPNEFISW  356

Query  1136  DGVHLTQKAHLAISQIVIPNILSRIQC  1216
             DG+HLTQ+AH  I++     I   + C
Sbjct  357   DGIHLTQEAHRHITEYNTNKIFPELSC  383



>ref|XP_010241275.1| PREDICTED: acetylajmalan esterase-like [Nelumbo nucifera]
Length=378

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 228/348 (66%), Gaps = 8/348 (2%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F +IYQ G S+ DTGNLIR   IG +   ARLPYG  +  +PTGR S+GL++VDFIA 
Sbjct  31    CSFDAIYQLGDSISDTGNLIREAPIGSSSAFARLPYGEAYFKKPTGRCSNGLIMVDFIAS  90

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             A+ LPLLNPYL+ +A+FT+GVNFAV  STALD  FLA+  ++VP     LS Q+ W K +
Sbjct  91    ALHLPLLNPYLEGDANFTHGVNFAVAGSTALDTSFLAKNKIIVPLTNSSLSVQLGWFKHH  150

Query  551   LSSSICAAPS------DCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTS  712
             L S IC   +      +C  +L R+LF VGEIG ND  +A  QG++I E+ ++VP I   
Sbjct  151   LKS-ICYTQTVFDLCLECAHKLGRALFLVGEIGGNDYIYAFFQGKSIGEIHSYVPHIVQK  209

Query  713   VINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNN  892
             + +A R+VI  G + ++VPG FP+GC P  L+ F + DP  YDEL CL+ +NNL +F NN
Sbjct  210   IKDAARKVIDHGAKTVIVPGHFPIGCLPIYLTAFRSNDPAAYDELKCLKGLNNLAMFHNN  269

Query  893   HLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDR  1072
             HLQ+AL  LRK +PD  I+YADYY A Q  L+ AP LGF    L   CCG  GG YN+D 
Sbjct  270   HLQRALKQLRKVYPDVTIVYADYYTALQWVLSHAPSLGFEDKSLQKVCCGI-GGDYNFDL  328

Query  1073  NKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              K CGS  V  CP+P   I WDG HLT+KA+  ++  ++ +I+  IQC
Sbjct  329   TKECGSPEVPVCPDPETRISWDGFHLTEKAYKYMADFLMHSIMPEIQC  376



>ref|XP_002279349.1| PREDICTED: acetylajmalan esterase [Vitis vinifera]
 emb|CBI39527.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 224/342 (65%), Gaps = 2/342 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F SIYQ G S+ DTGNLI   ++G   P +RLPYG TF   PTGR S+GLL++D +A 
Sbjct  33    CKFDSIYQLGDSISDTGNLIIESSLGAATPCSRLPYGETFFNEPTGRCSNGLLMIDHVAL  92

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
               GLP LNPYL K++ F++GVNFAVT +TAL   FLA KGV+ P     L+ Q++ + ++
Sbjct  93    EAGLPFLNPYLKKDSDFSHGVNFAVTGATALSTSFLAAKGVISPVTNSSLNVQLDRMSSF  152

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
              SS+     +D    LK +LF VGEIG ND  FA  QG+TI+E  + VPD+   + +AVR
Sbjct  153   FSSAF-HNDTDRAQELKDALFLVGEIGGNDFNFAFFQGKTIEEEKSIVPDVVQIISDAVR  211

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
              VIQ G RR+VVPG FP+GC P  L+ F T +   YDE  CL+  N+   + N  LQQA+
Sbjct  212   RVIQYGARRVVVPGNFPIGCLPIYLTVFKTNNTAAYDEFNCLKGFNDFAEYYNERLQQAI  271

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LR E PD VI+YADYY AFQ     A  LG     L   CCG+ GG+YNYDR + CG+
Sbjct  272   EELRNENPDTVIVYADYYNAFQWLFRNALFLGLDPASLLKACCGA-GGEYNYDRARTCGA  330

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              GV +CP+P + +HWDG+HLTQKA + I++ +I +IL ++QC
Sbjct  331   PGVQACPDPDRLVHWDGIHLTQKASMLIAKWLIQDILPKLQC  372



>gb|KCW64327.1| hypothetical protein EUGRSUZ_G01959 [Eucalyptus grandis]
Length=375

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 240/372 (65%), Gaps = 4/372 (1%)
 Frame = +2

Query  104   LTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIR-VGAIGPTLP  280
             +TL++ +L F     +++G  +       CP  +IYQFG S  DTGNLIR VG  G    
Sbjct  5     ITLHFLLLTFASFLLSSAGRVHGEAARRPCPIDAIYQFGDSTSDTGNLIRIVGPNGSGSQ  64

Query  281   AARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTA  460
             AARLPYG TF GRPTGR+SDG LIVD+ A A+GLPL+NP L KN SF +GVNFAV  ST 
Sbjct  65    AARLPYGETF-GRPTGRFSDGRLIVDYFAIALGLPLVNPSLGKNLSFEHGVNFAVAGSTV  123

Query  461   LDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRND  640
             L+  F A + V V +  VPL  Q+NW + YL+S+ C + ++C ++LKRSL  VGE+G ND
Sbjct  124   LNSSFYAARNVSVSASDVPLRLQLNWFRNYLNST-CRSKTECGEKLKRSLVIVGEMGSND  182

Query  641   ITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGT  820
               ++ + G++IQEV  +VP +    IN  RE+I++G  ++VV G F +GC P  L+ F +
Sbjct  183   FLYSFLNGKSIQEVMTYVPPVVEETINVTRELIKMGASKVVVFGDFAIGCSPIYLTLFKS  242

Query  821   QDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPL  1000
              D   YDE GCL++ N  + FRN H+Q AL  LR+E P A ILY DYY  ++  L +A  
Sbjct  243   NDSDAYDEKGCLKAYNAFSQFRNTHVQVALAKLRRELPQATILYGDYYNGYKYVLDQASH  302

Query  1001  LGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             LGF        CCG+ GG YN++ +++CGSTGV +CPNP ++I WDG+HLTQ+AH  I++
Sbjct  303   LGFDPESALKACCGT-GGSYNFNFSQMCGSTGVTACPNPNEFISWDGIHLTQEAHRHITE  361

Query  1181  IVIPNILSRIQC  1216
                  I   + C
Sbjct  362   YNTNKIFPELSC  373



>sp|Q3MKY2.1|AAE_RAUSE RecName: Full=Acetylajmalan esterase; Flags: Precursor [Rauvolfia 
serpentina]
 gb|AAW88320.1| acetylajmalan acetylesterase [Rauvolfia serpentina]
Length=387

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 242/361 (67%), Gaps = 10/361 (3%)
 Frame = +2

Query  134   LLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFP  313
             LLV+A   G+ N     ++CPF SIYQ G S  DTGNLIR+   GPT  AA  PYG TFP
Sbjct  13    LLVFA---GITNG----LICPFDSIYQLGDSFSDTGNLIRLPPDGPTFTAAHFPYGETFP  65

Query  314   GRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGV  493
             G PTGR SDG LI+DFIA A+ LPLLNPYL +N SF +GVNFAV  +TALD  FLA +GV
Sbjct  66    GTPTGRCSDGRLIIDFIATALNLPLLNPYLQQNVSFRHGVNFAVAGATALDRSFLAARGV  125

Query  494   VVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTI  673
              V  I   LS Q+NW +TYL  SIC+ P +C ++LK +LF +G IG ND+ +A    RTI
Sbjct  126   QVSDIHSHLSAQLNWFRTYL-GSICSTPKECSNKLKNALFILGNIGNNDVNYAF-PNRTI  183

Query  674   QEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGC  853
             +E+ A+VP IT +V NA RE+I++GG R++VPG FP+GC    L+        D D+LGC
Sbjct  184   EEIRAYVPFITEAVANATREIIRLGGSRVIVPGIFPIGCVARNLNFLNFFPDGDKDDLGC  243

Query  854   LRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMT  1033
             L S+NNL+I+ N+  Q+AL SL  EFP AVI+YADYY A++      P LG +   L   
Sbjct  244   LSSLNNLSIYFNSLFQRALASLSIEFPQAVIIYADYYNAWRFLFRNGPALGSNSTSLLKC  303

Query  1034  CCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQ  1213
             CCG  GG YNYD ++ CGS GV  CPNP QYI WDG H TQ A+  +++ VIP I+  ++
Sbjct  304   CCGI-GGPYNYDPDRECGSRGVPVCPNPTQYIQWDGTHFTQAAYRRVAEYVIPGIIKALK  362

Query  1214  C  1216
             C
Sbjct  363   C  363



>ref|XP_010918534.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X3 [Elaeis 
guineensis]
Length=387

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 226/333 (68%), Gaps = 2/333 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   +IY FG S+ DTGNLIR G  G   P A LPYG T   RPTGR S+GLL++D++A 
Sbjct  31    CYIEAIYSFGDSIADTGNLIREGVDGAFAPIAHLPYGETTFKRPTGRCSNGLLMIDYLAL  90

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             ++ LP +NPYLDK+A+F +GVNFAV   TALD+ F  ++G+++P     L+ Q+ W K++
Sbjct  91    SLKLPFVNPYLDKDANFNHGVNFAVAGGTALDVSFFKERGIMMPYTNSSLNVQLEWFKSH  150

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S IC++ +DC ++LK +LF VGEIG ND  +A   G++I EV  +VP + TS+INA +
Sbjct  151   LDS-ICSSQTDCAEKLKHALFLVGEIGGNDYNYAFFGGKSITEVMNYVPHVVTSIINAAK  209

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             EVI +G  ++V+PG FP+GC P+ L+   + DP  YD   CL+  N   +  N  LQ+A+
Sbjct  210   EVINMGAIQLVIPGNFPIGCLPSYLTALNSSDPDAYDNRLCLKGPNTFAMLHNLKLQEAI  269

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LR+ +P  VI+YADYY AF + L  A  LGF +N L   CCG GGG++N+D  K+CGS
Sbjct  270   QELRESYPHVVIMYADYYNAFMTLLDNALDLGFDKNSLMKACCG-GGGEHNFDATKMCGS  328

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              G  +C NP Q+I WDG+HLTQ+A++ +++ +I
Sbjct  329   PGASTCDNPAQHISWDGIHLTQEAYMIMARQLI  361



>ref|XP_006344835.1| PREDICTED: acetylajmalan esterase-like [Solanum tuberosum]
Length=378

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 234/366 (64%), Gaps = 4/366 (1%)
 Frame = +2

Query  119   CILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPY  298
             C+L F     A   ++ E  K+  C F SIYQFG S+ DTGN +R           +LPY
Sbjct  15    CLLIFQQKSDAQELIKLEKPKLRNCKFDSIYQFGDSISDTGNCMRESFCKAHSKCGKLPY  74

Query  299   GITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFL  478
             GI F    TGR S+G+L++D+IA   GLPLLNP+ D++A+F +GVNFAV  +TAL    +
Sbjct  75    GINFYQNTTGRCSNGMLMIDYIALESGLPLLNPFKDRSANFRHGVNFAVAGATALSNEIM  134

Query  479   AQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
             A K ++       LS Q++WL ++  ++     +DC+++LKRSLF VGEIG N+  F L 
Sbjct  135   ADKKILNKVTNSSLSVQLDWLSSHFETT---CSTDCREKLKRSLFLVGEIGGNEFNFGLS  191

Query  659   QGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
             QG+TI+E+   VP++  ++I+AV+ VI  G  RI+VPG FP+GC   +L+QF T     Y
Sbjct  192   QGKTIEEMRKIVPEVVQTIIHAVKRVIDFGATRIIVPGNFPIGCLSGMLTQFMTNKTTTY  251

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             DE  CL+ +NN  IF NNHL+QA+  L+K++P+  ++Y DYY A+   L  A  LGF +N
Sbjct  252   DEYHCLKDLNNFAIFYNNHLRQAIDELKKKYPNITLIYGDYYNAYMWLLQNAMRLGFDKN  311

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNI  1198
              L   CCG+ GG YNY+ +K CGS GV  C NP  YI+WDGVHLTQKA+  ++  +I ++
Sbjct  312   FLQKACCGT-GGDYNYNIHKRCGSQGVQVCANPNTYINWDGVHLTQKAYKWLTNWLIDDM  370

Query  1199  LSRIQC  1216
              S++ C
Sbjct  371   FSQLNC  376



>ref|XP_008806794.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Phoenix dactylifera]
 ref|XP_008806795.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Phoenix dactylifera]
Length=382

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/356 (46%), Positives = 235/356 (66%), Gaps = 6/356 (2%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
              L  +L +  ++G+E        C  ++IY  G S+ DTGNL+R G  G   P A LPYG
Sbjct  14    FLFLVLFFWTSAGLEEREG----CYIKAIYSLGDSIADTGNLLREGVGGAFAPIAHLPYG  69

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLA  481
              T   RPTGR SDGLL++D++A ++ LP +NPYLDK A+F +GVNFAV  +TALD  F  
Sbjct  70    ETTFHRPTGRCSDGLLMIDYLASSLNLPFVNPYLDKEANFNHGVNFAVAGATALDHSFFE  129

Query  482   QKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ  661
             ++G+++P     L+ Q++WLKT+L S +C++ +DC ++L  +LF VGEIG ND  +A   
Sbjct  130   ERGILMPYTNSSLNVQLDWLKTHLDS-VCSSETDCAEKLNHALFLVGEIGGNDYNYAFFG  188

Query  662   GRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD  841
             G++I EV ++VP +  S+INA +EVI +G  ++V+PG FP+GCFP+ L+   + DP  YD
Sbjct  189   GKSITEVISYVPHVVQSIINASKEVIDMGAVQLVIPGNFPIGCFPSYLTASRSSDPDAYD  248

Query  842   ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNK  1021
             +  C + +N   +  N  LQ+A+  LRK  P  +I+YADYY AF   L  A  LGF +N 
Sbjct  249   DRMCFKGLNAFAMLHNLKLQEAIQELRKSHPHVIIMYADYYHAFLHLLDNAVDLGFAKNS  308

Query  1022  LYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             L   CCGS GG YN+D +K+CGS G  +C NP Q+I WDG+HLTQKA++ +++ +I
Sbjct  309   LMKACCGS-GGVYNFDASKMCGSPGASTCDNPAQHISWDGIHLTQKAYMIMARELI  363



>ref|XP_010918533.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X2 [Elaeis 
guineensis]
Length=450

 Score =   347 bits (890),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 226/333 (68%), Gaps = 2/333 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   +IY FG S+ DTGNLIR G  G   P A LPYG T   RPTGR S+GLL++D++A 
Sbjct  94    CYIEAIYSFGDSIADTGNLIREGVDGAFAPIAHLPYGETTFKRPTGRCSNGLLMIDYLAL  153

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             ++ LP +NPYLDK+A+F +GVNFAV   TALD+ F  ++G+++P     L+ Q+ W K++
Sbjct  154   SLKLPFVNPYLDKDANFNHGVNFAVAGGTALDVSFFKERGIMMPYTNSSLNVQLEWFKSH  213

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S IC++ +DC ++LK +LF VGEIG ND  +A   G++I EV  +VP + TS+INA +
Sbjct  214   LDS-ICSSQTDCAEKLKHALFLVGEIGGNDYNYAFFGGKSITEVMNYVPHVVTSIINAAK  272

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             EVI +G  ++V+PG FP+GC P+ L+   + DP  YD   CL+  N   +  N  LQ+A+
Sbjct  273   EVINMGAIQLVIPGNFPIGCLPSYLTALNSSDPDAYDNRLCLKGPNTFAMLHNLKLQEAI  332

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LR+ +P  VI+YADYY AF + L  A  LGF +N L   CCG GGG++N+D  K+CGS
Sbjct  333   QELRESYPHVVIMYADYYNAFMTLLDNALDLGFDKNSLMKACCG-GGGEHNFDATKMCGS  391

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              G  +C NP Q+I WDG+HLTQ+A++ +++ +I
Sbjct  392   PGASTCDNPAQHISWDGIHLTQEAYMIMARQLI  424



>ref|XP_010918532.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X1 [Elaeis 
guineensis]
Length=460

 Score =   347 bits (889),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 226/333 (68%), Gaps = 2/333 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   +IY FG S+ DTGNLIR G  G   P A LPYG T   RPTGR S+GLL++D++A 
Sbjct  104   CYIEAIYSFGDSIADTGNLIREGVDGAFAPIAHLPYGETTFKRPTGRCSNGLLMIDYLAL  163

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             ++ LP +NPYLDK+A+F +GVNFAV   TALD+ F  ++G+++P     L+ Q+ W K++
Sbjct  164   SLKLPFVNPYLDKDANFNHGVNFAVAGGTALDVSFFKERGIMMPYTNSSLNVQLEWFKSH  223

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S IC++ +DC ++LK +LF VGEIG ND  +A   G++I EV  +VP + TS+INA +
Sbjct  224   LDS-ICSSQTDCAEKLKHALFLVGEIGGNDYNYAFFGGKSITEVMNYVPHVVTSIINAAK  282

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             EVI +G  ++V+PG FP+GC P+ L+   + DP  YD   CL+  N   +  N  LQ+A+
Sbjct  283   EVINMGAIQLVIPGNFPIGCLPSYLTALNSSDPDAYDNRLCLKGPNTFAMLHNLKLQEAI  342

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LR+ +P  VI+YADYY AF + L  A  LGF +N L   CCG GGG++N+D  K+CGS
Sbjct  343   QELRESYPHVVIMYADYYNAFMTLLDNALDLGFDKNSLMKACCG-GGGEHNFDATKMCGS  401

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              G  +C NP Q+I WDG+HLTQ+A++ +++ +I
Sbjct  402   PGASTCDNPAQHISWDGIHLTQEAYMIMARQLI  434



>ref|XP_010251983.1| PREDICTED: acetylajmalan esterase-like [Nelumbo nucifera]
Length=367

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 163/343 (48%), Positives = 226/343 (66%), Gaps = 3/343 (1%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             +CPF ++YQFG SL DTGN IR  + G    A+RLPYG T+  RPTGRWSDGLL +D+I 
Sbjct  27    ICPFDAVYQFGDSLSDTGNSIR-SSFGVNSSASRLPYGETYFRRPTGRWSDGLLAIDYIN  85

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
              A+GLPLLNPYL++NASF++GVNFAV  STAL+  F  ++ + V    +PLS Q+NW KT
Sbjct  86    LALGLPLLNPYLERNASFSHGVNFAVAGSTALNNTFFMKRNLFVSPGNIPLSVQLNWFKT  145

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             +L S+       C  RL R+L F+GEIG ND  ++   G+ I+E   +VP +  ++   V
Sbjct  146   HLKSTCRTLSGYCSKRLTRALVFMGEIGTNDYFYSF-GGKPIEETRTYVPYVVRAIKEGV  204

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             REV++ G   ++VPG  P+GC P  L+ F + D + YD++GCL+ +N   ++ N HL  A
Sbjct  205   REVVRAGAVNVIVPGIPPIGCVPTSLTFFQSNDTRSYDDMGCLKDLNEFAMYHNTHLHLA  264

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             L  LR+E+P A ILYAD+YA   S + RA  LGF ++ L   CCG  GG YN+  ++ CG
Sbjct  265   LKDLRREYPQAAILYADFYAVSLSIIRRAMALGFKKDVLLKACCGV-GGDYNFSLDRPCG  323

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             S GV  C  P QY+ WDG HLTQ+A+  ++  +I N+L++I C
Sbjct  324   SPGVPVCSKPAQYLSWDGTHLTQEANKKLADWMIDNVLTKIPC  366



>ref|XP_010929733.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Elaeis guineensis]
Length=376

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 228/356 (64%), Gaps = 7/356 (2%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             +L  L+V+   S +    +    C  ++IY FG S+ DTGNL+R G  G  +P A  PYG
Sbjct  11    LLSLLVVFQGFSNLAESKE----CFIKAIYSFGDSIADTGNLLREGPAGFFVPIASFPYG  66

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLA  481
              TF  +PTGR SDGLL++D+ A A+ L  +NPYLDK A+F NGVNFAV  +TALD  F  
Sbjct  67    KTF-NKPTGRCSDGLLMIDYFALALNLSFINPYLDKTANFDNGVNFAVAGATALDNSFFL  125

Query  482   QKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ  661
             Q+G+       PLS Q+ W KT+L+S+ C++ + C   LKR+LF VGEIG ND  +A  Q
Sbjct  126   QRGIFTTFTNNPLSVQLEWFKTHLNST-CSSKTKCAQSLKRALFLVGEIGGNDYNYAFSQ  184

Query  662   GRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD  841
             G ++++V  +VP++  S+I A +EVI +G  ++VVPG FP+GC P+ L+ F + DP  YD
Sbjct  185   GTSMKKVMTYVPEVVQSIIKAAKEVISMGAGQLVVPGNFPIGCMPSYLAMFYSLDPAAYD  244

Query  842   ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNK  1021
             E  CL+  N   +  N  LQ AL  LR  +P   I+YADYY AF   L +AP LGF ++ 
Sbjct  245   EKQCLKEYNAFAMHHNKQLQAALQDLRHAYPHVTIMYADYYQAFLHLLDKAPDLGFDKDS  304

Query  1022  LYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             L   CCG  GGQYN++ N +CG  G  +C NP ++I WDG+HLTQ+A+  ++Q +I
Sbjct  305   LLQACCGV-GGQYNFNINIMCGMPGASTCSNPSKHISWDGIHLTQEAYKVMAQSLI  359



>ref|XP_006344612.1| PREDICTED: acetylajmalan esterase-like [Solanum tuberosum]
Length=381

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/383 (44%), Positives = 244/383 (64%), Gaps = 7/383 (2%)
 Frame = +2

Query  77    MLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRV  256
             ML  + +  L     I+ F+++  + + V  E   ++ C F  IYQ G SL DTGN I+ 
Sbjct  1     MLLTIKMLDLLQVLSIISFMVLLKSDAQVMLEVPSLMKCKFDKIYQLGDSLSDTGNFIKE  60

Query  257   GAIGPTLPAARLPYGITFP-GRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGV  433
               +G   P A+LPYG  FP  + TGR SDGLL++DFIA   GLPLLNPY D+N +FT+G 
Sbjct  61    SFLGAFSPFAKLPYGQHFPQNKSTGRCSDGLLMIDFIALKCGLPLLNPYKDQNGNFTHGA  120

Query  434   NFAVTASTALDIGFLAQKGVVVPSITV--PLSGQINWLKTYLSSSICAAPSDCKDRLKRS  607
             NFAV  +TAL    L  K +   S+     L+ Q++W+ T+  S+     +DC   LK +
Sbjct  121   NFAVAGATALPAEILIDKKINSNSLITNSSLNVQLDWMSTHFKST---CSTDCSKYLKNA  177

Query  608   LFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLG  787
             LF VGEIG N+  + L+QG+T++E+ A VP++   +INAV+ VI  G  RIV+PG FP+G
Sbjct  178   LFLVGEIGGNEFNYGLLQGKTLEELRAMVPEVVQIIINAVKTVIGFGAVRIVIPGNFPIG  237

Query  788   CFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYA  967
             C PNLL+ F T +   YDE  CL+ +NNL +F N+HLQ+A+  L KE+P+  ++Y DYY 
Sbjct  238   CIPNLLTIFFTNNSTAYDEYHCLKDLNNLALFYNHHLQKAIQELEKEYPNITLIYGDYYN  297

Query  968   AFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVH  1147
             A+   L  A  LGF +  L+  CCG+GG  YNYD++++CG+ GV  C NP  YI+WDGVH
Sbjct  298   AYLWLLQNATRLGFDKYCLWKACCGTGGA-YNYDKSRICGAPGVPICGNPATYINWDGVH  356

Query  1148  LTQKAHLAISQIVIPNILSRIQC  1216
             LTQ A+  ++  +I ++L +++C
Sbjct  357   LTQAAYKLLAIWLIDDMLPKLKC  379



>ref|NP_001176564.1| Os11g0521000 [Oryza sativa Japonica Group]
 gb|ABA93963.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAH95292.1| Os11g0521000 [Oryza sativa Japonica Group]
Length=373

 Score =   338 bits (867),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 227/336 (68%), Gaps = 4/336 (1%)
 Frame = +2

Query  185   VVCPFRSIYQFGASLHDTGNLIRVG-AIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDF  361
               C   +IY FG S+ DTGNL+R G A+G        PYG T   RPTGR SDGLLI+D+
Sbjct  24    AACSVSAIYSFGDSIADTGNLLREGPAVGAFASIGTYPYGQTLR-RPTGRCSDGLLIIDY  82

Query  362   IARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
              A A+ L L++PYL+K A F +GVNFAV  +TALD  +L Q GVV+P  +VPLS Q++W 
Sbjct  83    FAMALNLSLVSPYLEKGARFESGVNFAVAGATALDRSYLLQSGVVMPPASVPLSSQLDWF  142

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
             +++L+S+ C++  DC  +L  +LF VGEIG ND  +A  QGR+I+ +  +VP +  S+++
Sbjct  143   RSHLNST-CSSHQDCAKKLSGALFLVGEIGGNDYNYAFFQGRSIESMKTYVPQVVRSIMD  201

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
               +EVI++G  +IV+PG FP+GC P+ LS F T    DYD+ GCL+S N+  ++ N+ L+
Sbjct  202   VAKEVIELGATKIVIPGNFPIGCSPSYLSLFSTAISGDYDDRGCLKSYNSFAMYHNDQLR  261

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
              A+  LRK   D  I+YADYY AF   L +A LLGF ++ L+  CCG+ GG+YN+D N +
Sbjct  262   AAIDDLRKVNSDVAIVYADYYGAFMHLLQKADLLGFEEDSLFKACCGA-GGKYNFDMNLM  320

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             CG+ G   C +P Q+I WDG+HLTQ+A+ A++  +I
Sbjct  321   CGAVGTNVCADPAQHISWDGIHLTQQAYKAMALSLI  356



>ref|XP_009786912.1| PREDICTED: acetylajmalan esterase-like [Nicotiana sylvestris]
Length=370

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 231/366 (63%), Gaps = 3/366 (1%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQK-VVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPY  298
             ++ FL +  A S     N K   +CPF SIYQ G SL DTGN I +  I PT  A  LPY
Sbjct  5     VVAFLFLSTAFSLSFCSNAKQTAICPFNSIYQLGDSLADTGNRILIPGIPPTFHAGHLPY  64

Query  299   GITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFL  478
             G T+ G+PTGR+SDGLL++D+IA A+ LP LNPYL KN+SF +GVNFAV  STALD  F 
Sbjct  65    GKTYFGKPTGRFSDGLLMIDYIAIALKLPFLNPYLSKNSSFIHGVNFAVAGSTALDKSFF  124

Query  479   AQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
              ++ + + S   PLS QI W K +L+ + C +P+ C  +L+ SL  +G  G ND   A  
Sbjct  125   DKRNISIKSFNPPLSTQIEWFKNHLNCT-CRSPTRCAKKLRNSLVNIGAFGGNDYFTAFS  183

Query  659   QGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
              G++ +E  +FVP    +++  ++E+I++G +RIV+ G  P GC P+LL+   + DP  Y
Sbjct  184   NGKSTEEAKSFVPFTVNAIVEGIKEIIKLGVKRIVISGVSPFGCLPSLLTSSPSSDPDAY  243

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             DE GCLR+ N    F NN+L+  +  + ++F D VILY DYY AF S   RA  LG  + 
Sbjct  244   DEFGCLRNYNKFASFHNNYLRDTISLVNRQFSDVVILYVDYYGAFLSIFRRAYYLGIDRE  303

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNI  1198
              L   CCG  GG+YN+D  K CGS     C +P ++++WDGVHLTQKA+  IS+I+I +I
Sbjct  304   SLLKACCGI-GGKYNFDGKKTCGSNETSVCSDPSRFMNWDGVHLTQKAYRHISEILITDI  362

Query  1199  LSRIQC  1216
             LS I C
Sbjct  363   LSNIDC  368



>ref|XP_009627361.1| PREDICTED: acetylajmalan esterase {ECO:0000303|PubMed:16133216}-like 
[Nicotiana tomentosiformis]
Length=371

 Score =   333 bits (855),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 165/362 (46%), Positives = 227/362 (63%), Gaps = 2/362 (1%)
 Frame = +2

Query  131   FLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF  310
             FL    + S   N  +   +CPF SIYQ G SL DTGN I +  I PT  A  LPYG T+
Sbjct  10    FLSTAFSLSFFSNAKETAPICPFNSIYQLGDSLADTGNRILIPGIPPTFHAGHLPYGETY  69

Query  311   PGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKG  490
              G+PTGR+SDGLL++D+IA A+ LPLLNPYL KN+SF +GVNFAV  STALD  F  ++ 
Sbjct  70    FGKPTGRFSDGLLMIDYIAIALKLPLLNPYLSKNSSFIHGVNFAVAGSTALDKSFFDERN  129

Query  491   VVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRT  670
             + + S   PLS QI W K +L+ + C +P+ C  +L+++L  +G  G ND   A    ++
Sbjct  130   ISIKSFNPPLSAQIEWFKNHLNCT-CRSPTLCAKKLRKALVSIGAFGGNDYFTAFSNRKS  188

Query  671   IQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELG  850
             I+E    VP    +++  ++E+I++G +RIV  G  P GC P+LL+   + DP  YDE G
Sbjct  189   IEEAKTLVPFTVNAIVEGIKEIIKLGVKRIVSSGVSPFGCLPSLLTSSPSSDPDAYDEFG  248

Query  851   CLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYM  1030
             CLR  N    F NN+L+  +  + +++ D VILY DYY AF S   RA  LG  +  L  
Sbjct  249   CLRDYNKFASFHNNYLRDTISLVSRQYSDVVILYVDYYGAFLSVFRRAYYLGIDRESLLK  308

Query  1031  TCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRI  1210
              CCG+ GG+YN+D  K CGS     C +P ++++WDGVHLTQKA+  IS+I+I +ILS I
Sbjct  309   ACCGN-GGKYNFDGKKTCGSNETSVCSDPSRFMNWDGVHLTQKAYRHISEILITDILSNI  367

Query  1211  QC  1216
              C
Sbjct  368   DC  369



>ref|XP_006663479.1| PREDICTED: acetylajmalan esterase-like [Oryza brachyantha]
Length=385

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 225/331 (68%), Gaps = 3/331 (1%)
 Frame = +2

Query  185   VVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFI  364
               C   +IY FG S+ DTGNL+R G +G        PYG T   RPTGR SDGLLI+D+ 
Sbjct  37    AACSVSAIYSFGDSIADTGNLLREGPVGTFASIGTYPYGQTLR-RPTGRCSDGLLIIDYF  95

Query  365   ARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLK  544
             A A+ L L++PYLDK ASF +GVNFAV  +TALD  +L Q G+++P  +VPLS Q++W +
Sbjct  96    AMALNLSLVSPYLDKGASFESGVNFAVAGATALDRTYLLQSGIMMPPASVPLSSQLDWFR  155

Query  545   TYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINA  724
             ++L+++ C++  +C+ +L  +LF VGEIG ND  +A  QGR+I  + A+VP +  S+++ 
Sbjct  156   SHLNTT-CSSQQECERKLGGALFLVGEIGGNDYNYAFFQGRSIDAMKAYVPQVVRSIMDV  214

Query  725   VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQ  904
              +EVI +G  +I++PG FP+GC P+ LS F T    DYD  GCL+S N+  ++ N+ L+ 
Sbjct  215   AKEVIGLGATKIIIPGNFPIGCSPSYLSLFSTAISGDYDNRGCLKSYNSFAMYHNDQLRA  274

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
             A+  LRK   D VI+YADYY AF   L +A LLGF +  L+  CCG+ GG+YN+D N +C
Sbjct  275   AIDDLRKVNSDIVIIYADYYGAFMHLLQKAFLLGFEEGSLFNACCGA-GGKYNFDMNLMC  333

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             G+ G  +C +P ++I WDG+HLTQ+A+ A++
Sbjct  334   GAVGTSACTDPMRHISWDGIHLTQQAYRAMA  364



>ref|XP_009613369.1| PREDICTED: acetylajmalan esterase {ECO:0000303|PubMed:16133216}-like 
[Nicotiana tomentosiformis]
Length=375

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/375 (42%), Positives = 231/375 (62%), Gaps = 3/375 (1%)
 Frame = +2

Query  95    LPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPT  274
             + SL L    L    +  A +   N ++    CP+  I+  G SL DTGNL+R+     T
Sbjct  1     MASLVLTSFFLTLYFLAFAYAANNNSSRIPNTCPYEYIFHVGDSLADTGNLVRLPNAKIT  60

Query  275   LPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTAS  454
               A   PYG  F G PTGR+SDG L +D+IA+A+ LPLL PYL K A+F++GVNFAV  S
Sbjct  61    YRADHYPYGRNFFGEPTGRFSDGRLTIDYIAKALNLPLLKPYLQKEANFSHGVNFAVGGS  120

Query  455   TALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGR  634
             TAL   +   + + +P+    L  Q+ WL TYL ++ C     C   L +SLF  GEIG 
Sbjct  121   TALRNPYYEARNISMPTYNRSLKVQLGWLTTYLKAT-CYTIRKCSKLLGKSLFMFGEIGG  179

Query  635   NDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQF  814
             ND   A  QG++I+E   FVP I  +++  +++V++ G +RIVVPG +P GCFP  L++F
Sbjct  180   NDYYQAFSQGKSIEEAKTFVPHIVKAIVKGIKQVMKYGAKRIVVPGIYPNGCFPYYLTKF  239

Query  815   GTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARA  994
              + D KDYDE GCL+S N+  ++ N++L++AL  L+ E+PD  I Y D Y  F+S L R 
Sbjct  240   SSLDYKDYDEFGCLKSYNDFAMYHNDYLERALSILKLEYPDVAIHYGDNYGTFKSILERP  299

Query  995   PLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAI  1174
                GFH+  +   CCG  GG YNY+ ++VCG+  V +C +  +Y+HWDG+HLT++A+  +
Sbjct  300   GYFGFHKKSILKACCGI-GGPYNYNEDRVCGTYEVPACSDSEKYLHWDGIHLTEEAYYYV  358

Query  1175  SQIVIPNILSR-IQC  1216
             ++ ++  IL++  QC
Sbjct  359   AEDLLSVILAKEFQC  373



>ref|XP_006357059.1| PREDICTED: acetylajmalan esterase-like [Solanum tuberosum]
Length=377

 Score =   328 bits (841),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 234/379 (62%), Gaps = 7/379 (2%)
 Frame = +2

Query  89    MGLPSLTLNYCILCFLLVYAAASGVENENQK---VVVCPFRSIYQFGASLHDTGNLIRVG  259
             M  P+  L   ++ F +        E++  +   ++ C F  IYQ G S+ DTGN IR  
Sbjct  1     MAFPTRVLLILLVIFTVFQLKIDAKESQIHRKRGLMNCRFDKIYQLGDSVSDTGNCIREN  60

Query  260   AIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNF  439
               G     A+ PYGI F  +PTGR S+GLL++DFIA   GLPLLNPY D++A+F +G NF
Sbjct  61    YCGSHSSCAKSPYGINFFHKPTGRCSNGLLMIDFIALESGLPLLNPYKDQSANFRHGANF  120

Query  440   AVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFV  619
             AV  +TAL    + +K +V+      L  Q++W+ ++  ++      DC  +LK+SLF V
Sbjct  121   AVAGATALSAQVMTEKKIVLSFTNSSLDVQLDWMSSHFETT---CSPDCPVQLKKSLFLV  177

Query  620   GEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPN  799
             G IG NDI + L QG+T++E+   V DI  ++I+ V+ +I  G  RI+VPGTFP GC P 
Sbjct  178   GHIGGNDIIYGLSQGKTMEELRRLVTDIVQTIIHGVKRIIGFGATRIIVPGTFPKGCGPA  237

Query  800   LLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQS  979
              L+QF T D   YDE  CL+ +NNL IF N+HLQQA+  ++KE+ +  ++Y DYY A+  
Sbjct  238   SLTQFMTNDSSAYDEYHCLKDLNNLAIFYNDHLQQAIDEMKKEYTNITLVYGDYYNAYMW  297

Query  980   FLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQK  1159
             FL  A  LGF +N L   CCG  GG YNYD+++ CG+ GV  C +P  + +WDG+HLTQ 
Sbjct  298   FLQNAVTLGFDKNSLQKACCGI-GGDYNYDKSRKCGAQGVPVCDDPSTHFNWDGLHLTQA  356

Query  1160  AHLAISQIVIPNILSRIQC  1216
             A+  +++ +I ++L ++ C
Sbjct  357   AYSWLTRWLIDDMLPKLNC  375



>ref|XP_010692476.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=378

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 226/340 (66%), Gaps = 6/340 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             F  IYQFG SL DTGNL+    +G     A  PYG+T    PTGR SDGLLI+D+ A+  
Sbjct  39    FDQIYQFGDSLSDTGNLVLENPLGAH-NFANFPYGVTI-HHPTGRCSDGLLIIDYFAKYF  96

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLS  556
              LPLL+P+LDK A+FT+G+NFAV  STALD   LA   V+ P     LS Q+NW K++L 
Sbjct  97    HLPLLSPFLDKQANFTHGLNFAVAGSTALDTATLASLNVLSPVTNSSLSVQLNWFKSHLE  156

Query  557   SSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREV  736
             S IC +PS+C+++L+RS+FF+ E G ND  +AL+Q +TI+EV   VP +  ++  AVR+V
Sbjct  157   S-ICGSPSECENKLRRSVFFI-ETGGNDYNYALLQRKTIEEVKDMVPQVVETIKEAVRKV  214

Query  737   IQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGS  916
             I +G  R+VVPG FP+GC P  L+ F T+D   YD+L CL+ +N    F N+ L+QAL  
Sbjct  215   ISLGATRVVVPGNFPIGCLPIYLASFETKDMNQYDDLKCLKGLNEFAKFHNDALKQALRE  274

Query  917   LRKEF--PDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
             +R E+   +  ++YADYY+  +  L  A   GF +++++  CCGSG   YN+D  K+CG+
Sbjct  275   IRAEYAGKNVAVVYADYYSGLRRILYNADAFGFKKDEIHKACCGSGNNAYNFDLMKMCGN  334

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRI  1210
              GV  CPNP + + WDG+HLTQ+A++ ++Q +  +I+ +I
Sbjct  335   KGVPVCPNPSRLVSWDGIHLTQRAYMRMAQGLFQHIIPQI  374



>ref|XP_009773453.1| PREDICTED: acetylajmalan esterase-like [Nicotiana sylvestris]
Length=375

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/344 (45%), Positives = 220/344 (64%), Gaps = 4/344 (1%)
 Frame = +2

Query  191   CP-FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             CP +  I+Q G SL DTGN  R+  +  +  A   PYG  F G+PTGR+SDG L++D+IA
Sbjct  32    CPNYEYIFQVGDSLADTGNRFRISNVKSSYRADHFPYGEKFFGKPTGRFSDGRLVIDYIA  91

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
              ++ LPLLNPY+ K A+F++GVN AV  +T L+  F   K +       PL  Q+ WL T
Sbjct  92    MSLKLPLLNPYMVKEANFSHGVNCAVGGATVLNDPFYVAKNITTAKDNRPLRSQLRWLTT  151

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             YL ++ C     C   L +SLF  GE G ND   A  +G++I E   FVP I  +++  +
Sbjct  152   YLKTT-CHTRQKCSKVLGKSLFMFGEFGGNDYYLAFSEGKSIDEAKTFVPYIVKTIVKGI  210

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             R+VI+ G +RIVVPG FPLGCFP  L+ F + D +DYDE GCL++ N L ++ N++L++A
Sbjct  211   RQVIRYGAKRIVVPGIFPLGCFPYYLTMFSSLDYEDYDEFGCLKAYNELAMYHNDYLERA  270

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             L  L+ E+ +  I+Y DYYAA +S L R    GF++  +  TCCG  GGQYNYD + +CG
Sbjct  271   LSILKLEYSNVAIIYIDYYAAVKSILERPSYFGFNKKSILKTCCGI-GGQYNYDDDILCG  329

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSR-IQC  1216
             ++ V +C +  +Y+HWDGVHLT+KA+  +++ VI  I S+  QC
Sbjct  330   TSKVQACSDSAKYLHWDGVHLTEKAYYYVAERVINGISSKEFQC  373



>ref|XP_009602651.1| PREDICTED: acetylajmalan esterase {ECO:0000303|PubMed:16133216}-like 
[Nicotiana tomentosiformis]
Length=376

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/344 (44%), Positives = 219/344 (64%), Gaps = 4/344 (1%)
 Frame = +2

Query  191   CP-FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             CP +  I+Q G SL DTGN  R+  +  +  A   PYG  F G+PTGR+SDG L++D+ A
Sbjct  33    CPNYEYIFQVGDSLADTGNRFRISNVKSSYRADHFPYGEKFFGKPTGRFSDGRLVIDYTA  92

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
              ++ LPLLNPY+DK A+F++GVN AV  ST L+  F   + +     T PL  Q+ WL T
Sbjct  93    MSLKLPLLNPYMDKTANFSHGVNCAVAGSTVLNDPFYVARNITTTKDTRPLRAQLRWLTT  152

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             YL ++ C     C   + +SLF  GE G ND   AL +G++I+E   FVP I  +++  +
Sbjct  153   YLKTT-CHTRQKCSKVVGKSLFMFGEFGGNDYYLALSEGKSIEEAKTFVPHIVKAIVKGI  211

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
              +VI+ G +RIVVPG +PLGCFPN L+ F + D +DYDE GCL++ N L ++ N++L++A
Sbjct  212   TQVIRYGAKRIVVPGIYPLGCFPNYLTMFSSLDYEDYDEFGCLKAYNELVMYHNDYLERA  271

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             L  L+ E+ +  I Y DYYAA +S L R    GF +  +   CCG  GGQYNYD +  CG
Sbjct  272   LSILKLEYSNVAIKYIDYYAAVKSILERPTNFGFDKKSILKACCGI-GGQYNYDDDNPCG  330

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSR-IQC  1216
             ++ V +C +  +Y+HWDGVHLT+KA+  +++ VI  I S+  QC
Sbjct  331   TSKVQACSDSAKYLHWDGVHLTEKAYYYVAEHVINGISSKEFQC  374



>ref|XP_008454485.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Cucumis melo]
Length=380

 Score =   327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/350 (45%), Positives = 219/350 (63%), Gaps = 4/350 (1%)
 Frame = +2

Query  167   NENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGL  346
             + ++ +  C   SI+QFG SL DTGNLIR     P+ P A LPYG TF  +PTGR S+GL
Sbjct  32    SNSEDLKACKLDSIFQFGDSLADTGNLIREN---PSTPFAHLPYGQTFFNKPTGRCSNGL  88

Query  347   LIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSG  526
             L+VD+ A A GLPL+NPYL K ASF +GVNFAV  STAL +  LAQ  V  P     L+ 
Sbjct  89    LMVDYFALAAGLPLVNPYLQKKASFVHGVNFAVAGSTALPLDVLAQNNVTSPVTNTSLTK  148

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ +YL +       DC  +LK +LFF+GEIG ND  +AL +G+T+ EV   VP + 
Sbjct  149   QLDWMHSYLRTICSNKRDDCTMKLKHALFFMGEIGGNDYNYALFEGKTVSEVKNMVPRVV  208

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              +++ A + VI  G  R+++PG F +GC P  L+ F T D   YD+  CL+  N L  + 
Sbjct  209   QTIMGATKRVIDYGATRVIIPGHFSMGCLPIYLTGFQTNDSTAYDKFHCLKDFNGLASYH  268

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             NN L+QA+  LRKE P+ +I Y DYY A       A LLGF + +L  +CCG+ GG YN+
Sbjct  269   NNKLKQAIKLLRKENPNVIIAYGDYYNALFWVFQHASLLGFDETRLQKSCCGT-GGDYNF  327

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             +  ++CG   V  C NP ++I WDG+HLTQK +  ++  +I +IL + +C
Sbjct  328   NVMQICGLPRVPVCSNPDKHISWDGIHLTQKTYQIMAHRLIRDILPKFRC  377



>ref|XP_009782266.1| PREDICTED: acetylajmalan esterase-like [Nicotiana sylvestris]
Length=370

 Score =   326 bits (835),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/362 (44%), Positives = 224/362 (62%), Gaps = 5/362 (1%)
 Frame = +2

Query  131   FLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF  310
             FLLV A A    +       C  RS+YQ G SL D GN+IR         A + PYG TF
Sbjct  12    FLLVIAFAY-FSSPTAAQTKCNIRSVYQLGDSLADAGNVIRTPGASIIFRANQAPYGETF  70

Query  311   PGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKG  490
               RPTGR+S+G +I+DFI+ A  L  LN YLD+ ASF+ GVNFAV  +TALD  F A +G
Sbjct  71    FRRPTGRFSNGRIIIDFISSAFKLSFLNAYLDRGASFSQGVNFAVAGATALDSSFWAARG  130

Query  491   VVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRT  670
             + +P+   PLS Q+ W K++L S+ C   S+C   L+ SL  +GE G ND      Q + 
Sbjct  131   IRLPTWNTPLSAQLGWFKSHLQST-CG--SNCAQTLRSSLIVMGEWGGNDYYNGFFQRKQ  187

Query  671   IQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELG  850
             + EV  +VP +   ++ ++++VIQ+G  RI+VPG +PLGC P  L+ F   +   YD+LG
Sbjct  188   LPEVRTYVPFVVAGIMKSIKDVIQLGATRILVPGIYPLGCLPLYLTTFPDSNANGYDQLG  247

Query  851   CLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYM  1030
             CLR+ N+   + N +L + L SL++EFP+  I+Y DYY A  + L      GF+QN L  
Sbjct  248   CLRNYNDFASYHNRYLNRGLASLQREFPNVRIVYGDYYGALLTLLRSPSSFGFNQNTLLT  307

Query  1031  TCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRI  1210
              CCG+ GG+YN++   VCGS  V +CPNP QY+HWDG+HLT +AH  ++ IV+ ++LSR 
Sbjct  308   ACCGT-GGRYNFNFRTVCGSPSVKACPNPAQYVHWDGIHLTDEAHRRMTDIVVKDMLSRF  366

Query  1211  QC  1216
              C
Sbjct  367   SC  368



>gb|EAZ18532.1| hypothetical protein OsJ_34061 [Oryza sativa Japonica Group]
Length=364

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/336 (47%), Positives = 222/336 (66%), Gaps = 13/336 (4%)
 Frame = +2

Query  185   VVCPFRSIYQFGASLHDTGNLIRVG-AIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDF  361
               C   +IY FG S+ DTGNL+R G A+G        PYG T   RPTGR SDGLLI+D+
Sbjct  24    AACSVSAIYSFGDSIADTGNLLREGPAVGAFASIGTYPYGQTLR-RPTGRCSDGLLIIDY  82

Query  362   IARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
              A A+ L L++PYL+K A F +GVNFAV  +TALD  +L Q GVV+P  +VPLS Q++W 
Sbjct  83    FAMALNLSLVSPYLEKGARFESGVNFAVAGATALDRSYLLQSGVVMPPASVPLSSQLDWF  142

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
             +++L+S+ C++  DC  +L  +LF VGEIG ND  +A  QGR+I+ +  +VP +      
Sbjct  143   RSHLNST-CSSHQDCAKKLSGALFLVGEIGGNDYNYAFFQGRSIESMKTYVPQV------  195

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
                EVI++G  +IV+PG FP+GC P+ LS F T    DYD+ GCL+S N+  ++ N+ L+
Sbjct  196   ---EVIELGATKIVIPGNFPIGCSPSYLSLFSTAISGDYDDRGCLKSYNSFAMYHNDQLR  252

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
              A+  LRK   D  I+YADYY AF   L +A LLGF ++ L+  CCG+ GG+YN+D N +
Sbjct  253   AAIDDLRKVNSDVAIVYADYYGAFMHLLQKADLLGFEEDSLFKACCGA-GGKYNFDMNLM  311

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             CG+ G   C +P Q+I WDG+HLTQ+A+ A++  +I
Sbjct  312   CGAVGTNVCADPAQHISWDGIHLTQQAYKAMALSLI  347



>ref|XP_008791125.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Phoenix dactylifera]
Length=376

 Score =   326 bits (835),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/356 (45%), Positives = 222/356 (62%), Gaps = 7/356 (2%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             +L  L+V+   S +    +    C   +IY FG S+ DTGNL+R G  G   P   LPYG
Sbjct  11    LLSVLVVFQGFSNLAESKE----CFINAIYSFGDSIADTGNLLREGPAGFFAPIGSLPYG  66

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLA  481
              TF  +PTGR SDGLL++D+ A A+ L  ++PYLD+ A+F NGVNFAV  +TALD  F  
Sbjct  67    KTFK-KPTGRCSDGLLMIDYFALALNLSFISPYLDRTANFDNGVNFAVAGATALDNSFFL  125

Query  482   QKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ  661
             ++         PLS Q+ W KT+L+S+ C++ + C   LKR+LF VGEIG ND  +A  Q
Sbjct  126   KRATFPTVTNSPLSVQLEWFKTHLNST-CSSQTKCAKLLKRALFLVGEIGGNDYNYAFTQ  184

Query  662   GRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD  841
             G +I++V  +VP +  S+I   +EVI VG  ++VVPG FP+GC P+ L+ F + DP  YD
Sbjct  185   GTSIKKVMTYVPQVVQSIIKTAKEVIDVGAVQLVVPGNFPIGCMPSYLTMFFSLDPGAYD  244

Query  842   ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNK  1021
             E  CL+  N   +  N  LQ AL  LR  +P   I+YADYY AF   L +AP LGF ++ 
Sbjct  245   EKKCLKEYNAFAMHHNKQLQAALEDLRHAYPHVTIMYADYYQAFLHLLDKAPELGFDKDS  304

Query  1022  LYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             L   CCG  GG++N++ N +CG  G  +C NP ++I WDG+HLTQ+A+  ++Q +I
Sbjct  305   LLQACCGV-GGEHNFNMNIMCGMPGASTCSNPSKHISWDGIHLTQEAYKVMAQSLI  359



>ref|XP_006382466.1| hypothetical protein POPTR_0005s02420g [Populus trichocarpa]
 gb|ERP60263.1| hypothetical protein POPTR_0005s02420g [Populus trichocarpa]
Length=373

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 242/376 (64%), Gaps = 14/376 (4%)
 Frame = +2

Query  95    LPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPT  274
             + S+ +++  L  +L YA+ +      + +  C F +IYQ G S+ DTGN I+     P+
Sbjct  8     IASVLISFLFLVAVLPYASNA------KSLKSCGFDAIYQLGDSISDTGNFIQEK---PS  58

Query  275   LPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFT--NGVNFAVT  448
                AR PYG TF  +PTGR S+G L++DFIA + G+P L+ +L+ N +FT  +GVNFAV 
Sbjct  59    SVYARFPYGETFFNKPTGRCSNGRLMIDFIASSAGVPFLDAHLNPNGTFTRGHGVNFAVA  118

Query  449   ASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEI  628
             +STAL    L++K +  P+ +  LS Q++W+ +Y +S IC    DC ++LK SLF VGEI
Sbjct  119   SSTALPADILSKKNIFPPTHS-SLSVQLDWMFSYFNS-ICFNEQDCAEKLKNSLFMVGEI  176

Query  629   GRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLS  808
             G ND T+A  QG+ ++EV   VPD+  ++ +AV  VI  G RR+VVPG  P+GCFP  L+
Sbjct  177   GVNDYTYAFFQGKIMEEVKNMVPDVVQAIKDAVTRVIGYGARRVVVPGNVPIGCFPIYLT  236

Query  809   QFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLA  988
              F T +   YD+  CL+ +NNL+   N+HLQQA+  L+KE P+ +I YADYY AFQ  L 
Sbjct  237   GFQTNNTDAYDKFHCLKGLNNLSASHNDHLQQAIEELKKENPNVLIAYADYYNAFQWILT  296

Query  989   RAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHL  1168
             +AP LGF    +   CCG+ GG Y ++  K+CG+ GV  CP P +YI WDGV LT+KA+ 
Sbjct  297   KAPNLGFDAKAVQKACCGT-GGDYGFNALKMCGTPGVPVCPEPDRYISWDGVQLTEKAYQ  355

Query  1169  AISQIVIPNILSRIQC  1216
              ++  +I +IL ++QC
Sbjct  356   YMALWIIDDILPKLQC  371



>gb|EAY81107.1| hypothetical protein OsI_36286 [Oryza sativa Indica Group]
Length=364

 Score =   324 bits (830),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/336 (47%), Positives = 221/336 (66%), Gaps = 13/336 (4%)
 Frame = +2

Query  185   VVCPFRSIYQFGASLHDTGNLIRVG-AIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDF  361
               C   +IY FG S+ DTGNL+R G A+G        PYG T   RPTGR SDGLLI+D+
Sbjct  24    AACSVSAIYSFGDSIADTGNLLREGPAVGAFASIGTYPYGQTLR-RPTGRCSDGLLIIDY  82

Query  362   IARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
              A A+ L L++PYL+K A F +GVNFAV  +TALD  +L Q GVV+P  +VPLS Q++W 
Sbjct  83    FAMALNLSLVSPYLEKGARFESGVNFAVAGATALDRSYLLQSGVVMPPASVPLSSQLDWF  142

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
             +++L+S+ C++  DC  +L  +LF VGEIG ND  +A  QGR+I+ +  +VP +      
Sbjct  143   RSHLNST-CSSHQDCAKKLSGALFLVGEIGGNDYNYAFFQGRSIESMKTYVPQV------  195

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
                EVI++G  +IV+PG FP+GC P+ LS F T    DYD+ GCL+S N+  ++ N+ L+
Sbjct  196   ---EVIELGATKIVIPGNFPIGCSPSYLSLFSTAISGDYDDRGCLKSYNSFAMYHNDQLR  252

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
              A+  LRK   D  I+YADYY AF   L +A LLGF +  L+  CCG+ GG+YN+D N +
Sbjct  253   AAIDDLRKVNSDVSIVYADYYGAFMHLLQKADLLGFEEGSLFKACCGA-GGKYNFDMNLM  311

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             CG+ G   C +P Q+I WDG+HLTQ+A+ A++  +I
Sbjct  312   CGAVGTNVCADPAQHISWDGIHLTQQAYKAMALSLI  347



>ref|XP_009383158.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 216/333 (65%), Gaps = 3/333 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   +IY FG S+ DTGNL+  GA G   P   LPYG T   + TGR SDGLL++D+ A 
Sbjct  28    CFIEAIYSFGDSIADTGNLLHEGAAGLFAPIGSLPYGETLK-KATGRCSDGLLMIDYFAL  86

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
              + LPL+NPYLD++++F +GVNFAV  STALD  F  Q+ +  P    PL  Q+ W KT+
Sbjct  87    NLNLPLINPYLDESSNFESGVNFAVAGSTALDSSFFVQRSIYTPVANSPLGVQLEWFKTH  146

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L+S+ C++P++C  +L+R+L  +GEIG ND   A  QGRTI +V +FVP +   +I+A  
Sbjct  147   LNST-CSSPTECARKLERALILMGEIGGNDYNNAFFQGRTIADVKSFVPLVVQRIISAAE  205

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             EVI +G  ++VVPG FP+GC P+ L+ F T +   YD   CL++ N+  ++ N+HLQ AL
Sbjct  206   EVIDLGAAQLVVPGNFPIGCAPSYLAMFTTANATAYDADNCLKNFNSFAVYHNDHLQAAL  265

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LR+  P   I+YADYY AF   L  A  LGF +  L+  CCG+ GG YN+D N +CG 
Sbjct  266   EGLRRAHPRVTIMYADYYQAFMYLLNHAADLGFDEGSLHKACCGA-GGPYNFDINLMCGL  324

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              G  +C  P +Y+ WDG+HLTQ+A+  ++Q +I
Sbjct  325   PGTETCTEPSKYVSWDGIHLTQEAYRVMAQSLI  357



>ref|XP_009767428.1| PREDICTED: acetylajmalan esterase-like isoform X1 [Nicotiana 
sylvestris]
Length=384

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 225/346 (65%), Gaps = 5/346 (1%)
 Frame = +2

Query  182   VVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF-PGRPTGRWSDGLLIVD  358
             ++ C F  IYQ G SL DTGN IR   +G   P A+LPYG  F     TGR SDGLL++D
Sbjct  41    LMKCKFDKIYQLGDSLSDTGNFIRESLVGAFSPFAKLPYGENFFQNESTGRCSDGLLMID  100

Query  359   FIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             FIA   GLPLLNPY D+N +FT+G NFAV  +TAL    +A+K +        L+ Q++W
Sbjct  101   FIALECGLPLLNPYKDQNGNFTHGANFAVAGATALPAEIMAEKKISNSLTNSSLNVQLDW  160

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
             + ++  S   A  ++C + LK++LF VGEIG N+  + L+QG+ ++E+ A VP++  ++I
Sbjct  161   MSSHFKS---ACSTECSEDLKKALFLVGEIGGNEFNYGLLQGKPMEELRAMVPEVVQTII  217

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
             NAV+ +I  G  RIV+PG FP+GC PNLL+ F T +   YD   CL+ +N+L I  N+HL
Sbjct  218   NAVKTIIGFGAVRIVIPGNFPIGCIPNLLTTFLTNNSTAYDYNHCLKDLNHLAILYNDHL  277

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             QQ +  L+K  P+  ++Y DYY A+   L  A  LGF +N L   CCG  G +YNYD+++
Sbjct  278   QQVIQELKKGHPNIALVYGDYYNAYLWLLKNAASLGFDKNSLLKACCGI-GEKYNYDKSR  336

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             +CG+ G+  C +P  YI WDG+HLTQ+A+  +++ +I ++L +++C
Sbjct  337   ICGAPGLQICTDPSTYISWDGIHLTQQAYKWLARWLIDDMLPKLKC  382



>ref|XP_010692472.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Beta vulgaris 
subsp. vulgaris]
Length=375

 Score =   324 bits (830),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 225/340 (66%), Gaps = 6/340 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             F  IYQFG SL DTGNL+    +G     A  PYG++    PTGR SDGLLI+D+ A+  
Sbjct  36    FDQIYQFGDSLSDTGNLVLENPLGAH-NFANFPYGVSI-HHPTGRCSDGLLIIDYFAKYF  93

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLS  556
              LPLL+P+LDK A+FT+G+NFAV  STALD   LA   V+ P     LS Q+NW K++L 
Sbjct  94    HLPLLSPFLDKQANFTHGLNFAVAGSTALDTATLASLNVLSPVTNSSLSVQLNWFKSHLE  153

Query  557   SSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREV  736
             S+ C +PS+C+++L+RS+FF+ E G ND  +AL+Q +TI+EV   VP +  ++  AVR+V
Sbjct  154   ST-CGSPSECENKLRRSVFFI-ETGGNDYNYALLQRKTIEEVKDMVPQVVGTIKEAVRKV  211

Query  737   IQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGS  916
             I +G  R+VVPG FP+GC P  L+ F T+D   YD+L CL+ +N    F N+ L+QAL  
Sbjct  212   ISLGATRVVVPGNFPIGCLPIYLASFETKDTNQYDDLKCLKGLNEFAKFHNDVLKQALRE  271

Query  917   LRKEF--PDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
             +R E+   +  ++YADYY+  +  L  A   GF +++++  CCGSG   YN+D  K+CG+
Sbjct  272   IRAEYAGKNVAVVYADYYSGLRRILYNADAFGFKKDEIHKACCGSGKNAYNFDLMKMCGN  331

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRI  1210
              GV  CPNP + + WDG+HLTQ+A++ ++Q +   I+ +I
Sbjct  332   KGVPVCPNPSRLVSWDGIHLTQRAYMRMAQGLFQQIIPQI  371



>ref|XP_010690534.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score =   324 bits (830),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 225/340 (66%), Gaps = 6/340 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             F  IYQFG SL DTGNL+    +G     A  PYG+T    PTGR SDGLLI+D+ A+  
Sbjct  38    FDQIYQFGDSLSDTGNLVLENPLGAH-NFANFPYGVTI-HHPTGRCSDGLLIIDYFAKYF  95

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLS  556
              LPLL+P+LDK A+FT+G+NFAV  STALD   LA + V+ P     LS Q+NW K++L 
Sbjct  96    HLPLLSPFLDKQANFTHGLNFAVAGSTALDTATLASQNVLSPVTNSSLSVQLNWFKSHLE  155

Query  557   SSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREV  736
             S+ C  P +C+++L+RS+FF+ E G ND  +AL+Q +TI+EV   VP +  ++  AVR+V
Sbjct  156   ST-CGNPLECENKLRRSVFFI-ETGGNDYNYALLQRKTIEEVKDMVPQVVGTIKEAVRKV  213

Query  737   IQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGS  916
             I +G  R+VVPG FP+GC P  L+ F T+D   YD+L CL+ +N    F N+ L+QAL  
Sbjct  214   ISLGATRVVVPGNFPIGCLPIYLAAFETKDTNQYDDLKCLKGLNEFAKFHNDVLKQALRE  273

Query  917   LRKEF--PDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
             +R E+   +  ++YADYY+  +  L  A + GF +++++  CCGSG   YN+D  K+CG+
Sbjct  274   IRAEYASKNVAVVYADYYSGLRRILYNADVFGFKKDEVHKACCGSGNNAYNFDLMKMCGN  333

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRI  1210
              GV  CPNP + + WDG+HLTQ+A++ ++Q +   I+ +I
Sbjct  334   KGVPVCPNPSRLVSWDGIHLTQRAYMRMAQGLFQQIIPQI  373



>ref|XP_011036970.1| PREDICTED: acetylajmalan esterase-like [Populus euphratica]
Length=373

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 225/344 (65%), Gaps = 8/344 (2%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F +IYQ G S+ DTGN I+     P+   AR PYG TF  +PTGR S+G LI+DFIA 
Sbjct  34    CGFDAIYQLGDSISDTGNFIQEK---PSSVYARFPYGETFFNKPTGRCSNGRLIIDFIAS  90

Query  371   AVGLPLLNPYLDKNASFT--NGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLK  544
             + G+P L+ +L+ N +FT  +GVNFAV +STAL    L++K +  P+ +  LS Q++W+ 
Sbjct  91    SAGVPFLDAHLNPNGTFTRGHGVNFAVASSTALPADILSKKNIFPPTRS-SLSVQLDWMF  149

Query  545   TYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINA  724
             +Y +S IC    DC ++LK SLF VGEIG ND T+A  QG+ ++EV   VPD+  ++ +A
Sbjct  150   SYFNS-ICFNEQDCAEKLKNSLFMVGEIGVNDYTYAFFQGKIMEEVKNMVPDVVQAIKDA  208

Query  725   VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQ  904
             V  VI  G RR+VVPG  P+GCFP  L+ F T     YD+  CL+ +NNL+   N+HL+Q
Sbjct  209   VTRVIGYGARRVVVPGNVPIGCFPIYLTGFQTNSTDAYDKFHCLKGLNNLSASHNDHLKQ  268

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
             A+  L+KE P+ +I YADYY AFQ  L +AP LGF    +   CCG+ GG Y ++  K+C
Sbjct  269   AIEELKKENPNVLIAYADYYNAFQWILTKAPNLGFDAKSVQKACCGT-GGDYGFNALKMC  327

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             G+ GV  CP P +YI WDGV LT+KA+  ++  +I +IL  +QC
Sbjct  328   GTPGVPVCPEPDRYISWDGVQLTEKAYQYMALWIIDDILPELQC  371



>ref|XP_004156989.1| PREDICTED: LOW QUALITY PROTEIN: acetylajmalan esterase-like [Cucumis 
sativus]
Length=376

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 218/350 (62%), Gaps = 4/350 (1%)
 Frame = +2

Query  167   NENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGL  346
             + ++ +  C   SI+QFG SL DTGNLIR     P+ P + LPYG TF  +PTGR S+GL
Sbjct  28    SNSEDLKACKLDSIFQFGDSLADTGNLIREN---PSTPFSHLPYGQTFFNKPTGRCSNGL  84

Query  347   LIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSG  526
             L+VD+ A A GLPL+NPYL K ASF +GVNFAV  STAL +  LAQ  +  P     LS 
Sbjct  85    LMVDYFALAAGLPLVNPYLQKKASFVHGVNFAVAGSTALPLDVLAQNNITSPVTNTSLSK  144

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ +YL++       DC  +LK +LFF+GEIG ND  +AL +G+T+ EV   VP + 
Sbjct  145   QLDWMHSYLNTICSNKRDDCTTKLKHALFFMGEIGGNDYNYALFEGKTVAEVKXMVPRVV  204

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++++A + VI  G  R+++PG F +GC P  L+ F T D   YD+  CL+  N L  + 
Sbjct  205   QTIMDATKRVIDYGATRVIIPGHFSMGCLPIYLTGFQTNDSTAYDKFHCLKDFNGLASYH  264

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N  L+QA+  LRKE P+ +I Y DYY A       A LLGF +  L  +CCG+ GG YN+
Sbjct  265   NKKLKQAIKLLRKENPNVIIAYGDYYNALFWVFQHASLLGFDETFLQKSCCGT-GGDYNF  323

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             +  ++CG   V  C NP ++I WDG+HLTQK +  ++  ++ +I  + +C
Sbjct  324   NVMQICGLPRVPVCSNPDKHISWDGIHLTQKTYQIMAHRLMRDISPKFRC  373



>ref|XP_009776096.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Nicotiana sylvestris]
Length=387

 Score =   321 bits (823),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/342 (46%), Positives = 215/342 (63%), Gaps = 4/342 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F  IYQ G SL DTGN IR+   G   P A+LPYG+ F  + TGR SDG++I+DFIA 
Sbjct  50    CGFDKIYQLGDSLSDTGNFIRLSIWGSVSPFAKLPYGVNFFKKGTGRASDGMIIIDFIAL  109

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
               GLPLLNPY+D+NA+F +G NFAV  +TAL+ G LA+K +  P     L  Q+ W+ ++
Sbjct  110   ESGLPLLNPYMDQNANFAHGANFAVIGATALEAGVLAEKKIFNPLGNGSLDMQLGWMSSH  169

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
                +     +DC + LK SLF VGEIG N+  + L QG+T++E+   VP++  +++ AV 
Sbjct  170   FQYT---CHNDCSEYLKSSLFLVGEIGGNEFFYGLTQGKTMEELRNMVPEVVQNIVEAVN  226

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
              V   G  RI +PG FP+GC P  L+ F T +   YDE  CL+ +N+L IF N + QQA+
Sbjct  227   TVTGFGAIRIFIPGNFPIGCLPMTLTTFLTNNSMAYDENYCLKDLNSLAIFYNENQQQAI  286

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               L+K+ P+  ++Y DYY A+Q  L      GF QN L   CCG  GG YNYD  + CG 
Sbjct  287   EDLKKKNPNVTLIYGDYYNAYQWLLQNTVNHGFDQNSLRKACCGE-GGYYNYDAKRHCGF  345

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              GV  C +P  YI WDGVHLT+KA+  I++ +I +IL +++C
Sbjct  346   PGVPVCADPSTYISWDGVHLTEKAYSLIARWLIDDILPQLEC  387



>ref|XP_004152298.1| PREDICTED: acetylajmalan esterase-like [Cucumis sativus]
Length=376

 Score =   321 bits (822),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 218/350 (62%), Gaps = 4/350 (1%)
 Frame = +2

Query  167   NENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGL  346
             + ++ +  C   SI+QFG SL DTGNLIR     P+ P + LPYG TF  +PTGR S+GL
Sbjct  28    SNSEDLKACKLDSIFQFGDSLADTGNLIREN---PSTPFSHLPYGQTFFNKPTGRCSNGL  84

Query  347   LIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSG  526
             L+VD+ A A GLPL+NPYL K ASF +GVNFAV  STAL +  LAQ  +  P     LS 
Sbjct  85    LMVDYFALAAGLPLVNPYLQKKASFVHGVNFAVAGSTALPLDVLAQNNITSPVTNTSLSK  144

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ +YL++       DC  +LK +LFF+GEIG ND  +AL +G+T+ EV   VP + 
Sbjct  145   QLDWMHSYLNTICSNKRDDCTTKLKHALFFMGEIGGNDYNYALFEGKTVAEVKNMVPRVV  204

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++++A + VI  G  R+++PG F +GC P  L+ F T D   YD+  CL+  N L  + 
Sbjct  205   QTIMDATKRVIDYGATRVIIPGHFSMGCLPIYLTGFQTNDSTAYDKFHCLKDFNGLASYH  264

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N  L+QA+  LRKE P+ +I Y DYY A       A LLGF +  L  +CCG+ GG YN+
Sbjct  265   NKKLKQAIKLLRKENPNVIIAYGDYYNALFWVFQHASLLGFDETFLQKSCCGT-GGDYNF  323

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             +  ++CG   V  C NP ++I WDG+HLTQK +  ++  ++ +I  + +C
Sbjct  324   NVMQICGLPRVPVCSNPDKHISWDGIHLTQKTYQIMAHRLMRDISPKFRC  373



>gb|EYU34257.1| hypothetical protein MIMGU_mgv1a008288mg [Erythranthe guttata]
Length=378

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 227/356 (64%), Gaps = 9/356 (3%)
 Frame = +2

Query  161   VENENQKV---VVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGR  331
             ++N  Q+      CPF+ IY FG  + D GN +RV   GP LPAAR PYG TFPG+PTGR
Sbjct  25    IQNSQQQRPQNTTCPFKYIYSFGDGITDIGNTVRVLPFGPFLPAARSPYGQTFPGQPTGR  84

Query  332   WSDGLLIVDFIARAVGLPLLNPYLDKNASFTN-GVNFAVTASTALDIGFLAQKGVVVPSI  508
             WSDG + +D+I   +GLP + PYL    S +N GV F+   ST LD  F   +GV +P  
Sbjct  85    WSDGRIAIDYIGSDLGLPNIVPYLSLRGSTSNDGVIFSAARSTTLDRLFFKLRGVAIPPY  144

Query  509   TVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAA  688
              +PLSGQ+ W K YLSS +C+ P DC + +  S+  +G+I  NDI +AL QG++IQ+V  
Sbjct  145   AIPLSGQLRWFKAYLSS-LCSTPQDCANIVGDSVIILGDIEANDIGYALEQGKSIQQVET  203

Query  689   FVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSIN  868
             +VP I  ++I A  E+I++G  R+V+ G+ P+GC+P +L+   T +   YD+LGCL+S+N
Sbjct  204   YVPFIIRALIEAATELIRMGATRVVLTGSVPVGCYPYILTALQTNNATAYDDLGCLKSVN  263

Query  869   NLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSG  1048
             +L + +N  LQ+A+ +L  +FP+  + YA  Y + QS + ++ + G   N    +CCG  
Sbjct  264   DLILSKNQLLQEAVTNLAAQFPNVGVYYAGIYDSVQSIIRQSSISG---NMTLKSCCGI-  319

Query  1049  GGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             GGQYNYDR + CGS GV+ C NP +YI+WDG+H TQ  +   + IV+P  L  + C
Sbjct  320   GGQYNYDRRRFCGSRGVLVCANPSEYIYWDGLHFTQDLYAQYTNIVVPPFLPVLGC  375



>ref|XP_003577537.1| PREDICTED: acetylajmalan esterase [Brachypodium distachyon]
Length=374

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/335 (45%), Positives = 213/335 (64%), Gaps = 3/335 (1%)
 Frame = +2

Query  173   NQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLI  352
             +     C   +IY FG S+ DTGNL+R G +G        PYG T+  +PTGR SDGLLI
Sbjct  22    DSAAAACSVNAIYSFGDSIADTGNLLREGPVGFFSSIGSYPYGQTYR-KPTGRCSDGLLI  80

Query  353   VDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQI  532
             +D++A A+ LPL+NPYLD  A F+ GVNFAV  +TALD   L Q  +V+    +PLS Q+
Sbjct  81    IDYLAMALKLPLINPYLDSGADFSGGVNFAVAGATALDRTVLVQNAIVMTPGNMPLSSQL  140

Query  533   NWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTS  712
             +W K++L+++ C +  DC  +L  +LF VGEIG ND  +A  Q R+I+ V A+VP +  S
Sbjct  141   DWFKSHLNAT-CTSQEDCAKKLAGALFLVGEIGGNDYNYAFFQKRSIEAVKAYVPQVVQS  199

Query  713   VINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNN  892
             + N  +E+I++G  +I++PG FP+GC P+ LS F      D+DE GCL S N+   + N 
Sbjct  200   ITNVAKELIELGATQIMIPGNFPIGCSPSYLSLFSVAGSTDHDERGCLVSYNSFAAYHNE  259

Query  893   HLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDR  1072
              LQ A+  LRK   D  I+YADYY AF   L  A +LGF +  L   CCG+ GG YN+D 
Sbjct  260   QLQAAIDGLRKANSDVSIVYADYYGAFLHLLDHASVLGFDEGSLLKACCGA-GGVYNFDM  318

Query  1073  NKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             + +CG  G  +C +P +++ WDG+HLTQ+A+ A++
Sbjct  319   DMMCGGLGASTCADPARHVSWDGIHLTQQAYRAMA  353



>ref|XP_008465497.1| PREDICTED: acetylajmalan esterase-like, partial [Cucumis melo]
Length=356

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 212/343 (62%), Gaps = 6/343 (2%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF-PGRPTGRWSDGLLIVDFIA  367
             C F  IYQ G S+ DTGNLIR     P  P + LPYG TF    PTGR S+GLLI+D+ A
Sbjct  17    CNFDGIYQLGDSISDTGNLIREN---PNTPFSHLPYGQTFFNSTPTGRCSNGLLIIDYFA  73

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
                 LPL+NPYL+K+A   +GVNFAV  STAL    L++K +  P     L  Q++W+ +
Sbjct  74    LDAKLPLVNPYLNKDALTRHGVNFAVAGSTALSSQLLSEKKISSPLTNSSLDIQLDWMFS  133

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC    DC ++L  +LF VGEIG ND  +AL+QG+TIQEV   VP++  +V NAV
Sbjct  134   HFNS-ICFDQKDCNEKLMNALFLVGEIGANDYNYALLQGKTIQEVKEMVPEVVQTVKNAV  192

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
               VI  G  R+VV G FP+GCFP  L+ F T D   YDE  CL+S+N LT + N+ +QQA
Sbjct  193   ERVISYGATRVVVSGNFPIGCFPIFLTVFQTNDTTAYDEFHCLKSLNALTSYHNDQIQQA  252

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L KE    VI+Y DYY AF   L  A  LGF    L  +CCG  GG YN++  K CG
Sbjct  253   IEVLNKENSRTVIVYGDYYNAFLWILRHASTLGFDNGSLQKSCCGI-GGDYNFELKKSCG  311

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             S GV  CPN  + I WDGV LTQKA+  I+  +I NI  ++ C
Sbjct  312   SQGVGVCPNADKVISWDGVQLTQKAYKFIADWLILNITPKLNC  354



>ref|XP_009587413.1| PREDICTED: acetylajmalan esterase {ECO:0000303|PubMed:16133216}-like 
isoform X1 [Nicotiana tomentosiformis]
Length=383

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/366 (43%), Positives = 225/366 (61%), Gaps = 9/366 (2%)
 Frame = +2

Query  134   LLVYAAASGVENE-----NQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPY  298
             L+V    S  E++       +++ C F  I+Q G SL DTGN IR       L   R PY
Sbjct  20    LVVLQQKSNAEDQLLMLQKPRLMKCRFDKIFQLGDSLSDTGNCIRESLCARRLLCGRFPY  79

Query  299   GITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFL  478
             G+ F    TGR S+G+L++DFIA   GLPLLNPY D+NA+F +G NFAV  +TAL    L
Sbjct  80    GMNFFQNTTGRCSNGMLMIDFIALESGLPLLNPYKDQNANFRHGANFAVAGATALSTENL  139

Query  479   AQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
             A++ +V       +S Q++W+ T+  S+    P+D   +LK+SLF VGEIG N+  + L 
Sbjct  140   AEEKIVNSVTNSSMSVQLDWMSTHFKSTY---PTDRLAKLKKSLFLVGEIGGNEFNYGLF  196

Query  659   QGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
             +G+TI+E+ + VP +  ++I  VR VI  G  RIVVPG FP+GC P  L+QF T D   Y
Sbjct  197   KGKTIKELRSMVPKVVQTIIQGVRTVISFGATRIVVPGNFPIGCIPIFLTQFRTNDSTAY  256

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             DE  CL+ +NNL+IF N+HL+QA+  L++E  +  ++Y DYY A+   L  A  +GF +N
Sbjct  257   DEYHCLQDLNNLSIFFNDHLKQAIQELKEEHSNIALVYGDYYNAYLWLLQNAMFIGFDKN  316

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNI  1198
              L   CCG  GG YNY     CG+ GV  C +P  YI WDGVHLT+KA+  +++ +I ++
Sbjct  317   SLLKACCGV-GGDYNYGIQNQCGAIGVPVCTDPNTYISWDGVHLTEKAYSWLARWLIDDM  375

Query  1199  LSRIQC  1216
             L ++ C
Sbjct  376   LPKLNC  381



>gb|KDO83163.1| hypothetical protein CISIN_1g037165mg, partial [Citrus sinensis]
Length=386

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 172/328 (52%), Positives = 217/328 (66%), Gaps = 19/328 (6%)
 Frame = +2

Query  215   FGASLHDTGNLIRVGAIGPTLPAARLPYGIT-FPGRPTGRWSDGLLIVDFIARAVGLPLL  391
             FG S+ DTGN IR   +     AARLPYG T F  +PTGRWSDGLL++D+IA  + LPLL
Sbjct  68    FGDSISDTGNQIRDHPV--LYYAARLPYGQTYFHDKPTGRWSDGLLMIDYIAMDLKLPLL  125

Query  392   NPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVP--SITVPLSGQINWLKTYLSSSI  565
             NPYLDKN SF NGVNFAV ASTALD  F A + + V   +   PL  Q+NW KTYL+SS+
Sbjct  126   NPYLDKNTSFNNGVNFAVAASTALDDWFFAARNIPVKWANNNAPLKVQLNWFKTYLNSSV  185

Query  566   CAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQV  745
             C + +DC  +L+RS+  + E G ND ++AL QG++IQEV  ++ DI  ++++AVREVI++
Sbjct  186   CQSNTDCARKLRRSIVIL-ETGSNDYSYALFQGKSIQEVQTYIRDIVGAIVDAVREVIRL  244

Query  746   GGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRK  925
             G  R+VV GT P GC P  L+ F   DPK YD+ GCLR +N          + AL  LR 
Sbjct  245   GAIRVVVTGTLPEGCCPIFLAAFPNSDPKAYDDKGCLRDLNE---------KGALAKLRP  295

Query  926   EFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRN--KVCGSTGV  1099
             EFP A I+YADYYAAF S L RA  LG   + L   CCG+ GG YN+D+N  KVCG+ GV
Sbjct  296   EFPHADIIYADYYAAFLSVLRRAESLGEPSSTL-KACCGT-GGLYNFDKNLTKVCGAPGV  353

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQI  1183
               CPNP Q+I WDG HLTQ   +   +I
Sbjct  354   PVCPNPDQHISWDGTHLTQNNSMYTVEI  381



>ref|XP_007018722.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY15947.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
Length=372

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 215/345 (62%), Gaps = 7/345 (2%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
              C F +IYQ G S+ DTGNLIR     P  P ARLPYG TF    TGR S+GLL++D+IA
Sbjct  31    TCQFDAIYQLGDSISDTGNLIRED---PLSPFARLPYGQTFFKNATGRCSNGLLMIDYIA  87

Query  368   RAVGLPLLNPYLDKNASFTNG--VNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
              + G+P L PYL+ +A FT G  VNFAV  STAL +  LA+  V+ P     LS Q++W+
Sbjct  88    LSAGIPFLEPYLNSDALFTRGRGVNFAVAGSTALPVETLAENNVLAPVTNSSLSRQLDWM  147

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
              +Y +  IC    DC  +LK +LF VGEIG ND  +AL QG+T  EV + +P +  ++ +
Sbjct  148   FSYFNG-ICRDEEDCVKKLKTALFMVGEIGGNDYNYALFQGKTFDEVRSMIPKVIQAIKD  206

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
             AV  V+  G  R++VPG FP+GC P  LS F + D   YD   CL+ +NNL I  N  L+
Sbjct  207   AVARVVGYGATRVIVPGNFPIGCLPIYLSGFQSSDSTAYDRFHCLKGLNNLAIHHNKLLK  266

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
              A+  LRK+ P+A+I+Y DYY A+Q  L +  LLGF        CCG  GG Y++   ++
Sbjct  267   HAIKELRKDLPNAIIVYGDYYNAYQKLLRKVELLGFDTKSTQKACCGI-GGDYDFSLTRM  325

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             CG+ GV  C NP QY+ WDGVHLTQKA+  ++  +I +I  ++QC
Sbjct  326   CGAPGVPVCSNPDQYVSWDGVHLTQKAYKFMAGWLIHHIYPQLQC  370



>ref|XP_009757390.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Nicotiana sylvestris]
Length=372

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 228/380 (60%), Gaps = 10/380 (3%)
 Frame = +2

Query  77    MLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRV  256
             M  L+ LP L+    ++  L  +++ S  + +      C  +S+YQFG SL D GN+IR 
Sbjct  1     MASLISLPKLSFFLLLIITLAFFSSPSAAQTK------CNIKSVYQFGDSLADAGNVIRT  54

Query  257   GAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVN  436
                     A R PYG TF  RPTGR+SDG +I+D+I  A+ L  LN YLD   +F+ GVN
Sbjct  55    PGANIIFRANRAPYGETFFKRPTGRFSDGRIIIDYITSALKLSFLNAYLDSGNTFSQGVN  114

Query  437   FAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFF  616
             FAV  +T L+  F A + V +P+   PL+ Q+ W K++L S+ C   S+C   L  SL  
Sbjct  115   FAVAGATTLNSSFWAARNVRLPAWNTPLAAQLGWFKSHLQST-CG--SNCAQTLSNSLVV  171

Query  617   VGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFP  796
             +GE G ND      Q + + EV  +VP +   ++  +++VIQ+G  RI+VPG FPLGC P
Sbjct  172   MGEWGGNDYYNNFFQRKQLPEVRTYVPFVVAGIMRGIKDVIQLGATRILVPGFFPLGCLP  231

Query  797   NLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQ  976
               L+ F   +   YD+ GCLR+ N+   + + +L + L +LR+EFP   I+Y DY  AF 
Sbjct  232   LYLTTFPDTNANAYDQFGCLRNYNDFASYHHRYLNRGLDNLRREFPSVRIVYGDYNGAFL  291

Query  977   SFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQ  1156
             + L  A   GF+QN L   CCG+ GG+YN++ + VCGS  V +C NP QY+HWDG+HLT 
Sbjct  292   TLLQSATSFGFNQNTLLAACCGT-GGRYNFNFSNVCGSASVRACSNPAQYVHWDGIHLTD  350

Query  1157  KAHLAISQIVIPNILSRIQC  1216
             +AH  I+ I++ ++LSR+ C
Sbjct  351   EAHRRITDIIVKDMLSRLGC  370



>ref|XP_004979339.1| PREDICTED: acetylajmalan esterase-like [Setaria italica]
Length=384

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/333 (46%), Positives = 212/333 (64%), Gaps = 4/333 (1%)
 Frame = +2

Query  182   VVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDF  361
                C   +IY FG S+ DTGNL+R G +G        PYG T   +PTGR SDGLLI+D+
Sbjct  34    AAACSVDAIYSFGDSIADTGNLLREGPVGFFASIGSYPYGQTLR-KPTGRCSDGLLIIDY  92

Query  362   IARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
              A A+ L L++PY+DK A F +GVNFAV  +TALD   L Q GV++P  +VP+S Q++W 
Sbjct  93    FAMALNLSLVSPYMDKGADFASGVNFAVAGATALDRAVLLQGGVMMPPASVPISTQLDWF  152

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQG-RTIQEVAAFVPDITTSVI  718
             +++L+++ C +  DC  +L R+LF VGEIG ND  +A  QG R+I+   A+VP +  +++
Sbjct  153   RSHLNAT-CGSQEDCAKKLARALFLVGEIGGNDYNYAFFQGIRSIEATKAYVPQVIKTIM  211

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
             N  +EVI++G  +I++PG FP+GC P+ LS F      D D+ GCL+S N      N  L
Sbjct  212   NVAKEVIELGATQIIIPGNFPIGCSPSYLSLFSVSGTGDLDDRGCLKSYNAFAQHHNEQL  271

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             Q A+  LRK   D  I+YADYY AF   L  A +LGF Q  L   CCG+GG  YN++ N 
Sbjct  272   QAAIDDLRKANTDVTIIYADYYGAFMHLLDHASILGFDQGSLLQACCGAGGA-YNFNMNL  330

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             +CG+ G  +C NP   + WDG+HLTQ+A+ AI+
Sbjct  331   MCGTPGTSTCANPAHRVSWDGIHLTQQAYRAIA  363



>ref|XP_004230198.1| PREDICTED: GDSL esterase/lipase At5g03980 [Solanum lycopersicum]
Length=377

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/343 (43%), Positives = 217/343 (63%), Gaps = 4/343 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F  IYQFG S+ DTGN IR           + PYG+ F    TGR SDG+L++DFIA 
Sbjct  36    CRFDKIYQFGDSISDTGNCIREPLCESHSDCRKHPYGMNFYENATGRCSDGMLMIDFIAL  95

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSGQINWLKT  547
               GLPLLNPY D+ A+F +GVNFAV   T +    + +  +   + T   L+ Q++W+ +
Sbjct  96    ESGLPLLNPYKDRIANFRHGVNFAVAGCTGISAEIMEENKIFNTAFTNSSLTVQLDWMSS  155

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             +  ++     +DC+ +LK+SL  VGEIG N+  + L+QG++I+E+   VP +  ++I+ V
Sbjct  156   HFENT---WNTDCRKKLKKSLVLVGEIGGNEFNYGLLQGKSIEELRKMVPIVIQTIIHGV  212

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             + VI  G  RI+VPG FP+GC P  L++F T D   YDE  CL+ +NN +IF NNHLQQA
Sbjct  213   KRVIDFGATRIIVPGNFPIGCVPIFLTRFMTDDSNAYDEHHCLKDLNNFSIFFNNHLQQA  272

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  ++K+ P+  ++Y DYY AF  FL  A   GF +N L   CCGSGGG YNY+  + CG
Sbjct  273   IDEMKKKHPNITLIYGDYYNAFMWFLQNAVGFGFDKNSLLKACCGSGGGDYNYNIRRRCG  332

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
               GV  C NP  YI+WDG+H+TQ+A+  +++ +I ++L ++ C
Sbjct  333   FPGVEVCANPSTYINWDGIHMTQEAYKYLAKWLIDDMLPQLNC  375



>ref|XP_009608978.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Nicotiana tomentosiformis]
Length=371

 Score =   317 bits (813),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/380 (42%), Positives = 231/380 (61%), Gaps = 11/380 (3%)
 Frame = +2

Query  77    MLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRV  256
             M  L+ LP ++  + +L     +++ S  + +      C  RS+YQFG SL D GN+IR 
Sbjct  1     MASLISLPKVSF-FLLLITFAFFSSPSAAQTK------CNIRSVYQFGDSLADAGNVIRT  53

Query  257   GAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVN  436
                     A R PYG TF  RPTGR+SDG +I+D+I+ A+ L  LN YLD +  F+ GVN
Sbjct  54    PGANIIFRANRAPYGETFFKRPTGRFSDGRIIIDYISSALKLSFLNAYLDSDNVFSQGVN  113

Query  437   FAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFF  616
             FAV  +T L+  F A + V +P+   PL+ Q+ W K++L S+ C   S+C   L  SL  
Sbjct  114   FAVAGATTLNSSFWAARNVRLPAWNTPLANQLGWFKSHLQST-CG--SNCAQTLSNSLVV  170

Query  617   VGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFP  796
             +GE G ND      Q + + EV  +VP +   ++  +++VIQ+G  RI+VPG FPLGC P
Sbjct  171   MGEWGGNDYYNNFFQRKQLPEVRTYVPFVVAGIMRGIKDVIQLGATRILVPGFFPLGCLP  230

Query  797   NLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQ  976
               L+ F   +   YD+LGCLR+ N+   + + +L + L +LR+EFP+  I+Y DY  AF 
Sbjct  231   LYLTTFPDTNANAYDQLGCLRNYNDFASYHHRYLNRGLDNLRREFPNVGIVYGDYNGAFL  290

Query  977   SFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQ  1156
             + L  A   GF+QN L   CCG+ GG+YN++ + VCGS  V +C NP QY+HWDG+HLT 
Sbjct  291   TVLQSASSFGFNQNTLLTACCGT-GGRYNFNFSNVCGSASVRACSNPAQYVHWDGIHLTD  349

Query  1157  KAHLAISQIVIPNILSRIQC  1216
             +AH  I+ I++ ++LSR+ C
Sbjct  350   EAHRRITDIIVKDMLSRLGC  369



>ref|XP_004171165.1| PREDICTED: acetylajmalan esterase-like, partial [Cucumis sativus]
Length=356

 Score =   317 bits (811),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 163/346 (47%), Positives = 218/346 (63%), Gaps = 9/346 (3%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF-PGRPTGRWSDGLLIVDFIA  367
             C F  IYQ G S+ DTGNLIR     P  P + LPYG TF    PTGR S+GLLI+D+ A
Sbjct  14    CNFDGIYQLGDSISDTGNLIREN---PNTPFSHLPYGQTFFNSTPTGRCSNGLLIIDYFA  70

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
                 LPL+NPYL+K+A   +G+NFAV  STAL    L++K +        L  Q++W+ +
Sbjct  71    LDARLPLVNPYLNKDALTRHGINFAVAGSTALSSELLSKKKISSLLTNSSLDLQLDWMFS  130

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC  P DC ++LK +LF VGEIG ND  +AL+QG+TI+EV   VP++  ++ NAV
Sbjct  131   HFNS-ICYDPKDCDEKLKNALFLVGEIGANDYNYALLQGKTIEEVKEMVPEVVQAIKNAV  189

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDP---KDYDELGCLRSINNLTIFRNNHL  898
               VI  G  R+VV G FP+GCFP  L+ F T +     +YDE  CL+S+N L  + N+ +
Sbjct  190   ERVISYGATRVVVSGNFPIGCFPISLTVFQTNNTTAYDEYDEYHCLKSLNALASYHNDQI  249

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             +QA+  L+KE    VI+Y DYY AF   L RA +LGF    L  +CCG  GG YN+D  +
Sbjct  250   KQAIEVLKKENLHTVIVYGDYYNAFLWILRRASMLGFDNGSLQKSCCGI-GGDYNFDLKR  308

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              CG+ GV  CPNP + I WDGVHLTQKA+  I+  +I NI  ++ C
Sbjct  309   TCGNNGVGVCPNPDKVISWDGVHLTQKAYKYIADWLILNISPKLNC  354



>emb|CDM82009.1| unnamed protein product [Triticum aestivum]
Length=373

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 215/334 (64%), Gaps = 5/334 (1%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
              C   +IY FG S+ DTGNL+R G +G        PYG T+  +PTGR SDGLLI+D+ A
Sbjct  27    ACSIDAIYSFGDSIADTGNLLREGPVGFFSSIGSYPYGQTYR-KPTGRCSDGLLIIDYFA  85

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
              A+ LPL+NPYLDK+A F+ GVNFAV  +TALD  +L Q  +V+P    PLS Q++W K+
Sbjct  86    MALDLPLVNPYLDKSADFSGGVNFAVAGATALDRTYLLQNAIVMPPGNTPLSSQLDWFKS  145

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             +L+ +      DC  +L  +LF VGEIG ND  +A  Q R+I+ V A+VP +  S+++  
Sbjct  146   HLNDTC---QQDCAKKLAGALFLVGEIGGNDYNYAFFQKRSIEAVKAYVPLVVKSIMDVA  202

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             +EVI++G  +I++PG FP+GC P+ LS F      D+DE GCL+S N    + N  LQ A
Sbjct  203   KEVIELGATQIIIPGNFPIGCSPSYLSLFSAAGSTDHDERGCLKSYNAFAAYHNEQLQAA  262

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  LRK   D  ++YADYY AF   L  A +LGF +  L   CCG+ GG++N+D + +CG
Sbjct  263   IVDLRKVNADVSVVYADYYGAFLHLLDHASVLGFDEGSLLKACCGA-GGEHNFDMDMMCG  321

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
               G  +C +P +++ WDG+HLTQ+A+ A++  ++
Sbjct  322   GLGASTCADPARHVSWDGIHLTQQAYRAMALSIL  355



>ref|XP_009765904.1| PREDICTED: acetylajmalan esterase-like isoform X1 [Nicotiana 
sylvestris]
Length=382

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/346 (44%), Positives = 216/346 (62%), Gaps = 4/346 (1%)
 Frame = +2

Query  179   KVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVD  358
             +++ C F  I+Q G SL DTGN IR           R PYG+ F    TGR S+G+L++D
Sbjct  39    RLMKCRFDKIFQLGDSLSDTGNCIRENLCARGFLCGRFPYGMNFFQNTTGRCSNGMLMID  98

Query  359   FIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             FIA   GLPLLNPY  +NA+F +G NFAV  +TAL    LA++ +V       LS Q++W
Sbjct  99    FIALESGLPLLNPYKLQNANFKHGANFAVAGATALSTENLAEEKIVNSVTNSSLSVQLDW  158

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
             + T+  S+    P+D   +LK+SLF VGEIG N+  + L +G+T++E+ + VP +  ++I
Sbjct  159   MSTHFKSTY---PTDRLSKLKKSLFLVGEIGGNEFNYGLFKGKTLKELRSMVPKVVQTII  215

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
               VR VI  G  RI+VPG FP+GC P  L+QF T D   YDE  CL+ +N+L IF N+HL
Sbjct  216   QGVRTVISFGATRIIVPGNFPIGCLPIFLTQFRTSDSTAYDEYHCLQDLNDLAIFFNDHL  275

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             +QA+  L++E  +  ++Y DYY A+   L  A  LGF +N L   CCG  GG YNYD + 
Sbjct  276   KQAIQELKEEHSNIALVYGDYYNAYMWLLQNAMFLGFDKNSLLKACCGI-GGDYNYDVHN  334

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              CG+ GV  C +P  YI WDGVHLT+K +  +++ +I ++L ++ C
Sbjct  335   QCGAIGVSVCTDPSTYISWDGVHLTEKTYSWLARWLIDDMLPKLNC  380



>ref|XP_004159174.1| PREDICTED: acetylajmalan esterase-like [Cucumis sativus]
Length=370

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 220/343 (64%), Gaps = 6/343 (2%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F +IYQ G S+ DTGNLIR        P + LPYG +F   PTGR S+GLL++DF+A 
Sbjct  31    CMFDAIYQLGDSISDTGNLIRENL---NTPFSHLPYGQSFFNNPTGRCSNGLLMLDFLAL  87

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQK-GVVVPSITVPLSGQINWLKT  547
               GLPL++PYL+K+    +GVNFAV  STAL   +L+    ++ P     L  Q++W+ +
Sbjct  88    DAGLPLVSPYLNKDGLMDHGVNFAVAGSTALPSQYLSSSYKIISPVTNSSLDHQLDWMFS  147

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC    +C ++L+ +LF VGEIG ND  +AL QG+TIQE    VPD+  ++ +AV
Sbjct  148   HFNS-ICHNQRECNEKLRSALFLVGEIGGNDYNYALFQGKTIQEAKDMVPDVVQTIKSAV  206

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
              +VI  G  R+VVPG FP+GCFP  L+ F T D   YDEL CL+ +N+   + N+ ++QA
Sbjct  207   EKVISYGATRVVVPGNFPIGCFPIYLTGFHTNDTSAYDELHCLKDLNSFATYHNDQIKQA  266

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L+KE P A+I+Y DYY AF   +  A +LGF +  L  +CCG  GG Y ++  ++CG
Sbjct  267   IEVLKKENPHAIIVYGDYYNAFLWIIRHAFVLGFDEESLQKSCCGI-GGDYKFNLMQMCG  325

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
               GV +CPNP ++I WDGVHLTQK +  ++  +I +I  ++ C
Sbjct  326   VAGVEACPNPNEHISWDGVHLTQKTYKFMTHWLIHDIFPKLHC  368



>gb|KHG07034.1| Acetylajmalan esterase [Gossypium arboreum]
Length=371

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/345 (47%), Positives = 213/345 (62%), Gaps = 7/345 (2%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
              C F +IYQ G S+ DTGNLIR     P  P ARLPYG TF    TGR S+GLLI+DF+A
Sbjct  30    TCKFDAIYQLGDSISDTGNLIREH---PFSPFARLPYGGTFFKHATGRCSNGLLIIDFLA  86

Query  368   RAVGLPLLNPYLDKNASFTNG--VNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
              + G+P L PYL+ NA FT G  VNFAV  STAL +  LA  GVV P     LS Q++W+
Sbjct  87    LSAGIPFLQPYLNSNALFTRGRGVNFAVAGSTALPVETLADNGVVAPVTNSSLSRQLDWM  146

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
              T+ +  IC    DC ++LK +LF VGEIG ND  +AL QG++  +V + +P +  ++ +
Sbjct  147   FTHFNG-ICHDEDDCLEKLKTALFIVGEIGGNDYYYALFQGKSFDQVRSMMPLVIQAIKD  205

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
             AV  V+  G  R++VPG FP+GCFP  L+ F + D   YD   CL+ +NNL+   N  L+
Sbjct  206   AVTRVVGYGATRVIVPGNFPIGCFPVHLTVFRSNDSDAYDGFNCLKDLNNLSSHHNGLLK  265

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
             QA+  LRKE P A ILY DYY  +   L +A  LG   N     CCG  GG YN + NK+
Sbjct  266   QAIKELRKELPHATILYGDYYNGYMRLLNKAKFLGLDPNSTQKACCGI-GGDYNMELNKM  324

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             CG+  V  C NP +YI WDGVHLTQKA+  IS  +I  +  +++C
Sbjct  325   CGAAEVGVCKNPDEYISWDGVHLTQKAYQLISGWLIHGVYWKLRC  369



>ref|XP_009629651.1| PREDICTED: acetylajmalan esterase {ECO:0000303|PubMed:16133216}-like 
[Nicotiana tomentosiformis]
Length=348

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/341 (45%), Positives = 217/341 (64%), Gaps = 5/341 (1%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             FRS+YQ G SL D GN+IR         A + PYG TF  RPTGR+S+G +I+D+I+ A 
Sbjct  10    FRSVYQLGDSLADAGNVIRTPGASIIFRANQAPYGETFFRRPTGRFSNGRIIIDYISSAF  69

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLS  556
              L  LN YLD+ ASF+ GVNFAV  +TAL+  F A +G+ +P+   PL+ Q+ W K++L 
Sbjct  70    KLSFLNAYLDRGASFSQGVNFAVAGATALNSSFWAARGIRLPTWNTPLAAQLGWFKSHLQ  129

Query  557   SSICAAPSDCKDRLKRS-LFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
             S+ C   S+C   L+ S L  +GE G ND      Q + + EV  +VP +   ++ ++++
Sbjct  130   ST-CG--SNCAQTLRSSSLIVMGEWGGNDYYNGFFQKKQLPEVRTYVPFVVAGIMKSIKD  186

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALG  913
             VIQ+G  RI+VPG +PLGC P  L+ F   +   YD+LGCLR+ N+   + N +L + L 
Sbjct  187   VIQLGATRILVPGIYPLGCLPLYLTSFPDSNANGYDQLGCLRNYNDFASYHNRYLTRGLA  246

Query  914   SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGST  1093
             SL++EFP+  I+Y DYY A  + L  A   GF+QN L   CCG+ GG+YN++   VCGS 
Sbjct  247   SLQREFPNVRIVYGDYYGALLTLLRSASSFGFNQNTLLTACCGT-GGRYNFNFRTVCGSA  305

Query  1094  GVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              V +C NP QY+HWDG+HLT +AH  ++ IV+ ++LSR  C
Sbjct  306   SVRACSNPAQYVHWDGIHLTDEAHRHMTDIVVKDMLSRFGC  346



>ref|XP_011073879.1| PREDICTED: acetylajmalan esterase-like [Sesamum indicum]
Length=300

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/277 (56%), Positives = 200/277 (72%), Gaps = 6/277 (2%)
 Frame = +2

Query  179   KVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVD  358
             K + CP + +YQFG S+ DTGN +R   I P LPA+R PYG TFPG+PTGRWSDG LI+D
Sbjct  27    KKMGCPVQPLYQFGDSISDTGNSVR---IVPALPASRRPYGETFPGKPTGRWSDGRLIID  83

Query  359   FIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             +IA A+GLPLLNPYL+K ASF+NGVNFAV ++T LD  F + KG+++P +   L+ Q+++
Sbjct  84    YIAMALGLPLLNPYLNKTASFSNGVNFAVASATTLDPSFYSAKGIIIPPLPA-LASQLSY  142

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEV-AAFVPDITTSV  715
              KTYL SSIC+ P+DC D+LK SLFFVGE G NDI +   QGR+++E+   FVP +   +
Sbjct  143   FKTYL-SSICSTPTDCADKLKGSLFFVGEFGYNDIYYPYTQGRSVEEIQTTFVPLVNQLI  201

Query  716   INAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNH  895
             IN+ RE+IQ+G  ++VVPG FPLGCFP  LS         YD+ GC  S+N+LT + NN 
Sbjct  202   INSTRELIQLGVSQVVVPGNFPLGCFPTFLSVARRNRSTAYDDFGCAESLNDLTSYENND  261

Query  896   LQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLG  1006
             LQ+AL SLR EFP+ VILYADYY AF S L +A   G
Sbjct  262   LQRALNSLRMEFPNTVILYADYYNAFLSLLRQATTFG  298



>ref|XP_011071662.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Sesamum indicum]
Length=376

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 221/343 (64%), Gaps = 5/343 (1%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             +C F  IYQ G S+ DTGNLIR   IG + P ARLPYG TF    TGR S+GLL++D+IA
Sbjct  37    ICNFDQIYQLGDSISDTGNLIREFPIGSSTPFARLPYGETFFKNATGRCSNGLLMIDYIA  96

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
                GLP L  Y D++A F +GVNFAV  STAL    LA K ++ P  T  L+ Q+ W+ T
Sbjct  97    LDAGLPFLPAYKDRDADFKHGVNFAVAGSTALPSHVLAAKHILSPVTTSSLTIQLGWMST  156

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC    +C ++L+ +LF VGEIG ND  +A+ QG+T+ E+ + VP++  ++INAV
Sbjct  157   HFNS-ICLHHRECAEKLQTALFMVGEIGGNDYNYAIFQGKTMDELQSMVPEVVHAIINAV  215

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             R VI  G  R+VVPG FP+GC P   + F T     YDE  CL+ +N+  ++ N  LQQA
Sbjct  216   RRVISFGATRVVVPGNFPIGCLPIYKTAFHTNKLAAYDENRCLKQLNDFAMYHNEQLQQA  275

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L++E P+A+I+YADYY A+Q  L  A   GF   +    CCGS GG+Y+++  ++CG
Sbjct  276   IEKLQQEHPNAIIVYADYYNAYQYLLHFAKSHGFDTER---ACCGS-GGKYSFNMTRMCG  331

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + GV  C +P +++ WDGVHLTQ+ +  ++  ++ +I + + C
Sbjct  332   APGVGVCADPGRFLSWDGVHLTQQGYKIMAGWLVHDIFTNLHC  374



>ref|XP_004158757.1| PREDICTED: acetylajmalan esterase-like [Cucumis sativus]
Length=371

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/343 (45%), Positives = 216/343 (63%), Gaps = 6/343 (2%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F +IYQ G S+ DTGNLIR     P  P + LPYG +F   PTGR S+GLL++DF A 
Sbjct  31    CMFDAIYQLGDSISDTGNLIREN---PNTPFSHLPYGQSFFNNPTGRCSNGLLMLDFFAL  87

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQK-GVVVPSITVPLSGQINWLKT  547
               GLPL+ PYL+K+    +GVNFAV  STAL   +L+    ++ P     L  Q+ W+ +
Sbjct  88    DAGLPLVTPYLNKDGWMDHGVNFAVAGSTALPSQYLSTNYKILSPVTNSSLDHQLEWMFS  147

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC    DC ++L+ +LF VGEIG ND  +AL QG+TIQE    VPD+  ++ +AV
Sbjct  148   HFNS-ICHDQRDCNEKLRSALFLVGEIGGNDYNYALFQGKTIQEAKHMVPDVVRTIKSAV  206

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
              +VI  G  R+VVPG FP+GCFP  L+ F T D   YDEL CL+ +N L  + N+ ++Q 
Sbjct  207   EKVISYGATRVVVPGNFPIGCFPIYLTGFHTNDTSAYDELHCLKDLNGLATYHNDQIKQT  266

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L+KE P  VI+Y DYY AF   +  A +LG+ +  L  +CCG  GG Y ++  K+CG
Sbjct  267   IEVLKKENPQTVIVYGDYYNAFLWVIRHAFVLGYDEESLQKSCCGI-GGDYKFNLMKMCG  325

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + GV +CPNP ++I WDGVHLTQ  +  ++  +I +I  ++ C
Sbjct  326   AAGVEACPNPNEHISWDGVHLTQNTYKFMTHWLIHHIFPKLHC  368



>ref|XP_004230194.1| PREDICTED: acetylajmalan esterase-like isoform X1 [Solanum lycopersicum]
Length=375

 Score =   316 bits (809),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/350 (45%), Positives = 220/350 (63%), Gaps = 5/350 (1%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             +N +++ C F  IYQFG SL DTGN IR    G TL    LPYG+ F    TGR S+G+L
Sbjct  28    QNPRLLNCRFDKIYQFGDSLSDTGNCIRETLCGATLSCGTLPYGMDFYQNATGRCSNGML  87

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSG  526
             I+DFIA   GLPLLNP+ D+NA F +GVNFAV  STAL    LA+K +V  ++T   LS 
Sbjct  88    IIDFIAVESGLPLLNPFKDENADFRHGVNFAVAGSTALSAKSLAEKNIVNIALTNSSLSV  147

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ ++  ++      DC ++L +SLF VGEIG N+  + L QG+++ E    VP+I 
Sbjct  148   QLDWMSSHFQTT---CSPDCPEKLNKSLFLVGEIGGNEFIYGLSQGKSMDESRKMVPEIV  204

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I+ V  +I  G  +I+VPG FP+GC P  L++F T     YDE  CL+ +NN  IF 
Sbjct  205   QTIIHGVERIIGFGATQIIVPGNFPIGCHPIFLTKFMTNISTAYDEYHCLKELNNFAIFF  264

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N +LQQA+  L+K++P+  ++Y DYY AF   L  A  LGF    L   CCG  GG+YNY
Sbjct  265   NRYLQQAIDELKKDYPNITLIYGDYYNAFLWLLQNADGLGFDNKSLQKACCGI-GGEYNY  323

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             D ++ CG+  V  C +P  +I WDGVHLTQ A+  I++ +I + L ++ C
Sbjct  324   DVHRRCGAPRVPVCVDPSTHISWDGVHLTQNAYRWIARWLIDDTLPKLNC  373



>ref|XP_009797172.1| PREDICTED: acetylajmalan esterase-like [Nicotiana sylvestris]
Length=382

 Score =   315 bits (808),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 220/347 (63%), Gaps = 5/347 (1%)
 Frame = +2

Query  179   KVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVD  358
             +++ C F  IYQ G SL DTGN IR    G     AR PYG+ F    TGR S+G+L++D
Sbjct  38    RLINCKFDKIYQLGDSLADTGNCIRERVCGAHTLCARFPYGMNFFQNATGRCSNGMLMID  97

Query  359   FIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             FIA   GLPLLNP  D+ A F +G +FAV  +TAL +  L    +V PS    LS Q++W
Sbjct  98    FIALESGLPLLNPIKDQTADFRHGADFAVAGATALPVEILENMKMVNPSTNSSLSVQLDW  157

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
             + ++  ++     +DC D++K++LF VG IG N+  FAL QG+T++E    VP++  ++I
Sbjct  158   MSSHFENTF---YTDCPDKVKKALFLVGGIGGNEFNFALSQGKTLEESRTIVPEVVEAII  214

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
             + VR VI  G  RIVVPG FP GCFP +L++F T +   YDE  CL+  N+L IF N+HL
Sbjct  215   HGVRRVISFGATRIVVPGNFPGGCFPIILTRFMTDNSSAYDEHHCLKDFNSLIIFFNDHL  274

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             +QA+  L+KE+P+  ++Y DYY A+   L  A  LGF +N L+  CCG  GG YNY+ + 
Sbjct  275   RQAILDLKKEYPNITLIYGDYYNAYLWLLQNAVSLGFDKNSLHKACCGI-GGDYNYNLHN  333

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIP-NILSRIQC  1216
              CG+ GV  C +P  YI WDG HLTQ+A+  +++ +I  NIL ++ C
Sbjct  334   QCGAIGVPVCIDPSTYISWDGAHLTQEAYSWLARWLIDTNILPQLNC  380



>ref|XP_006367845.1| PREDICTED: acetylajmalan esterase-like [Solanum tuberosum]
Length=377

 Score =   315 bits (807),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 154/381 (40%), Positives = 228/381 (60%), Gaps = 11/381 (3%)
 Frame = +2

Query  89    MGLPSLTLNYCILCFLLVYAAASGVEN----ENQKVVVCPFRSIYQFGASLHDTGNLIRV  256
             M L    + + IL  LL++   S  +     E  ++  C    IYQFG S+ DTGN IR 
Sbjct  1     MALTVSIIFHVILVCLLIFQQKSDAQEIIKLEKPRLRNCKIDRIYQFGDSISDTGNCIRE  60

Query  257   GAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVN  436
                         PYGI F    TGR SDG++++DFIA   GLPLLNPY D++A+F +GVN
Sbjct  61    PLCQSHSDCGSHPYGINFYQNATGRCSDGMIMIDFIALESGLPLLNPYKDRSANFRHGVN  120

Query  437   FAVTASTALDIGFLAQKGVVVPSIT-VPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLF  613
             FAV   T +    +A+  +   + T   L+ Q++W+ ++  ++          +LK+SLF
Sbjct  121   FAVAGCTGISAEIMAENKIFNTAFTNSSLTVQLDWMSSHFETTCTIG------KLKKSLF  174

Query  614   FVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCF  793
              VGEIG N+  + L+QG+TI+E+   VP +  ++I+ V+ VI  G  RI+VPG FP+GC 
Sbjct  175   LVGEIGGNEFNYGLLQGKTIEELRRMVPTVVQTIIHGVKRVIDFGATRIIVPGNFPIGCV  234

Query  794   PNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAF  973
             P  L++F T +   YDE  CL+ +NN +IF NNHLQQA+  ++K+ P+  ++Y DYY A+
Sbjct  235   PIFLTRFMTDNSNAYDEYHCLKDLNNFSIFFNNHLQQAIDEMKKKHPNITLIYGDYYNAY  294

Query  974   QSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLT  1153
                L  A   GF +N L   CCG+GGG YNY+  K CG  GV  C NP  YI+WDG+H+T
Sbjct  295   MWLLQNAVRFGFDKNSLQKACCGTGGGDYNYNIRKRCGFPGVEVCANPSTYINWDGIHMT  354

Query  1154  QKAHLAISQIVIPNILSRIQC  1216
             Q+A+  +++ +I ++L ++ C
Sbjct  355   QEAYKYLARWLIDDMLPQLNC  375



>ref|XP_011097738.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Sesamum indicum]
Length=376

 Score =   315 bits (807),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 220/343 (64%), Gaps = 5/343 (1%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             +C F  IYQ G S+ DTGNLIR   IG +   ARLPYG TF    TGR S+GLL++D+IA
Sbjct  37    ICNFDQIYQLGDSISDTGNLIREFPIGSSTSFARLPYGETFFKNATGRCSNGLLMIDYIA  96

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
                GLP L  Y D++A F +GVNFAV  STAL    LA K ++ P  T  L+ Q+ W+ T
Sbjct  97    LDAGLPFLPAYKDRDADFKHGVNFAVAGSTALPSHVLAAKHILSPVTTSSLTIQLGWMST  156

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC    +C ++L+ +LF VGEIG ND  +A+ QG+T+ E+ + VP++  ++INAV
Sbjct  157   HFNS-ICLHHRECAEKLQTALFMVGEIGGNDYNYAIFQGKTMDELQSMVPEVVHAIINAV  215

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             R VI  G  R+VVPG FP+GC P   + F T     YDE  CL+ +N+  ++ N  LQQA
Sbjct  216   RRVISFGATRVVVPGNFPIGCLPIYKTAFHTNKSAAYDENRCLKQLNDFAMYHNEQLQQA  275

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L++E P+A+++YADYY A+Q  L  A   GF   +    CCGS GG+Y+++  ++CG
Sbjct  276   IEKLQQEHPNAIVVYADYYNAYQHLLHFAKSHGFDTER---ACCGS-GGKYSFNMTRMCG  331

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + GV  C +P +++ WDGVHLTQ+ +  ++  ++ +I + + C
Sbjct  332   APGVGVCADPGRFLSWDGVHLTQEGYKIMAGWLVHDIFTNLHC  374



>ref|XP_004144819.1| PREDICTED: acetylajmalan esterase-like, partial [Cucumis sativus]
Length=359

 Score =   314 bits (805),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 162/346 (47%), Positives = 216/346 (62%), Gaps = 9/346 (3%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF-PGRPTGRWSDGLLIVDFIA  367
             C F  IYQ G S+ DTGNLIR     P  P + LPYG TF    PTGR S+GLLI+D+ A
Sbjct  17    CNFDGIYQLGDSISDTGNLIREN---PNTPFSHLPYGQTFFNSTPTGRCSNGLLIIDYFA  73

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
                 LPL+NPYL+K+A   +G+NFAV  STAL    L++K +        L  Q++W+ +
Sbjct  74    LDARLPLVNPYLNKDALTRHGINFAVAGSTALSSELLSKKKISSLLTNSSLDLQLDWMFS  133

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC    DC ++LK +LF VGEIG ND  +AL+QG+TI+EV   VP++  ++ NAV
Sbjct  134   HFNS-ICYDQKDCDEKLKNALFLVGEIGANDYNYALLQGKTIEEVKEMVPEVVQAIKNAV  192

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELG---CLRSINNLTIFRNNHL  898
               VI  G  R+VV G FP+GCFP  L+ F T +  DYDE     CL+S+N L  + N+ +
Sbjct  193   ERVISYGATRVVVSGNFPIGCFPISLTVFQTNNTTDYDEYDEYHCLKSLNALASYHNDQI  252

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             +Q +  L+KE    VI+Y DYY AF   L RA +LGF    L  +CCG  GG YN+D  +
Sbjct  253   KQVIEVLKKENLHTVIVYGDYYNAFLWILRRASMLGFDNGSLQKSCCGI-GGDYNFDLKR  311

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              CG+ GV  CPNP + I WDGVHLTQKA+  I+  +I NI  ++ C
Sbjct  312   TCGNNGVGVCPNPDKVISWDGVHLTQKAYKYIADWLILNISPKLNC  357



>ref|XP_011097730.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Sesamum indicum]
Length=376

 Score =   315 bits (807),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 220/343 (64%), Gaps = 5/343 (1%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             +C F  IYQ G S+ DTGNLIR   IG +   ARLPYG TF    TGR S+GLL++D+IA
Sbjct  37    ICNFDQIYQLGDSISDTGNLIREFPIGSSTSFARLPYGETFFKNATGRCSNGLLMIDYIA  96

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
                GLP L  Y D++A F +GVNFAV  STAL    LA K ++ P  T  L+ Q+ W+ T
Sbjct  97    LDAGLPFLPAYKDRDADFKHGVNFAVAGSTALPSHVLAAKHILSPVTTSSLTIQLGWMST  156

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC    +C ++L+ +LF VGEIG ND  +A+ QG+T+ E+ + VP++  ++INAV
Sbjct  157   HFNS-ICLHHRECAEKLQTALFMVGEIGGNDYNYAIFQGKTMDELQSMVPEVVHAIINAV  215

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             R VI  G  R+VVPG FP+GC P   + F T     YDE  CL+ +N+  ++ N  LQQA
Sbjct  216   RRVISFGATRVVVPGNFPIGCLPIYKTAFHTNKSAAYDENRCLKQLNDFAMYHNEQLQQA  275

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L++E P+A+I+YADYY A+Q  L  A   GF   +    CCGS GG+Y+++  ++CG
Sbjct  276   IEKLQQEHPNAIIVYADYYNAYQYLLHFAKSHGFDTER---ACCGS-GGKYSFNMTRMCG  331

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + GV  C +P +++ WDGVHLTQ+ +  ++  ++ +I + + C
Sbjct  332   APGVGVCADPGRFLSWDGVHLTQEGYKIMAGWLVHDIFTNLHC  374



>ref|NP_001152155.1| esterase precursor [Zea mays]
 gb|ACG46092.1| esterase precursor [Zea mays]
 tpg|DAA42003.1| TPA: esterase [Zea mays]
Length=386

 Score =   315 bits (807),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 210/333 (63%), Gaps = 5/333 (2%)
 Frame = +2

Query  182   VVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDF  361
                C   +IY FG S+ DTGNL+R G +G        PYG T   +PTGR SDGLLI+D+
Sbjct  37    AAACSVDAIYSFGDSIADTGNLLREGPVGFFASIGSYPYGQTLR-KPTGRCSDGLLIIDY  95

Query  362   IARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
              A A+ L L++PYLDK A F +G NFAV  +TALD   L Q G++ P  +VPLS Q++W 
Sbjct  96    FAMALNLSLVSPYLDKGADFASGANFAVAGATALDRAVLLQSGIMAPPASVPLSSQLDWF  155

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQG-RTIQEVAAFVPDITTSVI  718
             K +L+++ C +  DC  +L  +LF VGEIG ND  +  +QG R+I+ + A+VP +  +++
Sbjct  156   KAHLNATACPSLQDCAKKLAGALFLVGEIGGNDYNYGFLQGFRSIEAMKAYVPQVINAIM  215

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
             +  +EVI++G  +IV+PG FP+GC P+ LS F      D D+ GCLRS N      N  L
Sbjct  216   DVAKEVIELGATQIVIPGNFPIGCSPSYLSLFAAS--GDLDDRGCLRSYNAFAQHHNEQL  273

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             Q A+  LRK   D  ++YADYY AF   L  A LLGF Q  L   CCG+GG  YN++ N 
Sbjct  274   QAAIDGLRKANTDVTVVYADYYGAFMHLLDHASLLGFEQGALLQACCGAGGA-YNFNMNS  332

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             +CG+ G  +C +P + + WDG+HLTQ+A+ AI+
Sbjct  333   MCGAPGTTTCADPARNVSWDGIHLTQQAYRAIA  365



>ref|XP_009765907.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Nicotiana sylvestris]
Length=380

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/350 (43%), Positives = 221/350 (63%), Gaps = 7/350 (2%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF-PGRPTGRWSDGL  346
             +N ++  C F  +YQ G SL DTGN IR    G     ARLPYG+ F   + TGR S+G+
Sbjct  36    QNPRLTKCGFDKLYQLGDSLADTGNCIRESICGARTACARLPYGMNFFQEKTTGRCSNGM  95

Query  347   LIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSG  526
             LI+DFIA   GLPLLNPY  K+A+F +GVNFAV  +TAL    +A+K +V  +    LS 
Sbjct  96    LIIDFIALGSGLPLLNPYKLKSANFRHGVNFAVAGATALSAEVMAKKKIVNAATNSSLSV  155

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q+ W+ ++  +S     +D   +LK++LF VGE+G ND    L+QG+T++E+   VP++ 
Sbjct  156   QLAWMSSHFKTS-----TDVATKLKKALFLVGEVGGNDFNHGLLQGKTMKELRNMVPEVV  210

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I+ VR VI  G  RI VPG FP+GC P  L++F T++   YDE  CL+ +NN  +F 
Sbjct  211   QTIIHGVRRVIGFGATRIAVPGNFPIGCLPIYLTKFRTKNSTAYDEHHCLKDLNNFAVFY  270

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N+HLQQA+  L+K +P   ++Y DYY A+   L  A  LGF ++ L   CCG  G  YN+
Sbjct  271   NHHLQQAIQDLKKRYPKITLIYGDYYNAYLWLLHNAVSLGFDKSSLQKACCGM-GEDYNF  329

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             +  K+CGS GV  C +P  YI WDG+HLT +A+  +++ +I ++L ++ C
Sbjct  330   NIRKLCGSPGVPICADPSTYIGWDGIHLTHQAYKWLARWLINDMLPKLNC  379



>ref|XP_006367844.1| PREDICTED: acetylajmalan esterase-like [Solanum tuberosum]
Length=375

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/350 (45%), Positives = 219/350 (63%), Gaps = 5/350 (1%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             +N  ++ C F  IYQFG SL DTGN IR    G  L    LPYG+ F    TGR S+G+L
Sbjct  28    QNPLLMNCRFDKIYQFGDSLSDTGNCIRETLCGANLSCGALPYGMDFYQNATGRCSNGML  87

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSG  526
             I+DFIA   GLPLLNPY D+NA F +GVNFAV   TAL    LA   +V  ++T   LS 
Sbjct  88    IIDFIAVESGLPLLNPYKDENADFRHGVNFAVAGCTALSAKSLAGNNIVNIALTNSSLSV  147

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ ++    I  +P DC +++ +SLF VGEIG N+  + L QG+T+ E    VP++ 
Sbjct  148   QLDWMSSHFQ--ITCSP-DCPEKMNKSLFLVGEIGGNEFIYGLSQGKTMDESRRMVPEVV  204

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I+ V+ VI  G  +I+VPG FP+GC P  L++F T     YDE  CL+ +NN  IF 
Sbjct  205   QTIIHGVKRVIGFGATQIIVPGNFPIGCHPIFLTKFMTNISTAYDEYHCLKDLNNFAIFF  264

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N +LQQA+  L+K++P+  ++Y DYY AF   L  A  LGF  N L   CCG  GG+YNY
Sbjct  265   NRNLQQAIDELKKDYPNITLIYGDYYNAFLWLLQNAGSLGFDNNSLQKACCGI-GGEYNY  323

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             D ++ CG+  V  C +P  +I WDGVHLTQ A+  I++ +I +IL ++ C
Sbjct  324   DVHRRCGAPRVPVCVDPSTHISWDGVHLTQNAYRWIARWLIDDILPKLNC  373



>ref|XP_010681318.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/366 (42%), Positives = 224/366 (61%), Gaps = 13/366 (4%)
 Frame = +2

Query  119   CILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPY  298
             C+L  LL      G   E        F +IYQFG S+ DTGN+IR+   GP   +A LPY
Sbjct  18    CVLIGLLCNTTVGGQSKE--------FEAIYQFGDSVSDTGNIIRIA--GPNTASANLPY  67

Query  299   GITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFL  478
             G TF GRPTGR SDGLL++D+ A    LPLLNP+L   + F +G NFAV   TA D   L
Sbjct  68    GQTF-GRPTGRSSDGLLMIDYFAMHFHLPLLNPFLANGSDFGHGANFAVAGGTAQDFATL  126

Query  479   AQKGVVVP-SITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFAL  655
             A + +    +    L+ Q+ W   +L+S IC +P++CK++L+++L  VG IG ND   AL
Sbjct  127   AAQNITYRLANNASLASQLGWFNYHLTS-ICYSPAECKEKLRKALVIVGIIGGNDYNLAL  185

Query  656   VQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKD  835
              QG+T++EV   VP++  ++++AV EVIQ+G   +VVPG+ P GC P+ L +F T D   
Sbjct  186   TQGKTLEEVYQLVPNVVNTILHAVEEVIQLGAVNVVVPGSHPRGCMPSYLVRFETNDSSK  245

Query  836   YDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQ  1015
             YD+L CL+  N  + F N+ L++ +  L+ ++P   I Y DYY+A    L  A  LGF +
Sbjct  246   YDDLRCLKEFNAFSRFHNHKLKRGIKKLKLKYPGVAIAYGDYYSAMTWVLRHAASLGFDE  305

Query  1016  NKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPN  1195
             ++LY TCCG+G   YNYD ++ CGS GV  C +P + ++WDG HLTQ+A+  ++  ++  
Sbjct  306   DELYKTCCGTGNNNYNYDPSRPCGSLGVSVCSDPNKRVNWDGTHLTQQAYKYMASWLLTQ  365

Query  1196  ILSRIQ  1213
              L  +Q
Sbjct  366   FLPALQ  371



>ref|XP_011096137.1| PREDICTED: acetylajmalan esterase-like [Sesamum indicum]
Length=374

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/382 (42%), Positives = 235/382 (62%), Gaps = 13/382 (3%)
 Frame = +2

Query  74    AMLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIR  253
             ++L  + LP L L  C+   +   A A  ++       +C F  IYQ G S+ DTGNLIR
Sbjct  3     SVLHKLVLPVLVLFCCLFSCVPQCANAHPLK-------ICKFDQIYQLGDSISDTGNLIR  55

Query  254   VGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNAS-FTNG  430
                IG     ARLPYG TF    TGR S+GLL++D+IA A GLP L PY + +A+ F +G
Sbjct  56    EIPIGAATAFARLPYGETFFKNATGRCSNGLLMIDYIAMAAGLPFLPPYKNLDAADFEHG  115

Query  431   VNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSL  610
             VNFAV  STAL    LA + +  P  T  L+ Q++W+ T+ +S IC    DC ++L+ +L
Sbjct  116   VNFAVAGSTALPSQVLAAQHIFSPVTTSSLNVQLHWMFTHFTS-ICLNSRDCAEKLQNAL  174

Query  611   FFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGC  790
             F VGEIG ND  +A+ QG+T++E+ + VPD+  ++++A R+VI+VGG+R+V+PG FP+GC
Sbjct  175   FMVGEIGGNDYNYAIFQGKTMEELRSMVPDVVATIVDAARKVIEVGGKRVVIPGNFPIGC  234

Query  791   FPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAA  970
              P   + F T     YD+  CL+ +N+   + N  LQ A+ +L++E P+AVI+Y DYY A
Sbjct  235   LPIYKTAFQTNISAAYDKNHCLKHLNDFAKYHNKELQNAIHTLKQEKPNAVIVYGDYYNA  294

Query  971   FQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHL  1150
             +Q  L  A   GF + +    CCG+ GG+YN++   +CG  G   C NP +Y+ WDGVHL
Sbjct  295   YQFLLRVATSRGFERER---ACCGT-GGKYNFNMTTMCGGAGAKVCSNPERYMSWDGVHL  350

Query  1151  TQKAHLAISQIVIPNILSRIQC  1216
             TQ+ +  +   ++ NI   + C
Sbjct  351   TQQGYKIMVAWLVNNIFPHLLC  372



>ref|XP_006344611.1| PREDICTED: acetylajmalan esterase-like [Solanum tuberosum]
Length=375

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/378 (40%), Positives = 237/378 (63%), Gaps = 12/378 (3%)
 Frame = +2

Query  101   SLTLNYCILCFLLVYAAA--SGVENENQK----VVVCPFRSIYQFGASLHDTGNLIRVGA  262
             +LT+   IL  ++ +     +G   ++QK    ++ C F  IYQ G S+ DTGN +R   
Sbjct  2     ALTIRVLILLIIMSFVVLQLNGDAQKHQKTEGLLMNCRFDKIYQLGNSISDTGNCLREKL  61

Query  263   IGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFA  442
              G      R PYG+ F    TGR SDG+L++DFIAR  GLP LNP+ D+NA F++GVNFA
Sbjct  62    CGTHSSCRRSPYGMNFFHNVTGRCSDGMLMIDFIARESGLPFLNPFKDRNADFSHGVNFA  121

Query  443   VTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVG  622
             V  +TAL +  LA+  + +      LS Q+ W+ ++  S    +P   +++LK+SLF VG
Sbjct  122   VAGATALSVESLAENNIAMSFTNSTLSVQLLWMSSHFKS--IGSP---EEKLKKSLFLVG  176

Query  623   EIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNL  802
             EIG ND  + + QG++I+EV   VP++  ++I+ V+ VI  G  RI++PG FP+GC   +
Sbjct  177   EIGGNDFNYGISQGKSIKEVRKMVPEVVQTIIHGVKRVIDFGATRIIIPGNFPIGCVTAM  236

Query  803   LSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSF  982
             L++F T     YDE  C++ +N+L  + N+HLQQA+  ++K++P+ +++Y DYY A+   
Sbjct  237   LTKFKTNKITAYDEYHCVKDLNSLARYFNHHLQQAIHEMKKKYPNIILIYGDYYNAYLWL  296

Query  983   LARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKA  1162
             L  A  LGF +N L   CCG+ GG+YNY  ++ CG+ GV  C +P  +I WDG+HLTQ+A
Sbjct  297   LRNAVSLGFDKNSLQKACCGT-GGKYNYITSRTCGAPGVPVCVDPSTHISWDGIHLTQEA  355

Query  1163  HLAISQIVIPNILSRIQC  1216
             +  +++ +I ++L ++ C
Sbjct  356   YKWLAKWLIDDMLPQLNC  373



>ref|XP_003560500.1| PREDICTED: acetylajmalan esterase-like [Brachypodium distachyon]
Length=380

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/329 (44%), Positives = 203/329 (62%), Gaps = 4/329 (1%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNL++    G       LPYG+T  G PTGR SDGLL++DF+A+ +GL
Sbjct  35    AIYSLGDSITDTGNLVKEAPPGAFETIKHLPYGVTL-GYPTGRCSDGLLMIDFLAQDMGL  93

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALD-IGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             P LNPYL KN SF +GVNFAV  +TA+D  G    +   +P     L  Q+ W K +L S
Sbjct  94    PFLNPYLGKNKSFDHGVNFAVAGATAMDPAGLFGPRSFSMPFTVSSLKLQLRWFKDFLKS  153

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
             S  A   D + RL+ S+  VGEIG ND  +A    + + +V   +P +  ++I+A +EV+
Sbjct  154   SF-ATDEDIRKRLQSSIVLVGEIGGNDYNYAFFTNKNVSDVEKLIPAVVQTIIDAAKEVL  212

Query  740   QVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
              +G  R+++PG FP+GC P  L+  G+ +P DYD  GCLR +N      N+ LQQA+  L
Sbjct  213   DMGASRVIIPGNFPIGCIPGYLTTMGSSEPSDYDSTGCLREMNLFAAKHNSKLQQAIAGL  272

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             R  +P+A I YADYY +F S L  A  LGF  N   M CCG+ GG+YNYD  K+CG  G 
Sbjct  273   RSSYPNASIAYADYYNSFFSILKSASSLGFDANSTRMACCGA-GGKYNYDERKMCGMEGT  331

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
              +C  P  Y+ WDG+H+TQ A+ A+S+++
Sbjct  332   TACAEPSAYLSWDGIHMTQAAYKAMSRLI  360



>ref|XP_010025245.1| PREDICTED: acetylajmalan esterase-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW61855.1| hypothetical protein EUGRSUZ_H04541 [Eucalyptus grandis]
Length=383

 Score =   310 bits (794),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/352 (43%), Positives = 221/352 (63%), Gaps = 4/352 (1%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPG-RPTGRWSDGL  346
             E Q++  C   S+YQ G S  DTGNLI    IG   P +  PYG  FPG + TGR S+G 
Sbjct  26    EAQELGSCKLDSVYQLGDSTSDTGNLIHESLIGAASPCSHPPYGQDFPGGQATGRCSNGF  85

Query  347   LIVDFIARAVGLPLLNPYLDKNASFT--NGVNFAVTASTALDIGFLAQKGVVVPSITVPL  520
             L++D+++RA G+P  + YL+++A+FT  +GVNFAV  +TAL    L Q  +  PS    L
Sbjct  86    LMIDYLSRAAGVPFPDYYLNQSAAFTRGHGVNFAVAGATALPSDVLDQMNISNPSTNSSL  145

Query  521   SGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPD  700
             S Q++W+ +Y +  IC   +DC  +LK +LF VGEIG +D  +AL QG++I+E  + VP 
Sbjct  146   STQLDWMFSYFNG-ICFDKADCLWKLKDALFMVGEIGGSDYYYALFQGKSIEEAKSLVPQ  204

Query  701   ITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTI  880
             +  ++ +AV+ VI  G  R+VVPG+FP+GCFP  L++F T  P  YDE  CL+ +N L  
Sbjct  205   VVMAIKDAVQRVIGYGASRVVVPGSFPIGCFPVYLARFKTNHPSAYDESRCLKGLNGLAA  264

Query  881   FRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQY  1060
             + N  L++ +G LR+E  D +ILY DYY AF S     P LGF   +    CCG GGG Y
Sbjct  265   YHNILLRRVIGELREENRDVIILYGDYYNAFASMYRGGPNLGFDMVRAQKACCGMGGGDY  324

Query  1061  NYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             N+D N+ CG+ GV  CP+P + + WDG+ +TQ+A+  ++  +I ++  ++ C
Sbjct  325   NFDPNRRCGAPGVAVCPHPTKAMSWDGIQMTQRAYFVMTNWLIRDLWPKLNC  376



>ref|XP_009615529.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Nicotiana tomentosiformis]
Length=379

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/376 (41%), Positives = 224/376 (60%), Gaps = 12/376 (3%)
 Frame = +2

Query  89    MGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIG  268
             + LP ++L +C+L  L  +++ S  +      + C  RS+YQ G SL D GN+IR     
Sbjct  4     LSLPKVSL-FCLLITLAFFSSPSAAQ------IKCNIRSLYQLGDSLADAGNVIRTPGAS  56

Query  269   PTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVT  448
                 A + PYG TF  RPTGR+SDG +I+D+I+ A  LP LN YL   ASF  GVNFAV 
Sbjct  57    IIFRADKAPYGETFFKRPTGRFSDGRIIIDYISSAFNLPFLNAYLGTGASFDQGVNFAVA  116

Query  449   ASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEI  628
               TAL   F   + + +P+   PL  Q+NW K++L S+ C   S+C   L  SL  +GE 
Sbjct  117   GGTALSTPFWTARNIRLPAWNTPLPAQLNWFKSHLQST-CG--SNCTQTLSNSLIVMGEF  173

Query  629   GRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLS  808
             G ND      Q + I E+  +VP +   +I  +++VIQ+G  R++VPG +P GC P  L+
Sbjct  174   GGNDYYNCFFQNKKIPEIRTYVPFVVAGIIRGIKDVIQLGATRVLVPGVYPFGCLPLYLT  233

Query  809   QFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLA  988
              F   +   YD+LGCLR+ N    + N +L +AL +LR+EFP+  I+Y  YY A  + L 
Sbjct  234   TFPDTNANAYDQLGCLRNYNEFASYHNRYLNRALVNLRREFPNVGIVYGGYYEALLTVLG  293

Query  989   RAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHL  1168
              +P  GF+Q+ L   CCG+ GGQYN+    VCGSTGV  C +P +Y+HWDG+HLT + H 
Sbjct  294   -SPSFGFNQSALLSACCGT-GGQYNFSFRTVCGSTGVGVCSDPARYVHWDGIHLTDETHR  351

Query  1169  AISQIVIPNILSRIQC  1216
              ++ I++ +++S+  C
Sbjct  352   RMTNIIVSDMISKFGC  367



>ref|XP_002450809.1| hypothetical protein SORBIDRAFT_05g018910 [Sorghum bicolor]
 gb|EES09797.1| hypothetical protein SORBIDRAFT_05g018910 [Sorghum bicolor]
Length=387

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/334 (46%), Positives = 210/334 (63%), Gaps = 5/334 (1%)
 Frame = +2

Query  182   VVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDF  361
                C   +IY FG S+ DTGNL+R G +G        PYG T   +PTGR SDGLLI+D+
Sbjct  36    AAACSVDAIYSFGDSIADTGNLLREGPVGFFASIGSYPYGQTLR-KPTGRCSDGLLIIDY  94

Query  362   IARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
              A A+ L L++PYLDK A F +GVNFAV  +TALD   L   GV+ P  +VPLS Q++W 
Sbjct  95    FAMALNLSLVSPYLDKGADFASGVNFAVAGATALDRSVLLLSGVMAPPASVPLSSQLDWF  154

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQG-RTIQEVAAFVPDITTSVI  718
             K++L+++ C +  DC  +L  +LF VGEIG ND  +  +QG R+IQ + A+VP +  +++
Sbjct  155   KSHLNAT-CPSQEDCTKKLAGALFLVGEIGGNDYNYGFLQGTRSIQAMKAYVPQVINAIM  213

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDP-KDYDELGCLRSINNLTIFRNNH  895
             +  +EVI++G  +I++PG FP+GC P+ LS F       D D  GCL+S N      N  
Sbjct  214   DVAKEVIELGATQIIIPGNFPIGCSPSYLSLFSVSGSGDDLDNRGCLKSYNAFAQHHNEQ  273

Query  896   LQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRN  1075
             LQ A+  LRK   D  I+YADYY AF   L  A LLGF Q  L   CCG+GG  YN++ N
Sbjct  274   LQAAIDGLRKANTDVTIVYADYYGAFMHLLDHASLLGFDQGALLHACCGAGGA-YNFNMN  332

Query  1076  KVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
              +CG+ G  +C +P + + WDG+HLTQ+A+ AI+
Sbjct  333   MMCGAPGTSTCADPARRVSWDGIHLTQQAYRAIA  366



>ref|XP_006361896.1| PREDICTED: acetylajmalan esterase-like [Solanum tuberosum]
Length=371

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 218/350 (62%), Gaps = 5/350 (1%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             +N +++ C F  IYQFG S+ DTGN IR           R PYGI F    TGR S+G+L
Sbjct  24    QNPRLMNCRFDKIYQFGDSISDTGNCIRETLCEVQSWCKRPPYGINFYQNVTGRCSNGML  83

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSG  526
             I+DFIA   GLPLLNPY D+NA F +GVNFAV  STA+   FLA+  +  + +    LS 
Sbjct  84    IIDFIAVECGLPLLNPYKDENAEFRHGVNFAVAGSTAVSAEFLAENNIDNIGATNSSLSV  143

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ ++  ++      +C ++L  SLF VGEIG N+  F L+QG+TI+E+   VP + 
Sbjct  144   QLDWMSSHFHTT---CSPNCPEKLNNSLFLVGEIGGNEFNFGLLQGKTIEELRRIVPQVV  200

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I+AV+ +I  G  RI+VPG FP+GC P  L++F T +   YDE  CL+ +NN  IF 
Sbjct  201   QTIIHAVKRIIGFGATRIIVPGNFPIGCIPLFLTEFMTNNSTAYDEHHCLKDLNNFVIFY  260

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N +LQQA+  L+K++P+  ++Y D Y AF   L  A  LGF  N L   CCG  GG+YNY
Sbjct  261   NRYLQQAIDELKKDYPNITLIYGDNYNAFMWLLENAVSLGFDNNSLQKACCGI-GGEYNY  319

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + ++ CG   V  C +P  +I WDG+H TQ A+  +++ +I ++L ++ C
Sbjct  320   NGHRSCGDPMVPVCVDPNTHISWDGIHFTQNAYSWLARWLIDDMLPKLNC  369



>ref|XP_011087062.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Sesamum indicum]
Length=374

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 234/382 (61%), Gaps = 13/382 (3%)
 Frame = +2

Query  74    AMLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIR  253
             ++L  + LP L L  C+   +   A A  ++       +C F  IYQ G S+ DTGNLIR
Sbjct  3     SVLHKLVLPVLVLWCCLFSCVPQCANAHPLK-------ICKFDKIYQLGDSISDTGNLIR  55

Query  254   VGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNA-SFTNG  430
                IG     ARLPYG TF    TGR S+GLL++D+IA A GLP L PY + +A  F +G
Sbjct  56    EVPIGAATAFARLPYGETFFKNATGRCSNGLLMIDYIAMAAGLPFLPPYKNLDAVDFEHG  115

Query  431   VNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSL  610
             VNFAV  STAL    LA + +  P  T  L+ Q++W+ T+ +S IC    DC ++L+ +L
Sbjct  116   VNFAVAGSTALPSQVLAAQHIFSPVTTSSLNVQLDWMFTHFTS-ICLNSRDCAEKLQNAL  174

Query  611   FFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGC  790
             F VGEIG ND  +A+ QG+T+ E+ + VP++  ++++  ++VI+VGG+R+V+PG FP+GC
Sbjct  175   FMVGEIGGNDYNYAIFQGKTMAELRSMVPNVVATIVDTAKQVIEVGGKRVVIPGNFPIGC  234

Query  791   FPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAA  970
              P   +   T     YD+  CL+ +N+   + N  LQ A+ +L++E P+AVI+Y DYY A
Sbjct  235   LPIYKTALQTNISAAYDKNHCLKHLNDFAKYHNKELQNAIHTLKQEKPNAVIVYGDYYNA  294

Query  971   FQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHL  1150
             +Q  L  A   GF + +    CCG+ GG+YN+D  ++CG  GV  C NP +Y+ WDGVHL
Sbjct  295   YQFLLRVAISRGFERER---ACCGT-GGKYNFDMTRMCGGAGVKVCSNPERYMSWDGVHL  350

Query  1151  TQKAHLAISQIVIPNILSRIQC  1216
             T++ +  ++  ++ NI   + C
Sbjct  351   TERGYKIMAAWLLKNIFPHLLC  372



>ref|XP_007030130.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY10632.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
Length=372

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/345 (45%), Positives = 211/345 (61%), Gaps = 7/345 (2%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
              C F +IYQ G S+ DTGNLIR     P  P  RLPYG  F    TGR S+GLL++DF+A
Sbjct  31    TCQFDAIYQLGDSISDTGNLIRED---PLSPFGRLPYGQNFFKDATGRCSNGLLMIDFLA  87

Query  368   RAVGLPLLNPYLDKNASFT--NGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
              + G+P L PYL+ +A  T  +GVNFAV  STAL +  LA+  V+ P     L  Q++W+
Sbjct  88    LSTGIPFLEPYLNSDALLTRGHGVNFAVAGSTALPVEILAENNVLAPVTNTSLRRQLDWM  147

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
              +Y +  IC    DC  +LK SLF VGEIG ND  +AL QG+T +EV + +P +  ++ +
Sbjct  148   FSYFNG-ICRDQEDCFKKLKTSLFMVGEIGGNDYNYALFQGKTFEEVRSMMPKVVQAIKD  206

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
             AV  V+  G  R++VPG FP+GC P  L+ F +     YD   CL+ +N L I  NN L+
Sbjct  207   AVTRVVGYGATRVIVPGNFPIGCLPIYLTGFQSNHSAAYDGFHCLKGLNKLAIHHNNLLK  266

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
             +A+  LRK+ P+A+I+Y DYY AF   L +A LLGF        CCG  GG Y+Y   ++
Sbjct  267   RAIKELRKDLPNAIIVYGDYYNAFLQLLRKAELLGFDTKSTQKACCGI-GGDYDYTLTRM  325

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             CG+ GV  C +P QY+ WDGVHLTQKA+  ++  +I  I   +QC
Sbjct  326   CGAPGVPVCSDPDQYVSWDGVHLTQKAYKFMAGWLIRYIYPELQC  370



>ref|XP_007021821.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY13346.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
Length=368

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/343 (42%), Positives = 221/343 (64%), Gaps = 8/343 (2%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
              C F +IYQ G S+ DTGNLIR     P+   ARLPYG TF    TGR S+GL+++D++A
Sbjct  30    TCGFDAIYQLGDSVSDTGNLIRED---PSSVYARLPYGATFFKNATGRCSNGLIMIDYLA  86

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             R+ G+P L+ YL++N++ ++GV+FAV  +TAL +  LA++ +        L+ Q++W+ T
Sbjct  87    RSAGIPFLDAYLNENSTHSSGVDFAVAGATALPVEILARRNITATVTNSSLTMQLDWMFT  146

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +++ C     C  + + +LF VGEIG ND  +AL +G+ ++E+ A VP++  ++ +A 
Sbjct  147   HFNTT-CETDKGCFKKHRTALFMVGEIGANDYNYALFEGKNLEEIRAMVPEVVQAIKDAA  205

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
               VI  GG R+V+PG FP GC P  L  F T D   YD+  CL+ +NNL+I+ NNHL++A
Sbjct  206   ERVIDYGGSRLVIPGNFPTGCLPMFLIVFQTNDTTAYDKFHCLKDLNNLSIYHNNHLKKA  265

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  LRKE P+ +I+Y + Y A+   L++A +LGF   K    CCG  GG YN+   K+CG
Sbjct  266   IEELRKEHPNVIIVYGNNYQAYHWLLSKAKILGFDTRK---ACCGI-GGDYNFSIMKMCG  321

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + GV  C NP +++ WDG HLTQ+A+  ++  +I +I  ++QC
Sbjct  322   AAGVPVCSNPDKHLSWDGAHLTQEAYKFMATWLIHDIYPKLQC  364



>emb|CBV37053.1| GDSL lipase-like chlorogenate-dependent caffeoyltransferase precursor 
[Solanum lycopersicum]
Length=380

 Score =   307 bits (787),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 153/350 (44%), Positives = 216/350 (62%), Gaps = 5/350 (1%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             E  K+  C    I+QFG SL DTGN +R    G      +LPYG+ F    TGR SDG +
Sbjct  33    EEPKLKKCGIDRIFQFGDSLSDTGNCLRESYCGAQTKTGKLPYGMNFYQNATGRCSDGFI  92

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQ  529
             I+D+IA   GLPLLNP L++NA F++GVNFAV+ +TAL   +L  + + +      LS Q
Sbjct  93    ILDYIAMECGLPLLNPSLEENADFSHGVNFAVSGATALSAEYLISRDIAMSFTNSSLSVQ  152

Query  530   INWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITT  709
             + W+ +Y  S +C+  +DC   L+ SLF +GEIG +D+T+   QG+ I+EV   VPDI  
Sbjct  153   MRWMSSYFKS-VCS--NDCAKYLENSLFLIGEIGGDDVTYGFKQGKPIEEVRRIVPDIVK  209

Query  710   SVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRN  889
             ++I++VR VI  G  RI+VPG FP GCFP +L+ +       YDE  C    NN TI  N
Sbjct  210   NIIHSVRTVIGFGATRILVPGNFPSGCFPIILTLYMNDSSTVYDEYHCAEEWNNFTISYN  269

Query  890   NHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYD  1069
             N LQQ++  L +E+P+  I+Y DYY A+   L  A  LGF++  L ++CCG  GG+YNY 
Sbjct  270   NLLQQSIHELNEEYPNISIIYGDYYNAYYWLLRNAVALGFNKKTLQISCCGI-GGEYNYT  328

Query  1070  RNKVCGSTGV-ISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              ++ CG  G   +C +P  Y+ WDG HLTQKA+  I++ +I +IL ++ C
Sbjct  329   ESRRCGKPGAEKACADPSSYLSWDGSHLTQKAYGWITKWLIDDILPQLNC  378



>ref|XP_004251965.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Solanum lycopersicum]
Length=369

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/342 (41%), Positives = 213/342 (62%), Gaps = 4/342 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   S+YQ G SL D GN+IR         A R PYG TF  +PTGR+S+G +I DFI++
Sbjct  30    CNVNSVYQLGDSLADAGNVIRTPGASIIFRADRSPYGETFFRKPTGRFSNGRVITDFISQ  89

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             +  LP LN YLD+ ASF+ GVNFAV  +TALD  F   + + +P+   PLS Q+ W K++
Sbjct  90    SFKLPFLNAYLDRTASFSQGVNFAVAGATALDTSFWTARNIRLPTWNTPLSNQLTWFKSH  149

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S+ C   S C + LK S+  +GE G ND      Q + I EV ++VP +   ++  ++
Sbjct  150   LKST-CG--SKCAENLKNSIVIMGEWGGNDYYNCFFQRKQISEVRSYVPFVVAGIMRGIK  206

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             EVIQ+G  R++VP  +PLGC P  L+ F   +   YD+LGCL+S N+   + N  + +A+
Sbjct  207   EVIQLGATRVLVPSIYPLGCLPLYLTSFPDNNTSGYDQLGCLKSFNDFASYHNRFVVRAM  266

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              +L+++FP+  I+Y D+Y +  S +      GF+QN L   CCG+ GG +N++   VCG 
Sbjct  267   ANLQRQFPNVSIVYGDFYGSILSLIRNPSSFGFNQNTLLSACCGT-GGTHNFNFRTVCGG  325

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              G+ +C NP +Y+HWDG+HLT +AH  IS++++ ++L++  C
Sbjct  326   AGINACSNPAKYVHWDGIHLTDEAHRRISEVLVRDMLAKFNC  367



>emb|CDP17196.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 213/343 (62%), Gaps = 3/343 (1%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
              C F  IYQ G S+ DTGNL+R    G   P A LPYG +  G PTGR SDGLL++D+IA
Sbjct  95    ACHFNKIYQLGDSIADTGNLVRESPFGSGYPFAHLPYGESTFGFPTGRCSDGLLMIDYIA  154

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
              A GLP L P + ++ +FT GVNFAV  STAL    L  K +  P     LS Q++W+ +
Sbjct  155   LAAGLPYLEPSMKEDGNFTTGVNFAVGGSTALPKEVLEAKDITNPISNSSLSVQLDWMSS  214

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC     C+  L++SLFFVGEIG ND     ++GR++ E+ A VP++  S+ NA+
Sbjct  215   HFAS-ICHTKEVCRKMLEKSLFFVGEIGGNDYNVPFLEGRSMNELTALVPEVVQSITNAI  273

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             + VI  G  RI+VPG FP+GC P  ++ F T D   YDE  CL+ +NN     N  L+ +
Sbjct  274   KRVIDFGATRIIVPGNFPIGCIPVYVACFQTNDTAAYDEHHCLKDLNNFAEIHNQLLKAS  333

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L+K++P  VI+Y DYY A+ S L+ A  LGF +N L   CCG+    Y+    K+CG
Sbjct  334   IKKLKKDYPKVVIVYGDYYNAYLSLLSNARSLGFDENALQKACCGT--EPYDCSGGKLCG  391

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + GV +CP P +YI WDGVH TQ+A+  ++  ++ +I+ +++C
Sbjct  392   TPGVKACPRPDKYISWDGVHSTQQAYKYMTAHLLDSIMPQLKC  434



>ref|XP_006483686.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Citrus sinensis]
Length=287

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 196/285 (69%), Gaps = 6/285 (2%)
 Frame = +2

Query  374   VGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVP--SITVPLSGQINWLKT  547
             + LPLLNPYLDKNASF NG NFAV ASTALD  F A + + +       PL  Q+NW KT
Sbjct  3     LKLPLLNPYLDKNASFNNGANFAVAASTALDDWFFAARNIPMKWAKNNAPLKVQLNWFKT  62

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             YL+SS+C + +DC  +L+RS+  + E G ND ++AL QG++IQEV  ++PD+  +++NAV
Sbjct  63    YLNSSVCQSNTDCARKLRRSIVIL-ETGGNDYSYALFQGKSIQEVQTYIPDVVGAIVNAV  121

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             REVI++G  R+VV GT P GC P +L+ F   DPK YD+ GCLR +N   +  NN+L+ A
Sbjct  122   REVIRLGAIRVVVTGTLPEGCSPIVLTAFPNSDPKAYDDKGCLRDLNEFQMSHNNNLKGA  181

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRN--KV  1081
             L  LR +FP A I+YADYYAAF S L RA  LGF        CCG+ GG YN+D+N  KV
Sbjct  182   LAKLRPKFPHADIIYADYYAAFLSVLRRAESLGFEPRSTLKACCGT-GGLYNFDKNLTKV  240

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             CG+ GV  CPNP Q+I WDG HLTQ  +  +S+ +I +ILSRI+C
Sbjct  241   CGAPGVPVCPNPEQHISWDGTHLTQNGNRHMSEFLINDILSRIRC  285



>ref|XP_004230193.1| PREDICTED: acetylajmalan esterase [Solanum lycopersicum]
Length=380

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 215/347 (62%), Gaps = 5/347 (1%)
 Frame = +2

Query  179   KVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVD  358
             K+  C    I+QFG SL DTGN +R    G      +LPYG+ F    TGR SDG +I+D
Sbjct  36    KLKKCGIDRIFQFGDSLSDTGNCLRESYCGAQTKTGKLPYGMNFYQNATGRCSDGFIILD  95

Query  359   FIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             +IA   GLPLLNP L++NA F++GVNFAV+ +TAL   +L  + + +      LS Q+ W
Sbjct  96    YIAMECGLPLLNPSLEENADFSHGVNFAVSGATALSAEYLISRDIAMSFTNSSLSVQMRW  155

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
             + +Y  S +C+  +DC   L+ SLF +GEIG +D+T+   QG+ I+EV   VPDI  ++I
Sbjct  156   MSSYFKS-VCS--NDCAKYLENSLFLIGEIGGDDVTYGFKQGKPIEEVRRIVPDIVKNII  212

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
             ++VR VI  G  RI+VPG FP GCFP +L+ +       YDE  C    NN TI  NN L
Sbjct  213   HSVRTVIGFGATRILVPGNFPSGCFPIILTLYMNDSSTVYDEYHCAEEWNNFTISYNNLL  272

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             QQ++  L +E+P+  I+Y DYY A+   L  A  LGF++  L ++CCG  GG+YNY  ++
Sbjct  273   QQSIHELNEEYPNISIIYGDYYNAYYWLLRNAVALGFNKKTLQISCCGI-GGEYNYTESR  331

Query  1079  VCGSTGV-ISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              CG  G   +C +P  Y+ WDG HLTQKA+  I++ +I +IL ++ C
Sbjct  332   RCGKPGAEKACADPSSYLSWDGSHLTQKAYGWITKWLIDDILPQLNC  378



>ref|XP_010672326.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=374

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 217/338 (64%), Gaps = 3/338 (1%)
 Frame = +2

Query  200   RSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
              +IYQFG S+ DTGNLIR   +G     ARLPYG T+  +PTGR S+GLL++D+IA    
Sbjct  35    EAIYQFGDSISDTGNLIRENPVGSHTAFARLPYGETYFHKPTGRCSNGLLMIDYIAENFN  94

Query  380   LPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             LPLL+ YL++  +F +GVNFAV  STAL    LA K ++ P     LS Q++W +++L S
Sbjct  95    LPLLDAYLNEGGNFNHGVNFAVAGSTALTTSTLAAKNILSPVTNSSLSVQLSWFRSFLHS  154

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
              IC+ P + + +L  +LF + E G ND  +A  Q +++Q+V   V ++  ++   V+E+I
Sbjct  155   -ICSHPFEYQHKLANALFII-ETGGNDFNYAFFQQKSLQDVQQMVDEVIQAITTTVKELI  212

Query  740   QVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
              +G  + V+PG FP+GC P  LS F + D K YDEL CL+ +N   +F+NNHL++A+  L
Sbjct  213   SLGATKFVIPGNFPIGCLPIYLSAFESNDTKMYDELHCLKDLNEFAMFQNNHLERAIKEL  272

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             + ++P+  I+YADYY A +  L  A  LGF+++++   CCG G  +YN++   +CG  GV
Sbjct  273   QIQYPNVAIVYADYYNALRGLLTNAASLGFNKSEVQKACCGIGNNEYNFNMTSMCGYKGV  332

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVI-PNILSRI  1210
               C NP + + WDGVH+TQ A+  +++ +I  NIL  I
Sbjct  333   PVCENPDKSVSWDGVHMTQHAYQLMARWLIKKNILPGI  370



>ref|XP_010672325.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=374

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 215/338 (64%), Gaps = 3/338 (1%)
 Frame = +2

Query  200   RSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
              +IYQFG S+ DTGNLIR   +G     ARLPYG T+  +PTGR S+GLL++D+IA    
Sbjct  35    EAIYQFGDSISDTGNLIRENPVGSHTAFARLPYGETYFHKPTGRCSNGLLMIDYIAENFN  94

Query  380   LPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             LPLL+ YL+K  +F +GVNFAV  STAL    LA K ++ P     LS Q+ W +++L S
Sbjct  95    LPLLDAYLNKGGNFNHGVNFAVAGSTALTTSTLAAKNILSPVTNSSLSVQLGWFRSFLHS  154

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
              IC+ P + + +L  +LF + E G ND  +A  + +++Q+V   V ++  ++   V+E+I
Sbjct  155   -ICSHPFEYQPKLANALFII-ETGGNDFNYAFFEQKSLQDVQQMVDEVIQAITTTVKELI  212

Query  740   QVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
              +G  + V+PG FP+GC P  LS F + D K YDEL CL+ +N   + +NNHL++A+  L
Sbjct  213   SLGATKFVIPGNFPIGCLPIYLSAFQSNDTKMYDELHCLKDLNEFAVLQNNHLERAIKEL  272

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             +  +P+  I+YADYY A +  L  A LLGF+++++   CCG G  +YN++   +CG  GV
Sbjct  273   QMHYPNVAIVYADYYNALRGLLTNAALLGFNKSEVQKACCGIGNNEYNFNMTSMCGYKGV  332

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVI-PNILSRI  1210
               C NP + + WDGVH+TQ A+  +++ +I  NIL  I
Sbjct  333   PVCENPAKSVSWDGVHMTQHAYQLMARWLIKKNILPGI  370



>ref|XP_006433429.1| hypothetical protein CICLE_v10003375mg [Citrus clementina]
 gb|ESR46669.1| hypothetical protein CICLE_v10003375mg [Citrus clementina]
Length=373

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 160/368 (43%), Positives = 219/368 (60%), Gaps = 10/368 (3%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             ++CF L+  A S +    Q +  C   SIYQ G S+ DTGNLI+     P    A+LPYG
Sbjct  13    LICFFLL--APSPLPCNAQTLKTCGLNSIYQLGDSVSDTGNLIQEH---PESAFAKLPYG  67

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFT---NGVNFAVTASTALDIG  472
              TF    TGR S+GLL++D+ A + G+P ++ +L+ NAS     +GVNFAV  STAL   
Sbjct  68    ETFFKNATGRCSNGLLMIDYFAISAGIPFVDAFLNSNASLYIQGHGVNFAVAGSTALPSY  127

Query  473   FLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFA  652
              LA K +  P     LS Q++W+ TY +  IC    DC  +LK SLF VGEIG ND  +A
Sbjct  128   ILADKKISSPVTNSSLSTQLDWMFTYFNG-ICYDYDDCAQKLKSSLFIVGEIGENDYKYA  186

Query  653   LVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPK  832
             L QG+T++EV   VP++  ++ +AV  VI  G  R+VVPG FP+GCFP  L+QF T D  
Sbjct  187   LFQGKTVEEVKTLVPEVVQAIKDAVTRVIDFGAVRVVVPGNFPVGCFPIYLTQFRTNDSA  246

Query  833   DYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFH  1012
              YD+  CL+ +NNL+   N  LQQA+  L+ E P+  I+Y DYY AF   L     L F 
Sbjct  247   AYDQFHCLKCLNNLSFHHNELLQQAIQELKNEHPNVAIIYGDYYTAFMWILGHVRTLEFD  306

Query  1013  QNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIP  1192
                +   CCG  GG Y+++  K+CG +GV  C N  + I WDGVHLTQKA+  ++  +I 
Sbjct  307   NGSMQKACCGI-GGDYDFNLTKMCGMSGVPVCENLDKRISWDGVHLTQKANKYMAMWLIR  365

Query  1193  NILSRIQC  1216
             +I  ++ C
Sbjct  366   DIFPKLWC  373



>ref|XP_010672328.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=374

 Score =   305 bits (780),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/338 (43%), Positives = 215/338 (64%), Gaps = 3/338 (1%)
 Frame = +2

Query  200   RSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
              +IYQFG S+ DTGNLIR   +G     ARLPYG T+  +PTGR S+GLL++D+IA    
Sbjct  35    EAIYQFGDSISDTGNLIRENPVGSHTAFARLPYGETYFHKPTGRCSNGLLMIDYIAENFN  94

Query  380   LPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             LPLL+ YL+K  +F +GVNFAV  STAL    LA K ++ P     LS Q+ W +++L S
Sbjct  95    LPLLDAYLNKGGNFNHGVNFAVAGSTALTTSTLAAKNILSPVTNSSLSVQLGWFRSFLHS  154

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
              IC+ P + + +L  +LF + E G ND  +A  Q +++Q+    V ++  ++   V+E+I
Sbjct  155   -ICSHPFEYQHKLANALFII-ETGGNDFNYAFFQQKSLQDGQQMVDEVIQAITTTVKELI  212

Query  740   QVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
              +G  + V+PG FP+GC P  LS F + D K YDEL CL+ +N   +F+NNHL++A+  L
Sbjct  213   SLGATKFVIPGNFPIGCLPIYLSAFQSNDTKMYDELHCLKDLNEFAMFQNNHLERAIKEL  272

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             + ++P+  I+YADYY A +  L  A LLGF+++++   CCG G  QYN++   +CG  GV
Sbjct  273   QMQYPNVAIVYADYYNALRGLLTNAALLGFNKSEVQKACCGIGNNQYNFNMTSMCGYKGV  332

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVI-PNILSRI  1210
               C  P + + WDGVH+TQ A+  +++ +I  NIL  I
Sbjct  333   PVCEYPDKSVSWDGVHMTQHAYQLMARWLIKKNILPGI  370



>gb|ABD98038.1| acetylajmalan acetylesterase [Striga asiatica]
Length=406

 Score =   305 bits (782),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 151/375 (40%), Positives = 228/375 (61%), Gaps = 7/375 (2%)
 Frame = +2

Query  104   LTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPA  283
             LTL+Y  +  ++    A  +   + +   CPF  +Y +G  + D GN I V     T+P 
Sbjct  8     LTLSYSTVFKIVCLYLAIQIGTSSAQGWNCPFNYLYHWGDGVTDIGNSIYV-MPKITIPT  66

Query  284   ARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLD---KNASFTNGVNFAVTAS  454
              R PYG+T+PG PTGRWSDGL+  D+ A+ +GLP + PYL+    NA+  +GV F+V  S
Sbjct  67    GRKPYGMTYPGYPTGRWSDGLVDFDYSAQDLGLPNIRPYLNMNQSNAASYDGVIFSVARS  126

Query  455   TALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGR  634
               L   F  ++ +V+P  TV LS Q+ W K +L   +C +PS+C + +  S   +G+I  
Sbjct  127   PVLGRKFFEKRDIVIPRYTVSLSQQMRWFKGHLKY-VCNSPSECSEWIGNSPALMGDIEG  185

Query  635   NDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQF  814
             NDI +AL QG+TI EV  +VP I  + I+  RE+I++G +R+++PG  PLGC+P +L++ 
Sbjct  186   NDIGYALTQGKTIAEVRTYVPAIVKTPIDRSREIIKLGAKRLIIPGNGPLGCYPYILTEL  245

Query  815   GTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARA  994
              + DPK YDELGCL ++NN T+++NN+L  A+  L  EFPD  ILY D Y   ++ L  +
Sbjct  246   ASNDPKAYDELGCLATVNNFTVWKNNYLLNAMVKLENEFPDVQILYGDMYNGLRALLVNS  305

Query  995   PLLGFHQ-NKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLA  1171
              ++G    N+   +CCG  GG+YN+DR + CG  GV  C NP  Y+ WDG+H TQ+  + 
Sbjct  306   TVIGPDGVNRALKSCCGI-GGKYNFDRKRFCGDKGVPVCSNPKDYVFWDGMHYTQEGQMR  364

Query  1172  ISQIVIPNILSRIQC  1216
             + + +I   L  + C
Sbjct  365   VEKSLIFPALETLNC  379



>ref|XP_010672330.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=374

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/338 (43%), Positives = 214/338 (63%), Gaps = 3/338 (1%)
 Frame = +2

Query  200   RSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
              +IYQFG S+ DTGNLIR   +G     ARLPYG T+  +PTGR S+GLL++D+IA    
Sbjct  35    EAIYQFGDSISDTGNLIRENPVGSHTAFARLPYGETYFHKPTGRCSNGLLMIDYIAENFN  94

Query  380   LPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             LPLL+ YL+K  +F +GVNFAV  STAL    LA K ++ P     LS Q+ W +++L S
Sbjct  95    LPLLDAYLNKGGNFNHGVNFAVAGSTALTTSTLAAKNILSPVTNSSLSVQLGWFRSFLHS  154

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
              IC+ P + + +L  +LF + E G ND  +A  Q +++Q+V   V ++  ++   V+E+I
Sbjct  155   -ICSHPFEYQPKLANALFII-ETGGNDFNYAFFQQKSLQDVQQMVDEVIQAITTTVKELI  212

Query  740   QVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
              +G  + V+PG FP+GC P  LS F + D K YDEL CL+ +N   + +NNHL++A+  L
Sbjct  213   SLGATKFVIPGNFPIGCLPIYLSAFQSNDTKMYDELHCLKDLNEFAVLQNNHLERAIKEL  272

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             +  +P+  I+YADYY A +  L  A LLGF+++++   CCG G  QYN++   +CG  GV
Sbjct  273   QMHYPNVAIVYADYYNALRGLLTNAALLGFNKSEVQKACCGIGNNQYNFNMTSMCGYKGV  332

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVI-PNILSRI  1210
               C  P + + WDGVH+TQ A+  +++ +I  NIL  I
Sbjct  333   PVCEYPDKSVSWDGVHMTQHAYQLMARWLIKKNILPGI  370



>emb|CDP15821.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/339 (44%), Positives = 207/339 (61%), Gaps = 1/339 (0%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
              IYQ G S+ DTGNL+     G      R PYG T  G+PTGR S+GLL+VD+ A A GL
Sbjct  52    KIYQLGDSISDTGNLVLESPHGSGFLFTRPPYGETTFGKPTGRCSNGLLMVDYFATAFGL  111

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P L PY   +A+F +GVN AV  +TAL    L  K +  P+    LS Q+ W+ ++ +S+
Sbjct  112   PYLEPYKKAHANFKHGVNSAVAGATALSEEALKAKIITNPATNSSLSVQLEWMASHFNST  171

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
              C     C + L+ +LFFVGEIG ND  +  VQ +T+ E+   VPD+  S+ +AVR VI 
Sbjct  172   -CHTKEGCWEMLRNALFFVGEIGGNDYNYGFVQRKTLDELTGLVPDVVQSITDAVRRVIG  230

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLR  922
              G RR++VP  FP+GC P  LS F T +   YDE  CL+ +NN     N  L+ ++  L+
Sbjct  231   FGARRVIVPSNFPIGCLPIYLSSFHTNNSAAYDEKHCLKDLNNFAEIHNEVLKASINVLK  290

Query  923   KEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVI  1102
             KE+P   I+Y DYY A+   L+ A  L F +N L   CCGSG G YN+D  K+CG+ GV 
Sbjct  291   KEYPYVDIVYGDYYNAYLWLLSHAKRLRFGRNSLQKACCGSGSGPYNFDPRKMCGAEGVS  350

Query  1103  SCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQCF  1219
             +CPNP +YI WDG+H TQ+A+  I+  ++ +IL +++ F
Sbjct  351   ACPNPDKYISWDGIHSTQRAYKYIAGYLLRSILPQMRMF  389



>ref|XP_010692365.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Beta vulgaris 
subsp. vulgaris]
Length=406

 Score =   303 bits (776),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 220/340 (65%), Gaps = 8/340 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             F   YQFG SL DTGNL+    +G     A  PYG++    PTGR SDGLLI+D+ A+  
Sbjct  69    FDQAYQFGDSLSDTGNLVLENPVGAH-TFANYPYGVSI-HHPTGRCSDGLLIIDYFAKYF  126

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLS  556
              LPLL PYL+K A+ T+G+NFAV  STALD   LA K ++ P  +  LS Q++W K++L 
Sbjct  127   HLPLLKPYLNKQANSTHGLNFAVAGSTALDTATLASKNILSPVTSSSLSVQLDWFKSHLE  186

Query  557   SSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREV  736
             S+ C   S+CK++L +S+FF+ E G ND  +AL+Q +T++EV   VP +  ++  AV +V
Sbjct  187   ST-CG--SECKNKLHKSVFFI-ETGGNDYNYALLQRKTLKEVKDMVPQVVGAIKAAVEQV  242

Query  737   IQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGS  916
             + +G  R+VVPG FP+GC P  L+ FGT+DP  YD+L CL+ +N    F N+ L+QA+  
Sbjct  243   VSLGATRVVVPGNFPIGCLPIYLATFGTKDPNQYDDLKCLKGLNVFAKFHNDELKQAIRE  302

Query  917   LRKEFPDA--VILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
             L+ E+ D    ++Y D+Y+  +  L  A   GF +++++  CCGSG   YN+D  K+CG+
Sbjct  303   LQAEYFDKNVAVVYGDFYSGLRRILYNADAFGFKKDEVHKACCGSGNNAYNFDLMKMCGN  362

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRI  1210
              GV  C +P + + WDG+HLTQ+A++ ++Q +   I+ +I
Sbjct  363   KGVPVCADPSRLVSWDGIHLTQRAYMRMAQGLFQQIVPQI  402



>ref|XP_010683532.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=381

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 159/378 (42%), Positives = 222/378 (59%), Gaps = 7/378 (2%)
 Frame = +2

Query  95    LPSLTLNYCILC-FLLVYAAASGVE----NENQKVVVCPFRSIYQFGASLHDTGNLIRVG  259
             +   +L++ +LC   ++     GV+    ++    V   F +IYQFG SL DTGNLIR  
Sbjct  1     MTHFSLHFFMLCATTIITFTTQGVKASFRSKGNANVTMQFEAIYQFGDSLSDTGNLIR-E  59

Query  260   AIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNF  439
               G     ARLPYG TF  RPTGR SDGLL+VD+ A    LPLLNPYL + + F+NG NF
Sbjct  60    PYGARTAFARLPYGRTFFHRPTGRCSDGLLVVDYFAMYFHLPLLNPYLARRSDFSNGANF  119

Query  440   AVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFV  619
             AV  +TALD   LA + V +P     L+ QI W K YL  S  + P + K++L++SL  +
Sbjct  120   AVAGATALDPAALAARNVSLPLTRSTLARQIRWFK-YLLHSTLSNPREIKEKLQKSLVMM  178

Query  620   GEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPN  799
             GEIG ND  FA  QGRT+ EV   VP +  ++  AV+EVI++G   IVVPG FP+GC P 
Sbjct  179   GEIGGNDYNFAFFQGRTMHEVYKLVPYVVQAIKAAVQEVIKLGATNIVVPGNFPIGCVPL  238

Query  800   LLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQS  979
              L  F ++    YDE  CL+  N+ + F N  L + +  L++E P   I Y DYY+A   
Sbjct  239   YLVGFPSKYASKYDEFQCLKDYNDFSKFHNELLIKTIQELQQEHPGVAIAYGDYYSALMW  298

Query  980   FLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQK  1159
              +  AP LGF  +     CC  G   YNYD  + CGS GV  C +P + ++WDG+H+TQ+
Sbjct  299   VITHAPRLGFEADGSKRACCALGNNPYNYDPKRGCGSPGVPVCEDPSKTVNWDGIHMTQQ  358

Query  1160  AHLAISQIVIPNILSRIQ  1213
              +  +++ ++ NI+  +Q
Sbjct  359   GNKNVARWLLRNIVPTLQ  376



>emb|CDP16034.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/357 (44%), Positives = 208/357 (58%), Gaps = 41/357 (11%)
 Frame = +2

Query  131   FLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF  310
             FL+V++    V +  +     PF+ IYQFG SL DTGN IR  A+               
Sbjct  9     FLIVFSLLCTVSSAKENA--SPFKIIYQFGDSLADTGNRIRQSALH--------------  52

Query  311   PGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKG  490
                                    LPLL PYL+ NASF +GVNFAV  STALD  F   + 
Sbjct  53    -----------------------LPLLRPYLETNASFISGVNFAVGGSTALDNSFFYDRN  89

Query  491   VVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRT  670
             + VPS  VPLS Q+ W K +L   +    S C++RLKR+LF +GEIG ND + A  QG++
Sbjct  90    ISVPSTNVPLSQQLKWFKKHLKL-VSDNRSQCEERLKRALFMMGEIGGNDFSTAFSQGKS  148

Query  671   IQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELG  850
             I+E   +VP +  ++  A+REVIQ G R I+VPG  P+GC P+ L+ F + DPK YD+ G
Sbjct  149   IKESRNYVPYVVDAISLAIREVIQFGARIIIVPGIIPMGCLPSFLASFPSADPKAYDDKG  208

Query  851   CLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYM  1030
             CL+ +N   +F NN+LQ+ L +LR EFP  VI Y DYY AFQ  L  A  LGF Q  L  
Sbjct  209   CLKKLNKFVLFYNNYLQKNLAALRLEFPGVVIRYYDYYNAFQYILHNAGSLGFDQRSLLK  268

Query  1031  TCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNIL  1201
              CCG  GG+YNY  + +C S GV +C  P +++HWDGVHLTQ+A+  IS  +I +IL
Sbjct  269   ACCGK-GGKYNYSNDMICASNGVKACLQPERFVHWDGVHLTQEAYRYISDHLIRDIL  324



>emb|CDP09073.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/350 (43%), Positives = 206/350 (59%), Gaps = 6/350 (2%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF-PGRPTGRWSDGL  346
             +   +  C F  IYQ G S+ D GNLIR   +G  LP AR PYG T      TGR SDGL
Sbjct  28    DAHPLAFCHFDQIYQLGDSISDAGNLIRESPLGAFLPFARAPYGQTLLTHEATGRCSDGL  87

Query  347   LIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSG  526
             L++D+IA A GLPL+NP  D  ASF +G NFAV  +TAL    L +  V  P     L  
Sbjct  88    LMIDYIALASGLPLVNPIKDAKASFMHGANFAVAGATALSSATLDRHKVRNPVTNSSLDV  147

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q+ W+K +     C +   C+ +L+ +LF VGEIG ND  +A    +   E+  FVP + 
Sbjct  148   QLEWMKDHFHE-FCGSQRHCEMKLRNALFMVGEIGGNDYNYAFFSNKRKVEILDFVPQVV  206

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              S+  AV  VI+ G RRIVVPG FP+GC P  L+ F T +P DYDE  CL+ +N+     
Sbjct  207   ASIKKAVEGVIRFGARRIVVPGNFPIGCLPVYLTGFNTDNPDDYDENHCLKGLNSFATLH  266

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N+ L++A+  L+KE P   I Y DYY AFQ  L  A   GF   +L   CCG GGG+YN+
Sbjct  267   NSLLKKAISELQKENPQVTIAYGDYYGAFQHLLQIAKSRGF---ELQRACCG-GGGEYNF  322

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             ++ ++CG  G  +CP+P +Y+ WDG+H+TQ+A+  +   ++ + L ++ C
Sbjct  323   NQTRMCGYAGATACPDPYRYVSWDGIHMTQEAYHIMVDWLLADFLRKLHC  372



>ref|XP_004230192.1| PREDICTED: acetylajmalan esterase isoform X1 [Solanum lycopersicum]
Length=375

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/350 (41%), Positives = 215/350 (61%), Gaps = 5/350 (1%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             +N +++ C F  IYQFG S+ DTGN IR           R PYG+ F    TGR S+G+L
Sbjct  28    KNPRLMNCRFDKIYQFGDSISDTGNCIRESLCKAQFWCKRPPYGMDFYKHVTGRCSNGML  87

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSG  526
             I+DFIA    LPLLNPY D+NA F +GVNFAV  STA+   FLA+  +  + +    LS 
Sbjct  88    IIDFIAMECDLPLLNPYKDENAEFRHGVNFAVAGSTAISAEFLAENNIDNIGATNSSLSV  147

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ ++  ++      +C ++L  SLF VGEIG N+  F  +Q +TI+E    VP++ 
Sbjct  148   QLDWMSSHFHTT---CSPNCPEKLNNSLFLVGEIGGNEFNFGFLQDKTIEESRKIVPEVV  204

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I++V+ +I  G  RI+VPG FP+GC P  L++F T +   +D+  CL+ +NN  IF 
Sbjct  205   QTIIHSVKRIIGFGATRIIVPGNFPIGCIPFFLTKFMTNNSTAFDKHHCLKDLNNFVIFY  264

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N +LQQA+  L+ ++P+  ++Y DYY AF   L  A  LGF  N L   CCG  GG+YNY
Sbjct  265   NRYLQQAIDELKNDYPNITLIYGDYYNAFMWLLENAVSLGFDNNSLQKACCGI-GGEYNY  323

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + +  CG   V +C +P  +I WDG+H TQ A+  +++ +I ++L ++ C
Sbjct  324   NGHISCGDPMVPACVDPNTHISWDGIHFTQNAYSWLARWLIDDMLPKLNC  373



>emb|CDO98571.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 225/376 (60%), Gaps = 38/376 (10%)
 Frame = +2

Query  95    LPSLT--LNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIG  268
             LP+++   N+  L  L ++  A   E        C F  IYQFG SL DTG         
Sbjct  2     LPTMSSSTNFSFLVALSLFCMAFAAEE-----TTCRFDYIYQFGDSLADTG---------  47

Query  269   PTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVT  448
                                 R+S+GLL++DFIA+A+ LPLL+PYL+ NASF++GVNFAV 
Sbjct  48    --------------------RFSNGLLVIDFIAKALHLPLLHPYLETNASFSHGVNFAVG  87

Query  449   ASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEI  628
              STAL   F A++ +  PS  +PLS Q+ W K +LSS +  + S  K RLKR+L  +GEI
Sbjct  88    GSTALVNSFFAKRNISGPSKNIPLSQQVKWFKKHLSS-VSNSRSQIKKRLKRALIMMGEI  146

Query  629   GRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLS  808
             G ND      QG++++E   +VP +  ++ NAVREVIQ G   +VVPG FP GC P  L+
Sbjct  147   GGNDFNSIFSQGKSLKESRVYVPPVVKAICNAVREVIQFGAVHVVVPGNFPAGCLPKALA  206

Query  809   QFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLA  988
              F + DPK YD+ GCL   N   +  N +LQ+AL SLR EFP+A I Y DYY AF+  L 
Sbjct  207   SFSSADPKAYDDYGCLTESNKFALLFNRYLQKALASLRLEFPNADIRYFDYYKAFEYVLQ  266

Query  989   RAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHL  1168
              A  LGF Q  L   CCG+ G +YN++  KVCGS GV +C NP ++I+WDGVHLTQ  + 
Sbjct  267   NARYLGFDQRSLLKACCGT-GEKYNFNSTKVCGSPGVKACHNPEKFINWDGVHLTQATYH  325

Query  1169  AISQIVIPNILSRIQC  1216
              IS+ +I ++LS ++C
Sbjct  326   YISEHLIRDVLSEMKC  341



>gb|EYU27495.1| hypothetical protein MIMGU_mgv1a020136mg [Erythranthe guttata]
Length=382

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/346 (42%), Positives = 217/346 (63%), Gaps = 8/346 (2%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             +C F  IYQ G S+ DTGNL+R   +G + P A+LPYG TF    TGR S+GLL++D+ A
Sbjct  38    ICRFDKIYQLGDSISDTGNLVREFPVGASTPFAKLPYGETFFKNATGRCSNGLLMIDYFA  97

Query  368   RAVGLPLLNPYLDKNASFT---NGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
              A G+PLL PY + NA+     +GVNFAV  STAL    LA + V  P     L+ Q++W
Sbjct  98    MAAGVPLLPPYKNLNATRDFGHHGVNFAVAGSTALPTEVLASQHVFSPVTASSLNVQLDW  157

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
             + ++ +S+ C    DC ++L+ +LF VGEIG ND  +A+ QG+T+ E+ + VP++  +V+
Sbjct  158   MFSHFNST-CLDDKDCVEKLRHALFMVGEIGGNDYNYAIFQGKTMDELRSMVPEVVDAVM  216

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
             NA R VI  G +R+V+PG FP+GC P   + F T     YD+  CL+ +N    + N  L
Sbjct  217   NATRRVINSGAKRVVIPGNFPIGCLPIYKTAFQTNISTAYDDSQCLKQLNEFAKYHNEQL  276

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             Q+A+  L +E P+A+++Y DYY A++  L  A   GF   K    CCG  GG+YN++  +
Sbjct  277   QEAIEKLVQEKPNAIVVYGDYYNAYEFLLKVARYHGFETEK---ACCGI-GGKYNFNMTR  332

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             +CG+ GV  C +P +Y+ WDGVHLTQK +  ++  ++ NI  ++QC
Sbjct  333   MCGAHGVPVCEDPHRYMSWDGVHLTQKGYRIMAGWLLHNIFPKLQC  378



>ref|XP_006382478.1| hypothetical protein POPTR_0005s02510g [Populus trichocarpa]
 gb|ERP60275.1| hypothetical protein POPTR_0005s02510g [Populus trichocarpa]
Length=373

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 221/365 (61%), Gaps = 14/365 (4%)
 Frame = +2

Query  131   FLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF  310
             FLLV  +++   N  +K   C F++IYQ G S+ DTGNLIR     P  P A  PYG+  
Sbjct  18    FLLVPVSSTRGVNVLKK---CGFKAIYQLGDSIADTGNLIREN---PLSPYASFPYGLKL  71

Query  311   PGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNG---VNFAVTASTALDIGFLA  481
               +PTGR S+GLL++D+IAR+  LP    YL+    F+ G   VNFAV  STAL    L+
Sbjct  72    -SKPTGRCSNGLLMIDYIARSAKLPYPGAYLNSARKFSGGRGGVNFAVAGSTALPAEVLS  130

Query  482   QKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ  661
              K ++       LS Q+ W+ +Y +++ C+   DC   +K SLF VGEIG ND  +A + 
Sbjct  131   SKNIMNIVTNESLSTQLEWMFSYFNTT-CS--KDCAKEIKSSLFMVGEIGGNDYNYAFMF  187

Query  662   GRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD  841
              +T +E++A VP++  ++ +AV + I  G RR+VVPG FP+GCFP  LSQF   D   YD
Sbjct  188   NKTTEEISALVPEVVRAIKDAVAKAIGRGARRVVVPGNFPIGCFPVYLSQFHPNDAAAYD  247

Query  842   ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNK  1021
             E  CL+ +N+L  + N  L+Q +  L+  +PD +I+Y DYY AF S    A  LGF    
Sbjct  248   EFHCLKGLNSLASYHNELLKQTVEGLKTNYPDVIIVYGDYYKAFMSIYQNAQSLGFDTKS  307

Query  1022  LYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNIL  1201
             +   CCG+ GG +N+   ++CG+  V  CP P QYI WDGVHLTQKA+  +++ +I +I 
Sbjct  308   MQKACCGT-GGDHNFSLMRMCGAPDVPVCPKPDQYISWDGVHLTQKAYQHMAEWLINDIF  366

Query  1202  SRIQC  1216
              ++QC
Sbjct  367   PKLQC  371



>ref|XP_004151789.1| PREDICTED: acetylajmalan esterase-like [Cucumis sativus]
Length=356

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 209/343 (61%), Gaps = 21/343 (6%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F +IYQ G S+ DTGNLIR     P  P + LPYG +F   PTGR S+GLL++DF A 
Sbjct  31    CMFDAIYQLGDSISDTGNLIREN---PNTPFSHLPYGQSFFNNPTGRCSNGLLMLDFFAL  87

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQK-GVVVPSITVPLSGQINWLKT  547
               GLPL+ PYL+K+    +GVNFAV  STAL    L+    ++ P  T+ L  +IN    
Sbjct  88    DAGLPLVTPYLNKDGWMDHGVNFAVAGSTALPSQHLSTNYKILSPVTTLFLVVEIN----  143

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
                         C ++L+ +LF VGEIG ND  +AL QG+TIQE    VPD+  ++ +AV
Sbjct  144   ------------CNEKLRSALFLVGEIGGNDYNYALFQGKTIQEAKHMVPDVVRTIKSAV  191

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
              +VI  G  R+VVPG FP+GCFP  L+ F T D   YDEL CL+ +N L  + N+ ++Q 
Sbjct  192   EKVISYGATRVVVPGNFPIGCFPIYLTGFHTNDTSAYDELHCLKDLNGLATYHNDQIKQT  251

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L+KE P  VI+Y DYY AF   +  A +LG+ +  L  +CCG  GG Y ++  K+CG
Sbjct  252   IEVLKKENPQTVIVYGDYYNAFLWVIRHAFVLGYDEESLQKSCCGI-GGDYKFNLMKMCG  310

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + GV +CPNP ++I WDGVHLTQ  +  ++  +I +I  ++ C
Sbjct  311   AAGVEACPNPNEHISWDGVHLTQNTYKFMTHWLIHHIFPKLHC  353



>ref|XP_004230196.1| PREDICTED: GDSL esterase/lipase At5g03980 isoform X1 [Solanum 
lycopersicum]
Length=380

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 157/383 (41%), Positives = 232/383 (61%), Gaps = 11/383 (3%)
 Frame = +2

Query  80    LRLMGLPSLTLNYCILCFLLVYAAASG--VENENQKVVVCPFRSIYQFGASLHDTGNLIR  253
             +R+  L  L L   I+  L + A A    ++ E  K+  C    IYQFG SL DTGN +R
Sbjct  5     IRVAVLHLLILEITIISSLFLQANAQELLIKLEEPKLKKCGINRIYQFGDSLSDTGNCLR  64

Query  254   VGAIGPTLPAARLPYGITFPGRP-TGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNG  430
                 G        PYG+ F  +  TGR S+GLL+VDF+A   GLPLLNP L++NA+F+ G
Sbjct  65    ESYCGAHTGCRFPPYGMNFYQKEITGRCSNGLLMVDFMALECGLPLLNPSLEENANFSQG  124

Query  431   VNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSL  610
              NFAV  +TAL +  LA++ + +      L+ Q++W+ ++ +S IC+  +DC   L++SL
Sbjct  125   SNFAVAGATALSVEQLAERNISMSYTNSTLTVQLHWMSSHFNS-ICS--TDCPKYLEKSL  181

Query  611   FFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGC  790
             F VGEIG +++ +  +QG+TIQE+   VPDI  ++I  V  VI  G  RIVVPG  P GC
Sbjct  182   FLVGEIGGDELAYGFIQGKTIQELRTMVPDIVHAIIRGVTRVISFGATRIVVPGNIPAGC  241

Query  791   FPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAA  970
              P +L+ FGT     YDE GC++  NN  ++ NNHL++ +  L++E+P+  I Y DYY A
Sbjct  242   NPVILTIFGTT----YDEYGCVKEWNNFMMYYNNHLKRGVYMLKREYPNISISYGDYYNA  297

Query  971   FQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHL  1150
             +         LGF +N +   CCG  GG+YNY  +  CG+ GV +C +P  YI WDG+HL
Sbjct  298   YLWLRQNVVALGFDKNSVLKACCGI-GGEYNYRADMRCGNPGVKACADPNSYISWDGIHL  356

Query  1151  TQKAHLAISQIVIPNILSRIQCF  1219
             TQ+A+  +++ +I +I+ ++ C 
Sbjct  357   TQRAYSWLTKWLIDDIIPQLNCL  379



>ref|XP_006382477.1| hypothetical protein POPTR_0005s02500g [Populus trichocarpa]
 gb|ERP60274.1| hypothetical protein POPTR_0005s02500g [Populus trichocarpa]
Length=373

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/365 (42%), Positives = 221/365 (61%), Gaps = 14/365 (4%)
 Frame = +2

Query  131   FLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF  310
             FLLV  +++   N  +K   C F++IYQ G S+ DTGNLIR     P  P A  PYG+  
Sbjct  18    FLLVPVSSTRGVNVLKK---CGFKAIYQLGDSIADTGNLIREN---PLSPYASFPYGLKL  71

Query  311   PGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNG---VNFAVTASTALDIGFLA  481
               +PTGR S+GLL++D+IAR+  LP    YL+    F+ G   VNFAV  STAL    L+
Sbjct  72    -SKPTGRCSNGLLMIDYIARSAKLPCPGAYLNSARKFSGGRGGVNFAVAGSTALPAEVLS  130

Query  482   QKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ  661
              K ++       LS Q+ W+ +Y +++ C+   DC   +K SLF VGEIG ND  +A + 
Sbjct  131   SKNIMNIVTNESLSTQLEWMFSYFNTT-CS--KDCAKEIKSSLFMVGEIGGNDYNYAFMF  187

Query  662   GRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD  841
              +T +E++A VP++  ++ +AV + I  G RR+VVPG FP+GCFP  LSQF   D   YD
Sbjct  188   NKTTEEISALVPEVVRAIKDAVAKAIGRGARRVVVPGNFPIGCFPVYLSQFHPNDAAAYD  247

Query  842   ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNK  1021
             E  CL+ +N+L  + N  L+Q +  L+  +PD +I+Y DYY AF S    A  LGF    
Sbjct  248   EFHCLKGLNSLASYHNELLKQTVEGLKTNYPDVIIVYGDYYKAFMSIYQNAQSLGFDTKS  307

Query  1022  LYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNIL  1201
             +   CCG+ GG +N+   ++CG+  +  CP P QYI WDGVHLTQKA+  +++ +I +I 
Sbjct  308   MQKACCGT-GGDHNFSLMRMCGAPDIPVCPKPDQYISWDGVHLTQKAYQHMAEWLINDIF  366

Query  1202  SRIQC  1216
              ++QC
Sbjct  367   PKLQC  371



>gb|EMT13183.1| hypothetical protein F775_52505 [Aegilops tauschii]
Length=374

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 209/345 (61%), Gaps = 25/345 (7%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPG-----------RPTGRW  334
              C   +IY FG S+ DTGNL+R G +G        PYG T+             +PTGR 
Sbjct  27    ACSIDAIYSFGDSIADTGNLLREGPVGFFSSIGSYPYGQTYRKPCSSPYGQPYRKPTGRC  86

Query  335   SDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITV  514
             SDGLLI+D+ A A+ LPL+NPYLDK+A F+ GVNFAV  +TALD  +L Q  +++P    
Sbjct  87    SDGLLIIDYFAMALDLPLVNPYLDKSADFSGGVNFAVAGATALDRTYLLQNAIIMPPGNT  146

Query  515   PLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFV  694
             PLS Q++W K++L+ +      DC  +L  +LF VGEIG ND  +A  Q R+I+ V A+V
Sbjct  147   PLSSQLDWFKSHLNDTC---QQDCAKKLAGALFLVGEIGGNDYNYAFFQKRSIEAVKAYV  203

Query  695   PDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNL  874
             P           EVI++G  +I++PG FP+GC P+ L+ F      D+DE GCL+S N  
Sbjct  204   P----------LEVIELGATQIIIPGNFPIGCSPSYLALFSAAGSTDHDERGCLKSYNAF  253

Query  875   TIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGG  1054
               + N  LQ A+G L K   D  ++YADYY AF   L  A +LGF +  L   CCG+ GG
Sbjct  254   AAYHNEQLQAAIGDLLKVNADVSVVYADYYGAFLHLLDHAAVLGFDEGSLLKACCGA-GG  312

Query  1055  QYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             ++N+D + +CG  G  +C +P +++ WDG+HLTQ+A+ A++  ++
Sbjct  313   EHNFDMDMMCGGLGASTCADPARHVSWDGIHLTQQAYRAMALSIL  357



>ref|XP_006367846.1| PREDICTED: acetylajmalan esterase-like [Solanum tuberosum]
Length=384

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/350 (43%), Positives = 219/350 (63%), Gaps = 5/350 (1%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRP-TGRWSDGL  346
             E  K+  C    IYQFG SL DTGN +R             PYG+ F  +  TGR S+GL
Sbjct  37    EEGKMKKCGINRIYQFGDSLSDTGNCLRETYCRAHSGCRFPPYGMNFYQKAVTGRCSNGL  96

Query  347   LIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSG  526
             L++DFIA   GLPLLNP L++NA F++G NFAV+ +TAL +  LA+K + +      LS 
Sbjct  97    LMIDFIALECGLPLLNPSLEENADFSHGANFAVSGATALSVESLAKKKIHMSYTNSTLSV  156

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q+ W+ ++ +S +C+  +DC   L+ SLF VGEIG +++T+ L QG+T++E+   VPDI 
Sbjct  157   QLQWMSSHFNS-VCS--TDCPKYLENSLFLVGEIGGDELTYGLNQGKTMEELRRMVPDIV  213

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I  VR VI  G  RIVVPG  P GC P +L+ FGT+    YDE GC++  NN  ++ 
Sbjct  214   HAIIRGVRRVISFGATRIVVPGNIPAGCNPVILTIFGTRPSTTYDEYGCVKEWNNFIMYY  273

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             NN+L++ +  L++E+P+  I+Y DYY+A+         LGF +N +   CCG  GG YNY
Sbjct  274   NNYLKRGIHMLKREYPNISIIYGDYYSAYLWLRQNVVALGFDKNFVLKPCCGI-GGDYNY  332

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
               +  CG  GV +C +P  YI WDG+HLTQKA+  +++ +I +I+ ++ C
Sbjct  333   REDMKCGDPGVEACADPNIYISWDGLHLTQKAYSWLTKWLIDDIIPQLNC  382



>dbj|BAK05927.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 203/328 (62%), Gaps = 10/328 (3%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNL +    G       LPYG+TF GRPTGR SDGLL++DF+A+ +GL
Sbjct  31    AIYSLGDSITDTGNLAKEAPPGAFETIKHLPYGVTF-GRPTGRCSDGLLMIDFLAQDMGL  89

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P LNPYL KN SF +GVNFAV  +TA+D      +       T  L  Q+ W K ++ S+
Sbjct  90    PFLNPYLAKNRSFDHGVNFAVAGATAMDTDDQLNR-------TFSLKLQLRWFKDFMKST  142

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
                   + + RL+ SL  VGEIG ND  +AL   +++ EV   +P +  ++I+A +EV+ 
Sbjct  143   F-NTDQEIRKRLQSSLVLVGEIGGNDYNYALFGNQSVSEVEKLIPAVVQTIIDATKEVLD  201

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLR  922
             +G  R++VPG FP+GCFP+ L+   + +   YD  GCL+ +N      N  LQ+A+  LR
Sbjct  202   MGASRVIVPGNFPIGCFPSYLTAMASPEQSAYDSAGCLKDLNLFAAKHNAQLQRAVAGLR  261

Query  923   KEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVI  1102
               +PDA I YADY+ +F S L  AP LGF  +  +  CCG+ GG+YNYD  ++CG  G +
Sbjct  262   ASYPDAAIAYADYFNSFLSLLKGAPALGFDADSTHKACCGA-GGKYNYDERQMCGVEGTV  320

Query  1103  SCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
             +C +P  Y+ WDG+H+TQ A+ A+ +++
Sbjct  321   ACADPSTYVSWDGIHMTQAAYKAMFRLI  348



>ref|XP_006472123.1| PREDICTED: acetylajmalan esterase-like [Citrus sinensis]
Length=377

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 218/372 (59%), Gaps = 14/372 (4%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             ++CF L+  A S +    Q +  C   SIYQ G S+ DTGNLI+     P    A+LPYG
Sbjct  13    LICFFLL--APSPLPCNAQTLKTCGLNSIYQLGDSVSDTGNLIQEH---PESAFAKLPYG  67

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFT---NGVNFAVTASTALDIG  472
              TF    TGR S+GLL++D+ A + G+P ++ +L+ NAS     +GVNFAV  STAL   
Sbjct  68    ETFFKNATGRCSNGLLMIDYFAISAGIPFVDAFLNSNASLYIQGHGVNFAVAGSTALPSY  127

Query  473   FLAQKGVVVPSITVPLSGQINWLKTYLSSSIC----AAPSDCKDRLKRSLFFVGEIGRND  640
              LA K +  P     LS Q++W+ TY +  IC         C  +LK SLF VGEIG ND
Sbjct  128   ILADKKISSPVTNSSLSTQLDWMFTYFNG-ICYDYDGKCRYCAQKLKSSLFIVGEIGEND  186

Query  641   ITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGT  820
               +AL QG+T++EV   VP++  ++ +AV  VI  G  R+VVPG FP+GCFP  L+QF T
Sbjct  187   YKYALFQGKTVEEVKTLVPEVVQAIKDAVTRVIDFGAVRVVVPGNFPVGCFPIYLTQFRT  246

Query  821   QDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPL  1000
              D   YD+  CL+ +NNL+   N  LQQA+  L+ E P+  I+Y DYY AF   L     
Sbjct  247   NDSAAYDQFHCLKCLNNLSFHHNELLQQAIQELKNEHPNVAIIYGDYYTAFMWILGHVRT  306

Query  1001  LGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             L F    +   CCG  GG Y+++  K+CG +GV  C N  + I WDGVHLTQKA+  ++ 
Sbjct  307   LEFDNGSMQKACCGI-GGDYDFNLTKMCGMSGVPVCENLDKRISWDGVHLTQKANKYMAM  365

Query  1181  IVIPNILSRIQC  1216
              +I +I  ++ C
Sbjct  366   WLIRDIFPKLWC  377



>ref|XP_002528395.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF33988.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=379

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 220/347 (63%), Gaps = 12/347 (3%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF-PGRPTGRWSDGLLIVDFI  364
              C F +IYQ G S+ DTGNL++     P+    RLPYG  F   +PTGR S+GLL++D+I
Sbjct  32    ACNFDAIYQLGDSISDTGNLVQED---PSSFCGRLPYGQNFFNNKPTGRCSNGLLMIDYI  88

Query  365   ARAVGLPLLNPYL-DKNASFTN-GVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             A + G+PLLNPYL + NAS  N GVNFAV  STAL    LA+K V+ P     L+ Q+NW
Sbjct  89    ALSAGVPLLNPYLINPNASDHNRGVNFAVAGSTALPADVLARKRVLAPVTNSSLTIQLNW  148

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
             +  + +++        K R  +SLF VGEIG ND  +AL QG+T+ EV + VP++  ++ 
Sbjct  149   MSAHFNTTC----DRDKCRHNKSLFMVGEIGGNDYNYALFQGKTVGEVKSMVPEVVQAIK  204

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
              AV +VI  G  R+VVPG FP+GC P  L+ F T D   YDEL CL+ +N+L+++ N  L
Sbjct  205   TAVNKVIGYGATRVVVPGNFPIGCLPIYLTGFHTNDSAAYDELHCLKGLNSLSVYHNEKL  264

Query  899   QQALGSLRKEFPD-AVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRN  1075
             QQA+  L++E  + AV+LY DYY A++  L +A  LGF    L   CCG  GG Y++   
Sbjct  265   QQAIEELQQEHQNAAVLLYGDYYNAYKWVLLKAAWLGFDLQSLQKACCGI-GGDYDFSFG  323

Query  1076  KVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             ++CG  GV  CP P + I WDG+H T+KA+L +++++I ++  + QC
Sbjct  324   RMCGVAGVAVCPKPQERISWDGIHPTEKAYLYMARLLIRDMSQKFQC  370



>ref|XP_011095809.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Sesamum indicum]
Length=367

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/343 (43%), Positives = 214/343 (62%), Gaps = 11/343 (3%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             +C F  IYQ G S+ DTGNLIR   IG     ARLPYG TF    TGR S+GLL++D+I 
Sbjct  34    ICKFDQIYQLGDSISDTGNLIREVPIGAATAFARLPYGQTFFKNATGRCSNGLLMIDYIG  93

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             +      +  YL  +  F +GVNFAV  STAL    LA + +  P  T  L+ Q++W+ T
Sbjct  94    KV----FIPTYLVLD--FEHGVNFAVAGSTALPSQVLAAQHIFSPVTTSSLNVQLDWMFT  147

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + SS IC    DC ++L+ +LF VGEIG ND  +A+ QG+T++E+ + VPD+  ++++A 
Sbjct  148   HFSS-ICLNSRDCAEKLQNALFMVGEIGGNDYNYAIFQGKTMEELRSMVPDVVATIVDAA  206

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             R VI+VGG R+V+PG FP+GC P   + F T     YD+  CL+ +N+   + N  LQ A
Sbjct  207   RRVIEVGGNRVVIPGNFPIGCLPIYKTAFQTNISAAYDKNHCLKHLNDFAKYHNKELQNA  266

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             + +L++E P+AVI+Y DYY A+Q  L  A   GF + K    CCG+ GG+YN++  ++CG
Sbjct  267   IYTLKQEKPNAVIVYGDYYNAYQFLLQVATSHGFEREK---ACCGT-GGKYNFNMTRMCG  322

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
               GV  C NP +Y+ WDGVHLTQ+ +  ++  ++ NI   + C
Sbjct  323   GAGVKVCSNPKRYMSWDGVHLTQEGYKIMAAWLVNNIFPHLLC  365



>ref|XP_010684946.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Beta vulgaris 
subsp. vulgaris]
Length=345

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/337 (44%), Positives = 210/337 (62%), Gaps = 3/337 (1%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IYQFG S+ DTGNLIR   IG     ARLPYG  F  +PTGR S+GLL++DFIA    L
Sbjct  7     AIYQFGDSISDTGNLIREDPIGSHSAFARLPYGQNFFHKPTGRCSNGLLMIDFIAEYFKL  66

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P L+ YL+K   F +GVNFAV+ STAL    LA K ++ P     L  Q+ W K++L S 
Sbjct  67    PFLDAYLNKAGKFKHGVNFAVSGSTALTTSTLATKNILSPVTNSSLPVQLGWFKSHLQS-  125

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
             +C   SDCK +L  +LF + E G ND  +A  Q +++Q+V   V ++   + + V+EVI 
Sbjct  126   LCKHSSDCKHKLANALFII-ETGGNDFNYAFFQQKSLQDVQQMVDEVIQGITSVVQEVIS  184

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLR  922
              G  ++V+PG FP+GC P  LS F T D   YDEL CL+ +N    F+N+HLQ+A+  L+
Sbjct  185   SGATQVVIPGNFPIGCMPIYLSDFQTNDSNMYDELHCLKGLNEFVTFQNDHLQEAIRKLQ  244

Query  923   KEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVI  1102
             ++ P   I+YADYY A +  L  A  LGF ++++  TCCG G  +YN++   +CG  GV 
Sbjct  245   EQHPKVAIVYADYYNALRELLKHAASLGFEKDEVQKTCCGIGNNEYNFNVTSMCGHNGVP  304

Query  1103  SCPNPPQYIHWDGVHLTQKAHLAISQIVI-PNILSRI  1210
              C +P + + WDGVH+TQ A+  +++ ++  NI+  I
Sbjct  305   VCKHPYERVSWDGVHMTQHAYKLMARWLLKKNIIHGI  341



>ref|XP_011087121.1| PREDICTED: acetylajmalan esterase-like [Sesamum indicum]
Length=300

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 191/295 (65%), Gaps = 5/295 (2%)
 Frame = +2

Query  104  LTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPA  283
            L  N   +CF ++    +    + +    CPF  IY  G  + D GN IR    GP LPA
Sbjct  4    LCCNSVFICFFVLLLTGTISSQQPR----CPFNYIYHLGDGVADNGNAIRTLPFGPGLPA  59

Query  284  ARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTAL  463
            ARLPYG T+PGRPTGRWSDG LI+DF A  +GL  L PYLD N S  +GV FAV  S  L
Sbjct  60   ARLPYGETYPGRPTGRWSDGRLIIDFAATVLGLTRLKPYLDTNTSSNDGVIFAVAGSPVL  119

Query  464  DIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDI  643
            D  F   KGV +P+   PL+ Q NW + YL + +C+ P++C  RL  SL   G+I  NDI
Sbjct  120  DRFFYLNKGVTIPNYAAPLNLQHNWFRRYLMNFVCSTPTECAGRLGDSLLLFGDIEGNDI  179

Query  644  TFALVQGRTIQEVAA-FVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGT  820
             + L+QG++IQ++   +VP +T + IN  RE+I+ G +R++VPG  PLGC+P +LS+F +
Sbjct  180  HYPLLQGKSIQDIQTNYVPFVTQTTINTTRELIRAGAKRVIVPGNVPLGCYPYILSEFPS  239

Query  821  QDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFL  985
             DP  YD+LGCL+S+NNL +F+NNHL+ +L SL+ EFP+  IL+ADY+   ++ L
Sbjct  240  NDPTAYDDLGCLKSVNNLVLFKNNHLRTSLDSLKLEFPNVTILFADYFTTVKTVL  294



>ref|XP_010695793.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=374

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/329 (44%), Positives = 206/329 (63%), Gaps = 1/329 (0%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IYQFG S+ DTGNLIR   IG     ARLPYG  F  +PTGR S+GLL++DFIA    L
Sbjct  35    AIYQFGDSISDTGNLIREDPIGSHSAFARLPYGQNFFHKPTGRCSNGLLMIDFIAEYFKL  94

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             PLL+ YL+K  +F +GVNFAV  ST L    LA K ++ P     L  Q+ W K++L S 
Sbjct  95    PLLDAYLNKAGNFKHGVNFAVAGSTTLTTSTLAAKKILSPVTNSSLPVQLGWFKSHLDSI  154

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
                  SDCK +L  +LF + E G ND  +A  Q +++Q+V   V ++   + +AV+EVI 
Sbjct  155   CKHYSSDCKHKLANALFII-ETGGNDFNYAFFQQKSLQDVQQMVDEVIQGITSAVQEVIS  213

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLR  922
             +G  ++V+PG FP+GC P  LS F   D K YDEL CL+ +N    F+N+HLQ+A+  L+
Sbjct  214   LGATQVVIPGNFPIGCMPIYLSTFQMNDSKMYDELHCLKGLNEFATFQNDHLQEAIRKLQ  273

Query  923   KEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVI  1102
             ++ P   I+YADYY A +  L  A  LGF ++++  TCCG G  +YN++   +CG  GV 
Sbjct  274   EQHPKVAIVYADYYNALRELLKHATSLGFEKDQVQKTCCGIGNNEYNFNMTSMCGYNGVP  333

Query  1103  SCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              C +P + I WDGVH+TQ A+  +++ ++
Sbjct  334   VCKHPYERISWDGVHMTQHAYKLMARWLL  362



>ref|XP_010673153.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/337 (44%), Positives = 210/337 (62%), Gaps = 3/337 (1%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IYQFG S+ DTGNLIR   +G     ARLPYG  F  +PTGR S+GLL++DFIA    L
Sbjct  36    AIYQFGDSISDTGNLIREDPVGSHSAFARLPYGQNFFHKPTGRCSNGLLMIDFIAEYFKL  95

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P L+ YL+K  +F +GVNFAV  ST L    LA K ++ P     L  Q+ W K++L S 
Sbjct  96    PFLDAYLNKAGNFKHGVNFAVAGSTTLTTSTLAAKNILSPVTNSSLPVQLGWFKSHLQS-  154

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
             +C   SDCK +L  +LF + E G ND  +A  Q +++Q+V   V ++   + +AV+EVI 
Sbjct  155   LCKHSSDCKHKLANTLFII-ETGGNDFNYAFFQQKSLQDVQQMVDEVIQGITSAVQEVIS  213

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLR  922
              G  +IV+PG FP+GC P  LS F T D   YDEL CL+ +N    F+N+HLQ+A+  L+
Sbjct  214   SGATQIVIPGNFPIGCMPIYLSAFQTNDANMYDELHCLKGLNEFATFQNDHLQEAIRKLQ  273

Query  923   KEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVI  1102
             ++ P   I+YADYY A +  L  A  LGF ++++  TCCG G  +YN++   +CG  GV 
Sbjct  274   EQHPKVAIVYADYYNALRELLKHAASLGFKKDEVQKTCCGIGNNEYNFNITSMCGYNGVP  333

Query  1103  SCPNPPQYIHWDGVHLTQKAHLAISQIVI-PNILSRI  1210
              C +P + + WDGVH+TQ A+  +++ ++  NI+  I
Sbjct  334   VCKHPYERVSWDGVHMTQHAYKLMARWLLKKNIIHGI  370



>gb|ADQ08655.1| GDSL-lipase [Sorghum bicolor]
Length=383

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/341 (42%), Positives = 206/341 (60%), Gaps = 9/341 (3%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNL++    G       LPYG+TF G PTGR SDGLL++DF+A+ +GL
Sbjct  37    AIYSLGDSITDTGNLVKEAPPGMFETIKHLPYGVTF-GHPTGRCSDGLLMIDFLAQDLGL  95

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P LNPYL KN SF +GVNFAV  +TA+D        V VP  +  L  Q+ W K +L  +
Sbjct  96    PFLNPYLGKNKSFDHGVNFAVAGATAVDPADQYNVTVPVPVASNSLKVQLRWFKDFLKYT  155

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
                   + + RL+ SL  VGEIG ND  +A  + + + EV   +P +  ++I+A +EV+ 
Sbjct  156   F-GTDQEIRRRLRTSLVLVGEIGGNDYNYAFFEDKPVAEVEKLIPGVVKTIIDAAKEVLD  214

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQ-DPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
             +G  R++VPG FP+GC P  L+    + +P DYD  GCLR +N+     N+ L++A+  L
Sbjct  215   MGASRVIVPGNFPIGCVPGYLAMNAAKSEPADYDSAGCLRELNDFAAKHNSRLRRAVADL  274

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             +  +P A + YADY+ +F + L  A LLGF        CCG+GGG+YN+D  ++CG  G 
Sbjct  275   QASYPHAAVAYADYFDSFLTLLHNASLLGFDAASTRKACCGAGGGEYNFDWRRMCGFNGA  334

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVI------PNILS  1204
              +C  P  Y+ WDG+H+TQ A+ A+S+++       P ILS
Sbjct  335   AACAEPSTYLSWDGIHMTQAAYRAMSRLIYHGKYLHPQILS  375



>ref|XP_010696564.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   293 bits (750),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 210/333 (63%), Gaps = 4/333 (1%)
 Frame = +2

Query  200   RSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
              +IYQFG S+ DTGN IR     P    A LPYG +F  +PTGR S+GLLI+D+I++   
Sbjct  64    ETIYQFGDSISDTGNFIREH---PNSNFANLPYGESFFHQPTGRCSNGLLIIDYISKFYN  120

Query  380   LPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             LP L+PYL+K+ +F++GVNFAV  +TAL+   LA K  +  +    L  Q++W KT+L+S
Sbjct  121   LPFLDPYLNKHGNFSHGVNFAVAGATALNASTLAMKHSLSCTTNSSLLVQLDWFKTHLNS  180

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
              IC+  S+CK +L ++L  +GEIG ND  +A  QG+ I+E+   VP++   V   ++EVI
Sbjct  181   -ICSDASECKKKLGKALIMMGEIGGNDYNWAFFQGKPIKEIYKLVPEVIHVVKYVIKEVI  239

Query  740   QVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
              +G  R++VPG FP+GC    L  F T D + YDEL CL+S+NN   F+N+ +Q+A+G +
Sbjct  240   SLGATRVIVPGNFPIGCMAVYLEAFKTNDARMYDELQCLKSLNNFAEFQNDRIQEAIGEI  299

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             + + PD  I YADY++A +  L  A   GF ++ +   CCG    + + +    CG  G 
Sbjct  300   QTDHPDVSIQYADYFSALKEILQHATSFGFDKDIMQTPCCGLSNHEAHLNSGIECGRKGT  359

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNI  1198
             I C +P +++ WDG+HLTQ  +  +++++I  I
Sbjct  360   IVCKDPYKHLSWDGMHLTQHGYQIMAELLIKRI  392



>ref|XP_007029519.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY10021.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
Length=386

 Score =   292 bits (748),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 220/344 (64%), Gaps = 7/344 (2%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F +I+Q G S+ DTGN I+     P+   ARLPYG TF  + TGR S+GLL++D++A 
Sbjct  38    CKFDAIHQVGDSISDTGNYIQEN---PSSVYARLPYGETFFKKATGRCSNGLLMIDYLAL  94

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             +  +P L+ YL+K+  F +GVNFAV  +TAL +  L+++ +        LS Q++W+ +Y
Sbjct  95    SAEIPFLDAYLNKDGLFDHGVNFAVAGATALSVEVLSKRNISSVPTNKSLSNQLDWMFSY  154

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGR-TIQEVAAFVPDITTSVINAV  727
              + + C    DC  +  R+LF VGEIG ND  +A   G  T++EV A VP++  ++  AV
Sbjct  155   FNRT-CRYDKDCFIKNGRALFMVGEIGGNDYNYAFQIGNLTLEEVEAMVPEVVQAIKYAV  213

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             + VI  G  R+VVPG FP+GCFP  L++F T D   YD+L CL+ +NN++I+ N+ LQQA
Sbjct  214   KRVIGYGATRLVVPGNFPIGCFPVYLTKFQTNDTTAYDDLHCLKYLNNISIYHNDLLQQA  273

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L++E P+ +I+Y +YY AFQ  L++A LLGF    +   CCG  GG+YN+D ++ C 
Sbjct  274   IEELKEEHPNVIIVYGNYYTAFQWLLSKANLLGFDPTSVQKACCGI-GGKYNFDPSRWCA  332

Query  1088  ST-GVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
                 V  C NP + + WDGVHLTQ+A+  ++  +I +I  ++QC
Sbjct  333   KYPEVTVCLNPDERLSWDGVHLTQRAYELMAAWLIRDIYPKLQC  376



>ref|XP_010673156.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   291 bits (746),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 209/337 (62%), Gaps = 3/337 (1%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IYQFG S+ DTGNLIR   +G     ARLPYG  F  +PTGR S+GLL++DFIA    L
Sbjct  36    AIYQFGDSISDTGNLIREDPVGSHSAFARLPYGQNFFHKPTGRCSNGLLMIDFIAEYFKL  95

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P L+ YL+K  +F +GVNFAV  ST L    LA K ++ P     L  Q+ W K++L S 
Sbjct  96    PFLDAYLNKAGNFKHGVNFAVAGSTTLTTSTLAAKNILSPVTNSSLPVQLGWFKSHLQS-  154

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
             +C   SDCK +L  +LF + E G ND  +A  Q +++Q+V   V  +   + +AV+EVI 
Sbjct  155   LCKHSSDCKHKLTNALFII-ETGGNDFNYAFFQQKSLQDVQEMVDKVIQGITSAVQEVIS  213

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLR  922
              G  ++V+PG FP+GC P  LS F T D   YDEL CL+ +N    F+N+HLQ+A+  L+
Sbjct  214   SGATQVVIPGNFPIGCMPIYLSAFQTNDSNMYDELHCLKGLNEFATFQNDHLQEAIKKLQ  273

Query  923   KEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVI  1102
             ++ P   I+YADYY A +  L  A  LGF ++++  TCCG G  +YN++   +CG  GV 
Sbjct  274   EQHPKVAIVYADYYNALRELLKHAASLGFKKDEVQKTCCGIGNNEYNFNITSMCGYNGVP  333

Query  1103  SCPNPPQYIHWDGVHLTQKAHLAISQIVI-PNILSRI  1210
              C +P + + WDGVH+TQ A+  +++ ++  NI+  I
Sbjct  334   ICKHPYERVSWDGVHMTQHAYKLMARWLLKKNIIHGI  370



>ref|XP_010673174.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=374

 Score =   291 bits (746),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 215/338 (64%), Gaps = 3/338 (1%)
 Frame = +2

Query  200   RSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
              +IYQFG S+ DTGNLIR   +G     ARLPYG T+  + TGR S+GLL++D+IA    
Sbjct  35    EAIYQFGDSISDTGNLIRENPVGSHTAFARLPYGETYFHKQTGRCSNGLLMIDYIAENFN  94

Query  380   LPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             LPLL+ YL+K  +F +GVNFAV  STAL    LA K ++ P     LS Q+ W +++L S
Sbjct  95    LPLLDAYLNKGGNFNHGVNFAVAGSTALTTSTLAAKNILSPVTNSSLSVQLGWFRSFLHS  154

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
              IC+ P + + +L  +LF + E G ND  +A  Q +++Q+V   V ++  ++   V+E+I
Sbjct  155   -ICSHPFEYQPKLANALFII-ETGGNDFNYAFFQQKSLQQVQQMVDEVLQAITTTVKELI  212

Query  740   QVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
              +G  + V+PG FP+GC P  LS F ++D K YDEL CL+ +N    F+NNHL++A+  L
Sbjct  213   TLGATKFVIPGNFPIGCLPIYLSTFQSKDTKMYDELHCLKDLNEFATFQNNHLERAIKEL  272

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             + ++P+  I+YADYY A +  L  A  LGF+++++   CCG G  +YN++   +CG  GV
Sbjct  273   QIQYPNVAIVYADYYNALRGLLTNAASLGFNKSEVQKACCGIGKNEYNFNMTSMCGYKGV  332

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVI-PNILSRI  1210
               C NP + + WDGVH+TQ A+  +++ +I  NIL  I
Sbjct  333   TVCENPDKSVSWDGVHMTQHAYQLMARWLIKKNILPGI  370



>gb|ADQ08656.1| GDSL-lipase [Sorghum bicolor]
Length=383

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/341 (42%), Positives = 205/341 (60%), Gaps = 9/341 (3%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNL++    G       LPYG TF G PTGR SDGLL++DF+A+ +GL
Sbjct  37    AIYSLGDSITDTGNLVKEAPPGMFETIKHLPYGATF-GHPTGRCSDGLLMIDFLAQDLGL  95

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P LNPYL KN SF +GVNFAV  +TA+D        V VP  +  L  Q+ W K +L  +
Sbjct  96    PFLNPYLGKNKSFDHGVNFAVAGATAVDPADQYNVTVPVPVASNSLKVQLRWFKDFLKYT  155

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
                   + + RL+ SL  VGEIG ND  +A  + + + EV   +P +  ++I+A +EV+ 
Sbjct  156   F-GTDQEIRRRLRTSLVLVGEIGGNDYNYAFFEDKPVAEVEKLIPGVVKTIIDAAKEVLD  214

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQ-DPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
             +G  R++VPG FP+GC P  L+    + +P DYD  GCLR +N+     N+ L++A+  L
Sbjct  215   MGASRVIVPGNFPIGCVPGYLAMNAAKSEPADYDSAGCLRELNDFAAKHNSRLRRAVADL  274

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             +  +P A + YADY+ +F + L  A LLGF        CCG+GGG+YN+D  ++CG  G 
Sbjct  275   QASYPHAAVAYADYFDSFLTLLHNASLLGFDAASTRKACCGAGGGEYNFDWRRMCGFNGA  334

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVI------PNILS  1204
              +C  P  Y+ WDG+H+TQ A+ A+S+++       P ILS
Sbjct  335   AACAEPSTYLSWDGIHMTQAAYRAMSRLIYHGKYLHPQILS  375



>ref|XP_006286793.1| hypothetical protein CARUB_v10003448mg, partial [Capsella rubella]
 gb|EOA19691.1| hypothetical protein CARUB_v10003448mg, partial [Capsella rubella]
Length=306

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 154/343 (45%), Positives = 206/343 (60%), Gaps = 43/343 (13%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             CP  SIYQFG S+ DTGNLIR G +G     ARL                          
Sbjct  2     CPITSIYQFGDSISDTGNLIRNGPVG-----ARL--------------------------  30

Query  371   AVGLPLLNPYLD-----KNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQIN  535
               GLPLLNPYL+     K +S+ NGVNFAV+ STAL+  F A + + VP+  +PLS Q+ 
Sbjct  31    --GLPLLNPYLNGTTVTKPSSYKNGVNFAVSGSTALNSSFFAARNLHVPATNIPLSTQLA  88

Query  536   WLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSV  715
             W K++L S+   APS   D LK+SLF +GEIG ND  +   QG+ ++E+ +++P +  ++
Sbjct  89    WFKSHLLSTCQGAPSS--DCLKQSLFMMGEIGGNDYNYGFFQGKPMEEIRSYIPHVVGAI  146

Query  716   INAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNH  895
               A REVI+ G   +VVPG FP+GCFP  L+ F  +DPK YD+ GCL+ +N   +  NN 
Sbjct  147   TAAAREVIRTGAVNVVVPGNFPVGCFPIYLTSFPVKDPKAYDDQGCLKHLNEFAMDHNNQ  206

Query  896   LQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRN  1075
             LQ+A+ SLRKEFP   I+Y DYY AFQ+ L       F ++    +CCG GG  YNYD  
Sbjct  207   LQEAIASLRKEFPHVAIVYGDYYNAFQNVLRSEGR--FDKSVALKSCCGIGGA-YNYDGK  263

Query  1076  KVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILS  1204
             + CG+ GV  C NP ++I WDGVHLTQKA+  +S+ +   ILS
Sbjct  264   RPCGAAGVPVCQNPNKFISWDGVHLTQKAYRFMSKFLNNQILS  306



>ref|XP_011095811.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Sesamum indicum]
Length=348

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/344 (43%), Positives = 207/344 (60%), Gaps = 32/344 (9%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             +C F  IYQ G S+ DTGNLIR   IG     ARLPYG TF    TGR S+GLL++D+IA
Sbjct  34    ICKFDQIYQLGDSISDTGNLIREVPIGAATAFARLPYGETFFKNATGRCSNGLLMIDYIA  93

Query  368   RAVGLPLLNPYLDKNAS-FTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLK  544
              A GLP L PY + +A+ F +GVNFAV  STAL    LA + +                 
Sbjct  94    IAAGLPFLPPYKNLDAADFEHGVNFAVAGSTALPSQVLAAQHIF----------------  137

Query  545   TYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINA  724
                        SDC ++L+ +LF VGEIG ND  +A+ QG+T++E+ + VPDI  ++++A
Sbjct  138   -----------SDCAEKLQNALFMVGEIGGNDYNYAIFQGKTMEELRSMVPDIVATIVDA  186

Query  725   VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQ  904
              R VI+VGG R+V+PG FP+GC P   + F T     YD+  CL+ +N+   + N  LQ 
Sbjct  187   ARRVIEVGGNRVVIPGNFPIGCLPIYKTAFQTNISAAYDKNHCLKHLNDFAKYHNKELQN  246

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
             A+ +L++E P+AVI+Y DYY A+Q  L  A   GF + K    CCG+ GG+YN++  ++C
Sbjct  247   AIHTLKQEKPNAVIVYGDYYNAYQFLLQVATSHGFEREK---ACCGT-GGKYNFNMTRMC  302

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             G  GV  C NP +Y+ WDGVHLTQ+ +  ++  ++ NI   + C
Sbjct  303   GGAGVKVCSNPKRYMSWDGVHLTQQGYKIMAAWLVNNIFPHLLC  346



>ref|XP_003572697.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=405

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/351 (41%), Positives = 202/351 (58%), Gaps = 18/351 (5%)
 Frame = +2

Query  185   VVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFI  364
             +V    +I+ FG S+ DTGN IR GA+G       LPYG       TGR SDG L++D +
Sbjct  38    IVDGITAIFNFGDSISDTGNFIREGAVGMMRHTGVLPYGSAIADGATGRCSDGYLMIDNL  97

Query  365   ARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLK  544
             A+ +GLPLL PYLDK A FT+GVNFAVT STAL    LA++G+ VP     L  Q+ W K
Sbjct  98    AKDLGLPLLKPYLDKGADFTHGVNFAVTGSTALTTAALARRGITVPHTNSSLDVQLKWFK  157

Query  545   TYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQ----------------  676
              +++++   +P + +D+L  SL  +GEIG ND  +A V  +                   
Sbjct  158   DFMAATT-KSPQEIRDKLGSSLVLMGEIGGNDYNYAFVTNKPAAAAEGSIYNAIRTTVGA  216

Query  677   -EVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGC  853
              E  A VP++  SV++A RE++++G  R+V+PG FP+GC P+ LS    +DP  YD  GC
Sbjct  217   VEAMALVPEVVQSVLDAARELLEMGATRMVIPGNFPVGCVPSYLSAVDEKDPAAYDGNGC  276

Query  854   LRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMT  1033
             L  +N      N  LQ+ +  LR  +PDA I YADY++A+   L  A  +GF        
Sbjct  277   LIGLNFFAQMHNVALQRGIRELRGAYPDATISYADYFSAYVRLLRDAGRMGFDSAAATKA  336

Query  1034  CCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
             CCG G G YN D +++CG+ G   C  P +Y+ WDGVHLTQ A+  +S ++
Sbjct  337   CCGVGRGAYNVDMDRMCGAPGTTVCARPNEYVSWDGVHLTQHAYKVLSDLL  387



>ref|XP_010312718.1| PREDICTED: acetylajmalan esterase isoform X2 [Solanum lycopersicum]
Length=366

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/350 (40%), Positives = 213/350 (61%), Gaps = 14/350 (4%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             +N +++ C F  IYQFG S+ DTGN IR           R PYG+ F    TGR S+G+L
Sbjct  28    KNPRLMNCRFDKIYQFGDSISDTGNCIRESLCKAQFWCKRPPYGMDFYKHVTGRCSNGML  87

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSG  526
             I+DFIA    LPLLNPY D+NA F +GVNFAV  STA+   FLA+  +  + +    LS 
Sbjct  88    IIDFIAMECDLPLLNPYKDENAEFRHGVNFAVAGSTAISAEFLAENNIDNIGATNSSLSV  147

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ ++  ++      +C ++L  SLF VGEIG N+  F  +Q +TI+E    VP++ 
Sbjct  148   QLDWMSSHFHTT---CSPNCPEKLNNSLFLVGEIGGNEFNFGFLQDKTIEESRKIVPEVV  204

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I++V+ +I  G  RI+VPG FP+GC P  L++F T +   +D+  CL+ +NN  IF 
Sbjct  205   QTIIHSVKRIIGFGATRIIVPGNFPIGCIPFFLTKFMTNNSTAFDKHHCLKDLNNFVIFY  264

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N +LQQA+  L+ ++P+  ++Y DYY AF   L         +N + + CCG  GG+YNY
Sbjct  265   NRYLQQAIDELKNDYPNITLIYGDYYNAFMWLL---------ENAVSLACCGI-GGEYNY  314

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             + +  CG   V +C +P  +I WDG+H TQ A+  +++ +I ++L ++ C
Sbjct  315   NGHISCGDPMVPACVDPNTHISWDGIHFTQNAYSWLARWLIDDMLPKLNC  364



>dbj|BAK06896.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 205/347 (59%), Gaps = 21/347 (6%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY FG S+ DTG+L+R G  G      RLPYG+T  GRPTGR SDG L++D +A+ +GL
Sbjct  41    AIYNFGDSISDTGSLLREGDTGMLRYTTRLPYGVTI-GRPTGRCSDGFLMIDVLAKDLGL  99

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             PLLNPYLD+ A FT+GVNFAV  +TAL    LA +G+ VP     L  Q+ W K ++SS+
Sbjct  100   PLLNPYLDRRADFTHGVNFAVAGATALSTTALANRGISVPHTNSSLGVQLGWFKQFMSST  159

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGR-----------------TIQEVAAF  691
                +P D + +L  SL  +GEIG ND  +  +Q R                 ++    + 
Sbjct  160   T-NSPRDIRKKLASSLVMLGEIGGNDYNYVFLQPRRTSDRYDPISNATRSAESLARALSL  218

Query  692   VPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY-DELGCLRSIN  868
             VP++  ++  A +EV+ +G  R+V+PG FP+GC P+ LS     +P    D  GCL S N
Sbjct  219   VPEVVQTIAGAAKEVLDMGATRVVIPGNFPIGCMPSYLSAATASNPASLRDSYGCLVSFN  278

Query  869   NLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN-KLYMTCCGS  1045
              L    N  LQ+A+  LR+ +PDA + YADY+AA+   L  AP  GF     L   CCG+
Sbjct  279   LLARAHNERLQRAVAELRRSYPDATVAYADYFAAYLEILGHAPRFGFEGGAALRRACCGA  338

Query  1046  GGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
             GGG YN++ N++CG+ G  +C +P     WDG+HLTQ  +  +++++
Sbjct  339   GGGAYNFESNRLCGAPGTTACADPSGRPSWDGIHLTQHGYRIMAELL  385



>ref|XP_006382474.1| hypothetical protein POPTR_0005s02480g [Populus trichocarpa]
 gb|ERP60271.1| hypothetical protein POPTR_0005s02480g [Populus trichocarpa]
Length=363

 Score =   286 bits (733),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 207/345 (60%), Gaps = 20/345 (6%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C F++IYQ G S+ DTGNLI      P    A  PYG+    +PTGR S+GLL++D+IAR
Sbjct  34    CGFKAIYQLGDSIADTGNLITEN---PLSQYAWFPYGMNL-SKPTGRCSNGLLMIDYIAR  89

Query  371   AVGLPLLNPYLDKNASF---TNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWL  541
             +  LP L+ YL+    F    +GVNFAV  STAL    L  K ++       LS Q+ W+
Sbjct  90    SAKLPYLDAYLNPVRIFFGGCSGVNFAVAGSTALPAEVLLSKNIMNVVTKESLSTQLEWM  149

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
              TY +++      DC   +K SLF VGEIG ND  +A +  +T +E+ A VP++  ++ +
Sbjct  150   FTYFNTT---CSKDCAKEIKSSLFMVGEIGGNDYNYAFMFSKTTEEMKALVPEVVKAIKD  206

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
             AV +VI  G RR+VVPG FP+GCFP  LSQF   D   YDE  CL+ +N+   + N  L+
Sbjct  207   AVEKVIGYGARRVVVPGNFPIGCFPVYLSQFHPNDAAAYDEFHCLKGLNSFASYHNELLK  266

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
             Q +  L+  +PD +I+Y DYY AF S          +QN   + CCG+ GG +N+   + 
Sbjct  267   QTVEGLKTNYPDVIIVYGDYYKAFMS---------IYQNAQSLACCGT-GGDHNFSLMRT  316

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             CG+ GV  CPNP Q+I WDG+HLTQKA+  +++ +I +I  ++QC
Sbjct  317   CGALGVPVCPNPDQHISWDGIHLTQKAYQHMAEWLINDIFPKLQC  361



>ref|XP_006656415.1| PREDICTED: acetylajmalan esterase-like [Oryza brachyantha]
Length=411

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 201/329 (61%), Gaps = 5/329 (2%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNLI+    G       LPYG++  G PTGR SDGLL++DF+A+ +GL
Sbjct  70    AIYSLGDSITDTGNLIKEAPRGMFETIKHLPYGVSL-GYPTGRCSDGLLMIDFLAQDLGL  128

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P LNPYL KN SF +GVNFAV  +TA+D           P     L+ Q+ W K ++ SS
Sbjct  129   PFLNPYLGKNKSFDHGVNFAVAGATAMDTADQFNGRFFTPFAANSLNVQLRWFKDFMKSS  188

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
                   D + RL+ SL  +GEIG ND  +AL  G+ + EV   +P +  ++++A +EV+ 
Sbjct  189   F-GTDEDIRTRLQSSLVLIGEIGGNDYNYALF-GKNVSEVEKLIPGVVQTIVDATKEVLD  246

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALG-SL  919
             +G  R+++PG FP+GC P  L+   + +P DYD +GCLR +N      N  LQ A+   L
Sbjct  247   MGANRVIIPGNFPIGCMPTYLTTKRSSEPSDYDSMGCLRELNLFAGKHNARLQSAIADEL  306

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             R  +P A I YADY+ +F + LA A  LGF  +     CCG+ GG+YNYD  ++CG+ G 
Sbjct  307   RPSYPAASIAYADYFNSFLALLASADSLGFDASSARKACCGA-GGEYNYDWRRMCGAEGT  365

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
              +C  P +Y+ WDG+H+TQ A+ A+S++V
Sbjct  366   AACAEPEKYVSWDGIHMTQAAYRAMSRLV  394



>gb|EMT24134.1| GDSL esterase/lipase [Aegilops tauschii]
Length=400

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/375 (39%), Positives = 208/375 (55%), Gaps = 50/375 (13%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNL +    G       LPYG+TF GRPTGR SDGLL++DF+A  +GL
Sbjct  32    AIYSLGDSITDTGNLAKEAPPGAFETIKHLPYGVTF-GRPTGRCSDGLLMIDFLAHDMGL  90

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P LNPYL KN SF +GVNFAV  +TA+D    + +       T  L  Q+ W K ++ S+
Sbjct  91    PFLNPYLAKNTSFDHGVNFAVAGATAMDPADQSNR-------TFSLKLQLRWFKDFMKST  143

Query  563   ICAAPSDCKD-----------------------------------RLKRSLFFVGEIGRN  637
                   + K+                                   RL+ SL  VGEIG N
Sbjct  144   FDTDEGNSKNFFPLITVSQPQCTLCFQRSGILILYVKFVRAEIRKRLQSSLVLVGEIGGN  203

Query  638   DITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFG  817
             D  +AL   +++ EV   +P +  ++I+A +EV+ +G  R++VPG FP+GCFP+ L+   
Sbjct  204   DYNYALFGNKSVSEVEKLIPAVVQTIIDATKEVLDMGASRVIVPGNFPIGCFPSYLTAMA  263

Query  818   TQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAP  997
             + +   YD  GCL+ +N      N  LQ+A+  LR  +PDA I YADY+ +F S L  AP
Sbjct  264   SPEQSAYDSAGCLKDLNLFAAKHNAQLQRAVAGLRSSYPDAAIAYADYFNSFLSLLKGAP  323

Query  998   LLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
              LGF +N  +  CCG+ GG+YNYD  ++CG  G  +C +P  Y+ WDG+H+TQ A+  +S
Sbjct  324   ALGFDENSTHTACCGA-GGRYNYDERRMCGVEGTAACADPSAYVSWDGIHMTQAAYKEMS  382

Query  1178  QIVI------PNILS  1204
             +++       P ILS
Sbjct  383   RLIYHGRYLQPQILS  397



>ref|XP_006342691.1| PREDICTED: acetylajmalan esterase-like [Solanum tuberosum]
Length=383

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/345 (43%), Positives = 209/345 (61%), Gaps = 9/345 (3%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C  +S++QFG SL D GN+IR+     +  A  LPYG TF  +PTGR++DG +I D+IA 
Sbjct  33    CRIKSLFQFGDSLADAGNVIRIPGAVTSAQAWGLPYGETFFHKPTGRFTDGRIITDYIAS  92

Query  371   AVGLPLLNPYLDKNA-SFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             A+ LP +N YLDK+  SF+ G NFAV  +TA++  FL +KG+      VPL  Q+ W K+
Sbjct  93    ALNLPFVNAYLDKSGVSFSQGANFAVAGATAMNNSFLVEKGIGFIKFNVPLPSQLEWFKS  152

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDI--TFALVQGRTIQEVAAFVPDITTSVIN  721
             +L S+ C   S C   L+ SL  +GE G  D    FA    ++  EV  +VP I   +++
Sbjct  153   HLQST-CG--SKCARTLRNSLIVLGEFGGVDYWNAFAGAGTKSEPEVRTYVPLIIDGIMS  209

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
             A+++VIQ+G  RI+VPG  P GC    L++F   +P  YD+ GCL+S N   ++ N  L+
Sbjct  210   AIKDVIQLGSTRILVPGVLPFGCLSTYLTRFPDTNPDAYDQFGCLKSYNKFAMYHNTELK  269

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
             +AL +L+ EFP   I+Y DYY  F+     A  LGF+ N L   CCGS GG+YN D    
Sbjct  270   KALENLQCEFPRVKIVYGDYYGGFRFIFRYANWLGFNPNTLVSACCGS-GGRYNTDGG--  326

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             C  T    CPNP QY++WDG+HLT +A+  IS +VI N+L +  C
Sbjct  327   CTGTSTNVCPNPSQYVNWDGLHLTDEAYHRISDVVINNMLPKFGC  371



>ref|XP_006844513.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
 gb|ERN06188.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
Length=387

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/335 (43%), Positives = 205/335 (61%), Gaps = 7/335 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + +++ FG SL DTGN + +   G + P  RLPYG TF  RPTGR+S+G L+VDF A+A+
Sbjct  26    YAALFSFGDSLADTGNTL-LSLNGGSSPTGRLPYGETFFHRPTGRFSNGRLVVDFFAQAL  84

Query  377   GLPLLNPYL---DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             G+PLL PYL   D    F+ GVNFAV  +TALD  +   KG         L  Q+ W   
Sbjct  85    GVPLLPPYLSTLDGGDDFSKGVNFAVGGATALDSSYFISKGFEQHWTNYSLGVQLEWFHQ  144

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
              L S +C   SDCK+ +K+S+F VGEIG ND  FA  QG++ +EV AFVP I  +++ A 
Sbjct  145   LLPS-LCKPYSDCKEFMKKSMFLVGEIGGNDCNFAFFQGKSTEEVKAFVPSIINTIMKAA  203

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQ  904
              E I  G   +V+PG  P+GC    L+ F TQD ++YD + GCL+  N+  I+ N+ LQ 
Sbjct  204   SEFINEGVETLVIPGNLPIGCSTAYLTMFQTQDKQEYDPDTGCLKRFNDFAIYYNSKLQD  263

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
             A+  +R++FP A  +YADYY A   F       G  +  ++  CCG  G +YN++ N++C
Sbjct  264   AIQVMRQKFPHATTIYADYYNAALRFFKSPEAFGLAKETVHSACCGV-GDRYNFNFNRMC  322

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             G++GV +C +P  YI WDG+HLT+ A+  I+  ++
Sbjct  323   GTSGVTACSDPASYISWDGMHLTETAYKFITASLL  357



>ref|XP_004966154.1| PREDICTED: acetylajmalan esterase-like [Setaria italica]
Length=378

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/341 (41%), Positives = 202/341 (59%), Gaps = 9/341 (3%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNL++    G       LPYG+T  G PTGR SDGLL++DF+A+ +GL
Sbjct  32    AIYSLGDSITDTGNLVKEAPPGMFETIKHLPYGVTL-GTPTGRCSDGLLMIDFLAQDMGL  90

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P LNPYL KN SF +GVNFAV  +TA+D        V +P  +  L  Q+ W K ++ SS
Sbjct  91    PFLNPYLGKNKSFDHGVNFAVAGATAVDPADQFNLTVPMPFASNSLKVQLRWFKDFMKSS  150

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
                   + + +L+ SL  VGEIG ND  +     + + EV   +P +  ++I+A +EV+ 
Sbjct  151   F-GTDEEIRKKLQSSLVLVGEIGGNDYNYEFFANKPMTEVEKLIPGVIKTIIDAAKEVLD  209

Query  743   VGGRRIVVPGTFPLGCFPNLLS-QFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
             +G  ++++PG FP+GC P  L+   GT +P DYD  GCLR +N      N+ LQ+A+  L
Sbjct  210   MGAGKVIIPGNFPIGCVPGYLAMNAGTSEPADYDAYGCLRELNRFAAKHNSRLQRAVAEL  269

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             +   P A + YADY+ +F + L  A  LGF        CCG+GGG+YN+D  ++CG  G 
Sbjct  270   QASRPGASVAYADYFNSFLALLHNASSLGFDAASTRKACCGAGGGEYNFDWRRMCGFAGA  329

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVI------PNILS  1204
              +C  P  Y+ WDG+H+TQ A+ A+S+++       P ILS
Sbjct  330   TACAEPAAYLSWDGIHMTQAAYRAMSRLIYHGKYLEPQILS  370



>ref|XP_010314861.1| PREDICTED: acetylajmalan esterase-like [Solanum lycopersicum]
Length=380

 Score =   284 bits (727),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 207/344 (60%), Gaps = 8/344 (2%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   S++QFG S+ D GN+IR+     +  A  LPYG TF  +PTGR+SDG +I D+IA 
Sbjct  33    CHITSLFQFGDSIADAGNVIRIPGAVISAQAWGLPYGETFFHKPTGRFSDGRIIADYIAT  92

Query  371   AVGLPLLNPYLDKNA-SFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             A+ LP LNPY+DK+  SF+ G NFAV  +TA++  FL ++G+      VPL  Q+ W K+
Sbjct  93    ALSLPFLNPYMDKSGVSFSQGANFAVAGATAMNNSFLEERGIGHVPFNVPLPSQLEWFKS  152

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             +L S+     S     L+ SL  +GE G  D   AL   +   EV  +VP I   +I+A+
Sbjct  153   HLQSTY---GSKYSTTLRNSLVVLGEFGGVDYWNALAGNKPEPEVRTYVPFIIDGIISAI  209

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             +EVIQ+G  RI+VPG FP GC  + L++F   +P  YD+ GCL+  N+   + N  L++A
Sbjct  210   KEVIQLGSTRILVPGVFPFGCLSSYLTRFADTNPNAYDQYGCLKFYNDFATYHNIELKKA  269

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             L +LR EFP   I+Y DYY  F+     A  LGF+ + L   CCGS GG+YN      C 
Sbjct  270   LENLRCEFPRVKIVYGDYYGGFRLVFRYASWLGFNPSTLVSACCGS-GGRYNAGG---CS  325

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQCF  1219
             S     CPNP QY++WDG+HLT +A+  IS +VI N+L +  C+
Sbjct  326   SASTNVCPNPSQYVNWDGLHLTDEAYHRISNVVINNMLPKFGCY  369



>ref|XP_003565496.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=380

 Score =   284 bits (726),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 207/354 (58%), Gaps = 4/354 (1%)
 Frame = +2

Query  125   LCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGA-IGPTLPAARLPYG  301
             + FL V  A++               SI+ FG S  DTGN +++ A + P +P   LPYG
Sbjct  11    IAFLFVLLASAHYAQAYSARARPSVSSIFSFGNSYADTGNFVKLAAPLIPVIPFNNLPYG  70

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLA  481
              T+  RP GR S+G L +DFIA+  GLP L PYL +  +FT G NFAV   TALD+ +  
Sbjct  71    ETYFRRPNGRASNGRLTIDFIAKEFGLPFLPPYLGQGQNFTRGANFAVVGGTALDLAYFL  130

Query  482   QKGVV-VPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
             +  +  VP     LS Q++W K  L  ++C+ P  C+D  K+SLFF+GE G ND TF L 
Sbjct  131   KNNITSVPPFNSSLSVQLDWFKK-LKPTLCSTPQGCRDYFKKSLFFMGEFGGNDYTFILA  189

Query  659   QGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
              G++ ++VA++VP +  ++   V  VI+ G R +VVPG  P GC P +L+ + + + +DY
Sbjct  190   AGKSFRQVASYVPKVVEAISAGVEAVIKEGARTVVVPGQLPTGCIPIMLTLYASPNKRDY  249

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             D  GCLR  N L  + N  L +++  LR+++P A I+YADYYA   +FL +    GF  +
Sbjct  250   DSTGCLRKYNALARYHNAVLFESVYRLRQKYPAAKIVYADYYAPLIAFLKKPKTYGFSPS  309

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
                  CCG GGG YNY+    CG  G  +C +P  +++WDG+HLT+ A+  I+ 
Sbjct  310   SGLRVCCG-GGGPYNYNLTAACGLPGASACRDPAAHVNWDGIHLTEPAYERIAD  362



>ref|XP_004230195.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X2 [Solanum 
lycopersicum]
Length=358

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/350 (42%), Positives = 207/350 (59%), Gaps = 22/350 (6%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             +N +++ C F  IYQFG SL DTGN IR    G TL    LPYG+ F    TGR S+G+L
Sbjct  28    QNPRLLNCRFDKIYQFGDSLSDTGNCIRETLCGATLSCGTLPYGMDFYQNATGRCSNGML  87

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSG  526
             I+DFI                  F +GVNFAV  STAL    LA+K +V  ++T   LS 
Sbjct  88    IIDFI-----------------DFRHGVNFAVAGSTALSAKSLAEKNIVNIALTNSSLSV  130

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ ++  ++      DC ++L +SLF VGEIG N+  + L QG+++ E    VP+I 
Sbjct  131   QLDWMSSHFQTT---CSPDCPEKLNKSLFLVGEIGGNEFIYGLSQGKSMDESRKMVPEIV  187

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I+ V  +I  G  +I+VPG FP+GC P  L++F T     YDE  CL+ +NN  IF 
Sbjct  188   QTIIHGVERIIGFGATQIIVPGNFPIGCHPIFLTKFMTNISTAYDEYHCLKELNNFAIFF  247

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N +LQQA+  L+K++P+  ++Y DYY AF   L  A  LGF    L   CCG  GG+YNY
Sbjct  248   NRYLQQAIDELKKDYPNITLIYGDYYNAFLWLLQNADGLGFDNKSLQKACCGI-GGEYNY  306

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             D ++ CG+  V  C +P  +I WDGVHLTQ A+  I++ +I + L ++ C
Sbjct  307   DVHRRCGAPRVPVCVDPSTHISWDGVHLTQNAYRWIARWLIDDTLPKLNC  356



>ref|XP_006398909.1| hypothetical protein EUTSA_v10015988mg [Eutrema salsugineum]
 gb|ESQ40362.1| hypothetical protein EUTSA_v10015988mg [Eutrema salsugineum]
Length=325

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 202/344 (59%), Gaps = 50/344 (15%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             CP  SIYQFG S+ DTGNLIR G                 PG                  
Sbjct  30    CPINSIYQFGDSIADTGNLIRNG-----------------PGN-----------------  55

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
                    NP     +SF NGVNFAV  STAL+  F A + + VP+   PLS Q+ W K++
Sbjct  56    ------TNP-----SSFKNGVNFAVAGSTALNSSFFAARNLHVPATNTPLSTQLAWFKSH  104

Query  551   LSSSIC-AAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             L S+   ++ SDC   LK+SLF VGEIG ND  +   QG++++E+ +++P +  ++  A 
Sbjct  105   LRSTCHGSSSSDC---LKQSLFMVGEIGGNDYNYGFFQGKSMEEIRSYIPHVVGAIAAAA  161

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
             R+VI+ G   +V+PG FP+GCFP  L+ F  +DPK YD+ GCL+ +N   +  NN LQ+A
Sbjct  162   RDVIRAGAVNVVIPGNFPVGCFPIYLTSFPVKDPKAYDDKGCLKHLNEFAMDHNNQLQEA  221

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             + SL+KEFPD VI+Y DYY AFQS L  +   GF ++    +CCG GG  YNYD  + CG
Sbjct  222   IASLKKEFPDVVIVYGDYYKAFQSVLRSSKSAGFDKSVALKSCCGIGGA-YNYDGKRQCG  280

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQCF  1219
             + GV  C NP ++I WDGVHLTQKA+  +S+ +   ILS+I+C 
Sbjct  281   AAGVPVCQNPDKFISWDGVHLTQKAYRFMSKFLNNIILSQIKCL  324



>ref|XP_009415143.1| PREDICTED: GDSL esterase/lipase At1g28590-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 204/329 (62%), Gaps = 7/329 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + +I+ FG SL DTGNLIRV        A R PYG+T+   PTGR+SDG LIVD+IA A+
Sbjct  25    YSTIFSFGDSLADTGNLIRVPGHA-DCQAGRPPYGMTYFHSPTGRFSDGRLIVDYIAEAM  83

Query  377   GLPLLNPYLD--KNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             GLPLL PYL+  +      GVNFAV  +TA+D  F  +KG+   S    L  QI W +  
Sbjct  84    GLPLLPPYLEAWRGGRLRKGVNFAVAGATAMDNEFFQEKGITTGSTNCSLRFQIRWFQQL  143

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S +CA+P+DC+D L+ +LF +GEIG ND  F L QGR++QE  +FVP +  ++ + + 
Sbjct  144   LPS-LCASPTDCEDMLQNTLFLMGEIGGNDYNFPLSQGRSLQETESFVPLVVDTISSGIN  202

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             ++I++G R ++VPG  PLGC    L+ + +   +DYD +GC+R +N  + + N HL   +
Sbjct  203   KLIELGARALLVPGITPLGCNTVYLTTYRSDRAEDYDAIGCIRWLNEFSQYHNGHLHDEV  262

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               L+   P+AVI+YADYY A  +  +     G  +   ++ CCG GGG YNY+ ++ CGS
Sbjct  263   RRLQALHPEAVIIYADYYGAMMNIFSDPERFGIEER--FLACCG-GGGPYNYNSSRPCGS  319

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
              G   C +   Y+HWDG+H+T+  +  +S
Sbjct  320   EGQTVCDDTSTYLHWDGLHMTEATYRIVS  348



>emb|CDP13680.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/348 (41%), Positives = 207/348 (59%), Gaps = 10/348 (3%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPG-RPTGRWSDGLLIVDFIA  367
             C F  +YQ G S+ DTGNLIR   +G  LP AR PYG TF   + TGR SDGLL++D+IA
Sbjct  37    CRFDQVYQLGDSISDTGNLIRESPLGAALPFARNPYGQTFSHHKATGRCSDGLLMIDYIA  96

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             +A+GLPLLNP  D  A F +G NFAV  +TAL    LA+  V  P+    L  Q+ W+K 
Sbjct  97    QALGLPLLNPIKDTKADFEHGANFAVAGATALSSAVLARHHVRNPATNSSLDVQLQWMKD  156

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ----GRTIQEVAAFVPDITTSV  715
             +     C   +DC+  L+ +LF VGEIG ND  +A +Q     R    +   VP +   +
Sbjct  157   HF-HKFCH--NDCERMLQNALFMVGEIGGNDYNYAFLQYFDEARDTLRIQELVPLVVAKI  213

Query  716   INAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKD-YDELGCLRSINNLTIFRNN  892
              +AV +VI  G R IVVPG FP+GC P  L++FG +   D +DE  C+  +N+   F N+
Sbjct  214   KHAVEKVISFGARTIVVPGNFPMGCLPIYLTKFGLESEVDEFDENHCIWLLNSFATFHND  273

Query  893   HLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDR  1072
              L++A+  L+ ++P   I+Y DYYAA++  L      G    +L+  CCG  GG YN++ 
Sbjct  274   RLKKAIAELQDKYPYVTIVYGDYYAAYEQLLKLGETTGMFSFELHKACCGV-GGLYNFNE  332

Query  1073  NKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              ++CG  GV +C +P +Y+ WDG+HLTQ+A+  I   +  ++  +++C
Sbjct  333   TRMCGFPGVKACRDPKRYVSWDGIHLTQEAYRMIVDWLQADLFWKLRC  380



>ref|NP_001058440.1| Os06g0694200 [Oryza sativa Japonica Group]
 dbj|BAD53876.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF20354.1| Os06g0694200 [Oryza sativa Japonica Group]
 dbj|BAG97896.1| unnamed protein product [Oryza sativa Japonica Group]
Length=379

 Score =   281 bits (720),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 146/341 (43%), Positives = 209/341 (61%), Gaps = 10/341 (3%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNLI+    G       LPYGITF G PTGR SDGLL++DF+A+ +GL
Sbjct  37    AIYSLGDSITDTGNLIKEAPPGMFETIKHLPYGITF-GYPTGRCSDGLLMIDFLAQDLGL  95

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P LNPYL KN SF +GVNFAV  +TA+D           P  +  L+ Q+ W K ++ S+
Sbjct  96    PFLNPYLGKNKSFDHGVNFAVAGATAMDPTDQFNGRFFAPFSSNSLNVQLRWFKDFMKST  155

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQ  742
               +   D + RL+ SL  +GEIG ND  +AL  G+++ EV   +P +  ++I+A +EV++
Sbjct  156   F-STEEDIRKRLQSSLVLIGEIGGNDYNYALF-GKSVSEVEKLIPSVVRTIIDAAKEVLE  213

Query  743   VGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALG-SL  919
             +G  R+++PG FP+GC P  L+   + +P DYD  GCLR +N      N  L++A+   L
Sbjct  214   MGANRVIIPGNFPIGCMPTYLTSKRSSEPSDYDATGCLRELNRFAAKHNARLRRAIADEL  273

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             R  +P A + YADY+ +F + L  A  LGF        CCG+GGG+YNYD  ++CG+ G 
Sbjct  274   RPSYPAAAVAYADYFNSFLALLDAAGELGFDAGSARRACCGAGGGEYNYDPRRMCGAEGA  333

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVI------PNILS  1204
              +C  P +Y+ WDGVH+TQ A+ A+S++V       P ILS
Sbjct  334   AACAEPEKYVSWDGVHMTQAAYRAMSRLVYHGMYLEPQILS  374



>gb|AFW69252.1| alpha-L-fucosidase 2 [Zea mays]
Length=431

 Score =   283 bits (725),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 139/342 (41%), Positives = 203/342 (59%), Gaps = 10/342 (3%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNL++    G       LPYG+TF G PTGR SDGLL++DF+A+ +GL
Sbjct  84    AIYSLGDSITDTGNLVKEAPPGMFETIKHLPYGVTF-GYPTGRCSDGLLMIDFLAQDLGL  142

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALD-IGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             P LNPYL KN SF +GVNFAV  +TA+D         V VP  +  L  Q+ W K +L  
Sbjct  143   PFLNPYLGKNKSFDHGVNFAVAGATAVDPADQFNLPAVPVPFASKSLKVQLRWFKDFLKY  202

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
             +      + + RL+ SL  VGEIG ND  +A  Q + + EV   +P +  +++ A +EV+
Sbjct  203   TF-GTDEEIRRRLQASLVLVGEIGGNDYNYAFFQAKPVAEVEKLIPGVVKTIVGAAKEVL  261

Query  740   QVGGRRIVVPGTFPLGCFPNLLS-QFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGS  916
              +G  R++VPG FP+GC P  L+    + +P DYD  GCLR +N+     N+ L++A+  
Sbjct  262   DMGATRVIVPGNFPIGCVPGYLAMNAASSEPADYDSAGCLRELNDFAAKHNSRLRRAVAD  321

Query  917   LRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTG  1096
             L+  +P A + YADY+ +F + L  A   GF        CCG+G G+YN+D  ++CG  G
Sbjct  322   LQASYPGAAVAYADYFDSFLTLLHNASSFGFDAASTRKACCGAGAGEYNFDWRRMCGFPG  381

Query  1097  VISCPNPPQYIHWDGVHLTQKAHLAISQIVI------PNILS  1204
               +C +P  Y+ WDG+H+TQ A+ A+S+++       P ILS
Sbjct  382   TAACADPSTYLSWDGIHMTQAAYRAMSRLIYHGKYLQPQILS  423



>ref|NP_001151231.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACG42068.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=386

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/342 (40%), Positives = 202/342 (59%), Gaps = 10/342 (3%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNL++    G       LPYG+TF G PTGR SDGLL++DF+A+ +GL
Sbjct  39    AIYSLGDSITDTGNLVKEAPPGMFETIKHLPYGVTF-GYPTGRCSDGLLMIDFLAQDLGL  97

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALD-IGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             P LNPYL KN SF +GVNFAV  +TA+D         V VP  +  L  Q+ W K +L  
Sbjct  98    PFLNPYLGKNKSFDHGVNFAVAGATAVDPADQFNLPAVPVPFASKSLKVQLRWFKDFLKY  157

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
             +      + + RL+ SL  VGEIG ND  +A  Q + + EV   +P +  +++ A +EV+
Sbjct  158   TF-GTDEEIRRRLQASLVLVGEIGGNDYNYAFFQAKPVAEVEKLIPGVVKTIVGAAKEVL  216

Query  740   QVGGRRIVVPGTFPLGCFPNLLS-QFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGS  916
              +G  R++VPG FP+GC P  L+    + +P DYD  GCLR +N+     N+ L++A+  
Sbjct  217   DMGATRVIVPGNFPIGCVPGYLAMNAASSEPADYDSAGCLRXLNDFAAKHNSRLRRAVAD  276

Query  917   LRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTG  1096
             L+  +P A + YADY+ +F +    A   GF        CCG+G G+YN+D  ++CG  G
Sbjct  277   LQASYPGAAVAYADYFDSFLTLXHNASSFGFDAASTRKACCGAGAGEYNFDWRRMCGFPG  336

Query  1097  VISCPNPPQYIHWDGVHLTQKAHLAISQIVI------PNILS  1204
               +C +P  Y+ WDG+H+TQ A+ A+S+++       P ILS
Sbjct  337   TAACADPSTYLSWDGIHMTQAAYRAMSRLIYHGKYLQPQILS  378



>emb|CDO96771.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 208/349 (60%), Gaps = 11/349 (3%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPG-RPTGRWSDGLLIVDFIA  367
             C F  +YQ G S+ DTGNLIR   +G  LP AR PYG TF   + TGR SDGLL++D+ A
Sbjct  37    CRFDQVYQLGDSISDTGNLIRESPLGAALPFARNPYGQTFSHHKATGRCSDGLLMIDYFA  96

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             +A+GLPLLNP  D  A+F +G NFAV  +TAL    LA   V  P     L  Q+ W+K 
Sbjct  97    QALGLPLLNPIKDTKANFEHGANFAVAGATALSSAVLAHHHVRNPVTNSSLDVQLQWMKD  156

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ----GRTIQEVAAFVPDITTSV  715
             +     C   +DC+ +L+ +LF VGEIG ND  +A +Q     R    +   VP +   +
Sbjct  157   HFHK-FCH--NDCERKLQNALFMVGEIGGNDYNYAYLQYLDDARDTLRILELVPLVVAKI  213

Query  716   INAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKD-YDELGCLRSINNLTIFRNN  892
              +AV +VI  G R IVVPG FP+GC P  L++FG +   D +DE  C+  +N+   F N+
Sbjct  214   KHAVEKVISFGARTIVVPGNFPMGCLPIYLTKFGLESEGDEFDENHCIWLLNSFATFHND  273

Query  893   HLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLG-FHQNKLYMTCCGSGGGQYNYD  1069
             HL++A+  L++++P   I+Y DYYAA++  L      G F   +L   CCG GG  YN++
Sbjct  274   HLKKAIAELQEKYPYVTIVYGDYYAAYEQLLNLGETEGMFVSFELQKACCGVGG-LYNFN  332

Query  1070  RNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
               ++CG  GV +C +P +Y+ WDG+HLTQ+A+  I   +  ++  +++C
Sbjct  333   ETRMCGFPGVKACRDPERYVSWDGIHLTQEAYRMIVDWLQADLFWKLRC  381



>gb|EAZ02202.1| hypothetical protein OsI_24297 [Oryza sativa Indica Group]
Length=387

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 209/347 (60%), Gaps = 15/347 (4%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNLI+    G       LPYGITF G PTGR SDGLL++DF+A+ +GL
Sbjct  38    AIYSLGDSITDTGNLIKEAPPGMFETIKHLPYGITF-GYPTGRCSDGLLMIDFLAQDLGL  96

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P LNPYL KN SF +GVNFAV  +TA+D+          P  +  L+ Q+ W K Y+ S+
Sbjct  97    PFLNPYLGKNKSFDHGVNFAVAGATAMDLTDQFSGRFFAPFSSNSLNVQLRWFKDYMKST  156

Query  563   ICAAPSDCKD------RLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINA  724
                   +  D      RL+ SL  +GEIG ND  +AL  G+++ EV   +P +  ++I+A
Sbjct  157   FSTDEGNSPDQFHIRKRLQSSLVLIGEIGGNDYNYALF-GKSVSEVEKLIPGVVRTIIDA  215

Query  725   VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQ  904
              +EV+++G  R+++PG FP+GC P  L+   + +P DYD  GCLR +N      N  L++
Sbjct  216   AKEVLEMGANRVIIPGNFPIGCMPTYLTSKRSSEPSDYDATGCLRELNRFAAKHNARLRR  275

Query  905   ALG-SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
             A+   LR  +P A + YADY+ +F + L  A  LGF        CCG+GGG+YNYD  ++
Sbjct  276   AIADELRPSYPAAAVAYADYFNSFLALLDAAGELGFDAGSARRACCGAGGGEYNYDPRRM  335

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI------PNILS  1204
             CG+ G  +C  P +Y+ WDGVH+TQ A+ A+S++V       P ILS
Sbjct  336   CGAEGAAACAEPEKYVSWDGVHMTQAAYRAMSRLVYHGMYLEPQILS  382



>ref|XP_004955060.1| PREDICTED: acetylajmalan esterase-like [Setaria italica]
Length=405

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/345 (43%), Positives = 204/345 (59%), Gaps = 19/345 (6%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY FG SL DTGNL+R GA G    +   PYG    G  TGR SDG L++DF+A+ +GL
Sbjct  49    AIYNFGDSLSDTGNLLREGATGMLRHSMGPPYGSAI-GGATGRCSDGYLMIDFLAKDLGL  107

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             PLLNPYLDK A FT+GVNFAV  +TALD   LA++GV VP     L+ Q+   K ++S++
Sbjct  108   PLLNPYLDKGADFTHGVNFAVAGATALDAAALARRGVAVPHTNTSLAVQLQQFKDFMSAN  167

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRT-----------------IQEVAAF  691
                +P + +++L  SL  VGEIG ND  +A  + +                  + E  A 
Sbjct  168   T-RSPQEIREKLSHSLVMVGEIGGNDYNYAFSENKPAGNGERNLYNFGRMATGVVEAMAL  226

Query  692   VPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINN  871
             VPD+  SV +A RE++ +G  R+V+PG FPLGC P+ +S     DP  YD  GCL S+N 
Sbjct  227   VPDVVRSVTDAARELLDMGATRLVIPGNFPLGCVPSYMSAVNETDPAAYDANGCLMSLNL  286

Query  872   LTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGG  1051
                  N  LQQ +  LR+ +P A I YADY+ A+   L  A   GF +  +   CCG+GG
Sbjct  287   FAQMHNVLLQQEIRELRRSYPSATIAYADYFYAYVRMLRDAGKTGFDEGAVTKACCGAGG  346

Query  1052  GQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
             G YN+D  ++CG+ G   C  P + I WDGVHLTQ+A+  ++ ++
Sbjct  347   GAYNFDMERMCGAPGASVCARPEERISWDGVHLTQRAYRVMTDLL  391



>ref|XP_010682072.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/345 (42%), Positives = 210/345 (61%), Gaps = 11/345 (3%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFI------  364
             +IYQFG S+ DTGNLIR   IG     ARLPYG  F  +PTGR S+GLL++DFI      
Sbjct  31    AIYQFGDSISDTGNLIREDPIGSHSAFARLPYGQKFFHKPTGRCSNGLLMIDFIVLFFSC  90

Query  365   --ARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
               A    L  L+ YL+K  +F +GVNFAV  ST L    LA K ++ P     L  Q+ W
Sbjct  91    ISAEYFKLSFLDAYLNKADNFKHGVNFAVAGSTTLTTSTLAAKNILSPITNSSLPVQLGW  150

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
              K++L S +C   SDCK +L  +LF + E G ND  +A  Q +++Q+V   V ++   + 
Sbjct  151   FKSHLQS-LCKHSSDCKHKLANALFII-ETGGNDFNYAFFQQKSLQDVQQMVDEVIQGIT  208

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
             +AV++VI  G  ++V+PG FP+GC P  L+ F T D   YDEL CL+ +N  + F+N+HL
Sbjct  209   SAVQDVISSGATQVVIPGNFPIGCMPIYLNAFQTNDLNMYDELHCLKGLNEFSTFQNDHL  268

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             Q+A+  L+++ P   I+YADYY A +  L  A  LGF ++++  TCCG G  +YN++   
Sbjct  269   QEAIRKLQEQHPKVAIVYADYYNALRELLKHAASLGFKKDEVQKTCCGIGNNEYNFNMTS  328

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI-PNILSRI  1210
             +CG  GV  C +P + + WDGVH+TQ A+  +++ ++  NI+  I
Sbjct  329   MCGYNGVPVCKHPYERVSWDGVHMTQHAYKLMARWLLKKNIIHGI  373



>emb|CDO96766.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   279 bits (714),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 142/349 (41%), Positives = 208/349 (60%), Gaps = 11/349 (3%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPG-RPTGRWSDGLLIVDFIA  367
             C F  +YQ G S+ DTGNLIR   +G  LP AR PYG TF   + TGR SDGLL++D+ A
Sbjct  37    CRFDQVYQLGDSISDTGNLIRESPLGAALPFARNPYGQTFSHHKATGRCSDGLLMIDYFA  96

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             +A+GLPLLNP  D  A+F +G NFAV  +TAL    LA   V  P     L  Q+ W+K 
Sbjct  97    QALGLPLLNPIKDTKANFEHGANFAVAGATALSSAVLAHHHVTNPVTNSSLDIQLQWMKD  156

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ----GRTIQEVAAFVPDITTSV  715
             +     C   +DC+ +L+ +LF VGEIG ND  +A +Q     R   ++   VP +   +
Sbjct  157   HFHK-FCH--NDCERKLQNALFMVGEIGGNDYNYAFLQYLDEARDTLKILELVPLVVAKI  213

Query  716   INAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKD-YDELGCLRSINNLTIFRNN  892
              +AV +VI  G R IVVPG FP+GC P  L++FG +   D +DE  C+  +N+   F N+
Sbjct  214   KHAVEKVISFGARTIVVPGNFPMGCLPIYLTKFGLESEVDEFDENHCIWLLNSFATFHND  273

Query  893   HLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN-KLYMTCCGSGGGQYNYD  1069
             HL++A+  L++++P   I+Y DYYAA++         G   + +L   CCG GG  YN++
Sbjct  274   HLKKAIAELQEKYPYVTIVYGDYYAAYEQLFNLGETEGMLVSFELQKACCGVGG-LYNFN  332

Query  1070  RNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
               ++CG  GV +C +P +Y+ WDG+HLTQ+A+  I   +  ++  +++C
Sbjct  333   ETRMCGFPGVKACRDPERYVSWDGIHLTQEAYRMIVDWLQADLFWKLRC  381



>ref|XP_004955061.1| PREDICTED: acetylajmalan esterase-like [Setaria italica]
Length=398

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/355 (42%), Positives = 205/355 (58%), Gaps = 19/355 (5%)
 Frame = +2

Query  173   NQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLI  352
              +K V     +IY FG SL DTGNL+R GA G        PYG    G  TGR SDG L+
Sbjct  30    KEKAVADGITAIYNFGDSLSDTGNLLREGATGMLQYTTGPPYGSAIGG-ATGRCSDGYLM  88

Query  353   VDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQI  532
             +D++A+ +GLPLL+PYLDK A FT+GVNFAV  +TALD   LA++GV VP     L+ Q+
Sbjct  89    IDYLAKDLGLPLLSPYLDKGADFTHGVNFAVAGATALDAAALARRGVAVPHTNTSLAVQL  148

Query  533   NWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQ------------  676
                K ++S++   +P + +++L RSL  VGEIG ND  +A  + R +             
Sbjct  149   QQFKDFMSANT-RSPQEIREKLARSLVMVGEIGGNDYNYAFSENRPVAGGARNFYNFGRM  207

Query  677   -----EVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD  841
                  E  A VPD+  SV +A RE++ +G  R+ +PG FPLGC P+ +S     DP  YD
Sbjct  208   ATGVVEAMALVPDVVRSVTDAARELLDMGATRLEIPGNFPLGCVPSYMSAANETDPAAYD  267

Query  842   ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNK  1021
               GCL S+N      N  LQQ +  LR+ +P A I Y DY+ A+   L  A   GF +  
Sbjct  268   ANGCLMSLNLFAQMHNVLLQQEIRELRRSYPSATIAYGDYFYAYVQMLRDAGKTGFDEGA  327

Query  1022  LYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
             +   CCG+GGG YN+D  ++CG+ G   C  P + I WDGVHLTQ+A+  ++ ++
Sbjct  328   VTKACCGAGGGAYNFDMERMCGAPGATVCARPDERISWDGVHLTQRAYRVMTDLL  382



>dbj|BAJ90990.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86531.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88801.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89246.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 209/356 (59%), Gaps = 7/356 (2%)
 Frame = +2

Query  119   CILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGA-IGPTLPAARLP  295
             C+  FLL   A+  V     K       SI+ FG S  DTGN +++ A + P +P + LP
Sbjct  9     CMAFFLLTLLAS--VHYTQAKPGRNSIHSIFSFGNSYADTGNFVKLAAPVLPIIPFSNLP  66

Query  296   YGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGF  475
             YG TF GRPTGR S+G +I+DFIA   GLP + P L    +FT+G NFAV  +TALD+ +
Sbjct  67    YGETFFGRPTGRASNGRIILDFIADEFGLPFIPPILGGEHNFTHGANFAVVGATALDLAY  126

Query  476   LAQKGVV-VPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFA  652
               ++ +  VP     LS Q++W +  L  ++C+ P  C+D  +RSLF +GE G ND TF 
Sbjct  127   FYERNITSVPPFKSSLSVQLDWFQK-LKPTLCSTPQGCRDYFRRSLFLMGEFGGNDYTFI  185

Query  653   LVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPK  832
             L  G+T+ +VA++VP++  ++   V ++I+ GGR +VVPG  P+GC P +L+ + + + K
Sbjct  186   LAAGKTLDQVASYVPEVVQAISAGVEKLIKEGGRYVVVPGQLPMGCLPIVLTLYASPNKK  245

Query  833   DYD-ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGF  1009
              YD   GCL   N LT + N  L +A+  LR ++P   I+Y DYY     FL      GF
Sbjct  246   HYDPRTGCLTKYNALTRYHNRLLSKAIYRLRIKYPATNIIYGDYYTPVMEFLRTPTRFGF  305

Query  1010  HQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
               +     CCG+ GG YNY+    CG  G  +C NP   I+WDG+H+T+ A++ I+
Sbjct  306   SASSRLRVCCGA-GGPYNYNLTAACGFPGASACANPATRINWDGIHMTETAYMYIA  360



>gb|EAZ38126.1| hypothetical protein OsJ_22475 [Oryza sativa Japonica Group]
Length=386

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/347 (42%), Positives = 208/347 (60%), Gaps = 15/347 (4%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY  G S+ DTGNLI+    G       LPYGITF G PTGR SDGLL++DF+A+ +GL
Sbjct  37    AIYSLGDSITDTGNLIKEAPPGMFETIKHLPYGITF-GYPTGRCSDGLLMIDFLAQDLGL  95

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
             P LNPYL KN SF +GVNFAV  +TA+D           P  +  L+ Q+ W K ++ S+
Sbjct  96    PFLNPYLGKNKSFDHGVNFAVAGATAMDPTDQFNGRFFAPFSSNSLNVQLRWFKDFMKST  155

Query  563   ICAAPSDCKD------RLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINA  724
                   +  D      RL+ SL  +GEIG ND  +AL  G+++ EV   +P +  ++I+A
Sbjct  156   FSTEEGNSPDQFHIRKRLQSSLVLIGEIGGNDYNYALF-GKSVSEVEKLIPSVVRTIIDA  214

Query  725   VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQ  904
              +EV+++G  R+++PG FP+GC P  L+   + +P DYD  GCLR +N      N  L++
Sbjct  215   AKEVLEMGANRVIIPGNFPIGCMPTYLTSKRSSEPSDYDATGCLRELNRFAAKHNARLRR  274

Query  905   ALG-SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
             A+   LR  +P A + YADY+ +F + L  A  LGF        CCG+GGG+YNYD  ++
Sbjct  275   AIADELRPSYPAAAVAYADYFNSFLALLDAAGELGFDAGSARRACCGAGGGEYNYDPRRM  334

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI------PNILS  1204
             CG+ G  +C  P +Y+ WDGVH+TQ A+ A+S++V       P ILS
Sbjct  335   CGAEGAAACAEPEKYVSWDGVHMTQAAYRAMSRLVYHGMYLEPQILS  381



>ref|XP_010666442.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/333 (43%), Positives = 204/333 (61%), Gaps = 20/333 (6%)
 Frame = +2

Query  200   RSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
              +IYQFG S+ DTGNLIR     P+   A+LPYG TF  +PTGR SDGLL++D+  R   
Sbjct  62    EAIYQFGDSISDTGNLIREN---PSSNYAKLPYGQTFFHKPTGRCSDGLLMIDYFTRFFK  118

Query  380   LPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSS  559
             LP L+PYL+K  +F++GVNFAV  +TAL+   LA+K  +       L  Q++W KT+L+S
Sbjct  119   LPFLDPYLNKEGNFSHGVNFAVAGATALNGSTLAKKHNLSGPTNSSLLVQLDWFKTHLNS  178

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
              IC+  SD K +L ++L  +GEIG ND  +A  Q + I E+   VP +   + N V+EVI
Sbjct  179   -ICSDASDRKKKLAKALIVMGEIGGNDYNWAFFQRKPITEIYDMVPKVIQMIKNVVKEVI  237

Query  740   QVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
              +G  RIVVPG FP+GC    L  F T D K YDEL CLRS+N+   F N+ LQ+A+  +
Sbjct  238   NLGATRIVVPGNFPIGCMTIYLDMFKTNDIKMYDELQCLRSLNDFAKFHNDKLQEAITDI  297

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             +++ P+  I+YADY+ A +  L  A  LGF ++K+   CCGS G                
Sbjct  298   QRDHPNVSIMYADYFEALKEILQNATSLGFDEDKVRTACCGSRG----------------  341

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNI  1198
             I C +P ++++WD +HLTQ A+  +++ +I  I
Sbjct  342   IVCGDPYKHVNWDRIHLTQHAYQVMAKSLIKPI  374



>ref|XP_009767429.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 205/346 (59%), Gaps = 31/346 (9%)
 Frame = +2

Query  182   VVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF-PGRPTGRWSDGLLIVD  358
             ++ C F  IYQ G SL DTGN IR   +G   P A+LPYG  F     TGR SDGLL++D
Sbjct  41    LMKCKFDKIYQLGDSLSDTGNFIRESLVGAFSPFAKLPYGENFFQNESTGRCSDGLLMID  100

Query  359   FIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             FI                          V  +TAL    +A+K +        L+ Q++W
Sbjct  101   FI--------------------------VAGATALPAEIMAEKKISNSLTNSSLNVQLDW  134

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
             + ++  S   A  ++C + LK++LF VGEIG N+  + L+QG+ ++E+ A VP++  ++I
Sbjct  135   MSSHFKS---ACSTECSEDLKKALFLVGEIGGNEFNYGLLQGKPMEELRAMVPEVVQTII  191

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
             NAV+ +I  G  RIV+PG FP+GC PNLL+ F T +   YD   CL+ +N+L I  N+HL
Sbjct  192   NAVKTIIGFGAVRIVIPGNFPIGCIPNLLTTFLTNNSTAYDYNHCLKDLNHLAILYNDHL  251

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             QQ +  L+K  P+  ++Y DYY A+   L  A  LGF +N L   CCG  G +YNYD+++
Sbjct  252   QQVIQELKKGHPNIALVYGDYYNAYLWLLKNAASLGFDKNSLLKACCGI-GEKYNYDKSR  310

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             +CG+ G+  C +P  YI WDG+HLTQ+A+  +++ +I ++L +++C
Sbjct  311   ICGAPGLQICTDPSTYISWDGIHLTQQAYKWLARWLIDDMLPKLKC  356



>gb|EAY86633.1| hypothetical protein OsI_08013 [Oryza sativa Indica Group]
Length=403

 Score =   275 bits (703),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/352 (41%), Positives = 207/352 (59%), Gaps = 20/352 (6%)
 Frame = +2

Query  185   VVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARL--PYGITFPGRPTGRWSDGLLIVD  358
             VV    +IY FG S+ DTGN +R GA    +    +  PYG    G  TGR SDG L++D
Sbjct  38    VVDGITAIYNFGDSISDTGNYLREGAAAGAMMEHTVAPPYGAAIGG-ATGRCSDGYLMID  96

Query  359   FIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             ++A+ +GLPLLNPYLDK A FT+GVNFAVT +TALD   LA+ GV  P     LS Q+ W
Sbjct  97    YLAKDLGLPLLNPYLDKGADFTHGVNFAVTGATALDAAALARIGVAAPHTNSSLSVQLQW  156

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGR----------------T  670
              + ++S++   +P++ +D+L  SL  VGEIG ND  +A    R                 
Sbjct  157   FRDFMSATT-KSPAEVRDKLASSLVMVGEIGGNDYNYAFAANRPRPGGRSAADVGRMVTG  215

Query  671   IQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELG  850
             + E    VP++  SV+ A REV+++G  R+V+PG FPLGC P+ L+     +   YD  G
Sbjct  216   VVESVVLVPEVVRSVVGAAREVLEMGATRVVIPGNFPLGCAPSYLAAVDETERAAYDGNG  275

Query  851   CLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYM  1030
             CL  +N      N  LQQ +  LR+ +P+A + YADY+ A+   L RA  +GF    L  
Sbjct  276   CLVGLNLFAQMHNVLLQQGIRELRRSYPEATVAYADYFGAYVRMLERAREMGFDGTALTN  335

Query  1031  TCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
              CCG+GGG+YN++  ++CG+ G   C  P + I WDGVHLTQ+A+  +++++
Sbjct  336   ACCGAGGGKYNFEMERMCGAGGTAVCARPEERISWDGVHLTQRAYSVMAELL  387



>ref|NP_001173068.1| Os02g0608801 [Oryza sativa Japonica Group]
 dbj|BAD19595.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAD20155.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAH91797.1| Os02g0608801 [Oryza sativa Japonica Group]
Length=403

 Score =   275 bits (703),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/352 (41%), Positives = 207/352 (59%), Gaps = 20/352 (6%)
 Frame = +2

Query  185   VVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARL--PYGITFPGRPTGRWSDGLLIVD  358
             VV    +IY FG S+ DTGN +R GA    +    +  PYG    G  TGR SDG L++D
Sbjct  38    VVDGITAIYNFGDSISDTGNYLREGAAAGAMMEHTVAPPYGAAIGG-ATGRCSDGYLMID  96

Query  359   FIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             ++A+ +GLPLLNPYLDK A FT+GVNFAVT +TALD   LA+ GV  P     LS Q+ W
Sbjct  97    YLAKDLGLPLLNPYLDKGADFTHGVNFAVTGATALDAAALARIGVAAPHTNSSLSVQLQW  156

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGR----------------T  670
              + ++S++   +P++ +D+L  SL  VGEIG ND  +A    R                 
Sbjct  157   FRDFMSATT-KSPAEVRDKLASSLVMVGEIGGNDYNYAFAANRPRPGGRSAADVGRMVTG  215

Query  671   IQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELG  850
             + E    VP++  SV+ A REV+++G  R+V+PG FPLGC P+ L+     +   YD  G
Sbjct  216   VVESVVLVPEVVRSVVGAAREVLEMGATRVVIPGNFPLGCAPSYLAAVDETERAAYDGNG  275

Query  851   CLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYM  1030
             CL  +N      N  LQQ +  LR+ +P+A + YADY+ A+   L RA  +GF    L  
Sbjct  276   CLVGLNLFAQMHNVLLQQGIRELRRSYPEATVAYADYFGAYVRMLERAREMGFDGTALTN  335

Query  1031  TCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
              CCG+GGG+YN++  ++CG+ G   C  P + I WDGVHLTQ+A+  +++++
Sbjct  336   ACCGAGGGKYNFEMERMCGAGGTAVCARPEERISWDGVHLTQRAYSVMAELL  387



>ref|XP_002452415.1| hypothetical protein SORBIDRAFT_04g025350 [Sorghum bicolor]
 gb|EES05391.1| hypothetical protein SORBIDRAFT_04g025350 [Sorghum bicolor]
Length=399

 Score =   275 bits (702),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 205/356 (58%), Gaps = 19/356 (5%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             + + V V    +IY FG SL DTGNL+R GA G       LPYG    G  TGR SDG L
Sbjct  32    KEKVVAVDGITAIYNFGDSLSDTGNLLREGATGMLQHTTGLPYGSAI-GGATGRCSDGYL  90

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQ  529
             ++D++A+ +GLPLLNPYLD  A F++GVNFAV  +TALD   LA++GV VP     L  Q
Sbjct  91    MIDYLAKDLGLPLLNPYLDDGADFSHGVNFAVAGATALDAAALARRGVAVPHTNSSLGVQ  150

Query  530   INWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQ-----------  676
             +   K ++S++   +P + +++L  SL  VGEIG ND  +A    + +            
Sbjct  151   LQRFKDFMSANT-QSPEEIREKLAHSLVMVGEIGGNDYNYAFSANKPVAGGARNIYNFGR  209

Query  677   ------EVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
                   E  A VPD+  SV +A RE++ +G  R+V+PG FPLGC P+ ++     DP  Y
Sbjct  210   MATGVAEAMALVPDVVRSVTSAARELLDMGATRVVIPGNFPLGCVPSYMAAVNETDPAAY  269

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             D  GCL ++N      N  LQQ +  LR+ +P A I YADY+ A+   L  A   GF + 
Sbjct  270   DANGCLAALNLFAQMHNVLLQQGIRELRRSYPSATISYADYFYAYVRMLRDAGKTGFDEG  329

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
                  CCG+GGG YN+D +++CG+ G   C  P + I WDGVHLTQ+A+  +S ++
Sbjct  330   ARTTACCGAGGGAYNFDMDRMCGAPGASVCARPDERISWDGVHLTQRANSVMSDLL  385



>ref|XP_010674065.1| PREDICTED: acetylajmalan esterase-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=382

 Score =   274 bits (700),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 142/341 (42%), Positives = 214/341 (63%), Gaps = 8/341 (2%)
 Frame = +2

Query  161   VENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSD  340
             V N N +   C   SIYQ G SL DTGNLI     G     ARLPYG +F   PTGR SD
Sbjct  33    VSNSNPRS--CNITSIYQLGDSLSDTGNLIIESPNGVASAFARLPYGESFFKHPTGRCSD  90

Query  341   GLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPL  520
             GLL++DF+A+A+ +P LNPYL+++A F +GVNFAV  +TAL + FLA K +V P     L
Sbjct  91    GLLMIDFMAKALNIPRLNPYLNRDALFNHGVNFAVAGATALPVEFLADKNIVNPLTNSSL  150

Query  521   SGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPD  700
             S Q++W+ ++  +SIC    DC  +LK +LF VG+IG +D  +A  QG+ +++V   V D
Sbjct  151   SVQLDWMWSHF-NSICYDGQDCAAKLKCALFIVGDIGSHDYYYAFSQGKRMEDVNNMVID  209

Query  701   ITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTI  880
             +  ++I  +  VIQ+GG +I+VPG+FPLG FP  L+    +   +   L   R + NL++
Sbjct  210   VVEAIIEGITRVIQIGGTKIIVPGSFPLGQFPAYLT---ARQANNSTTLRKQRLLYNLSL  266

Query  881   FRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFH-QNKLYMTCCGSGGGQ  1057
               N+ L++ L  L++++ +  I+Y DY+ AF   +  AP  GF+  + L   CCG  GG+
Sbjct  267   HHNDELKKRLQMLKRDYKNITIIYVDYHNAFDRLMENAPRFGFNGASDLRKACCGV-GGR  325

Query  1058  YNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             ++++ +++CG+ GV  C NP  Y+ WDG +LTQKA+  +++
Sbjct  326   FSFNPSRLCGAAGVPVCTNPDGYVMWDGFNLTQKAYRILAR  366



>ref|XP_009765905.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X2 [Nicotiana 
sylvestris]
Length=356

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 197/346 (57%), Gaps = 30/346 (9%)
 Frame = +2

Query  179   KVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVD  358
             +++ C F  I+Q G SL DTGN IR           R PYG+ F    TGR S+G+L++D
Sbjct  39    RLMKCRFDKIFQLGDSLSDTGNCIRENLCARGFLCGRFPYGMNFFQNTTGRCSNGMLMID  98

Query  359   FIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             FI                          V  +TAL    LA++ +V       LS Q++W
Sbjct  99    FI--------------------------VAGATALSTENLAEEKIVNSVTNSSLSVQLDW  132

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
             + T+  S+    P+D   +LK+SLF VGEIG N+  + L +G+T++E+ + VP +  ++I
Sbjct  133   MSTHFKSTY---PTDRLSKLKKSLFLVGEIGGNEFNYGLFKGKTLKELRSMVPKVVQTII  189

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHL  898
               VR VI  G  RI+VPG FP+GC P  L+QF T D   YDE  CL+ +N+L IF N+HL
Sbjct  190   QGVRTVISFGATRIIVPGNFPIGCLPIFLTQFRTSDSTAYDEYHCLQDLNDLAIFFNDHL  249

Query  899   QQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNK  1078
             +QA+  L++E  +  ++Y DYY A+   L  A  LGF +N L   CCG  GG YNYD + 
Sbjct  250   KQAIQELKEEHSNIALVYGDYYNAYMWLLQNAMFLGFDKNSLLKACCGI-GGDYNYDVHN  308

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              CG+ GV  C +P  YI WDGVHLT+K +  +++ +I ++L ++ C
Sbjct  309   QCGAIGVSVCTDPSTYISWDGVHLTEKTYSWLARWLIDDMLPKLNC  354



>ref|XP_003572686.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Brachypodium 
distachyon]
Length=423

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/358 (40%), Positives = 201/358 (56%), Gaps = 32/358 (9%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY FG S+ DTGN IR G +G        PYG    G  TGR SDG L++DF+A  +GL
Sbjct  52    AIYNFGDSISDTGNFIREGPVGLMEHTGEPPYGSAI-GAATGRCSDGYLMIDFLAADLGL  110

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSGQINWLKTYLSS  559
             PLL+PYLD+ A FT+GVNFAVT +TA+D   L   GV  +P     LS Q+   K +++S
Sbjct  111   PLLSPYLDERADFTHGVNFAVTGATAVDTASLQSMGVDNMPHTNSSLSVQLQRFKDHMAS  170

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVA------------------  685
             +   +PS+ ++RL  SL  +GEIG ND  +A    R   + A                  
Sbjct  171   A-SNSPSEIRERLASSLVMLGEIGGNDYNYAFATNRPRHQAAAGADDDWPHSLYYKFYNT  229

Query  686   -----------AFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPK  832
                        A VP +  ++  A RE++++G  R+V+PG FPLGC P+ LS  G +DP 
Sbjct  230   GQMITGAVEAMALVPHVVAAITGAARELLEMGATRMVIPGNFPLGCAPSYLSAVGEKDPA  289

Query  833   DYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFH  1012
              YD  GCL  +N      N  LQQ +  LR  +P A I YADY++A+   L  A  LGF 
Sbjct  290   AYDGNGCLVGLNLFAQMHNVALQQGIRELRATYPGATIAYADYFSAYVRMLRAASGLGFD  349

Query  1013  QNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
                    CCG+GGG+YN+D +++CG+TG   C  P  Y+ WDGVHLTQ+ +  +++++
Sbjct  350   AAAATKACCGAGGGEYNFDMDRMCGATGTTVCERPDGYLSWDGVHLTQRVYQVMNELL  407



>ref|NP_001172233.1| Os01g0216900 [Oryza sativa Japonica Group]
 dbj|BAH90963.1| Os01g0216900 [Oryza sativa Japonica Group]
Length=383

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/328 (40%), Positives = 196/328 (60%), Gaps = 4/328 (1%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGA-IGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
             S++ FG S  DTGN + + A + P +P   LPYG TF G PTGR ++G +I+DFIA    
Sbjct  38    SVFSFGNSFADTGNFVELAAPLLPIMPFNNLPYGETFFGHPTGRATNGRIIMDFIADEFH  97

Query  380   LPLLNPYLDK-NASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSGQINWLKTYL  553
             +P + P+L +   +FT+G NFAV  ++ALD+ F  +  +  VP + + LS Q+ W +  L
Sbjct  98    VPFVPPFLGQGRQNFTHGANFAVVGASALDLAFFLKNNITNVPPLNISLSVQLEWFQK-L  156

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
               ++C    +C++  KRSLFF+GE G ND  F L  G+T++E+  +VP +  ++   +  
Sbjct  157   KPTLCQTAQECREYFKRSLFFMGEFGGNDYVFILAAGKTLEELVPYVPKVVQAISAGIEA  216

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALG  913
             VI+ G R +VVPG  P GC P +L+ + ++   DYD  GCL+  N L  + N+ L +A+ 
Sbjct  217   VIKEGARYVVVPGELPNGCVPIILTLYASKSRGDYDARGCLKKQNALARYHNSALFEAVS  276

Query  914   SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGST  1093
              LR  +P   I+YADYY     F+ +    GF+ +     CCG+GGG YNYD    CG  
Sbjct  277   RLRHRYPWVKIVYADYYKPVIDFIKKPARFGFNGSSTLRACCGAGGGPYNYDATAACGLP  336

Query  1094  GVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             G  +CP+P  +I WDG+HLT+ A+  IS
Sbjct  337   GAAACPDPAAFISWDGIHLTEAAYARIS  364



>ref|XP_010674066.1| PREDICTED: acetylajmalan esterase-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/347 (41%), Positives = 217/347 (63%), Gaps = 8/347 (2%)
 Frame = +2

Query  161   VENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSD  340
             V N N +   C   SIYQ G SL DTGNLI     G     ARLPYG +F   PTGR SD
Sbjct  33    VSNSNPRS--CNITSIYQLGDSLSDTGNLIIESPNGVASAFARLPYGESFFKHPTGRCSD  90

Query  341   GLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPL  520
             GLL++DF+A+A+ +P LNPYL+++A F +GVNFAV  +TAL + FLA K +V P     L
Sbjct  91    GLLMIDFMAKALNIPRLNPYLNRDALFNHGVNFAVAGATALPVEFLADKNIVNPLTNSSL  150

Query  521   SGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPD  700
             S Q++W+ ++  +SIC    DC  +LK +LF VG+IG +D  +A  QG+ +++V   V D
Sbjct  151   SVQLDWMWSHF-NSICYDGQDCAAKLKCALFIVGDIGSHDYYYAFSQGKRMEDVNNMVID  209

Query  701   ITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTI  880
             +  ++I  +  VIQ+GG +I+VPG+FPLG FP  L+    +   +   L   R + NL++
Sbjct  210   VVEAIIEGITRVIQIGGTKIIVPGSFPLGQFPAYLT---ARQANNSTTLRKQRLLYNLSL  266

Query  881   FRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFH-QNKLYMTCCGSGGGQ  1057
               N+ L++ L  L++++ +  I+Y DY+ AF   +  AP  GF+  + L   CCG  GG+
Sbjct  267   HHNDELKKRLQMLKRDYKNITIIYVDYHNAFDRLMENAPRFGFNGASDLRKACCGV-GGR  325

Query  1058  YNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNI  1198
             ++++ +++CG+ GV  C NP  Y+ WDG +LTQKA+  +++ +  ++
Sbjct  326   FSFNPSRLCGAAGVPVCTNPDGYVMWDGFNLTQKAYRILARWLFRSV  372



>ref|XP_006828268.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
 gb|ERM95684.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
Length=377

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/335 (41%), Positives = 206/335 (61%), Gaps = 7/335 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + +++ FG SL DTGNL+  G   P +  A  P+G TF  +PTGR SDG L+VDF+A A 
Sbjct  34    YSALFSFGDSLADTGNLLLSGH-SPFIRIAHPPFGETFFHKPTGRCSDGRLVVDFVAEAF  92

Query  377   GLPLLNPYLDK---NASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             GLPLL PYL K    A F  GVNFAV  +TAL+  +  +K +        L+ Q+ W   
Sbjct  93    GLPLLPPYLSKLKGPADFRKGVNFAVAGATALNSSYFTKKNIGFLWTNSSLNVQLGWF-Y  151

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             +L  S+C   + CK  LK+S+F VGEIG ND  +A +QG++I++V ++VPD+  +++NA 
Sbjct  152   HLLPSLCRTDAACKSYLKKSVFLVGEIGGNDYNYAFIQGKSIEQVKSYVPDVINAIMNAA  211

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQ  904
               +I++G + +VVPG  P+GC  ++L+ F T D  +YD   GCL   N    + N+ L +
Sbjct  212   SVLIRIGAKTLVVPGNLPVGCSASILTGFLTTDKNEYDPRNGCLIRFNEFAQYHNSKLHK  271

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
             A+ ++R+ FP   I+YADYY A   F+    + GF +  +   CCG GGG YN++    C
Sbjct  272   AIQAMRERFPHINIIYADYYNAAIRFVQTPEMFGFRKETVLRACCG-GGGPYNFNITDRC  330

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             G  G  +C NP +Y++WDG+HLT+ A+  I++ ++
Sbjct  331   GHPGAHACANPARYVNWDGIHLTEAAYEFIAKAML  365



>dbj|BAJ86481.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 206/357 (58%), Gaps = 12/357 (3%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             + C  LV  A  G   +N       + S++ FG SL DTGNL+    +   +   R PYG
Sbjct  27    LACCCLVRLAQCGGGGQN-------YTSMFSFGDSLTDTGNLLVSSPLSFNI-VGRFPYG  78

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLA  481
             +T+  RPTGR SDG L+VDF+A+A GLPLL PYL +      GVNFAV  +TA+D  F  
Sbjct  79    MTYFHRPTGRCSDGRLVVDFLAQAFGLPLLQPYLSRGKDVRQGVNFAVGGATAMDPPFFQ  138

Query  482   QKGVVVPSIT-VPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
               G      T + LS Q++W    L  S+C++P +CK    RSLF VGEIG ND  +AL 
Sbjct  139   GIGASDKLWTNLSLSVQLDWFDK-LKPSLCSSPKNCKKYFSRSLFLVGEIGGNDYNYALF  197

Query  659   QGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
             +G+T+ +  ++VP +++++I+A   +I+ G   +VVPG  P+GC    L+    ++  DY
Sbjct  198   KGKTLDDAKSYVPTVSSAIIDATERLIKGGAMHLVVPGNLPMGCSSAYLTLHPGRNSSDY  257

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             D +GCL++ N      N  +QQ L  LR ++P A I+YADYY A  SF       GF Q 
Sbjct  258   DSVGCLKTYNEFAQRHNAMVQQKLQVLRLKYPKARIMYADYYGAAMSFAKNPKQFGFKQG  317

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              L  TCCG GGG YN++    CG  G   C +P  Y +WDGVHLT+ A+ AI+  ++
Sbjct  318   PL-KTCCG-GGGPYNFNPTASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSIL  372



>ref|XP_009587414.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X2 [Nicotiana 
tomentosiformis]
Length=357

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/366 (39%), Positives = 205/366 (56%), Gaps = 35/366 (10%)
 Frame = +2

Query  134   LLVYAAASGVENE-----NQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPY  298
             L+V    S  E++       +++ C F  I+Q G SL DTGN IR       L   R PY
Sbjct  20    LVVLQQKSNAEDQLLMLQKPRLMKCRFDKIFQLGDSLSDTGNCIRESLCARRLLCGRFPY  79

Query  299   GITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFL  478
             G+ F    TGR S+G+L++DFI                          V  +TAL    L
Sbjct  80    GMNFFQNTTGRCSNGMLMIDFI--------------------------VAGATALSTENL  113

Query  479   AQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
             A++ +V       +S Q++W+ T+  S+    P+D   +LK+SLF VGEIG N+  + L 
Sbjct  114   AEEKIVNSVTNSSMSVQLDWMSTHFKSTY---PTDRLAKLKKSLFLVGEIGGNEFNYGLF  170

Query  659   QGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
             +G+TI+E+ + VP +  ++I  VR VI  G  RIVVPG FP+GC P  L+QF T D   Y
Sbjct  171   KGKTIKELRSMVPKVVQTIIQGVRTVISFGATRIVVPGNFPIGCIPIFLTQFRTNDSTAY  230

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             DE  CL+ +NNL+IF N+HL+QA+  L++E  +  ++Y DYY A+   L  A  +GF +N
Sbjct  231   DEYHCLQDLNNLSIFFNDHLKQAIQELKEEHSNIALVYGDYYNAYLWLLQNAMFIGFDKN  290

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNI  1198
              L   CCG  GG YNY     CG+ GV  C +P  YI WDGVHLT+KA+  +++ +I ++
Sbjct  291   SLLKACCGV-GGDYNYGIQNQCGAIGVPVCTDPNTYISWDGVHLTEKAYSWLARWLIDDM  349

Query  1199  LSRIQC  1216
             L ++ C
Sbjct  350   LPKLNC  355



>ref|XP_004234096.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum lycopersicum]
Length=380

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/341 (42%), Positives = 201/341 (59%), Gaps = 11/341 (3%)
 Frame = +2

Query  179   KVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVD  358
             K V   + SI  FG SL DTGNLIR+      + ++ LPYG TF   PTGR+SDG L++D
Sbjct  20    KHVYGSYESIISFGDSLADTGNLIRLSKSNKIVASSVLPYGETFFHHPTGRFSDGRLVID  79

Query  359   FIARAVGLPLLNPYLD--KNASFTN----GVNFAVTASTALDIGFLAQKGVVVPSITVPL  520
             FIA  +G PL+ PY+   KN S +     GVNFAV  +TA+DI +L ++G+  P+  V L
Sbjct  80    FIAEGMGFPLVPPYVGVMKNMSSSKNSIRGVNFAVAGATAVDISYLEKRGIKNPATNVSL  139

Query  521   SGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPD  700
               Q+ W K  L   +C +P+ CK+ L+ SLF +GEIG ND      QG++ +EV +FVP 
Sbjct  140   GTQLEWFKQMLPI-LCDSPTSCKEYLENSLFLMGEIGGNDYNHPFSQGKSGEEVKSFVPA  198

Query  701   ITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLT  877
             + +++  A+ E+I++G + ++VPG  P+GC  + L+ F   + KDYD   GC+  +N   
Sbjct  199   VISAIGQAINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKKDYDNSTGCIIWLNEFA  258

Query  878   IFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQ  1057
              + N  LQQ +  LR+  P A I+YADYY A           GF      + CCG GGG 
Sbjct  259   EYHNQLLQQEIHKLREIHPHANIIYADYYNAAMQIYRSPKKFGF--TSTIVACCG-GGGV  315

Query  1058  YNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             YNYD N+ CGS     C  P  Y+ WDGVHLT+ A+  I++
Sbjct  316   YNYDSNRPCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAK  356



>ref|XP_006828273.1| hypothetical protein AMTR_s00023p00217880 [Amborella trichopoda]
 gb|ERM95689.1| hypothetical protein AMTR_s00023p00217880 [Amborella trichopoda]
Length=374

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/335 (43%), Positives = 198/335 (59%), Gaps = 7/335 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + S++ FG S+ DTGNL+  G   P +  A  PYG TF  +PTGR SDG LIVDF A A+
Sbjct  28    YSSLFSFGDSISDTGNLLLSGD-NPFIGIANPPYGQTFFKKPTGRCSDGRLIVDFFAEAL  86

Query  377   GLPLLNPYLDKNAS---FTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             GLP L PYL K+ S   F  G+NFAV  +TAL   +   +G+ +      LS Q+ W + 
Sbjct  87    GLPFLPPYLSKSKSKKDFRKGMNFAVAGATALSYSYFESRGMGLLWTNKSLSVQLEWFQQ  146

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             +L S +C   +DCK  LK SLF VGEIG ND  + L+Q R++ E   +VPD+  ++  AV
Sbjct  147   FLPS-LCHPGTDCKRYLKNSLFLVGEIGGNDFNYPLLQARSLHEARTYVPDVIKAITEAV  205

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQ  904
               +I++G + +VVPG FP GC    L+ F T +  +Y+   GCL   N    + N+ LQ 
Sbjct  206   SVLIRLGAKTLVVPGNFPTGCSTLYLTVFQTNNKDEYEPSTGCLIRFNEFASYYNSKLQD  265

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
              + +LRK FP A I+YAD Y     F+    L GF + ++   CCG GGG YN+D  K C
Sbjct  266   GIQALRKRFPKATIIYADNYNMSMRFVETPTLFGFPKERVLFACCG-GGGPYNFDITKTC  324

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             GS  V +C  P QY  WDG+HLT+ A+  I++ ++
Sbjct  325   GSPRVKACTYPAQYADWDGLHLTEAAYEFIAKAML  359



>ref|XP_006844517.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
 gb|ERN06192.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
Length=378

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 198/338 (59%), Gaps = 11/338 (3%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +++ FG SL DTGNL +            LPYG TF  RPTGR SDG LIVDF+A+ +GL
Sbjct  32    ALFSFGDSLTDTGNL-KYLEHDQFFDIWSLPYGETFFHRPTGRCSDGRLIVDFLAQGLGL  90

Query  383   PLLNPYLDK---NASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYL  553
             P+L PYL        F  G NFAV  +TAL    L +KGV   S  + L  Q+ W    L
Sbjct  91    PMLQPYLSGFHGAVEFRKGANFAVGGATALSPSLLREKGVEKLSTNISLENQLQWFYQLL  150

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
              S IC   +DCK+ +KRS+F VGEIG ND  FA   G  I EV AFVPD+ TS++  V  
Sbjct  151   PS-ICHPNNDCKEYMKRSIFLVGEIGGNDYYFAFNHGMKIDEVQAFVPDVVTSIMKTVEG  209

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQAL  910
             +IQ G R +VVPG  P GC+  +L+ F + +  DYD + GCL   N+   F N+ L+  +
Sbjct  210   LIQKGARTLVVPGGIPFGCWTCVLTVFPSDNSSDYDPQTGCLIPFNDFLSFHNSKLEDGI  269

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              ++RK+FP A I+YADYY A   F     L GF ++ ++M CCG  GG YN+D  + CG 
Sbjct  270   QAMRKKFPQANIIYADYYNALLRFFESPELYGFPKDTVHMACCGV-GGPYNFDPARTCGQ  328

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILS  1204
               V SC NP   ++WDG+H T+ A    S+ V+  +LS
Sbjct  329   PEVHSCENPSMRVNWDGLHPTEAA----SKHVVRALLS  362



>ref|XP_002512444.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF49896.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=367

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 145/352 (41%), Positives = 210/352 (60%), Gaps = 11/352 (3%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             E Q +  C F +IYQ G S+ DTGN I    I P    +RLPYG T  G+ TGR SDG L
Sbjct  22    EAQDLKACKFDAIYQLGDSISDTGNSIV--EIPPAF-HSRLPYGETI-GKATGRPSDGYL  77

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQ  529
             ++DFIA++ GLP L PY + N+ FT+G +F+V  + A+    L +  + V      LS Q
Sbjct  78    MIDFIAQSAGLPFLEPYENPNSKFTHGADFSVAGARAMSAEDLLKLNLDVGFTNSSLSVQ  137

Query  530   INWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFV-PDIT  706
             + WLK  LS+ +C  P DC+++LK SLF VG IG ND+   L +G  I++V   V P + 
Sbjct  138   LGWLKKVLST-VCNGPKDCQEKLKSSLFMVGLIGPNDLMAGLFKGDGIEKVKTTVLPAVL  196

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              +VI+ V+ VI  G  R+VVPG +PLGC P+LL+ +       YD LGCL+  N+   + 
Sbjct  197   QTVIDGVQTVISYGASRVVVPGAYPLGCTPSLLTTYSVNKSAAYDSLGCLKDYNDFFAYY  256

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N  LQ AL + RK  P+ +I+Y+D+Y+A QS L     LGF   +    CCG  GG++N+
Sbjct  257   NTQLQIALENSRKANPNVIIIYSDFYSATQSILDNLSTLGFKAFR--KACCGI-GGEFNF  313

Query  1067  --DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
                  K CG+ GV  CPNP +++ WDG H +  A++ +++ +I  +L ++ C
Sbjct  314   TPTMQKTCGAKGVPVCPNPKEHVFWDGGHFSHHANMVLAEWLIKEMLPQLHC  365



>ref|XP_002457134.1| hypothetical protein SORBIDRAFT_03g001820 [Sorghum bicolor]
 gb|EES02254.1| hypothetical protein SORBIDRAFT_03g001820 [Sorghum bicolor]
Length=377

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/329 (42%), Positives = 199/329 (60%), Gaps = 6/329 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGA-IGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARA  373
             F SI+ FG S  DTGN +R+ A I P +P   LPYG TF  RPTGR S+G L++DFIA A
Sbjct  34    FTSIFSFGNSYTDTGNFVRLAAPIIPVIPFNNLPYGETFFRRPTGRASNGRLVLDFIADA  93

Query  374   VGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYL  553
              GLP + P LDK+ SF+ G NFAV  +TALD+ +  +  +   S+   LS QI W +  L
Sbjct  94    FGLPFVPPSLDKSQSFSKGANFAVVGATALDLSYFQEHNIT--SVPPSLSVQIGWFQQ-L  150

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
               S+C+ P  C   L +SLF +GEIG ND  + L   +T+ +  + VP +  ++   V  
Sbjct  151   KPSLCSTPKQCDGYLGKSLFVMGEIGGNDYIYLLAANKTVAQTKSHVPTVVKAIAGGVER  210

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALG  913
             +I +G +RIVVPG  P+GC P +L+ + +    DYDE GCL   N+L  + N  L++ + 
Sbjct  211   LINLGAKRIVVPGNLPMGCTPIILTLYASHSKSDYDEYGCLDRFNDLARYHNELLRREVQ  270

Query  914   SLRKEF-PDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
             +L+K++ P   I +ADY+     FL +    GF+     + CCG+ GG+YNY+    CG 
Sbjct  271   ALQKKYKPTTKIAFADYFRPVVEFLQKPDEFGFNGGTALVACCGA-GGRYNYNATAACGL  329

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
              G  +C +P + ++WDGVHLT+KA+ AI+
Sbjct  330   AGATTCVDPSRALNWDGVHLTEKAYGAIA  358



>ref|XP_004955062.1| PREDICTED: acetylajmalan esterase-like [Setaria italica]
Length=415

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 149/345 (43%), Positives = 206/345 (60%), Gaps = 19/345 (6%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGL  382
             +IY FG SL DTGNL+R GA G    +   PYG    G  TGR SDG L++DF+A+ +GL
Sbjct  49    AIYNFGDSLSDTGNLLREGATGMLRHSMGPPYGSAIGG-ATGRCSDGYLMIDFLAKDLGL  107

Query  383   PLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSS  562
              LLNPYLDK A FT+GVNFAV  +TALD   LA++GVVVP     L+ Q+   K ++S++
Sbjct  108   LLLNPYLDKGADFTHGVNFAVAGATALDAAALARRGVVVPHTNTSLAVQLQQFKDFMSAN  167

Query  563   ICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQ-----------------EVAAF  691
                +P + +++L RSL  VGEIG ND  +A  + R +                  E  A 
Sbjct  168   T-RSPQEIREKLARSLVMVGEIGGNDYNYAFSENRPVAGGARNFYNFGRMATGVVEAMAL  226

Query  692   VPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINN  871
             VPD+  SV +A RE++ +G  R+V+PG FPLGC P+ +S     DP  YD  GCL S+N 
Sbjct  227   VPDVVRSVTDAARELLDMGATRLVIPGNFPLGCVPSYMSAVNETDPAAYDANGCLMSLNL  286

Query  872   LTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGG  1051
                  N  LQQ +  LR+ +P A I YADY+ A+   L  A   GF +  +   CCG+GG
Sbjct  287   FAQMHNVLLQQEIRELRRSYPSATIAYADYFYAYVRMLRDAGKTGFDEGAVTKACCGAGG  346

Query  1052  GQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
             G+YN++  ++CG+ G   C  P + I WDGVHLTQ+A+  ++ ++
Sbjct  347   GEYNFNMERMCGAPGASVCARPEERISWDGVHLTQRAYRVMTDLL  391



>ref|XP_008812183.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=395

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 146/351 (42%), Positives = 212/351 (60%), Gaps = 11/351 (3%)
 Frame = +2

Query  173   NQKVVVCPFRSIYQFGASLHDTGNLIR-VGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             +   + C + SI+ FG SL DTGNL+  VG     +   RLPYG T+  RPTGR+SDG L
Sbjct  26    SHAAITC-YTSIFSFGDSLADTGNLLHDVGK--NNIHVGRLPYGETYFRRPTGRFSDGRL  82

Query  350   IVDFIARAVGLPLLNPYLDK--NASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLS  523
             +VDF+A+A+GLPLL PYL       F  G NFAV  +TA++ GF  +KG+ V      L 
Sbjct  83    VVDFLAQAMGLPLLPPYLAGPGRKGFRRGANFAVAGATAIENGFFTEKGIQVLWSNNSLG  142

Query  524   GQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDI  703
              QI W +  L S +C++ SDC D  + SLF VGEIG ND  +  +Q R++ E+ ++VP +
Sbjct  143   SQIEWFRQLLPS-LCSSDSDCNDMFRNSLFLVGEIGGNDYNYPFLQARSLDEIVSYVPRV  201

Query  704   TTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIF  883
               ++ +A+  +I++G R +VVPG FP+GC    L+ F +   +DYD +GC++ +N  + F
Sbjct  202   MDAISSAITALIELGARTLVVPGNFPIGCNSAYLTVFRSNRSEDYDAIGCIKWLNKFSRF  261

Query  884   RNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYN  1063
              NN L+  L  +R   P A ++YADYY+A  S  +     GF  + L   CCG GGG YN
Sbjct  262   HNNRLRVVLNRVRLRNPHATVIYADYYSAAMSLFSSPEPSGFRISPL-PACCG-GGGPYN  319

Query  1064  YDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAH--LAISQIVIPNILSRI  1210
             Y+ +  CG++G   C +P  YI WDG+H+T+ A+  +AI  +  PN +  I
Sbjct  320   YNSSLQCGNSGSNICADPSIYITWDGMHMTEAAYRKIAIGLLKGPNAVPAI  370



>ref|XP_009122651.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g03980 
[Brassica rapa]
Length=332

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/342 (42%), Positives = 199/342 (58%), Gaps = 39/342 (11%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   SIYQFG S+ DTGNLIR G IG + P+ +                           
Sbjct  27    CLINSIYQFGDSIADTGNLIRNGPIGASTPSPK---------------------------  59

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
                 PL          F+NGVNFAV  STAL+  F   + + VP+   PLS Q++W K++
Sbjct  60    ----PLPQRKHHATVFFSNGVNFAVAGSTALNSSFFTSRNLHVPATNTPLSTQLSWFKSH  115

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S+ C  PS C   LK+SL  +GEIG ND  +   QG++ +E+ +++P +  ++  A R
Sbjct  116   LRST-CHNPS-C---LKQSLVMMGEIGGNDYNYGFFQGKSTEEIRSYIPHVVGAIAAAAR  170

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             EVI+ G   +VVPG FP+GCFP  L+ F   DPK YD+ GCL  +N   +  NN LQ+A+
Sbjct  171   EVIRAGAVNVVVPGNFPVGCFPIYLTSFPVNDPKAYDDKGCLIRLNEFAMDHNNQLQEAI  230

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              SL+KEFP  VI+Y DYY AFQ  L+ +  +GF ++    +CCG GGG YNYD  + CG+
Sbjct  231   SSLQKEFPGVVIVYGDYYNAFQYVLSGS--VGFDKSVALKSCCGIGGG-YNYDGKRQCGA  287

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              GV  C NP ++I WDGVHLTQKA+  +S+ +   IL +I+C
Sbjct  288   VGVPVCQNPDKFISWDGVHLTQKAYRFMSKFLNYKILPQIKC  329



>ref|XP_003542991.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Glycine 
max]
 ref|XP_006594559.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Glycine 
max]
 ref|XP_006594560.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X3 [Glycine 
max]
Length=378

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/367 (42%), Positives = 214/367 (58%), Gaps = 17/367 (5%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             I+ F++V+++A+        +  CP++SI+ FG S  DTGNL    +  P+      PYG
Sbjct  12    IVGFVVVFSSAT-------ILAACPYKSIFSFGDSFADTGNLY-FSSHPPSHHCFFPPYG  63

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLD-KNASFTNGVNFAVTASTALDIGFL  478
              TF  R TGR SDG LI+DFIA ++GLPLL PYL  K  +   G NFAV  +TALD+ F 
Sbjct  64    QTFFHRVTGRCSDGRLIIDFIAESLGLPLLKPYLGMKKKNVVGGANFAVIGATALDLSFF  123

Query  479   AQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
              ++G+ +P+    L+ Q+NW K  L S +C + +DC + +  SLF +GEIG ND  + L 
Sbjct  124   EERGISIPT-HYSLTVQLNWFKELLPS-LCNSSADCHEVVGNSLFLMGEIGGNDFNYLLF  181

Query  659   QGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
             Q R+I EV  FVP +  ++ +AV E+I +G R ++VPG  PLGC    L+ + T D   Y
Sbjct  182   QQRSIAEVKTFVPYVIKAITSAVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQY  241

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             D+ GCL+ +N    + N  LQ  L  L+     A I+YADYY A  S      + GF   
Sbjct  242   DQYGCLKWLNKFAEYYNQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTNL  301

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI--P  1192
             K   TCCG  GG YNY+ +  CG  GV +C +P ++I WDGVHLT+ A+  I+Q +I  P
Sbjct  302   K---TCCGM-GGPYNYNASADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQGLIKGP  357

Query  1193  NILSRIQ  1213
               L R  
Sbjct  358   YCLPRFN  364



>gb|EAZ11035.1| hypothetical protein OsJ_00879 [Oryza sativa Japonica Group]
Length=382

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/328 (42%), Positives = 191/328 (58%), Gaps = 5/328 (2%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGA-IGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
             SI+ FG S  DTGN +++ A + P +    LPYG TF G PTGR SDG L VDFIA   G
Sbjct  38    SIFSFGNSYSDTGNFVKLAAPVIPVIAFNNLPYGETFFGHPTGRASDGRLNVDFIAEDFG  97

Query  380   LPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSGQINWLKTYLS  556
             +PLL PYL ++ +F++G NFAV  +TALD+ F  +  +  VP     LS Q+ W    L 
Sbjct  98    VPLLPPYLGESKNFSHGANFAVVGATALDLAFFQKNNITSVPPFNTSLSVQVEWFHK-LK  156

Query  557   SSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREV  736
              ++C+    C+D  +RSLFF+GE G ND  F L  G+T+ E  ++VP +   +   V  V
Sbjct  157   PTLCSTTQGCRDYFERSLFFMGEFGGNDYVFLLAAGKTVDEAMSYVPKVVGVISAGVEAV  216

Query  737   IQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDE-LGCLRSINNLTIFRNNHLQQALG  913
             I+ G R +VVPG  P GC P +L+ + + +  DY+   GCLR  N L  + N  L  A+ 
Sbjct  217   IEEGARYVVVPGQLPTGCLPIILTLYASANATDYESGAGCLRRFNELARYHNAALFAAVS  276

Query  914   SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGST  1093
              LR + P A I++ADYY     F+      GF ++     CCG GGG+YNY+    CG  
Sbjct  277   LLRGKHPSAAIVFADYYQPVIEFVRMPENFGFSRSSRLRACCG-GGGRYNYNATAACGLA  335

Query  1094  GVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             G  +CP+P   I+WDGVHLT+ A+  I+
Sbjct  336   GATACPDPAASINWDGVHLTEAAYGRIA  363



>ref|NP_001042399.1| Os01g0216400 [Oryza sativa Japonica Group]
 dbj|BAA94220.1| putative esterase [Oryza sativa Japonica Group]
 dbj|BAF04313.1| Os01g0216400 [Oryza sativa Japonica Group]
 gb|EAY73027.1| hypothetical protein OsI_00898 [Oryza sativa Indica Group]
Length=382

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/328 (42%), Positives = 191/328 (58%), Gaps = 5/328 (2%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGA-IGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
             SI+ FG S  DTGN +++ A + P +    LPYG TF G PTGR SDG L VDFIA   G
Sbjct  38    SIFSFGNSYSDTGNFVKLAAPVIPVIAFNNLPYGETFFGHPTGRASDGRLNVDFIAEDFG  97

Query  380   LPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSGQINWLKTYLS  556
             +PLL PYL ++ +F++G NFAV  +TALD+ F  +  +  VP     LS Q+ W    L 
Sbjct  98    VPLLPPYLGESKNFSHGANFAVVGATALDLAFFQKNNITSVPPFNTSLSVQVEWFHK-LK  156

Query  557   SSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREV  736
              ++C+    C+D  +RSLFF+GE G ND  F L  G+T+ E  ++VP +   +   V  V
Sbjct  157   PTLCSTTQGCRDYFERSLFFMGEFGGNDYVFLLAAGKTVDEAMSYVPKVVGVISAGVEAV  216

Query  737   IQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDE-LGCLRSINNLTIFRNNHLQQALG  913
             I+ G R +VVPG  P GC P +L+ + + +  DY+   GCLR  N L  + N  L  A+ 
Sbjct  217   IEEGARYVVVPGQLPTGCLPIILTLYASANATDYESGAGCLRRFNELARYHNAALFAAVS  276

Query  914   SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGST  1093
              LR + P A I++ADYY     F+      GF ++     CCG GGG+YNY+    CG  
Sbjct  277   LLRGKHPSAAIVFADYYQPVIEFVRMPENFGFSRSSRLRACCG-GGGRYNYNATAACGLA  335

Query  1094  GVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             G  +CP+P   I+WDGVHLT+ A+  I+
Sbjct  336   GATACPDPAASINWDGVHLTEAAYGRIA  363



>gb|EEE54111.1| hypothetical protein OsJ_00875 [Oryza sativa Japonica Group]
Length=374

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 206/357 (58%), Gaps = 7/357 (2%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             ++C  LV  +  GV    Q+     + S++ FG SL DTGNL+    +  ++   + PYG
Sbjct  14    LVCCSLVRLSRCGVCGGGQRAQ--NYTSMFSFGDSLTDTGNLVVSSPLSFSI-VGKYPYG  70

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLA  481
             +T+  RPTGR SDG L+VDF+A+A GLPLL PYL +    T GVNFAV  +TA+D  F  
Sbjct  71    MTYFHRPTGRCSDGRLVVDFLAQAFGLPLLQPYLSRGEDVTRGVNFAVGGATAMDPPFFE  130

Query  482   QKGVVVPSIT-VPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
             + G      T + LS Q+ W +  L  S+C++P DCK+   +SLF VGEIG ND  +A  
Sbjct  131   EIGASDKLWTNLSLSVQLGWFEQ-LKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFF  189

Query  659   QGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
             +G+++ +  ++VP +  +V +A   +I+ G   +VVPG  P+GC    L+   + +  DY
Sbjct  190   KGKSLDDAKSYVPTVAGAVADATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDY  249

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             D  GCL++ N+     N  LQ  L  LR+ +P+A I+YADYY A  SF       GF   
Sbjct  250   DSTGCLKTYNDFAQHHNAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHG  309

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              L  TCCG GGG YN++    CG  G   C +P  Y +WDGVHLT+  + AI+  ++
Sbjct  310   AL-RTCCG-GGGPYNFNPKASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSIL  364



>ref|XP_003565548.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=373

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/359 (40%), Positives = 205/359 (57%), Gaps = 13/359 (4%)
 Frame = +2

Query  119   CILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPY  298
             C  C + +   A G   +N       + S++ FG SL DTGNL+    +  T+   R PY
Sbjct  16    CCSCLVRLSQCAGGGAGQN-------YTSMFSFGDSLTDTGNLLVSSPLSFTI-VGRFPY  67

Query  299   GITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTASTALDIGF  475
             G+T+  RPTGR SDG L+VDF+A+A GLPLL PYL  K      GVNFAV  +TA+   F
Sbjct  68    GMTYFHRPTGRCSDGRLVVDFLAQAFGLPLLQPYLQSKGKDLRQGVNFAVGGATAMGPPF  127

Query  476   LAQKGVVVPSIT-VPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFA  652
                 G      T + LS Q++W +  L  S+C +P +CK+   +SLF VGEIG ND  +A
Sbjct  128   FEGIGASDKLWTNLSLSVQLDWFEK-LKPSLCNSPKNCKEYFSKSLFLVGEIGGNDYNYA  186

Query  653   LVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPK  832
               +G+++ +  ++VP + T++I+A   +I+ G   +VVPG  P+GC    L+    ++  
Sbjct  187   FFKGKSLDDAKSYVPTVATAIIDATERLIKGGAMHLVVPGNLPMGCSSAYLTLHPGKNSS  246

Query  833   DYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFH  1012
             DYD +GCL++ N      N  +QQ L  LR+++P A I+YADYY A  SF       GF 
Sbjct  247   DYDSVGCLKTYNEFAQRHNAMVQQKLQGLRRKYPQARIMYADYYGAAMSFAKNPKQFGFK  306

Query  1013  QNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
                L  TCCG GGG YN++    CG  G   C +P  Y +WDGVHLT+ A+ AI+  ++
Sbjct  307   HGPL-KTCCG-GGGPYNFNPKTSCGVRGSSVCEDPSAYANWDGVHLTEAAYHAIADSIL  363



>ref|XP_010683534.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=377

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 208/351 (59%), Gaps = 13/351 (4%)
 Frame = +2

Query  161   VENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSD  340
             + N+    +   F +IYQFG SL+D GN IR    GP    ARLPYG T   RPTGR SD
Sbjct  27    LRNKGTLKLATQFEAIYQFGDSLNDNGNFIRQLPGGPKSAVARLPYGETL-KRPTGRASD  85

Query  341   GLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPL  520
             GL++VD+IA    LP L PYL   ++FT+GVNFAV  +TA         G+   S    L
Sbjct  86    GLIMVDYIAMNFQLPPLIPYLANGSNFTHGVNFAVFGATATG-------GIGANS----L  134

Query  521   SGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPD  700
             + Q++W K++L ++  ++P+  K++L++SL  +GEIG ND      +G+TI E+   +P 
Sbjct  135   ASQLDWFKSHLKATY-SSPAAIKEKLQKSLVMMGEIGGNDFNGPFYRGKTIPELTPLIPI  193

Query  701   ITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTI  880
             +  ++ +AV EVI +G   IVVPG FP+GC P  L  F T D   YDEL CL+  N+ + 
Sbjct  194   VVQTIKDAVEEVISLGANNIVVPGNFPIGCVPLYLVNFATNDTSKYDELQCLKDYNDFSK  253

Query  881   FRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQY  1060
               N  L QA+  L++E P+  I+YADYY+A    +  +P LG         CCG+G   Y
Sbjct  254   LYNQQLIQAIQQLQQEHPNVAIVYADYYSALIWVITNSPQLGIEPGCAKKACCGTGSNPY  313

Query  1061  NYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQ  1213
             NYD +K CGS GV  CP+P + I WDGVH+TQ+ +  ++ +++     ++Q
Sbjct  314   NYDGHKFCGSPGVSVCPDPTKRISWDGVHMTQQGNKCVANLLVKQFAPKLQ  364



>ref|XP_009589774.1| PREDICTED: acetylajmalan esterase {ECO:0000303|PubMed:16133216}-like 
[Nicotiana tomentosiformis]
Length=380

 Score =   269 bits (687),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 146/340 (43%), Positives = 202/340 (59%), Gaps = 5/340 (1%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   S+YQFG SL D GN IR+  +   L   +LPYG TF  +PTGR SDG +I DFI  
Sbjct  31    CGITSVYQFGDSLADAGNAIRIPDVSLLLSTGKLPYGETFFNKPTGRASDGRIINDFIVS  90

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
              + LP LN YL+   SF  G NFAV+ +TAL+  F A + V +      L  Q++W K++
Sbjct  91    TLNLPFLNAYLNNGTSFRQGANFAVSGATALNNTFWAAQNVNLRPWNKYLDVQLDWFKSH  150

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S+ C   S+C+  LK SL  +GE G  D        +   E+  +VP +   +   +R
Sbjct  151   LQST-CG--SNCRQNLKNSLVILGEFGGVDYFNCFFSNKQEPEIRRYVPIVIAEITRGIR  207

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             +VI++G  RI+VPG +P GC P  L+ F   +   Y+ LGCLR++N  + + N  L+ AL
Sbjct  208   DVIKLGATRILVPGVYPFGCLPVYLASFAVPNATAYNPLGCLRNLNAFSSYHNTELKIAL  267

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              SL+ EFP+  I+Y DYY A  + L RA   GF+QN L  TCCG GGG YNY   K CGS
Sbjct  268   KSLQCEFPNVRIVYGDYYGALMTVLRRATRFGFNQNTLLTTCCGGGGGLYNY--GKPCGS  325

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRI  1210
              G  +CPNP +Y++WDG+HLT  AH  ++ I++ +IL + 
Sbjct  326   DGATTCPNPSRYVNWDGIHLTDAAHHRMANIIVNDILPKF  365



>ref|XP_004968628.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=378

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 194/331 (59%), Gaps = 5/331 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGA-IGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARA  373
             F +I+ FG S  DTGN +R  A   P +P   LPYG TF  +PTGR S+G +I+DFIA A
Sbjct  31    FTAIFSFGNSYADTGNFVRFAAPFIPVIPFNNLPYGETFFHKPTGRASNGRIILDFIAEA  90

Query  374   VGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSGQINWLKTY  550
              GLPL+ P LD   SF+ G NFAV  +TALD+ +  ++ +  VP      S QI W +  
Sbjct  91    YGLPLVPPSLDTTQSFSKGANFAVVGATALDLSYFMERNITSVPPFNSSFSVQIGWFEQL  150

Query  551   LSSSIC--AAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINA  724
             L +S+C   A   C D LK+SLF +GE G ND  F L   +T+++   +VP +  ++   
Sbjct  151   LKTSLCNNTAKGKCDDYLKKSLFVMGEFGGNDYVFLLAANKTVEQTKTYVPAVVKAIAGG  210

Query  725   VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQ  904
             V ++I+ G RRIVVPG  P GC P +L+ + + +  DYD  GCL  +N L  + N  L++
Sbjct  211   VEKLIKHGARRIVVPGNLPTGCIPIMLTLYASPNKADYDRYGCLDKLNGLARYHNAFLRR  270

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
              + +LR ++P   I YADY+     FL      GF  +   + CCG+ GG+YNY+    C
Sbjct  271   EVMALRIKYPGTKIAYADYFWPVVGFLQNPANSGFDGSTALVACCGA-GGRYNYNVTAAC  329

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             G  G  +C +P + ++WDG+HLT+ A+  I+
Sbjct  330   GFPGATACADPSRAVNWDGIHLTEAAYRDIA  360



>emb|CDX70269.1| BnaA10g26180D [Brassica napus]
Length=328

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 145/342 (42%), Positives = 197/342 (58%), Gaps = 43/342 (13%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   SIYQFG S+ DTGNLIR G  G    AA  PYG T+  + T               
Sbjct  27    CLISSIYQFGDSIADTGNLIRNGPTGAKSHAASFPYGQTYFQQAT---------------  71

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
                                 VNFAV  STAL+  F   + + VP+   PLS Q++W K++
Sbjct  72    --------------------VNFAVAGSTALNSSFFTSRNLHVPATNTPLSTQLSWFKSH  111

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S+ C +PS C   LK+SL  +GEIG ND  +   QG++ +E+ +++P +  ++  A R
Sbjct  112   LRST-CHSPS-C---LKQSLVMMGEIGGNDYNYGFFQGKSTEEIRSYIPHVVGAIAAAAR  166

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             EVI+ G   +VVPG FP+GCFP  L+ F   DPK YD+ GCL  +N   +  NN LQ+A+
Sbjct  167   EVIRAGAVNVVVPGNFPVGCFPIYLTSFPVNDPKAYDDKGCLIRLNEFAMDHNNQLQEAI  226

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              SL+KEFP  VI+Y DYY AFQ  L  +  +GF ++    +CCG GGG YNYD  + CG+
Sbjct  227   SSLQKEFPGVVIVYGDYYNAFQYVLRGS--VGFDKSVALKSCCGIGGG-YNYDGKRQCGA  283

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              GV  C NP ++I WDGVHLTQKA+  +S+ +   IL +I+C
Sbjct  284   VGVPVCQNPDKFISWDGVHLTQKAYRFMSKFLNYKILPQIKC  325



>dbj|BAA94228.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAY73022.1| hypothetical protein OsI_00894 [Oryza sativa Indica Group]
Length=374

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 196/332 (59%), Gaps = 5/332 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + S++ FG SL DTGNL+    +  ++   + PYG+T+  RPTGR SDG L+VDF+A+A 
Sbjct  37    YTSMFSFGDSLTDTGNLVVSSPLSFSI-VGKYPYGMTYFHRPTGRCSDGRLVVDFLAQAF  95

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSGQINWLKTYL  553
             GLPLL PYL +    T GVNFAV  +TA+D  F  + G      T + LS Q+ W +  L
Sbjct  96    GLPLLQPYLSRGEDVTRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGWFEQ-L  154

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
               S+C++P DCK+   +SLF VGEIG ND  +A  +G+++ +  ++VP +  +V +A   
Sbjct  155   KPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVADATER  214

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALG  913
             +I+ G   +VVPG  P+GC    L+   + +  DYD  GCL++ N+     N  LQ  L 
Sbjct  215   LIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDYDSTGCLKTYNDFAQHHNAVLQDKLR  274

Query  914   SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGST  1093
              LR+ +P+A I+YADYY A  SF       GF    L  TCCG GGG YN++    CG  
Sbjct  275   LLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGAL-RTCCG-GGGPYNFNPKASCGVR  332

Query  1094  GVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             G   C +P  Y +WDGVHLT+  + AI+  ++
Sbjct  333   GSSVCTDPSAYANWDGVHLTEAGYHAIANSIL  364



>ref|NP_001042396.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAF04310.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAG87737.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 196/332 (59%), Gaps = 5/332 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + S++ FG SL DTGNL+    +  ++   + PYG+T+  RPTGR SDG L+VDF+A+A 
Sbjct  41    YTSMFSFGDSLTDTGNLVVSSPLSFSI-VGKYPYGMTYFHRPTGRCSDGRLVVDFLAQAF  99

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSGQINWLKTYL  553
             GLPLL PYL +    T GVNFAV  +TA+D  F  + G      T + LS Q+ W +  L
Sbjct  100   GLPLLQPYLSRGEDVTRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGWFEQ-L  158

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
               S+C++P DCK+   +SLF VGEIG ND  +A  +G+++ +  ++VP +  +V +A   
Sbjct  159   KPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVADATER  218

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALG  913
             +I+ G   +VVPG  P+GC    L+   + +  DYD  GCL++ N+     N  LQ  L 
Sbjct  219   LIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDYDSTGCLKTYNDFAQHHNAVLQDKLR  278

Query  914   SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGST  1093
              LR+ +P+A I+YADYY A  SF       GF    L  TCCG GGG YN++    CG  
Sbjct  279   LLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGAL-RTCCG-GGGPYNFNPKASCGVR  336

Query  1094  GVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             G   C +P  Y +WDGVHLT+  + AI+  ++
Sbjct  337   GSSVCTDPSAYANWDGVHLTEAGYHAIANSIL  368



>ref|NP_001149156.1| esterase precursor [Zea mays]
 gb|ACG34406.1| esterase precursor [Zea mays]
Length=370

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 196/333 (59%), Gaps = 6/333 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + S++ FG SL DTGNL+    +   +   R PYGIT+  RPTGR SDG L+VDF+A+A 
Sbjct  32    YTSMFSFGDSLTDTGNLLVSSPLSNHI-VGRYPYGITYFHRPTGRCSDGRLVVDFLAQAF  90

Query  377   GLPLLNPYLD-KNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSGQINWLKTY  550
             GLPLL PYL  +      GVNFAV  +TA+D  F  + G      T + LS Q+ W +  
Sbjct  91    GLPLLQPYLQSRGKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGWFEQ-  149

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L  S+C++P +CK+   +SLF VGEIG ND  +A  +G+T+ +   +VP +  +V +A  
Sbjct  150   LKPSLCSSPKECKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAAAVTDATE  209

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
              +I+ G   +VVPG  P+GC    L+    ++  DYD  GCLR+ N+     N  LQ+ L
Sbjct  210   RLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGSDYDAAGCLRTYNDFAQHHNAVLQRKL  269

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              +LR ++P A I+YADYY A  SF       GF Q  L  TCCG GGG YN++    CG 
Sbjct  270   RALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPL-RTCCG-GGGPYNFNPKASCGV  327

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              G   C +P  Y +WDGVHLT+ A+ AI+  ++
Sbjct  328   RGSSVCADPSAYANWDGVHLTEAAYHAIADSIL  360



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/372 (41%), Positives = 222/372 (60%), Gaps = 16/372 (4%)
 Frame = +2

Query  77    MLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRV  256
             M  L  LP++ L   IL  LLV +  S  +  N       F+SI  FG S+ DTGNL+  
Sbjct  1     MASLDSLPAMKLVRFILSTLLVTSVNSQTQCRN-------FKSIISFGDSIADTGNLL--  51

Query  257   GAIGPT-LPAARLP-YGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLD-KNASFTN  427
             G   P  LPA+  P YG TF   PTGR+SDG LI+DFIA  +G PL+ P+   +NA+F  
Sbjct  52    GLSDPNDLPASAFPPYGETFFHHPTGRYSDGRLIIDFIAEFLGFPLVPPFYGCQNANFKK  111

Query  428   GVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRS  607
             GVNFAV  +TAL+  FL ++G+      V LS Q+      L + +C +PSDC+D ++ +
Sbjct  112   GVNFAVAGATALEPSFLEERGIHSTITNVSLSVQLRSFTESLPN-LCGSPSDCRDMIENA  170

Query  608   LFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLG  787
             L  +GEIG ND  FAL Q + ++EV   VP +  ++ +A+ E++ +GGR  +VPG FP+G
Sbjct  171   LILMGEIGGNDYNFALFQRKPVKEVEELVPFVIATISSAITELVCMGGRTFLVPGNFPIG  230

Query  788   CFPNLLSQFGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYY  964
                + L+ + T + ++YD L GCL+ +N+ + + N  LQ+ L  LRK +P   I+YADYY
Sbjct  231   YSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYYNKQLQEELNGLRKLYPHVNIIYADYY  290

Query  965   AAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGV  1144
              A           GF  N+    CCG  GG YN++ ++ CGS GV  C +P QY+++DG+
Sbjct  291   NALLRLFQEPAKFGF-MNRPLPACCGV-GGSYNFNFSRRCGSVGVEYCDDPSQYVNYDGI  348

Query  1145  HLTQKAHLAISQ  1180
             H+T+ A+  IS+
Sbjct  349   HMTEAAYRLISE  360



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/329 (42%), Positives = 200/329 (61%), Gaps = 6/329 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + S++ FG SL DTGNL+R       +   RLPYG T+  RPTGR+ DG L+VDFIA+A+
Sbjct  73    YTSVFSFGDSLADTGNLLRYLG-KKNIDVGRLPYGETYFRRPTGRFCDGRLVVDFIAQAM  131

Query  377   GLPLLNPYLDKNAS--FTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             GLPLL PYL + +   F  G NFAV  +TA++ GF  +KG+ VP     L  QI W +  
Sbjct  132   GLPLLPPYLARRSGHGFRQGANFAVAGATAIENGFFMEKGLHVPWSNNSLGIQIEWFRQL  191

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S +C++ SDC    + SLF VGEIG ND  +  +Q R + EV ++VP +  ++ +A+ 
Sbjct  192   LPS-LCSSDSDCNVMFQNSLFLVGEIGGNDYNYPFLQARALDEVISYVPPVMDAISSAIT  250

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
              +I++G R +VVPG FP+GC    L+ F +   +DYD  GC++ +N  + + NN L+  L
Sbjct  251   ALIELGARTLVVPGNFPIGCNSAYLTVFHSNRSEDYDAFGCIKWLNKFSRYHNNQLRVVL  310

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               +R+  P A ++YADYY+A  S      L GF  + L   CCG GGG YN++    CG+
Sbjct  311   KRIRQRNPHATVIYADYYSAAMSMFRSPQLSGFRSSPL-PACCG-GGGPYNFNSFLQCGN  368

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
              G   C +P  Y+ WDG+H+T+ A+  I+
Sbjct  369   PGSNVCADPSSYVTWDGMHMTEAAYRKIA  397



>ref|XP_002873127.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49386.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=320

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/342 (42%), Positives = 194/342 (57%), Gaps = 46/342 (13%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             CP  SIYQFG S+ DTGNLIR G      PA+                            
Sbjct  25    CPINSIYQFGDSIADTGNLIRNG------PASS---------------------------  51

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
                 P L P   +  +    VNFAV+ STAL+  F A++ + VP+   PLS Q+ W K++
Sbjct  52    ----PTLKPLPQRKHNVF--VNFAVSGSTALNSSFFAERNLHVPATNTPLSTQLAWFKSH  105

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S+   + SDC   LK+SLF VGEIG ND  +   QG+ ++E+ +++P +  ++  A R
Sbjct  106   LRSTCHGSSSDC---LKQSLFMVGEIGGNDYNYGFFQGKPMEEIRSYIPHVVGAITAAAR  162

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             EVI+ G   +VVPG FP+GCFP  L+ F  +DPK YD+ GCL+ +N   +  NN LQ A+
Sbjct  163   EVIRAGAVNVVVPGNFPVGCFPIYLTSFPVKDPKAYDDKGCLKHLNEFAMDHNNQLQGAI  222

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              SLRKEFP   I+Y DYY AFQ  L       F ++    +CCG GG  YNYD  + CG+
Sbjct  223   ASLRKEFPGVAIVYGDYYNAFQYVLRSE---RFDKSVALKSCCGIGGA-YNYDGKRPCGA  278

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              GV  C NP ++I WDGVHLTQKA+  +S  +   ILS+I+C
Sbjct  279   AGVPVCQNPNKFISWDGVHLTQKAYRFMSNFLNYQILSQIKC  320



>ref|XP_009767427.1| PREDICTED: acetylajmalan esterase-like [Nicotiana sylvestris]
Length=309

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/293 (44%), Positives = 190/293 (65%), Gaps = 4/293 (1%)
 Frame = +2

Query  317   RPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVV  496
             + TGR S+G+L++DFIA   GLPLLNP  D+ A+F +G +FAV  +TAL +  L  + +V
Sbjct  7     KTTGRCSNGMLMIDFIALESGLPLLNPIKDQTANFRHGADFAVAGATALPVEILENEKMV  66

Query  497   VPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQ  676
               S    LS Q++W+ ++  ++     +D  D+L+++LF VG IG N+  F+L++G+T++
Sbjct  67    NLSTNSSLSVQLDWMSSHFQTN---GYTDRPDKLEKALFLVGGIGGNEFIFSLLEGKTME  123

Query  677   EVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCL  856
             E    VP++  ++I+ VR VI +G  +IVVPG FP GCFP  L+ F T +   YDE  CL
Sbjct  124   ETQRMVPEVVEAIIHGVRRVISLGATQIVVPGNFPGGCFPIALTIFMTDNSSAYDEHHCL  183

Query  857   RSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTC  1036
             +  NNL IF N+HL+QA+  L+KE+P+  ++Y DYY A+   L  A  LGF +N L   C
Sbjct  184   KDFNNLIIFFNDHLRQAILDLKKEYPNITLIYGDYYNAYLWLLQNAASLGFEKNSLQKAC  243

Query  1037  CGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPN  1195
             CG+ GG YN+D +  CG  GV  C +P  YI WDG HLTQ+A+  +++ +I N
Sbjct  244   CGT-GGDYNFDIHIKCGDPGVSVCVDPSTYISWDGAHLTQEAYSWLARWLIDN  295



>ref|XP_004952881.1| PREDICTED: acetylajmalan esterase-like [Setaria italica]
Length=408

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 202/347 (58%), Gaps = 21/347 (6%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVG-AIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
             +IY FG SL DTGNL+R G A G       LPYG    G  TGR SDG L++DF+A+ +G
Sbjct  48    AIYNFGDSLSDTGNLLREGGATGVLQHTTSLPYGSAIGG-ATGRCSDGYLMIDFLAKDLG  106

Query  380   LPLLNPYLDKNAS-FTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLS  556
             LPLLNPYLDK A  FT+G NFAV  +TALD   LA +GV VP     L+ Q+   K  +S
Sbjct  107   LPLLNPYLDKGADDFTHGANFAVAGATALDAAALATRGVSVPHTNSSLAVQLQRFKDLMS  166

Query  557   SSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ--------------GRT---IQEVA  685
             ++   +P + ++RL RSL  VGEIG ND  +A                 GR    + E  
Sbjct  167   ATT-RSPQEVRERLARSLVMVGEIGGNDYNYAFAANKPAAGGAHNLYNFGRVATGVVEAL  225

Query  686   AFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSI  865
             A VPD+  SV  A RE++ +G  R+V+PG FPLGC P+ +S     DP  YD  GCL ++
Sbjct  226   ALVPDVVRSVTGAARELLDMGATRVVIPGNFPLGCVPSYMSAANETDPAAYDANGCLAAL  285

Query  866   NNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGS  1045
             N  +   N  LQQ +  LR+ +P A I YADY+ A+   L  A   GF +  +   CCG+
Sbjct  286   NLFSQMHNVLLQQGIRELRRSYPAATIAYADYFYAYVRMLRDAGKTGFDEGAVTKACCGA  345

Query  1046  GGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
             GGG+YN D +++CG+ G   C  P + I WDGVHLTQ A+  ++ ++
Sbjct  346   GGGKYNVDMDRMCGAPGASVCARPDERISWDGVHLTQHAYRVMTDLL  392



>ref|XP_004952880.1| PREDICTED: acetylajmalan esterase-like [Setaria italica]
Length=408

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 202/347 (58%), Gaps = 21/347 (6%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVG-AIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
             +IY FG SL DTGNL+R G A G       LPYG    G  TGR SDG L++DF+A+ +G
Sbjct  48    AIYNFGDSLSDTGNLLREGGATGVLHHTTSLPYGSAIGG-ATGRCSDGYLMIDFLAKDLG  106

Query  380   LPLLNPYLDKNAS-FTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLS  556
             LPLLNPYLDK A  FT+G NFAV  +TALD   LA +GV VP     L+ Q+   K  +S
Sbjct  107   LPLLNPYLDKGADDFTHGANFAVAGATALDAAALATRGVSVPHTNSSLAVQLQRFKDLMS  166

Query  557   SSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ--------------GRT---IQEVA  685
             ++   +P + ++RL RSL  VGEIG ND  +A                 GR    + E  
Sbjct  167   ATT-RSPQEVRERLARSLVMVGEIGGNDYNYAFAANKPAAGGAHNLYNFGRVATGVVEAL  225

Query  686   AFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSI  865
             A VPD+  SV  A RE++ +G  R+V+PG FPLGC P+ +S     DP  YD  GCL ++
Sbjct  226   ALVPDVVRSVTGAARELLDMGATRVVIPGNFPLGCVPSYMSAANEADPAAYDANGCLAAL  285

Query  866   NNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGS  1045
             N  +   N  LQQ +  LR+ +P A I YADY+ A+   L  A   GF +  +   CCG+
Sbjct  286   NLFSQMHNVLLQQGIRELRRSYPAATIAYADYFYAYVRMLRDAGKTGFDEGAVTKACCGA  345

Query  1046  GGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIV  1186
             GGG+YN D +++CG+ G   C  P + I WDGVHLTQ A+  ++ ++
Sbjct  346   GGGKYNVDMDRMCGAPGASVCARPDERISWDGVHLTQHAYRVMTDLL  392



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 200/335 (60%), Gaps = 11/335 (3%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + SI  FG SL DTGNLIR+      + ++ LPYG TF   PTGR+SDG L++DFIA  +
Sbjct  29    YESIISFGDSLADTGNLIRLSKSNKIVASSVLPYGETFFHHPTGRFSDGRLVIDFIAEGM  88

Query  377   GLPLLNPYLD--KNASFTN----GVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINW  538
             G PL+ PY+   KN S +     GVNFAV  +TA+DI +L ++G+  P+  V L  Q+ W
Sbjct  89    GFPLVPPYVGVMKNMSSSKNSMRGVNFAVAGATAVDISYLEKRGIKNPATNVSLGTQLEW  148

Query  539   LKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVI  718
              K  L   +C +P+ CK+ L+ SLF +GEIG ND      QG++ ++V +FVP + +++ 
Sbjct  149   FKQMLPI-LCDSPTSCKEFLENSLFLMGEIGGNDYNHPFSQGKSGEDVQSFVPAVISAIG  207

Query  719   NAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDE-LGCLRSINNLTIFRNNH  895
              A+ E+I++G + ++VPG  P+GC  + L+ F   + K+YD+  GC+  +N+   + N  
Sbjct  208   LAINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKKEYDDSTGCINWLNDFAEYHNQL  267

Query  896   LQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRN  1075
             LQQ +  LR+  P A I+YADYY A           GF      + CCG GGG YNYD  
Sbjct  268   LQQEIHKLREIHPHANIIYADYYNAAMQIYKSPKKFGF--TSTIVACCG-GGGPYNYDSK  324

Query  1076  KVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             + CGS     C  P  Y+ WDGVHLT+ A+  I++
Sbjct  325   RPCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAE  359



>ref|XP_010683535.1| PREDICTED: acetylajmalan esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=380

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 155/381 (41%), Positives = 217/381 (57%), Gaps = 28/381 (7%)
 Frame = +2

Query  86    LMGLPSLTLNYCILCFLLVYAAASGV-----ENENQKVVVCPFRSIYQFGASLHDTGNLI  250
             L  L  L L +  LC  +V   + G      E  NQ +    F +IYQFG SL DTGN +
Sbjct  5     LSHLRMLCLFFTSLCAPIVTPHSVGASLRIKETLNQAM---EFEAIYQFGDSLSDTGNYV  61

Query  251   RVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNG  430
             R  A   +   +RLPYG T+   PTGR SDGL++VD+ A    LPLLNPYL   + FT G
Sbjct  62    REHA---SSAYSRLPYGQTY--YPTGRASDGLIMVDYFATYFNLPLLNPYLADGSDFTQG  116

Query  431   VNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSL  610
             VNFAV  +TA    +              L+ Q++W + +L+S+  + P   K+RL++SL
Sbjct  117   VNFAVVGATANGGDY-------------SLATQLSWFRCHLNSTF-SDPMAIKERLQKSL  162

Query  611   FFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGC  790
               +GEIG ND      +GR+I EV   +P +  ++ +AV EVI +G   IVVPG FP+GC
Sbjct  163   VLMGEIGGNDFNGPFYRGRSIHEVCKLIPGVVKTIKDAVEEVISLGATNIVVPGNFPIGC  222

Query  791   FPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAA  970
              P  L +F T D   YDEL CL+  N+ + F N  L QA+  L++E PD  I+YADYY+A
Sbjct  223   VPLYLVKFATNDTSKYDELECLKDYNDFSKFYNQQLLQAIQQLQQEHPDVAIVYADYYSA  282

Query  971   FQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHL  1150
               S +  AP LG  Q+     CCG+G   YNY   K CGS+G   C +P + I+WDGVH+
Sbjct  283   LISVIINAPQLGIEQDGTKKACCGAGNNPYNYGA-KSCGSSGASVCEDPSKRINWDGVHM  341

Query  1151  TQKAHLAISQIVIPNILSRIQ  1213
             TQ+ ++ + + ++   +  +Q
Sbjct  342   TQQGNIFVGEFLLQQFVPALQ  362



>ref|XP_004968625.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=374

 Score =   266 bits (680),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 142/333 (43%), Positives = 195/333 (59%), Gaps = 6/333 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + S++ FG SL DTGNL+    +   +   R PYGIT+  RPTGR SDG L+VDF+A+A 
Sbjct  36    YTSMFSFGDSLTDTGNLLVSSPLSNHI-VGRYPYGITYFHRPTGRCSDGRLVVDFLAQAF  94

Query  377   GLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSGQINWLKTY  550
             GLPLL PYL  K      GVNFAV  +TA+D  F  + G      T + LS Q+ W +  
Sbjct  95    GLPLLPPYLQSKGKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGWFEQ-  153

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L  S+C++P  CK+   +SLF VGEIG ND  +A  +G+T+ +   +VP +  +V +A  
Sbjct  154   LKPSLCSSPKKCKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAGAVTDATE  213

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
              +I+ G   +VVPG  P+GC    L+    ++  DYD  GCL++ N+     N  LQQ L
Sbjct  214   RLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGSDYDAAGCLKTYNDFAQHHNAVLQQKL  273

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              +LR ++P A I+YADYY A  SF       GF Q  L  TCCG GGG YN++    CG 
Sbjct  274   QALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPL-RTCCG-GGGPYNFNPKASCGV  331

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              G   C +P  Y +WDGVHLT+ A+ AI+  ++
Sbjct  332   RGSSVCTDPSAYANWDGVHLTEAAYHAIANSIL  364



>gb|EMT16237.1| GDSL esterase/lipase [Aegilops tauschii]
Length=382

 Score =   266 bits (680),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 144/369 (39%), Positives = 210/369 (57%), Gaps = 9/369 (2%)
 Frame = +2

Query  89    MGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIG  268
             M  P L+L   ++  L+    ASGV   +       F SI+ FG+S  DTGN + + A  
Sbjct  1     MKPPLLSLAVVLISCLMYNTGASGVPEADHHAQR--FHSIFSFGSSYSDTGNFVLLSAGF  58

Query  269   PTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVT  448
             P  P    PYG TF  RPTGR SDG LI+DFIA A+ LPL+ P++ K  +FT G NFA+ 
Sbjct  59    PFSPFNNSPYGETFFRRPTGRPSDGRLIIDFIAEALELPLVPPFMSKAGNFTQGANFAIV  118

Query  449   ASTALDIG-FLAQKGVVVPSITVPLSGQINWLKTYLSSSI-CAAPSDCKDRLKRSLFFVG  622
               TALD+G FL      VP     L  QI W +  +  S+ C   + C++RL RSLF VG
Sbjct  119   GGTALDVGFFLRHNSGSVPPFRSSLRAQIGWFRKVVKQSLSCNTTAQCRERLARSLFVVG  178

Query  623   EIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNL  802
             E+G  D ++ L  G+++QE  +FVPD+  ++I  V  +++ G R +VV GT P+GC P  
Sbjct  179   ELGLTDYSYILSGGKSLQEAKSFVPDVVQAIIRGVERLVEEGARYVVVSGTPPMGCTPMA  238

Query  803   LSQFG-TQDPKDYD-ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQ  976
             L+++    +  +YD   GCLR +N L+ + N  LQ+++   R ++P   ++YADY+    
Sbjct  239   LTKYAVAANATEYDRRTGCLRRLNGLSQYHNWMLQESVRRARVKYPGTTLVYADYHKPVA  298

Query  977   SFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRN-KVCGSTGVISCPNPPQYIHWDGVHLT  1153
               + R   LGF    L   CCG GGG+YNY+ +   CG  G  +C +P  ++ WDG+H T
Sbjct  299   RLIRRPGKLGFTAEPL-RACCG-GGGRYNYNMDGSACGLPGATACSDPSTHLFWDGIHYT  356

Query  1154  QKAHLAISQ  1180
             + A+  I+ 
Sbjct  357   EAANKYIAH  365



>emb|CDY41414.1| BnaCnng10500D [Brassica napus]
Length=328

 Score =   264 bits (675),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 143/342 (42%), Positives = 197/342 (58%), Gaps = 43/342 (13%)
 Frame = +2

Query  191   CPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             C   SIYQFG S+ DTGNLIR G  G    AA  PYG T+  + T               
Sbjct  27    CLINSIYQFGDSIADTGNLIRNGPTGAKSHAASFPYGQTYFQQAT---------------  71

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
                                 VNFAV  STAL+  F   + + VP+   PLS Q++W K++
Sbjct  72    --------------------VNFAVAGSTALNSSFFTSRNLHVPATNTPLSTQLSWFKSH  111

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S+ C +PS C   LK+SL  +GEIG ND  +   QG++ +E+ +++P +  ++  A R
Sbjct  112   LRST-CHSPS-C---LKQSLIMMGEIGGNDYNYGFFQGKSTEEIRSYIPHVVGAIAAAAR  166

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
             +VI+ G   +VVPG FP+GCFP  L+ F   DPK YD+ GCL  +N   +  NN LQ+A+
Sbjct  167   DVIRAGAVNVVVPGNFPVGCFPIYLTSFPVNDPKAYDDKGCLIRLNEFAMDHNNQLQEAI  226

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              SL+KEFP  VI+Y DYY AFQ  L  +  +GF ++    +CCG GGG YNYD  + CG+
Sbjct  227   SSLQKEFPGVVIVYGDYYNAFQYVLRGS--VGFDKSVALKSCCGVGGG-YNYDGMRQCGA  283

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              GV  C NP ++I WDGVHLTQKA+  +S+ +   IL +++C
Sbjct  284   VGVPVCQNPDKFISWDGVHLTQKAYRFMSKFLNYKILPQLKC  325



>ref|XP_006398857.1| hypothetical protein EUTSA_v10015547mg [Eutrema salsugineum]
 gb|ESQ40310.1| hypothetical protein EUTSA_v10015547mg [Eutrema salsugineum]
Length=316

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 177/266 (67%), Gaps = 5/266 (2%)
 Frame = +2

Query  425   NGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSIC-AAPSDCKDRLK  601
             NGVNFAV  STAL+  F A + + VP+   PLS Q+ W K++L S+   ++ SDC   LK
Sbjct  54    NGVNFAVAGSTALNSSFFAARNLHVPATNTPLSTQLAWFKSHLRSTCHGSSSSDC---LK  110

Query  602   RSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFP  781
             +SLF VGEIG ND  +   QG++++E+ +++P +  ++  A R+VI+ G   +V+PG FP
Sbjct  111   QSLFMVGEIGGNDYNYGFFQGKSMEEIRSYIPHVVGAIAAAARDVIRAGAVNVVIPGNFP  170

Query  782   LGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADY  961
             +GCFP  L+ F  +DPK YD+ GCL+ +N   +  NN LQ+A+ SL+KEFPD VI+Y DY
Sbjct  171   VGCFPIYLTSFPVKDPKAYDDKGCLKHLNEFAMDHNNQLQEAIASLKKEFPDVVIVYGDY  230

Query  962   YAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDG  1141
             Y AFQS L  +   GF ++    +CCG GG  YNYD  + CG+ GV  C NP ++I WDG
Sbjct  231   YKAFQSVLRSSKSAGFDKSVALKSCCGIGGA-YNYDGKRQCGAAGVPVCQNPDKFISWDG  289

Query  1142  VHLTQKAHLAISQIVIPNILSRIQCF  1219
             VHLTQKA+  +S+ +   ILS+I+C 
Sbjct  290   VHLTQKAYRFMSKFLNNIILSQIKCL  315



>gb|EPS66618.1| hypothetical protein M569_08158 [Genlisea aurea]
Length=358

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 200/344 (58%), Gaps = 19/344 (6%)
 Frame = +2

Query  200   RSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGR-PTGRWSDGLLIVDFIARAV  376
              SIYQFG SL+D GN I +  IGPTLPAAR PYG + PG+ PTGRWSDGLLIVD IA  +
Sbjct  22    ESIYQFGDSLNDVGNAILLPTIGPTLPAARPPYGESLPGKKPTGRWSDGLLIVDRIAELL  81

Query  377   GLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVP-LSGQINWLKTY  550
              +PLL PYL + N  F NGVNFAV  + AL+   L+ +G+  P   VP L  QI W K+Y
Sbjct  82    NVPLLPPYLSNPNGPFPNGVNFAVAGAAALNFSVLSSQGIR-PLFPVPGLQDQIGWFKSY  140

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             LS+  C+  +DC   L  SLF +GEIG NDI  A+  G+T QE+  FVP +  + + A+R
Sbjct  141   LSTQ-CSTFTDCCSYLSSSLFVIGEIGVNDINSAITSGKTYQEIMEFVPLVVNATLQAIR  199

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKD------YDELGCLRSINNLTIFRNN  892
             +VI +G R+I V G  P+GC      QF   D  +      YD  GCL++ N +  + N 
Sbjct  200   DVIALGARKIAVAGNLPIGC-----QQFTMLDYNNSAAAGPYDADGCLQNPNKIATYLNQ  254

Query  893   HLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDR  1072
              L   + +L  +FP   ++Y +YY AFQ  +      GF    ++  CCG+G      D 
Sbjct  255   LLVSGIFNLTVDFPGVKVVYLNYYDAFQGLVQIPAAFGFDPKTVFQPCCGNG---VLSDA  311

Query  1073  NKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILS  1204
             +  CG      C +P ++I WDG HLTQ A+  I++ +   +LS
Sbjct  312   DVFCGGAEAALCGDPDEFISWDGYHLTQAAYSKIAEYLTLPVLS  355



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 209/332 (63%), Gaps = 9/332 (3%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIR-VGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARA  373
             + SI+ FG SL DTGNL+  +G  G  +   R PYG+T+  RPTGR+SDG LIVDFIA+A
Sbjct  52    YSSIFSFGDSLADTGNLLHTLGRDGTRI--GRPPYGMTYFHRPTGRFSDGRLIVDFIAQA  109

Query  374   VGLPLLNPYLDKN--ASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
             +GLPLL PYL++        GVNFAV  +TA++ GF  ++G+ +    V L  QI+W + 
Sbjct  110   MGLPLLPPYLEETTGGDMRKGVNFAVGGATAMENGFFRKRGIHIKFTNVSLGDQIHWFRQ  169

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
              L S   ++ + C+D L +SL  +G IG ND     ++GR+++E+ +FVP + +++ +A+
Sbjct  170   LLPSLCSSSSA-CEDMLHKSLVLMGAIGGNDYNDPFMEGRSLREIKSFVPRVVSTISSAI  228

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDE-LGCLRSINNLTIFRNNHLQQ  904
              E+I++G R ++VPG  PLGC    L+ + T   +DYD   GCL+ +N  +++ N  LQ 
Sbjct  229   DELIELGARTLLVPGITPLGCNSAYLTYYRTHQAEDYDSTTGCLKWLNEFSMYHNGRLQA  288

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
              L  L++  P A I+YADYY A  S  +     GF +  L + CCG GGG YNY+ ++ C
Sbjct  289   ELRRLQQLHPHATIIYADYYGASMSIFSNPNAFGFGEEPL-VACCG-GGGPYNYNFSRQC  346

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             GS G   C +P +Y+HWDG+H+T+  + +I+ 
Sbjct  347   GSEGSTVCGDPSRYVHWDGLHMTEATYRSIAS  378



>ref|XP_009109700.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X1 [Brassica 
rapa]
Length=390

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/362 (41%), Positives = 206/362 (57%), Gaps = 9/362 (2%)
 Frame = +2

Query  107   TLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAA  286
             +L   I  FLL++++   VE+         ++SI  FG S  DTGN + +  +     AA
Sbjct  4     SLKKLISSFLLIFSSTITVESSEPSCR--SYKSIISFGDSGADTGNYLHLSDVNHPPQAA  61

Query  287   RLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTASTAL  463
               PYG TF   PTGR SDG LI+DFIA  +GLP + PY   +N SF  G+NFAV  +TAL
Sbjct  62    FPPYGETFFHTPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNVSFKQGINFAVYGATAL  121

Query  464   DIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPS--DCKDRLKRSLFFVGEIGRN  637
             D   L +KG+      V LS Q+N  K  L S +CA+ S  DCK+ L  SL  +G+IG N
Sbjct  122   DCALLIEKGIGSDFTNVSLSVQLNIFKQTLPS-LCASSSSHDCKEMLGDSLILMGDIGAN  180

Query  638   DITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFG  817
             D  +   QG++I EV   VP +  ++ +A+ ++I +GG+  +VPGTFP GCFP  L+ F 
Sbjct  181   DYDYMFFQGKSINEVEELVPLVIKAISSAIVDLINLGGKTFLVPGTFPYGCFPAYLTLFQ  240

Query  818   TQDPKDYDEL-GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARA  994
             T   ++YD L GCL  +N L    + HL+  L  LRK +P   I+YADYY +   F    
Sbjct  241   TAKEEEYDPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEP  300

Query  995   PLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAI  1174
                GF +  L   CCG  GGQYN+   + CG  GV  C NP +Y++WDG HLT+  H  +
Sbjct  301   AKYGFKERPL-GACCGV-GGQYNFTFGEECGCQGVGYCKNPSEYVNWDGYHLTEATHQKM  358

Query  1175  SQ  1180
             + 
Sbjct  359   AH  360



>gb|AFW80395.1| esterase [Zea mays]
Length=367

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/333 (42%), Positives = 195/333 (59%), Gaps = 6/333 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + S++ FG SL DTGNL+    +   +   R PYGIT+  R TGR SDG L+VDF+A+A 
Sbjct  29    YTSMFSFGDSLTDTGNLLVSSPLSNHI-VGRYPYGITYFHRSTGRCSDGRLVVDFLAQAF  87

Query  377   GLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSGQINWLKTY  550
             GLPLL PYL  +      GVNFAV  +TA+D  F  + G      T + LS Q+ W +  
Sbjct  88    GLPLLQPYLQSRGKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGWFEQ-  146

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L  S+C++P +CK+   +SLF VGEIG ND  +A  +G+T+ +   +VP +  +V +A  
Sbjct  147   LKPSLCSSPKECKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAAAVTDATE  206

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
              +I+ G   +VVPG  P+GC    L+    ++  DYD  GCLR+ N+     N  LQ+ L
Sbjct  207   RLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGSDYDAAGCLRTYNDFAQHHNAVLQRKL  266

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              +LR ++P A I+YADYY A  SF       GF Q  L  TCCG GGG YN++    CG 
Sbjct  267   RALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPL-RTCCG-GGGPYNFNPKASCGV  324

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              G   C +P  Y +WDGVHLT+ A+ AI+  ++
Sbjct  325   RGSSVCADPSAYANWDGVHLTEAAYHAIADSIL  357



>ref|XP_004152872.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Cucumis sativus]
Length=357

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/334 (40%), Positives = 194/334 (58%), Gaps = 8/334 (2%)
 Frame = +2

Query  188   VCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
              C F +IYQ G S+ DTGNLIR     P  P + LPY  +F   P GR  +GL+++DF A
Sbjct  30    TCMFDAIYQLGDSISDTGNLIREN---PNTPFSHLPYDQSFFNNPIGRCFNGLVMLDFFA  86

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
                GLPL++PYL+K+ S  + V                   ++ P     L  Q+ W+ +
Sbjct  87    LDAGLPLVSPYLNKDGSMDHAVTSQWLVLQRPSQHLSTNYKILSPVTNSSLDHQLQWMFS  146

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
             + +S IC    + + +L+ +LF V EI  ND  +AL QG+TIQE    VPD+  ++ +AV
Sbjct  147   HFNS-IC---HNQRGKLRSALFLVVEISGNDYKYALFQGKTIQEAKHMVPDVVRTIKSAV  202

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQA  907
              +VI  G  R+VVPG FP+GCFP  L  F T D   YDEL CL+ +N L  + N+ ++Q 
Sbjct  203   EKVISYGATRVVVPGNFPIGCFPIYLIGFHTDDTSAYDELHCLKELNGLATYHNDQIKQT  262

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             +  L+KE P  VI+Y DYY AF   +  A +LG+ +  L  +CCG  GG Y ++  K+CG
Sbjct  263   IEVLKKESPRTVIVYGDYYNAFLWVIRHAFVLGYDEESLQKSCCGI-GGDYKFNLMKMCG  321

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             + GV +CPNP ++I WDGVHLTQ  +  ++  +I
Sbjct  322   AAGVEACPNPNEHISWDGVHLTQNTYKFMTHWLI  355



>ref|NP_196018.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LZB2.1|GDL74_ARATH RecName: Full=GDSL esterase/lipase At5g03980; AltName: Full=Extracellular 
lipase At5g03980; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB85518.1| lipase-like protein [Arabidopsis thaliana]
 gb|AED90679.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=323

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 208/372 (56%), Gaps = 53/372 (14%)
 Frame = +2

Query  101   SLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLP  280
             S T    +L F+L     S V + +Q    CP  SIYQFG S+ DTGNLIR G      P
Sbjct  2     STTKALSLLVFILF---VSLVHSSDQ----CPINSIYQFGDSISDTGNLIRNG------P  48

Query  281   AARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTA  460
             A+           PT +                 PL  P  + N      VNF V+ STA
Sbjct  49    ASS----------PTPK-----------------PL--PQREHNVF----VNFGVSGSTA  75

Query  461   LDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRND  640
             L+  F +++ + VP+   PLS Q+ W K +L S+   + SDC   LK SLF VGEIG ND
Sbjct  76    LNSSFFSERNLHVPATNTPLSMQLAWFKGHLRSTCHGSSSDC---LKHSLFMVGEIGGND  132

Query  641   ITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGT  820
               +   QG+ ++E+ +++P +  ++  A REVI+ G   +VVPG FP+GCFP  L+ F  
Sbjct  133   YNYGFFQGKPMEEIRSYIPHVVGAITAAAREVIRAGAVNVVVPGNFPVGCFPIYLTSFPV  192

Query  821   QDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPL  1000
             +D KDYD+ GCL  +N   +  NN LQ+A+ SLRKEFPD  I+Y DYY AFQ  L     
Sbjct  193   KDTKDYDDNGCLTHLNEFAMDHNNQLQEAIASLRKEFPDVAIVYGDYYNAFQYVLRSE--  250

Query  1001  LGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
               F ++    +CCG+GG  YNYD  +  G+ GV  C NP ++I WDGVHLTQKA+  +S+
Sbjct  251   -RFDKSVALKSCCGTGGA-YNYDGKRPYGAVGVPVCQNPHKFISWDGVHLTQKAYRFMSK  308

Query  1181  IVIPNILSRIQC  1216
              +   ILS+I+C
Sbjct  309   FLNNQILSQIKC  320



>ref|XP_011086014.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Sesamum indicum]
Length=373

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 146/336 (43%), Positives = 200/336 (60%), Gaps = 9/336 (3%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLP-AARLPYGITFPGRPTGRWSDGLLIVDFIARA  373
             + SI+ FG SL DTGNL+  GA   T P  A+LPYG TF   PTGR SDG LIVDFIA A
Sbjct  25    YDSIFSFGDSLADTGNLLLSGA--RTFPFIAKLPYGQTFFHYPTGRCSDGRLIVDFIAEA  82

Query  374   VGLPLLNPYLD--KNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITV--PLSGQINWL  541
              GLP L PYL   K  +F +GVNFAV  +TALD  F   + +    +     LS Q+ W 
Sbjct  83    SGLPYLPPYLAVAKGETFEHGVNFAVAGATALDAKFFYSRNIGSQLLLTNDSLSVQLGWF  142

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
                 S+ IC+   DC  R ++SLF VGEIG ND  +    G TIQ++ A VP +  ++ N
Sbjct  143   SKLKSTLICSTKQDCARRFEKSLFLVGEIGGNDYNYPFFAGGTIQQLKALVPLVVETIAN  202

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
             A   +I+ G   ++VPG  P+GC    L+ F T +   YD  GCL++ N+ + + N++L+
Sbjct  203   ATSVLIEEGAVELMVPGNLPIGCNAVYLTLFRTPNKTAYDRNGCLKAYNSFSKYHNSNLK  262

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
              AL +LR ++P A I+YADYYAA   F       GF    L + CCG GGG YN++ + +
Sbjct  263   LALENLRHKYPHAKIIYADYYAAAIKFFHAPHHYGFWNGAL-VACCG-GGGPYNFNNSAI  320

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             CGS G  +C +P  Y +WDG+HLT+ A+  I+  ++
Sbjct  321   CGSPGSKTCLDPTTYANWDGIHLTESAYRVITMGLV  356



>ref|XP_002457137.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
 gb|EES02257.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
Length=379

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 195/333 (59%), Gaps = 6/333 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + S++ FG SL DTGNL+    +   +   R PYG+T+  RPTGR SDG L+VDF+A+A 
Sbjct  41    YTSMFSFGDSLTDTGNLLVSSPLSNHI-VGRYPYGMTYFHRPTGRCSDGRLVVDFLAQAF  99

Query  377   GLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSGQINWLKTY  550
             GLPLL PYL  +      GVNFAV  +TA+D  F  + G      T + LS Q+ W +  
Sbjct  100   GLPLLQPYLQSRGKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGWFEQ-  158

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L  S+C++P  CK+   +SLF VGEIG ND  +A  +G+T+ +   +VP +  +V +A  
Sbjct  159   LKPSLCSSPKKCKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAAAVTDATE  218

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
              +I+ G   +VVPG  P+GC    L+    ++  DYD  GCL++ N+     N  LQQ L
Sbjct  219   RLIKAGATHLVVPGNLPIGCSSAYLTLHPGRNSSDYDAAGCLKTYNDFAQHHNAVLQQNL  278

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
              +LR ++P A I+YADYY A  SF       GF +  L  TCCG GGG YN++    CG 
Sbjct  279   RALRVKYPQARIMYADYYGAAMSFAKNPKQFGFTEGPL-RTCCG-GGGPYNFNPKASCGV  336

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              G   C +P  Y +WDGVHLT+ A+ AI+  ++
Sbjct  337   RGSSVCTDPSAYANWDGVHLTEAAYHAIADSIL  369



>ref|XP_002457133.1| hypothetical protein SORBIDRAFT_03g001810 [Sorghum bicolor]
 gb|EES02253.1| hypothetical protein SORBIDRAFT_03g001810 [Sorghum bicolor]
Length=381

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/331 (40%), Positives = 196/331 (59%), Gaps = 6/331 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGA-IGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARA  373
             F +I+ FG S  DTGN +R+ A I P +P   LPYG+TF  RPTGR S+G +I+DFIA+A
Sbjct  35    FNAIFSFGNSYADTGNFVRLAAPIIPIIPFNNLPYGVTFFRRPTGRASNGRIILDFIAQA  94

Query  374   VGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSGQINWLKTY  550
              GLP + P LD+  +F+ G NFAV  +TALD+ +  +  +  VP        QI W +  
Sbjct  95    FGLPFVPPSLDRTQNFSKGANFAVVGATALDLSYFLEHNITSVPPFNSSFGVQIGWFEQ-  153

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L  S+C  P  C + L RSLF +GE G ND  F L   +T++E  A+VP +  ++ + V 
Sbjct  154   LKPSLCDTPKQCDEYLGRSLFVMGEFGGNDYVFLLAANKTVEETRAYVPTVVKAIADGVE  213

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
              +I++G +RIVVPG  P GC P +L+ + + +  DYD+ GCL   N L  + N  L++ +
Sbjct  214   RLIKLGAKRIVVPGNLPTGCIPIILTLYASPNKSDYDKYGCLDKFNGLARYHNRLLRREV  273

Query  911   GSLRKEFP--DAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
              +L+K++      I +ADY+     FL +    GF+     + CCG+ GG+YNY+    C
Sbjct  274   RALQKKYKLTTTKIAFADYFRPIVKFLQKPAKFGFNGGTALVACCGA-GGRYNYNATAAC  332

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             G  G  +C +  + ++WDG+HLT KA+  I+
Sbjct  333   GLPGATACADVSRALNWDGIHLTDKAYGNIA  363



>ref|XP_009626701.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X1 [Nicotiana 
tomentosiformis]
Length=349

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 197/350 (56%), Gaps = 32/350 (9%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFP-GRPTGRWSDGL  346
             ++ +++ C F  IYQ G SL DTGN IR       L   R PYG+ F   + TGR S+G+
Sbjct  30    QSLRLMKCGFDKIYQLGDSLADTGNCIRENLCARRLRCGRFPYGMNFSQKKSTGRCSNGM  89

Query  347   LIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSG  526
             LI+DFI                          V  +TAL    +A+K +V  +    LS 
Sbjct  90    LIIDFI--------------------------VAGATALPAEVMAEKKIVNAATNSSLSV  123

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q+ W+ ++  +S      D   +LK++LF VGE+G ND    L+QG+TI+E+    P++ 
Sbjct  124   QLAWMSSHFKTS----TRDRAAKLKKALFLVGEVGGNDFNHGLLQGKTIKELRNMAPEVV  179

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I  VR VI  G  +IVVPG FP+GC P  L++F T +   YD   CL+ +NN  +F 
Sbjct  180   QTIIRGVRRVIGFGATQIVVPGNFPIGCLPIYLTKFRTDNSTAYDNHHCLKDLNNFAVFY  239

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N+HLQQA+  L+K +P   ++Y DYY A+   L  A  LGF ++ L   CCG G G YN+
Sbjct  240   NHHLQQAIQELKKRYPKITLIYGDYYNAYMWLLRNAVALGFDKSSLQKACCGIGRG-YNF  298

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             D  K+CGS  V  C +P  YI WDG+HLTQ+A+  +++ +I ++L ++ C
Sbjct  299   DLRKICGSPRVPICTDPNAYISWDGIHLTQEAYKWLARWLINDMLPKLNC  348



>ref|XP_010277743.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Nelumbo nucifera]
Length=390

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 204/363 (56%), Gaps = 8/363 (2%)
 Frame = +2

Query  104   LTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPA  283
             +  N+ +L    V      +   +     C + SI+ FG SL DTGNL+R+     +   
Sbjct  1     MATNFLLLSKFSVLGVLLALATTHPTSCSCHYTSIFSFGDSLIDTGNLLRLQHNNASF-E  59

Query  284   ARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNA---SFTNGVNFAVTAS  454
                PYGIT+   PTGR SDG LI+DFIA  +GLP + PYL + +    F +GVNFAV  +
Sbjct  60    CWFPYGITYFHHPTGRCSDGRLIIDFIAEYLGLPFVPPYLSRGSGGQDFRHGVNFAVGGA  119

Query  455   TALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGR  634
             TALD  F    G     I   L+ Q+ W K  L S +C + S C+D   RSLF VGEIG 
Sbjct  120   TALDYNFNEHGGTHDSRINNSLAIQLRWFKELLPS-LCDSDSKCRDLFSRSLFIVGEIGG  178

Query  635   NDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGR-RIVVPGTFPLGCFPNLLSQ  811
             ND + AL +GR+++E+ + VP +  ++ +A++  IQ  G   ++VPG  P GCFP  L+ 
Sbjct  179   NDYSLALNRGRSLEEIKSLVPRVINNISSAIQMFIQENGAVTLLVPGHLPYGCFPVFLTD  238

Query  812   FGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLA  988
             F + + +DY+ E GCLR +N L+ F N+ LQ+ +  LR   P   I+YAD Y A ++   
Sbjct  239   FKSPNEEDYESETGCLRWLNQLSEFNNHLLQEEIHRLRHLHPHVTIIYADLYNAVKAIFR  298

Query  989   RAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHL  1168
                  GF +  L +TCCG G G YNY+++  CG  G   C +P QY  WDG H+T+  + 
Sbjct  299   SPDKFGFRKGALLLTCCG-GEGPYNYNKSVHCGVRGAKVCQDPSQYGSWDGTHMTEAVYR  357

Query  1169  AIS  1177
              I+
Sbjct  358   VIA  360



>emb|CDO96755.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 142/335 (42%), Positives = 200/335 (60%), Gaps = 9/335 (3%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIG-PTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARA  373
             + SI+ FG SL DTGN +R GA+  P +   RLPYG TF    TGR SDG L+VDF A A
Sbjct  30    YDSIFSFGDSLADTGNFLRTGALAFPVI--ERLPYGETFFHHATGRCSDGRLVVDFFADA  87

Query  374   VGLPLLNPYLD--KNASFTNGVNFAVTASTALDIGFL-AQKGVVVPSITVPLSGQINWLK  544
              GLP L PYL   ++ +F +GVNFAV  +TALD  F   QK   +      LS Q+ W K
Sbjct  88    YGLPYLKPYLAVARDGNFQHGVNFAVAGATALDPEFFYHQKLGPILWTNDSLSVQLGWFK  147

Query  545   TYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINA  724
               + S++C+ P +CK+  K+SLF VGEIG ND  +    G TI++V A VP +  ++   
Sbjct  148   K-VKSTLCSTPQECKNFFKKSLFLVGEIGGNDYNYPFFIGGTIKQVKATVPVVVEAIAAT  206

Query  725   VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQ  904
             +  +I  G   +VVPG FP+GC    L+ F T +   YDE GCL+  N    + N  L+ 
Sbjct  207   ISALIDEGAVELVVPGNFPIGCSAVYLTLFETPNKAAYDEHGCLKVYNAFAKYHNAQLRL  266

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
              L  LR+++P A I+YADYY A + F+      GF +++L + CCG GGG YN++ +  C
Sbjct  267   GLEKLRQKYPQAKIIYADYYGAAKRFVHSPKHYGFSKDRL-VACCG-GGGPYNFNNSARC  324

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             G TG  +C +P  + +WDG+HLT+ A+  ++  +I
Sbjct  325   GHTGSTTCTSPSAHANWDGIHLTEAAYRYVAMGLI  359



>ref|XP_006643908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=377

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/332 (41%), Positives = 194/332 (58%), Gaps = 5/332 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + S++ FG SL DTGNL+    +  ++   + PYG+T+  RPTGR SDG L+VDF+A+A 
Sbjct  40    YTSMFSFGDSLTDTGNLVVSSPLSFSI-VGKYPYGMTYFHRPTGRSSDGRLVVDFLAQAF  98

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSGQINWLKTYL  553
             GLPLL PYL +      GVNFAV  +TA+D  F  + G      T + LS Q+ W +  L
Sbjct  99    GLPLLQPYLSRGKDVRRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGWFEQ-L  157

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
               S+C++P DCK+   +SLF VGEIG ND  +A  +G+++ +  ++VP +  +V +A   
Sbjct  158   KPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVADATER  217

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALG  913
             +I+ G   +V  GT P+GC    L+   + +  DYD  GCL++ N+     N  LQ  L 
Sbjct  218   LIKAGALHLVGRGTLPIGCSSAYLTLHPSGNKSDYDATGCLKTYNDFAQHHNAVLQDKLQ  277

Query  914   SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGST  1093
              LR+ +P+A I+YADYY A  SF       GF    L  TCCG GGG YN++    CG  
Sbjct  278   LLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGAL-RTCCG-GGGPYNFNPKASCGVR  335

Query  1094  GVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             G   C +P  Y +WDGVHLT+  + AI+  ++
Sbjct  336   GSSVCTDPSAYANWDGVHLTEAGYHAIANSIL  367



>ref|XP_009626702.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X2 [Nicotiana 
tomentosiformis]
Length=346

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 197/350 (56%), Gaps = 35/350 (10%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFP-GRPTGRWSDGL  346
             ++ +++ C F  IYQ G SL DTGN IR       L   R PYG+ F   + TGR S+G+
Sbjct  30    QSLRLMKCGFDKIYQLGDSLADTGNCIRENLCARRLRCGRFPYGMNFSQKKSTGRCSNGM  89

Query  347   LIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSG  526
             LI+DFI                          V  +TAL    +A+K +V  +    LS 
Sbjct  90    LIIDFI--------------------------VAGATALPAEVMAEKKIVNAATNSSLSV  123

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q+ W+ ++  +S        + +LK++LF VGE+G ND    L+QG+TI+E+    P++ 
Sbjct  124   QLAWMSSHFKTST-------RAKLKKALFLVGEVGGNDFNHGLLQGKTIKELRNMAPEVV  176

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I  VR VI  G  +IVVPG FP+GC P  L++F T +   YD   CL+ +NN  +F 
Sbjct  177   QTIIRGVRRVIGFGATQIVVPGNFPIGCLPIYLTKFRTDNSTAYDNHHCLKDLNNFAVFY  236

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNY  1066
             N+HLQQA+  L+K +P   ++Y DYY A+   L  A  LGF ++ L   CCG G G YN+
Sbjct  237   NHHLQQAIQELKKRYPKITLIYGDYYNAYMWLLRNAVALGFDKSSLQKACCGIGRG-YNF  295

Query  1067  DRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
             D  K+CGS  V  C +P  YI WDG+HLTQ+A+  +++ +I ++L ++ C
Sbjct  296   DLRKICGSPRVPICTDPNAYISWDGIHLTQEAYKWLARWLINDMLPKLNC  345



>gb|KHN08454.1| GDSL esterase/lipase [Glycine soja]
Length=709

 Score =   270 bits (689),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 149/354 (42%), Positives = 209/354 (59%), Gaps = 15/354 (4%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             I+ F++V+++A+        +  CP++SI+ FG S  DTGNL    +  P+      PYG
Sbjct  12    IVGFVVVFSSAT-------ILAACPYKSIFSFGDSFADTGNLY-FSSHPPSHHCFFPPYG  63

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLD-KNASFTNGVNFAVTASTALDIGFL  478
              TF  R TGR SDG LI+DFIA ++GLPLL PYL  K  +   G NFAV  +TALD+ F 
Sbjct  64    QTFFHRVTGRCSDGRLIIDFIAESLGLPLLKPYLGMKKKNVVGGANFAVIGATALDLSFF  123

Query  479   AQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
              ++G+ +P+    L+ Q+NW K  L S +C + +DC + +  SLF +GEIG ND  + L 
Sbjct  124   EERGISIPT-HYSLTVQLNWFKELLPS-LCNSSADCHEVVGNSLFLMGEIGGNDFNYLLF  181

Query  659   QGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDY  838
             Q R+I EV  FVP +  ++ +AV E+I +G R ++VPG  PLGC    L+ + T D   Y
Sbjct  182   QQRSIAEVKTFVPYVIKAITSAVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQY  241

Query  839   DELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
             D+ GCL+ +N    + N  LQ  L  L+     A I+YADYY A  S      + GF   
Sbjct  242   DQYGCLKWLNKFAEYYNQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTNL  301

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             K   TCCG  GG YNY+ +  CG  GV +C +P ++I WDGVHLT+ A+  I+Q
Sbjct  302   K---TCCGM-GGPYNYNASADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQ  351


 Score =   240 bits (613),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 185/327 (57%), Gaps = 13/327 (4%)
 Frame = +2

Query  224   SLHDTGNLIRVGAIGPTLPAARLP-YGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPY  400
             SL DTGNL  +       P   LP YG T   RP GR SDG LI+DF+A ++GLP + PY
Sbjct  353   SLTDTGNLYFISP--RQSPDCLLPPYGQTHFHRPNGRCSDGRLILDFLAESLGLPYVKPY  410

Query  401   LD------KNASFTNGVNFAVTASTALDIGFLAQKGVVVP-SITVPLSGQINWLKTYLSS  559
             L       K  +   GVNFAV  +TALD GF  +KG  V  +    L  Q++W K  L S
Sbjct  411   LGFKNGAVKRGNIEQGVNFAVAGATALDRGFFEEKGFAVDVTANFSLGVQLDWFKELLPS  470

Query  560   SICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVI  739
              +C + S CK  +  SLF VGEIG ND  + L +     ++  ++P + + + +A+RE+I
Sbjct  471   -LCNSSSSCKKVIGSSLFIVGEIGGNDYGYPLSETTAFGDLVTYIPQVISVITSAIRELI  529

Query  740   QVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSL  919
              +G    +VPG+ PLGC P  L+ F T D ++YD+ GCL+ +N    + N  LQ  +  L
Sbjct  530   DLGAVTFMVPGSLPLGCNPAYLTIFATIDKEEYDQAGCLKWLNTFYEYHNELLQIEINRL  589

Query  920   RKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGV  1099
             R  +P   I+YADY+ A   F       GF  N L   CCG GGG YNY+   +CG  GV
Sbjct  590   RVLYPLTNIIYADYFNAALEFYNSPEQFGFGGNVL-KVCCG-GGGPYNYNETAMCGDAGV  647

Query  1100  ISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             ++C +P QY+ WDG HLT+ A+  +++
Sbjct  648   VACDDPSQYVSWDGYHLTEAAYRWMTK  674



>gb|ABK24921.1| unknown [Picea sitchensis]
Length=388

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/381 (38%), Positives = 210/381 (55%), Gaps = 14/381 (4%)
 Frame = +2

Query  47    KRTPQCVHPAMLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGAS  226
             K+TP  V+  M   M +      + ++C  L     S + +   +   C + +IY FG S
Sbjct  5     KKTP--VNGHMRNYMWI------FLVICMALFDMQPSVLVDAKHQNREC-YSAIYSFGDS  55

Query  227   LHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLD  406
             L DTGNL+  GA     P + LPYG T+  +PTGR S+G LIVDFIA+A G   L P+LD
Sbjct  56    LADTGNLLISGA-QQFGPISELPYGQTYFNKPTGRCSNGRLIVDFIAQAYGFQFLPPFLD  114

Query  407   KNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDC  586
             K+A F+NG NFAV  +TA+D  F  ++ +        L  QI W KT+   + C    DC
Sbjct  115   KHADFSNGANFAVAGATAMDASFFEERHIEPIFTNFSLDTQIEWFKTF-KENYCYGTPDC  173

Query  587   KDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVV  766
              D  + +LF +GEIG ND  +   QGR+++EV+ FVP I   +  A+ E+I  G ++  V
Sbjct  174   ADHFENALFLIGEIGGNDYNYPFAQGRSLEEVSTFVPLIVQKIKGAIEELIDEGAKKFFV  233

Query  767   PGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVI  946
              G  P+GC P  L+   T    D D +GCL   NN + + N H++  L  ++ +  +  I
Sbjct  234   QGNLPIGCSPFYLTTQQTNSSADLDHMGCLVKFNNFSQYSNLHIRNMLLDVQGKHQNISI  293

Query  947   LYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQY  1126
             +YADY++A    L+     G  +N L   CCG  GG+YN+     C S  V SC NP QY
Sbjct  294   IYADYFSAALKVLSNPKQYGLQRNVL-RVCCGR-GGKYNFSPPTSC-SPNVSSCLNPEQY  350

Query  1127  IHWDGVHLTQKAHLAISQIVI  1189
              +WDGVHLT+ A+  I+++ +
Sbjct  351   FNWDGVHLTETAYRTIAKMFV  371



>emb|CDX90163.1| BnaA08g18210D [Brassica napus]
Length=390

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/331 (40%), Positives = 196/331 (59%), Gaps = 4/331 (1%)
 Frame = +2

Query  194   PFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARA  373
             P++SI  FG S+ DTGN +R+  +     AA LPYG TF   P+GR+SDG LI+DFIA  
Sbjct  32    PYKSIISFGDSIADTGNYLRLSDVNHLPQAAFLPYGETFFHPPSGRYSDGRLIIDFIAEF  91

Query  374   VGLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             +GLP + PY   +N SF  G+NFAV  +TALD  FL +KG+      V L+ Q+N  K  
Sbjct  92    LGLPYVPPYFGSQNVSFEQGINFAVYGATALDRAFLMEKGIESDFTNVSLNVQLNTFKQV  151

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L S   ++  DC++ L  SL  +GEIG ND  +   +G++I E+   VP I  ++ +A+ 
Sbjct  152   LPSLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLIIKTISSAIV  211

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQA  907
             +++ +GG+  +VPG FP+GC  + L+ F     +++D   GC+  +N    + N  L+  
Sbjct  212   DLVDLGGKTFLVPGNFPIGCSASYLTLFHNAKEEEHDPFTGCIPWLNEFGEYHNEQLKTE  271

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             L  L+K +P   I+YADYY +  +F       GF +N+    CCG  GG+YN+  N+ CG
Sbjct  272   LKRLQKLYPHVNIIYADYYNSIHTFFQEPAKYGF-KNRPLAACCGV-GGKYNFTVNEECG  329

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
               GV  C NP +Y++WDG HLT+ A+  I+ 
Sbjct  330   YGGVNYCQNPSEYVNWDGYHLTEAAYHKIAH  360



>ref|XP_002299039.1| hypothetical protein POPTR_0001s46820g [Populus trichocarpa]
 gb|EEE83844.1| hypothetical protein POPTR_0001s46820g [Populus trichocarpa]
Length=367

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 215/370 (58%), Gaps = 18/370 (5%)
 Frame = +2

Query  122   ILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYG  301
             + C LLV   ++    +  K   C F +IY FG S+ DTGN +    + P       PYG
Sbjct  9     VTCSLLVLVLSNSSSCDATKHKNCGFDAIYNFGTSMSDTGNAMH---LTPNASEFNAPYG  65

Query  302   ITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNG-VNFAVTASTALDIGFL  478
              +      GR+SDG L++D+ A+A  LPLLNPYL+K+   T+G VNFAV  +TAL    L
Sbjct  66    RSIKD-AKGRYSDGFLVIDYFAKAACLPLLNPYLNKDVKDTHGGVNFAVAGATALPREAL  124

Query  479   AQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALV  658
              +K  + P I + L  Q+ W   Y  S    +  DCK++LK SLF +  +G ND   A++
Sbjct  125   -EKFNLQPFINISLDIQLQWWGNYAKSLCNNSKVDCKEKLKSSLFSIEAMGANDYLTAML  183

Query  659   QGRTIQEVAAFVPDITTSVINA----VREVIQVGGRRIVVPGTFPLGCFPNLLS-QFGTQ  823
             +G+TI+E+     D+ + VI A    VR++I  G  +++V G   +GC P+LL+ +  + 
Sbjct  184   RGKTIEELKKM--DLVSQVIKANEEGVRKIIGYGATQVLVTGYLHVGCAPSLLAMRSNSS  241

Query  824   DPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLL  1003
             D +D  + GCL+  N+   + N+ L++A+  LRKE PD  IL  DYY A QS L     L
Sbjct  242   DARD--QFGCLKDYNDFIKYHNDLLREAISRLRKEHPDVHILIGDYYTAMQSVLDNHQKL  299

Query  1004  GFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQI  1183
             GF    + + CCG+GG +YN+D  K CG+ GV SC +P +YI WDG+H+TQ++H  I++ 
Sbjct  300   GFES--VLVACCGTGG-KYNFDHRKKCGTQGVQSCSDPRKYISWDGLHMTQESHKHIAKW  356

Query  1184  VIPNILSRIQ  1213
              I +I S+ Q
Sbjct  357   YIQDIFSKFQ  366



>dbj|BAK01569.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/355 (43%), Positives = 203/355 (57%), Gaps = 17/355 (5%)
 Frame = +2

Query  134   LLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFP  313
             LLV A    +    QK     + +I+ FG SL D GNL+ V  I   L  ARLPYG+T+ 
Sbjct  11    LLVVAGLWPLRAAAQK-----YAAIFNFGDSLADAGNLV-VDGIPEYLATARLPYGMTYF  64

Query  314   GRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGV  493
             G PTGR SDG L+VDFIA+ +GLPLL P    NASF  G NFA+T  T+LD  F    G+
Sbjct  65    GYPTGRVSDGRLVVDFIAQELGLPLLPPSKAHNASFHRGANFAITGGTSLDTSFFEAHGM  124

Query  494   VVPSITVPLSG----QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ  661
                  TV  SG    Q+ W +  +  SIC +P +C+D  +RSLF VGE G ND   AL  
Sbjct  125   ---GHTVWNSGSLHTQLRWFED-MKPSICNSPKECRDLFRRSLFIVGEFGGNDYAAALGA  180

Query  662   GRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD  841
                +Q+V  FVP I  S+   + ++I  G   +VVPG  P+GCFP  LS F  Q P+ Y 
Sbjct  181   FLPLQKVHTFVPHIVDSIGKGIEKLIAEGAVELVVPGVLPIGCFPVYLSIFLKQRPEMYG  240

Query  842   -ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
                GC++ +N L+   N  LQ+ +  LRK+ P   I+YADYY A   F+  A   GF + 
Sbjct  241   PRSGCIKDLNTLSWVHNALLQRKIAELRKKHPGVRIMYADYYTAVTQFVLHADNWGFLK-  299

Query  1019  KLYMTCCGSGG-GQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             +   TCCG+ G GQYN++    CG  G  +C +P  + +WDGVHLT+ A+  I++
Sbjct  300   QTPRTCCGAPGVGQYNFNLTSKCGEPGAYACDDPSNHWNWDGVHLTEAAYGHIAK  354



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score =   271 bits (693),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 156/389 (40%), Positives = 228/389 (59%), Gaps = 16/389 (4%)
 Frame = +2

Query  26    SPSIN*SKRTPQCVHPAMLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRS  205
             SPS N  ++        M  L  LP++ L   IL  LLV +  S  +  N       F+S
Sbjct  404   SPSANRKEKEYNLPASPMASLDSLPAMKLVRFILSTLLVTSVNSQTQCRN-------FKS  456

Query  206   IYQFGASLHDTGNLIRVGAIGPT-LPAARLP-YGITFPGRPTGRWSDGLLIVDFIARAVG  379
             I  FG S+ DTGNL+  G   P  LPA+  P YG TF   PTGR+SDG LI+DFIA  +G
Sbjct  457   IISFGDSIADTGNLL--GLSDPNDLPASAFPPYGETFFHHPTGRYSDGRLIIDFIAEFLG  514

Query  380   LPLLNPYLD-KNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLS  556
              PL+ P+   +NA+F  GVNFAV  +TAL+  FL ++G+      V LS Q+      L 
Sbjct  515   FPLVPPFYGCQNANFKKGVNFAVAGATALEPSFLEERGIHSTITNVSLSVQLRSFTESLP  574

Query  557   SSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREV  736
             + +C +PSDC+D ++ +L  +GEIG ND  FAL Q + ++EV   VP +  ++ +A+ E+
Sbjct  575   N-LCGSPSDCRDMIENALILMGEIGGNDYNFALFQRKPVKEVEELVPFVIATISSAITEL  633

Query  737   IQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQALG  913
             + +GGR  +VPG FP+G   + L+ + T + ++YD L GCL+ +N+ + + N  LQ+ L 
Sbjct  634   VCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYYNKQLQEELN  693

Query  914   SLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGST  1093
              LRK +P   I+YADYY A           GF  N+    CCG  GG YN++ ++ CGS 
Sbjct  694   GLRKLYPHVNIIYADYYNALLRLFQEPAKFGF-MNRPLPACCGV-GGSYNFNFSRRCGSV  751

Query  1094  GVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             GV  C +P QY+++DG+H+T+ A+  IS+
Sbjct  752   GVEYCDDPSQYVNYDGIHMTEAAYRLISE  780


 Score =   244 bits (623),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/336 (40%), Positives = 192/336 (57%), Gaps = 7/336 (2%)
 Frame = +2

Query  191   CP-FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIA  367
             CP F+SI  FG S+ DTGNL+ +         A  PYG TF   PTGR  DG +I+DFIA
Sbjct  26    CPNFKSIISFGDSIADTGNLVGLSDRNQLPVTAFPPYGETFFHHPTGRSCDGRIIMDFIA  85

Query  368   RAVGLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLK  544
               VGLP + PY   KN +F  GVNFAV  +TAL   FL ++G+  P   V L  Q+   K
Sbjct  86    EFVGLPYVPPYFGSKNRNFDKGVNFAVAGATALKSSFLKKRGIQ-PHTNVSLGVQLKSFK  144

Query  545   TYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINA  724
               L + +C +PSDC+D +  +L  +GEIG ND  F     + ++EV   VP +  S+ + 
Sbjct  145   KSLPN-LCGSPSDCRDMIGNALILMGEIGGNDYNFPFFNRKPVKEVEELVPFVIASISST  203

Query  725   VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQ  901
             + E+I +GG+  +VPG FP+GC    L+ + T +  +YD   GCL+ +N    + +  L+
Sbjct  204   ITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPSTGCLKWLNKFGEYHSEKLK  263

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
               L  LRK +P   I+YADYY +           GF + + +  CCG  GG YN++  + 
Sbjct  264   VELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFME-RPFPACCGI-GGPYNFNFTRK  321

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             CGS GV SC +P +Y+ WDGVH+T+ A+  I+  ++
Sbjct  322   CGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGIL  357



>ref|NP_001057786.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAD54230.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF19700.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAG87915.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 189/330 (57%), Gaps = 7/330 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + +I+ FG SL D GNLI  G I  +L  AR PYG+TF GRPTGR S+G L+VDF+A   
Sbjct  55    YEAIFSFGDSLSDAGNLIADG-IPKSLTTARAPYGMTFFGRPTGRCSNGRLVVDFLAEHF  113

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSI-TVPLSGQINWLKTYL  553
             GLPL        A F+ G NFA+T +TAL+  F  Q G+      T  ++ QI WL+  +
Sbjct  114   GLPLPPASKAHGADFSKGANFAITGATALEYSFFKQHGIDQRIWNTGSINTQIGWLQD-M  172

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
               S+C +  +CKD   +SLF VGE G ND    L  G    EV  +VP +  ++ N V +
Sbjct  173   KPSLCKSDQECKDYFGKSLFVVGEFGGNDYNAPLFSGVAFSEVKTYVPLVAKAIANGVEK  232

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQAL  910
             +I++G + ++VPG  P+GCFP  L+ + T    DY+   GCLR  N L    N  L+Q L
Sbjct  233   LIELGAKDLLVPGVLPIGCFPLYLTLYNTSSKADYNARTGCLRRYNRLAFHHNRELKQQL  292

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGG-GQYNYDRNKVCG  1087
               L+K++P+  I+Y DY+ A   F+      GF  +     CCG+GG G YN++  K CG
Sbjct  293   DELQKKYPETKIMYGDYFKAAMQFVVSPGNFGF--SSTMQACCGAGGQGNYNFNLKKKCG  350

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
               G   C NP  Y+ WDG+H+T+ A+  ++
Sbjct  351   EEGASVCSNPSSYVSWDGIHMTEAAYRYVA  380



>gb|EAZ01210.1| hypothetical protein OsI_23235 [Oryza sativa Indica Group]
Length=379

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 189/330 (57%), Gaps = 7/330 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + +I+ FG SL D GNLI  G I  +L  AR PYG+TF GRPTGR S+G L+VDF+A   
Sbjct  39    YEAIFSFGDSLSDAGNLIADG-IPKSLTTARAPYGMTFFGRPTGRCSNGRLVVDFLAEHF  97

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSI-TVPLSGQINWLKTYL  553
             GLPL        A F+ G NFA+T +TAL+  F  Q G+      T  ++ QI WL+  +
Sbjct  98    GLPLPPASKAHGADFSKGANFAITGATALEYSFFKQHGIDQRIWNTGSINTQIGWLQD-M  156

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
               S+C +  +CKD   +SLF VGE G ND    L  G    EV  +VP +  ++ N V +
Sbjct  157   KPSLCKSDQECKDYFGKSLFVVGEFGGNDYNAPLFSGVAFSEVKTYVPLVAKAIANGVEK  216

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQAL  910
             +I++G + ++VPG  P+GCFP  L+ + T    DY+   GCLR  N L    N  L+Q L
Sbjct  217   LIELGAKDLLVPGVLPIGCFPLYLTLYNTSSKADYNARTGCLRRYNRLAFHHNRELKQQL  276

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGG-GQYNYDRNKVCG  1087
               L+K++P+  I+Y DY+ A   F+      GF  +     CCG+GG G YN++  K CG
Sbjct  277   DELQKKYPETKIMYGDYFKAAMQFVVSPGNFGF--SSAMQACCGAGGQGNYNFNLKKKCG  334

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
               G   C NP  Y+ WDG+H+T+ A+  ++
Sbjct  335   EEGASVCSNPSSYVSWDGIHMTEAAYRYVA  364



>gb|EAZ37226.1| hypothetical protein OsJ_21564 [Oryza sativa Japonica Group]
Length=379

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 189/330 (57%), Gaps = 7/330 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + +I+ FG SL D GNLI  G I  +L  AR PYG+TF GRPTGR S+G L+VDF+A   
Sbjct  39    YEAIFSFGDSLSDAGNLIADG-IPKSLTTARAPYGMTFFGRPTGRCSNGRLVVDFLAEHF  97

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSI-TVPLSGQINWLKTYL  553
             GLPL        A F+ G NFA+T +TAL+  F  Q G+      T  ++ QI WL+  +
Sbjct  98    GLPLPPASKAHGADFSKGANFAITGATALEYSFFKQHGIDQRIWNTGSINTQIGWLQD-M  156

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
               S+C +  +CKD   +SLF VGE G ND    L  G    EV  +VP +  ++ N V +
Sbjct  157   KPSLCKSDQECKDYFGKSLFVVGEFGGNDYNAPLFSGVAFSEVKTYVPLVAKAIANGVEK  216

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQAL  910
             +I++G + ++VPG  P+GCFP  L+ + T    DY+   GCLR  N L    N  L+Q L
Sbjct  217   LIELGAKDLLVPGVLPIGCFPLYLTLYNTSSKADYNARTGCLRRYNRLAFHHNRELKQQL  276

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGG-GQYNYDRNKVCG  1087
               L+K++P+  I+Y DY+ A   F+      GF  +     CCG+GG G YN++  K CG
Sbjct  277   DELQKKYPETKIMYGDYFKAAMQFVVSPGNFGF--SSTMQACCGAGGQGNYNFNLKKKCG  334

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
               G   C NP  Y+ WDG+H+T+ A+  ++
Sbjct  335   EEGASVCSNPSSYVSWDGIHMTEAAYRYVA  364



>ref|XP_009629822.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=385

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 197/340 (58%), Gaps = 11/340 (3%)
 Frame = +2

Query  182   VVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDF  361
             +V+  + SI  FG SL DTGNLIR+      + ++  PYG TF   PTGR+SDG L++DF
Sbjct  22    LVLGCYESIISFGDSLTDTGNLIRLSKSNSHVASSVPPYGETFFHHPTGRFSDGRLVIDF  81

Query  362   IARAVGLPLLNPY------LDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLS  523
             IA ++G PL+ PY      +  N +   GVNFAV  +TA+DI FL ++GV  P+  V L 
Sbjct  82    IAESMGFPLIPPYAGVMKNMTSNRNSIRGVNFAVAGATAVDISFLQKRGVKNPATNVSLG  141

Query  524   GQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDI  703
              ++ W K  L   +C +P+ C++ L  SL  +GEIG ND      QG+  +EV  +VP++
Sbjct  142   TELEWFKQMLPI-LCNSPTSCREFLGNSLVLMGEIGGNDYNHPFSQGKPREEVQTYVPEV  200

Query  704   TTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTI  880
               ++  A+ E+I++G + ++VPG  P+GC  + L+ F   +  +YD E GC+  +NN   
Sbjct  201   VKAIGLAIHELIELGAQTLIVPGNLPIGCSASYLTNFKNSNKNEYDSETGCINWLNNFAE  260

Query  881   FRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQY  1060
             + N  LQ+ +  +R+  P A ++YADYY A           GF      + CCG GGG Y
Sbjct  261   YHNQLLQEEIHRIRELHPQANVIYADYYNAAMQIYKSPKKFGF--TSTIVACCG-GGGPY  317

Query  1061  NYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             NYD   +CGS     C NP  Y+ WDGVHLT+ A+  I++
Sbjct  318   NYDSLAICGSPLSNVCNNPSSYVSWDGVHLTEAAYRLIAK  357



>dbj|BAD73016.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAY73029.1| hypothetical protein OsI_00901 [Oryza sativa Indica Group]
 gb|EAZ11038.1| hypothetical protein OsJ_00882 [Oryza sativa Japonica Group]
Length=409

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/354 (38%), Positives = 199/354 (56%), Gaps = 30/354 (8%)
 Frame = +2

Query  203   SIYQFGASLHDTGNLIRVGA-IGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVG  379
             S++ FG S  DTGN + + A + P +P   LPYG TF G PTGR ++G +I+DFIA    
Sbjct  38    SVFSFGNSFADTGNFVELAAPLLPIMPFNNLPYGETFFGHPTGRATNGRIIMDFIADEFH  97

Query  380   LPLLNPYLDK-NASFTNGVNFAVTASTALDIGFLAQKGVV-VPSITVPLSGQINWLKTYL  553
             +P + P+L +   +FT+G NFAV  ++ALD+ F  +  +  VP + + LS Q+ W +  L
Sbjct  98    VPFVPPFLGQGRQNFTHGANFAVVGASALDLAFFLKNNITNVPPLNISLSVQLEWFQK-L  156

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSV---INA  724
               ++C    +C++  KRSLFF+GE G ND  F L  G+T++E+  +VP +  ++   I A
Sbjct  157   KPTLCQTAQECREYFKRSLFFMGEFGGNDYVFILAAGKTLEELVPYVPKVVQAISAGIEA  216

Query  725   -----------------------VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKD  835
                                    ++ VI+ G R +VVPG  P GC P +L+ + ++   D
Sbjct  217   AVKFSLTIYTELTLPLSRTNNIVIQAVIKEGARYVVVPGELPNGCVPIILTLYASKSRGD  276

Query  836   YDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQ  1015
             YD  GCL+  N L  + N+ L +A+  LR  +P   I+YADYY     F+ +    GF+ 
Sbjct  277   YDARGCLKKQNALARYHNSALFEAVSRLRHRYPWVKIVYADYYKPVIDFIKKPARFGFNG  336

Query  1016  NKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             +     CCG+GGG YNYD    CG  G  +CP+P  +I WDG+HLT+ A+  IS
Sbjct  337   SSTLRACCGAGGGPYNYDATAACGLPGAAACPDPAAFISWDGIHLTEAAYARIS  390



>ref|XP_006415633.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
 gb|ESQ33986.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
Length=392

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 207/360 (58%), Gaps = 5/360 (1%)
 Frame = +2

Query  110   LNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLP-AA  286
             L   IL FLL++++++     + +     F+SI  FG S+ DTGN I + +     P AA
Sbjct  5     LKKLILSFLLIFSSSTFNVASSDQPPCRRFKSIISFGDSIADTGNYIHLSSDVNHPPQAA  64

Query  287   RLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTASTAL  463
              LPYG TF   P+GR+SDG LI+DFIA  +GLP + PY   +N SF  G+NFAV  +TAL
Sbjct  65    FLPYGETFFRSPSGRYSDGRLIIDFIAEFLGLPYVPPYFGSQNVSFEKGINFAVYGATAL  124

Query  464   DIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDI  643
             D  FL  KG+      V LS Q+N  K  L +   ++  DC++ L+ SL  +GEIG ND 
Sbjct  125   DRAFLLAKGIESDFTNVSLSVQLNIFKQILPNLCASSSRDCREILEDSLILMGEIGGNDY  184

Query  644   TFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQ  823
              +   +G++I E+   VP +  ++ +A+ ++I +GG+  +VPG FPLGC P  L+ F T 
Sbjct  185   NYPFFEGKSINELKDLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCSPAYLTLFKTV  244

Query  824   DPKDYDEL-GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPL  1000
             + +++D   GC+  +N      N  L+  L  L+K +P   I+YADYY +   F      
Sbjct  245   EEEEHDPFTGCITWLNEFGQHHNEQLKTELKRLQKLYPHVNIIYADYYNSMYPFFQEPAR  304

Query  1001  LGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
              GF +N+    CCG  GG YN+  N+ CG  GV  C NP +Y++WDG HLT+  H  I+ 
Sbjct  305   YGF-KNRPLGACCGV-GGNYNFTINEECGYEGVSYCQNPSEYVNWDGYHLTEATHQKIAH  362



>ref|XP_003546024.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max]
 gb|KHN18920.1| GDSL esterase/lipase [Glycine soja]
Length=374

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 196/336 (58%), Gaps = 10/336 (3%)
 Frame = +2

Query  194   PFRSIYQFGASLHDTGNLIRVGAIGPTLPA-ARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             P+++I+  G SL DTGN +  GAI    P   + PYG TF  R TGR SDG L++DFIA 
Sbjct  28    PYKAIFNLGDSLSDTGNFLASGAI--LFPVIGKPPYGQTFFKRATGRCSDGRLMIDFIAE  85

Query  371   AVGLPLLNPYL--DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITV-PLSGQINWL  541
             A  LP L PYL   K+     GVNFAV  +TALD  F  + G+     T   LS Q+ W 
Sbjct  86    AYELPYLPPYLALTKDKDIQRGVNFAVAGATALDAKFFIEAGLAKYLWTNNSLSIQLGWF  145

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
             K  L  S+C    DC    KRSLF VGEIG ND  +A + G  I ++ A VP +  ++  
Sbjct  146   KK-LKPSLCTTKQDCDSYFKRSLFLVGEIGGNDYNYAAIAG-NITQLQATVPPVVEAITA  203

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
             A+ E+I  G R ++VPG FP+GC    L+ F +++ +DYD+ GCL++ N    + N  L+
Sbjct  204   AINELIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYDDSGCLKTFNGFAEYHNKELK  263

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
              AL +LRK+ P A ILYADYY A + F       GF    L   CCG GGG YN++ +  
Sbjct  264   LALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGAL-RACCG-GGGPYNFNISAR  321

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             CG TG  +C +P  Y +WDG+HLT+ A+  I++ +I
Sbjct  322   CGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLI  357



>gb|EYU34853.1| hypothetical protein MIMGU_mgv1a021103mg, partial [Erythranthe 
guttata]
Length=281

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/282 (44%), Positives = 177/282 (63%), Gaps = 4/282 (1%)
 Frame = +2

Query  371   AVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             A GL  +NPY ++ A F NG NFA   +TAL   FL  K +  P  T  L  Q++ + T+
Sbjct  2     ASGLAFINPYKNREAEFKNGDNFATAGATALPTQFLQSKNISSPITTTSLDVQLDLMFTH  61

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
              +S IC   +DC   LK SLF VGEIG ND ++AL+QG++IQ+  + V D+  ++  A+ 
Sbjct  62    FNS-ICL--TDCIQLLKNSLFMVGEIGMNDYSYALLQGKSIQDTTSLVSDVVYAIQKAIN  118

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQAL  910
              VI+ G  RIVVPG  PLGC P LL++F T+DPK YD+  CL  +NNL+ + N+ LQ+A+
Sbjct  119   RVIEFGAVRIVVPGILPLGCLPALLTRFETKDPKSYDKFQCLNYLNNLSQYHNSELQKAI  178

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               ++K+ P+  ILY DYY A+ + L  A  L F    L   CCG GG  YNY  N+ CG+
Sbjct  179   QEVKKQNPNVAILYGDYYNAYTAILRNASHLKFDVKNLQKACCGIGGA-YNYKSNQTCGA  237

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
              GV +C  P  Y+ WDG++LT++A+  I+Q ++ +IL ++ C
Sbjct  238   RGVHACAQPSSYVSWDGINLTEEAYANIAQSLVADILPKLNC  279



>ref|XP_009109701.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X2 [Brassica 
rapa]
Length=387

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 149/362 (41%), Positives = 203/362 (56%), Gaps = 12/362 (3%)
 Frame = +2

Query  107   TLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAA  286
             +L   I  FLL++++   VE+         ++SI  FG S  DTGN + +  +     AA
Sbjct  4     SLKKLISSFLLIFSSTITVESSEPSCR--SYKSIISFGDSGADTGNYLHLSDVNHPPQAA  61

Query  287   RLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTASTAL  463
               PYG TF   PTGR SDG LI+DFIA  +GLP + PY   +N SF  G+NFAV  +TAL
Sbjct  62    FPPYGETFFHTPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNVSFKQGINFAVYGATAL  121

Query  464   DIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPS--DCKDRLKRSLFFVGEIGRN  637
             D   L +KG+      V LS Q+N  K  L  S+CA+ S  DCK+ L  SL  +G+IG N
Sbjct  122   DCALLIEKGIGSDFTNVSLSVQLNIFKQTL-PSLCASSSSHDCKEMLGDSLILMGDIGAN  180

Query  638   DITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFG  817
             D  +   QG++I EV   VP +  ++     ++I +GG+  +VPGTFP GCFP  L+ F 
Sbjct  181   DYDYMFFQGKSINEVEELVPLVIKAI---SSDLINLGGKTFLVPGTFPYGCFPAYLTLFQ  237

Query  818   TQDPKDYDEL-GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARA  994
             T   ++YD L GCL  +N L    + HL+  L  LRK +P   I+YADYY +   F    
Sbjct  238   TAKEEEYDPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEP  297

Query  995   PLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAI  1174
                GF +  L   CCG  GGQYN+   + CG  GV  C NP +Y++WDG HLT+  H  +
Sbjct  298   AKYGFKERPL-GACCGV-GGQYNFTFGEECGCQGVGYCKNPSEYVNWDGYHLTEATHQKM  355

Query  1175  SQ  1180
             + 
Sbjct  356   AH  357



>emb|CDX90162.1| BnaA08g18220D [Brassica napus]
Length=390

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 145/364 (40%), Positives = 205/364 (56%), Gaps = 9/364 (2%)
 Frame = +2

Query  101   SLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLP  280
             + +L   I  FL ++++   V++         ++SI  FG S  DTGN + +  +     
Sbjct  2     AFSLKKLISTFLFIFSSTITVDSSEPSCR--SYKSIISFGDSGADTGNYLHLSDVNHPPQ  59

Query  281   AARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTAST  457
             AA  PYG TF   PTGR SDG LI+DFIA  +GLP + PY   +N SF  G+NFAV  +T
Sbjct  60    AAFPPYGETFFHAPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNVSFKQGINFAVYGAT  119

Query  458   ALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPS--DCKDRLKRSLFFVGEIG  631
             ALD   L +KG+      V LS Q++  K  +  S+CA+ S  DCK+ L  SL  +G+IG
Sbjct  120   ALDCALLIEKGIGSDFTNVSLSVQLSIFKQ-IFPSLCASSSSHDCKEMLGDSLILMGDIG  178

Query  632   RNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQ  811
              ND  +   QG++I EV   VP +  ++ + + ++I +GG+  +VPGTFP GCFP  L+ 
Sbjct  179   ANDYDYMFFQGKSINEVEELVPLVIKAISSVIVDLINLGGKTFLVPGTFPYGCFPAYLTL  238

Query  812   FGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLA  988
             F T   ++YD L GCL  +N L    + HL+  L  LRK +P   I+YADYY +   F  
Sbjct  239   FQTAKEEEYDPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQ  298

Query  989   RAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHL  1168
                  GF +  L   CCG  GGQYN+   + CG  GV  C NP +Y++WDG HLT+  H 
Sbjct  299   EPAKYGFKERPL-GACCGV-GGQYNFTIGEECGGQGVGYCKNPSEYVNWDGYHLTEATHQ  356

Query  1169  AISQ  1180
              ++ 
Sbjct  357   KMAH  360



>ref|XP_006656143.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=403

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 189/331 (57%), Gaps = 7/331 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + +I+ FG SL D GNLI  G +   L  AR PYG+TF GRPTGR S+G L+VDF+A   
Sbjct  63    YEAIFSFGDSLSDAGNLIADG-VPKALTTARPPYGMTFFGRPTGRCSNGRLVVDFLAEHF  121

Query  377   GLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSI-TVPLSGQINWLKTYL  553
             GLPL          F+ G NFA+T +TAL+  F  Q G+      T  ++ QI WL+  +
Sbjct  122   GLPLPPASKAHGKDFSKGANFAITGATALEYSFFKQHGIDQRIWNTGSINTQIGWLQD-M  180

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
               S+C + S+CKD   +SLF VGE G ND    L  G    EV  +VP +  ++ N V +
Sbjct  181   KPSLCKSESECKDYFGKSLFVVGEFGGNDYNAPLFSGVAFSEVKTYVPLVAKAIANGVEK  240

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQAL  910
             +I++G + +VVPG  P+GCFP  L+ + T +  DY+   GCLR  N L    N  L+Q L
Sbjct  241   LIELGAKDMVVPGVLPIGCFPLYLTLYNTSNKADYNARTGCLRRYNRLAFHHNRELKQQL  300

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGG-GQYNYDRNKVCG  1087
               L+K++P+  I+Y DY+ A   F+      GF  +     CCG+GG G YN++  K CG
Sbjct  301   DELQKKYPETKIMYGDYFKAAMQFVVSPGNFGF--SSAMQACCGAGGEGNYNFNLKKKCG  358

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
               G   C NP  Y+ WDG+H+T+ A+  ++ 
Sbjct  359   EDGASVCSNPSSYVSWDGIHMTEAAYRYVAN  389



>ref|XP_009109702.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X3 [Brassica 
rapa]
Length=387

 Score =   258 bits (660),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 147/360 (41%), Positives = 203/360 (56%), Gaps = 8/360 (2%)
 Frame = +2

Query  107   TLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAA  286
             +L   I  FLL++++   VE+         ++SI  FG S  DTGN + +  +     AA
Sbjct  4     SLKKLISSFLLIFSSTITVESSEPSCR--SYKSIISFGDSGADTGNYLHLSDVNHPPQAA  61

Query  287   RLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTASTAL  463
               PYG TF   PTGR SDG LI+DFIA  +GLP + PY   +N SF  G+NFAV  +TAL
Sbjct  62    FPPYGETFFHTPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNVSFKQGINFAVYGATAL  121

Query  464   DIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDI  643
             D   L +KG+      V LS Q+N  K  L S +CA+ S   + L  SL  +G+IG ND 
Sbjct  122   DCALLIEKGIGSDFTNVSLSVQLNIFKQTLPS-LCAS-SSSHEMLGDSLILMGDIGANDY  179

Query  644   TFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQ  823
              +   QG++I EV   VP +  ++ +A+ ++I +GG+  +VPGTFP GCFP  L+ F T 
Sbjct  180   DYMFFQGKSINEVEELVPLVIKAISSAIVDLINLGGKTFLVPGTFPYGCFPAYLTLFQTA  239

Query  824   DPKDYDEL-GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPL  1000
               ++YD L GCL  +N L    + HL+  L  LRK +P   I+YADYY +   F      
Sbjct  240   KEEEYDPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEPAK  299

Query  1001  LGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
              GF +  L   CCG  GGQYN+   + CG  GV  C NP +Y++WDG HLT+  H  ++ 
Sbjct  300   YGFKERPL-GACCGV-GGQYNFTFGEECGCQGVGYCKNPSEYVNWDGYHLTEATHQKMAH  357



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score =   269 bits (687),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 222/374 (59%), Gaps = 21/374 (6%)
 Frame = +2

Query  71    PAMLRLMGLPSLTLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLI  250
             P  L +M L S      +L  LLV +A S  +  N       F+SI  FG S+ DTGNL+
Sbjct  423   PDSLLVMKLVSF-----LLSTLLVTSANSQTQCRN-------FKSIISFGDSIADTGNLL  470

Query  251   RVGAIGPT-LPAARLP-YGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLD-KNASF  421
               G   P  LPA+  P YG TF   PTGR+SDG LI+DFIA  +G PL++P+   +NA+F
Sbjct  471   --GLSDPNNLPASAFPPYGETFFHHPTGRYSDGRLIIDFIAEFLGFPLVHPFYGCQNANF  528

Query  422   TNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLK  601
               GVNFAV  +TALD  FL + G+      V LS Q+   K  L + +C +PSDC+D ++
Sbjct  529   EKGVNFAVAGATALDTSFLEEGGIHSDITNVSLSVQLRSFKESLPN-LCGSPSDCRDMIE  587

Query  602   RSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFP  781
              +L  +GEIG ND  FAL Q + I+EV   VP + +++  A++E++ +GGR  +VPG FP
Sbjct  588   NALILMGEIGGNDYNFALFQRKAIEEVEELVPFVVSAISLAIKELVCMGGRTFLVPGNFP  647

Query  782   LGCFPNLLSQFGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYAD  958
             LGC    L+ + T + ++YD L GCL  +N  + + N  LQ+ L  L++ +P   I+YAD
Sbjct  648   LGCSAAYLTLYQTSNKEEYDPLTGCLTWLNVFSEYYNEQLQKELNRLKELYPHVNIIYAD  707

Query  959   YYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWD  1138
             YY A           GF  N+    CCG  GG YN++ ++ CGS GV  C +P +Y++WD
Sbjct  708   YYNALLRLFPEPAKFGF-MNRPLPACCGL-GGSYNFNFSRRCGSVGVEYCNDPSKYVNWD  765

Query  1139  GVHLTQKAHLAISQ  1180
             G+H+T+ A+  IS+
Sbjct  766   GIHMTEAAYRWISE  779


 Score =   250 bits (638),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 135/333 (41%), Positives = 193/333 (58%), Gaps = 6/333 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             F+SI  FG S+ DTGNL+ +         A  PYG TF   PTGR  DG +I+DFIA  V
Sbjct  29    FKSIISFGDSIADTGNLVGLSNRNNLPVTAFPPYGETFFHHPTGRSCDGRIIMDFIAEFV  88

Query  377   GLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYL  553
             GLP + PY   KN +F  GVNFAV  +TAL+  FL ++G+  P   V L  Q+   K  L
Sbjct  89    GLPYVPPYFGSKNGNFDKGVNFAVAGATALESSFLMKRGIH-PHTNVSLGVQLKSFKKSL  147

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
                +C +PSDC+D++  +L  +GEIG ND  F   + + I+EV   VP +  ++ +A+ E
Sbjct  148   PD-LCGSPSDCRDKIGNALILMGEIGGNDYNFPFFERKPIKEVKELVPFVIATISSAITE  206

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQAL  910
             +I +G +  +VPG FP+GC    L+ + T + ++YD L GCL+ +N    + +  L+  L
Sbjct  207   LIGMGAKTFLVPGEFPIGCSVVYLTLYQTSNKEEYDPLTGCLKWLNKFGEYHSQQLKTEL  266

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LRK  P   I+YADYY A           GF    L+  CCG  GGQYN++  + CGS
Sbjct  267   NRLRKLNPHVNIIYADYYNALLRLFKEPAKFGFMDRPLH-ACCGI-GGQYNFNFTRKCGS  324

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              GV SC +P +Y+ WDGVH+T+ A+  I+  ++
Sbjct  325   VGVESCKDPSKYVGWDGVHMTEGAYKWIADGIL  357



>gb|KDP21068.1| hypothetical protein JCGZ_21539 [Jatropha curcas]
Length=367

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 210/363 (58%), Gaps = 16/363 (4%)
 Frame = +2

Query  113   NYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIG-PTLPAAR  289
             N+ ILC  L +    G+ + N       + SI+ FG SL DTGN +  GA+  P +   +
Sbjct  3     NFMILCLALCFI---GIVSTNP----LKYDSIFNFGDSLSDTGNFLLSGALAFPVI--GK  53

Query  290   LPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLD--KNASFTNGVNFAVTASTAL  463
             LPYG T+   PTGR SDG L+VDFIA A GLP L PYL   K  +F +GVNFAV  +TAL
Sbjct  54    LPYGETYFRHPTGRCSDGRLVVDFIAEASGLPHLPPYLGLGKGQNFRDGVNFAVAGATAL  113

Query  464   DIGFLAQKGV-VVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRND  640
                F   K +  V      LS Q+ W K  L +S+C    +C +  K+SLF VGEIG ND
Sbjct  114   SSEFFYDKKIGQVLWTNDSLSIQLGWFKE-LKTSLCTTKQECDNYFKKSLFVVGEIGGND  172

Query  641   ITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGT  820
               +    G +I+++ A VP +  ++  A+  +I+ G   ++VPG  P+GC    L+ F +
Sbjct  173   YNYPFFVGGSIKQLRASVPLVVGAITKAITVLIEEGAVELMVPGNLPIGCSAVYLTLFQS  232

Query  821   QDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPL  1000
              +  DYD+ GCL++ N+ + + NN L+ AL +LR ++P+A I+YADYY A + F      
Sbjct  233   PNKADYDKNGCLKAYNSFSKYHNNQLKGALETLRNKYPNARIIYADYYGAAKRFYHSPKH  292

Query  1001  LGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
              GF+ N +   CCG GGG YN++    CG  G  +C NP  Y +WDG+HLT+ A+  I+ 
Sbjct  293   YGFY-NGVLTACCG-GGGSYNFNNFARCGHVGSKACVNPSTYANWDGIHLTEAAYRIIAM  350

Query  1181  IVI  1189
              +I
Sbjct  351   GLI  353



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/363 (40%), Positives = 210/363 (58%), Gaps = 7/363 (2%)
 Frame = +2

Query  113   NYCILCFLLVYAAASG--VENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAA  286
             +Y  L  LL++   S   V N + +     FRSI  FG S+ DTGNL+ +         A
Sbjct  5     DYTFLMKLLIFIFLSTFIVTNVSSETKCREFRSIISFGDSIADTGNLLGLSDPNDLPHMA  64

Query  287   RLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNP-YLDKNASFTNGVNFAVTASTAL  463
               PYG TF   PTGR+S+G LI+DFIA  +GLPL+ P Y  +NA+F  GVNFAV  +TAL
Sbjct  65    FPPYGETFFHHPTGRFSNGRLIIDFIAEFLGLPLVPPFYGSQNANFDKGVNFAVGGATAL  124

Query  464   DIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDI  643
             +  FL ++G+  P   V L  Q+   K  L S IC +PSDC+D ++ +L  +GEIG ND 
Sbjct  125   ERSFLEERGIHFPYTNVSLGVQLQSFKESLPS-ICGSPSDCRDMIENALILMGEIGGNDY  183

Query  644   TFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQ  823
              +A    ++I+E+    P + T++ +A+ E+I +GGR  +VPG FP+GC    L+   T 
Sbjct  184   NYAFFVDKSIEEIKELTPLVITTISSAITELISMGGRTFLVPGEFPVGCSVFYLTSHQTS  243

Query  824   DPKDYDEL-GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPL  1000
             + ++YD L GCL+ +NN        L+  L  L+K +P   ++YADYY A          
Sbjct  244   NMEEYDPLTGCLKWLNNFGENHGEQLRAELKRLQKLYPHVNVIYADYYNALLRLYQEPAK  303

Query  1001  LGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
              GF  N+    CCGS GG YNY   + CG+  V SC +P +Y+ WDGVHLT+ A+  +++
Sbjct  304   FGF-MNRPLSACCGS-GGPYNYTVGRKCGTDIVESCNDPSKYVAWDGVHLTEAAYRLMAE  361

Query  1181  IVI  1189
              ++
Sbjct  362   GIL  364



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/357 (40%), Positives = 208/357 (58%), Gaps = 10/357 (3%)
 Frame = +2

Query  134   LLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAI--GPTLPAARLPYGIT  307
             +L+ A    + + NQ V+ C + SI+ FG SL DTGNL+ + A    P    +R+PYG T
Sbjct  12    ILLVAVFLALASTNQ-VLSC-YTSIFSFGDSLADTGNLLILQAQEHKPYSRISRVPYGET  69

Query  308   FPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNAS--FTNGVNFAVTASTALDIGFLA  481
             +  RPTGR S+G L++DFIA+++GLP + P+L +N S     G+NFAV  +TALD  FL 
Sbjct  70    YFHRPTGRSSNGRLVIDFIAQSLGLPFIPPFLQRNNSQPVQQGLNFAVVGATALDDSFLR  129

Query  482   QKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQ  661
             ++G+  P     L  Q  W K  L S +C   ++C++ L RSL   GEIG ND   A  +
Sbjct  130   ERGIFNPDSNNSLGIQFQWFKQVLPS-LCDPSTNCRELLARSLVLAGEIGGNDFNHAFFE  188

Query  662   GRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD  841
             G++  ++   VP +  +V + V+ +I+ G   ++VPG  P+GC    L+QF + +  DYD
Sbjct  189   GKSFHDIRPLVPLVINAVTSTVQMLIEQGAVTLLVPGNLPIGCSAAYLTQFQSPNKDDYD  248

Query  842   -ELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQN  1018
              E GCL+ +N      N+HL + L  +R+ +P A I+YADYY A           GF   
Sbjct  249   PETGCLKWLNEFAQKFNDHLVKELDGMRELYPHATIIYADYYNAAMRIYRSPSQYGFTNG  308

Query  1019  KLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
              L   CCG GGG YNYDR  +CG  G  +C +P  Y+ WDG+HLT+ A+  I++ +I
Sbjct  309   AL-TACCG-GGGPYNYDRTAMCGDAGSRTCEDPSSYVSWDGIHLTEAAYRLIAEGLI  363



>ref|XP_004963464.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=390

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/361 (39%), Positives = 198/361 (55%), Gaps = 24/361 (7%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             F SI+ FG S  DTGN +   A  P +P    PYG TF  RPTGR SDG LI+DFIA A+
Sbjct  32    FNSIFSFGNSYADTGNFVLQSAGLPAIPFNHSPYGETFFRRPTGRPSDGRLIIDFIAEAL  91

Query  377   GLPLLNPYLDKNA--SFTNGVNFAVTASTALDIGF-LAQKGVVVPSITVPLSGQINWLKT  547
              LPLL P+L +      ++G NFA+   TALD+GF L      VP     L  QI W + 
Sbjct  92    ELPLLAPFLSRQQPQDLSHGANFAIVGGTALDVGFFLRHNAASVPPFRSSLRAQIAWFRR  151

Query  548   YLS-SSIC-----AAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITT  709
             +   SS+C     AA   C +RL RSLF VGE+G ND  + L  G++++E  + VP++  
Sbjct  152   FKKRSSLCNGTTAAAAGGCGERLARSLFVVGELGSNDYGYFLAGGKSLRETKSLVPEVVK  211

Query  710   SVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQF------GTQDPKDYD-ELGCLRSIN  868
             ++   +  +++ G R +VV GT P GC P  L+++      G     +YD   GCLR +N
Sbjct  212   AICRGIERLVEEGARYVVVSGTLPAGCLPMALAKYGGAGEAGNATTAEYDRRTGCLRRLN  271

Query  869   NLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSG  1048
              L  + N  L++A+G +R ++P   ++YAD+Y      + R    GF +  L   CCG G
Sbjct  272   GLAQYHNWMLREAVGHMRAKYPATKLVYADFYRPVARLVRRPRKFGFTEEPL-RACCG-G  329

Query  1049  GGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ------IVIPNILSRI  1210
             GG YNY+    CGS     C +P +Y+HWDG+HLT+ A+  I+          P+IL   
Sbjct  330   GGPYNYNTEAACGSPDATVCGDPSKYVHWDGIHLTEAAYKYIADGWLDGLYAYPSILDLA  389

Query  1211  Q  1213
             Q
Sbjct  390   Q  390



>ref|XP_010696562.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Beta vulgaris 
subsp. vulgaris]
Length=321

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 190/322 (59%), Gaps = 13/322 (4%)
 Frame = +2

Query  245   LIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFT  424
             LI    + P    + + + + FP  P              A+   LP L+PYL+K+ +FT
Sbjct  9     LIMFITLNPLFSPSPMTFMMLFPSPPPP------------AKFFNLPFLDPYLNKDGNFT  56

Query  425   NGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKR  604
             +GVNFAV  ++AL+   LA K +V       L  Q++W K++L+S+  +  S+CK+RL +
Sbjct  57    HGVNFAVAGASALNYSALAMKDIVSLVTNSSLDVQLDWFKSHLNSTFHSI-SECKERLAK  115

Query  605   SLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPL  784
             SL  +GEIG ND  + L Q ++I +V   VP++   +  A++EVI +G  RIVVPG FP+
Sbjct  116   SLIIMGEIGGNDYNWELFQRKSISKVYKMVPEVVQVIEKAIKEVISLGATRIVVPGNFPI  175

Query  785   GCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYY  964
             GC P  L+ F T DP+ YDE  CLR +N    F N+ +Q+ +  LR + P   I+YADY+
Sbjct  176   GCLPVYLAMFETNDPRMYDEQQCLRYLNMFAKFHNSKIQEIIRQLRNDHPHVTIVYADYF  235

Query  965   AAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGV  1144
              A +  L  A  LGF ++ + + CCG G  +YN+D ++ CGS GVI+C +P ++I WDG+
Sbjct  236   RALKEILQHATSLGFGEDVMEIVCCGIGKNEYNFDYDRRCGSEGVIACEHPEKHISWDGI  295

Query  1145  HLTQKAHLAISQIVIPNILSRI  1210
             HLTQ  +  +++ +I +    I
Sbjct  296   HLTQNTYQLMAKWLITHNFKSI  317



>emb|CDY43308.1| BnaC03g58800D [Brassica napus]
Length=399

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 203/362 (56%), Gaps = 9/362 (2%)
 Frame = +2

Query  107   TLNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAA  286
             +L   I  FLL++++   V++         ++SI  F  S  DTGN + +  +     AA
Sbjct  4     SLKKLISSFLLMFSSTITVDSSEPSCR--SYKSIISFSDSGADTGNYLHLSDVNHPPQAA  61

Query  287   RLPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTASTAL  463
               PYG TF   PTGR SDG LI+DFIA  + LP + PY   +N SF  G+NFAV  +TAL
Sbjct  62    FPPYGETFFHAPTGRNSDGRLIIDFIAEFLRLPYVPPYFGSQNVSFKQGINFAVYGATAL  121

Query  464   DIGFLAQKGVVVPSITVPLSGQINWLKTYLSSSICAA--PSDCKDRLKRSLFFVGEIGRN  637
             D  FL +KG+      V LS Q+N  K  L S +CA+  P DCK+ L  SL  +G+IG N
Sbjct  122   DRTFLMEKGIESDFTNVSLSVQLNIFKKILPS-LCASSSPHDCKEMLGDSLILMGDIGAN  180

Query  638   DITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFG  817
             D  +   QG++I +V   VP +  ++ +A+ ++I +GG+  VVPG+FP GCFP  L+ F 
Sbjct  181   DYDYMFFQGKSINDVEELVPLVIKAISSALVDLIDLGGKTFVVPGSFPYGCFPAYLTLFQ  240

Query  818   TQDPKDYDEL-GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARA  994
             T   K+YD   GCL  +N L    +  L+  L  LRK +P   I+YADYY +   F    
Sbjct  241   TSKEKEYDTFTGCLSWLNELGKNHDEQLKTELKRLRKLYPHVNIIYADYYNSMYRFFQEP  300

Query  995   PLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAI  1174
                GF +  L   CCG  GGQYN+   + CG  GV  C NP +Y++WDG HLT+  H  +
Sbjct  301   AKYGFKERPL-GACCGV-GGQYNFTIGEECGYQGVGYCKNPSEYVNWDGYHLTEATHQKM  358

Query  1175  SQ  1180
             + 
Sbjct  359   AH  360



>ref|XP_010312731.1| PREDICTED: acetylajmalan esterase-like isoform X3 [Solanum lycopersicum]
Length=310

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/281 (46%), Positives = 179/281 (64%), Gaps = 4/281 (1%)
 Frame = +2

Query  170   ENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLL  349
             +N +++ C F  IYQFG SL DTGN IR    G TL    LPYG+ F    TGR S+G+L
Sbjct  28    QNPRLLNCRFDKIYQFGDSLSDTGNCIRETLCGATLSCGTLPYGMDFYQNATGRCSNGML  87

Query  350   IVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSIT-VPLSG  526
             I+DFIA   GLPLLNP+ D+NA F +GVNFAV  STAL    LA+K +V  ++T   LS 
Sbjct  88    IIDFIAVESGLPLLNPFKDENADFRHGVNFAVAGSTALSAKSLAEKNIVNIALTNSSLSV  147

Query  527   QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDIT  706
             Q++W+ ++  ++ C+   DC ++L +SLF VGEIG N+  + L QG+++ E    VP+I 
Sbjct  148   QLDWMSSHFQTT-CSP--DCPEKLNKSLFLVGEIGGNEFIYGLSQGKSMDESRKMVPEIV  204

Query  707   TSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFR  886
              ++I+ V  +I  G  +I+VPG FP+GC P  L++F T     YDE  CL+ +NN  IF 
Sbjct  205   QTIIHGVERIIGFGATQIIVPGNFPIGCHPIFLTKFMTNISTAYDEYHCLKELNNFAIFF  264

Query  887   NNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGF  1009
             N +LQQA+  L+K++P+  ++Y DYY AF   L  A  L F
Sbjct  265   NRYLQQAIDELKKDYPNITLIYGDYYNAFLWLLQNADGLDF  305



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/340 (43%), Positives = 195/340 (57%), Gaps = 13/340 (4%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPA-ARLPYGITFPGRPTGRWSDGLLIVDFIARA  373
             F SI+ FG SL DTGNL+    +G    A A+LPYG T+    TGR SDG LI+DFIA+A
Sbjct  45    FASIFSFGDSLADTGNLLHY--LGDDAGALAQLPYGETYFHHATGRLSDGRLIIDFIAQA  102

Query  374   VGLPLLNPYLDKNAS--FTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKT  547
              GLPL+ PYL   ++  F  G NFAV  +TALD  F   KG+ V      L  Q NW K 
Sbjct  103   SGLPLVPPYLAGTSAQDFRYGANFAVAGATALDNDFFRAKGLNVTWTEYSLGVQFNWFKQ  162

Query  548   YLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAV  727
              L S +C+  SDCK  +  SLF VGEIG ND + +  QGRT  E+  F+P+I   + + +
Sbjct  163   LLPS-LCSTDSDCKGIMSNSLFLVGEIGWNDHSHSFEQGRTTDEIRTFIPNIVEVISSVI  221

Query  728   REVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRNNHLQQ  904
              ++I++G +  VVPG FP GC    L+ F ++D +DYD + GC+R +N  + + N+ LQ 
Sbjct  222   DDLIKLGAKTFVVPGIFPSGCVSTYLTAFQSEDAEDYDPDTGCIRWVNEFSAYHNHLLQN  281

Query  905   ALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVC  1084
              L  LR+  P   I+YADYY A  S        GF +  L   CCG GGG YN + + +C
Sbjct  282   ELDRLRRLHPHVTIIYADYYEALMSIFHSPQKFGFKKAPL-DACCG-GGGPYNVNFSLLC  339

Query  1085  GSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILS  1204
             G+     C +P  ++ WDG HLT  A    S+IV   +L 
Sbjct  340   GAPMTTVCRDPSMFVFWDGTHLTDAA----SEIVARGLLE  375



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 198/330 (60%), Gaps = 5/330 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             F+SI  FG S+ DTGNL+ +         A  PYG TF    TGR+S+G LI+DFIA  +
Sbjct  30    FKSIISFGDSIADTGNLLGLSDPNDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAEYL  89

Query  377   GLPLLNP-YLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYL  553
             GLPL+ P Y  +NA+F  GVNFAV  +TAL+  FL ++G+      V L  Q+   K  L
Sbjct  90    GLPLVPPFYGSQNANFDKGVNFAVGGATALERSFLEERGIHFAYTNVSLGVQLQSFKNLL  149

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
              + +C +PS+C+D ++ +L  +GE+G ND+ +A   G+ I+E+   +P + T++ +A+ E
Sbjct  150   PN-LCDSPSECRDMIEDALILMGEVGGNDLNYAFFVGKPIEEIKELIPLVITTISSAITE  208

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQAL  910
             +I +GGR  +VPG FPLGC    L+ + T + ++YD + GCL+ +N    + N  LQ  L
Sbjct  209   LIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNMEEYDPVTGCLKWLNKFAEYFNEQLQAEL  268

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LRK +P   I+YADYY A           GF  N+    CCG  GGQYNY   K CG 
Sbjct  269   DRLRKLYPHVNIIYADYYNALSRIFQEPAKFGF-MNRPLPACCGL-GGQYNYTPGKKCGF  326

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
              GV  C +P +Y++WDGVH+T+ A+  I++
Sbjct  327   EGVEYCDDPSKYVNWDGVHMTEAAYRLIAE  356



>ref|XP_006415637.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
 gb|ESQ33990.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
Length=387

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/351 (40%), Positives = 203/351 (58%), Gaps = 8/351 (2%)
 Frame = +2

Query  131   FLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF  310
             F L+    + V +E Q      F+SI  FG S+ DTGNL+ +        AA  PYG TF
Sbjct  16    FFLIALLTTSVSSEQQ---CRKFKSIISFGDSITDTGNLLGLSDANDLPQAAFPPYGETF  72

Query  311   PGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQK  487
                PTGR+S+G LI+DFIA  +GLP + PY   +N SF  GVNFAV  +TAL+  FL  +
Sbjct  73    FHVPTGRFSNGRLIIDFIAEFLGLPYVPPYFGSQNGSFEKGVNFAVAGATALERVFLESR  132

Query  488   GVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGR  667
             G+      V L  Q+   K  L + +C +PSDC++ +  +L  VGEIG ND  +  + G+
Sbjct  133   GIHYAYTNVSLRVQLQSFKESLPN-LCGSPSDCREMIGNALVIVGEIGGNDYNYGFLVGK  191

Query  668   TIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL  847
             +I E+   VP + +++ + V E+I +GGR I+VP  FP+GC+P+ L+Q+ T + ++YD L
Sbjct  192   SIVEMKELVPLVISTISSVVTELISMGGRTILVPSDFPIGCWPSFLTQYQTSNQEEYDPL  251

Query  848   -GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKL  1024
              GCL+ +N      N  LQ  L  L++  P   ILYADY+ A           GF  N+ 
Sbjct  252   TGCLKWLNEFIERHNEELQAELNRLQRLNPRVTILYADYHNALLHTFQEPTRFGF-MNRP  310

Query  1025  YMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
                CCGS GG Y ++  + CG+ GV  C +P +Y+HWDG HLT+ A+  I+
Sbjct  311   LSACCGS-GGPYKFNSVRQCGTKGVDCCVDPSKYVHWDGFHLTESAYRWIA  360



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/346 (41%), Positives = 197/346 (57%), Gaps = 12/346 (3%)
 Frame = +2

Query  173   NQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLI  352
             N  V+ C + SI  FG S+ DTGNL        +L     PYG T+   PTGR SDG L+
Sbjct  20    NPLVLGC-YNSIIGFGDSITDTGNLYNSDP-NRSLNFFHPPYGETYFHHPTGRCSDGRLV  77

Query  353   VDFIARAVGLPLLNPYLDKNAS------FTNGVNFAVTASTALDIGFLAQKGVVVPSITV  514
             +DFIA  +GLPL+ PYL+  +S      F  GVNFAV  +TALD  FL + G  V     
Sbjct  78    IDFIAEFLGLPLVPPYLESQSSNQSVQNFEAGVNFAVAGATALDAAFLEEMGDSVSCTND  137

Query  515   PLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFV  694
              LS Q+ W K  L S +C   SDC   L  SL  +GEIG ND   AL+ G++I++V A+V
Sbjct  138   SLSIQLEWFKQMLPS-LCNTSSDCNKVLSTSLILMGEIGGNDYNDALLAGKSIEKVQAYV  196

Query  695   PDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINN  871
             P +  ++ + + E+I++G   ++VPG FP+GC P  L+++ + D   YD   GCL  +N 
Sbjct  197   PLVIETIASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNK  256

Query  872   LTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGG  1051
              + + N+ LQ AL  +R+  P   I+YADYY A           GF   +    CCG GG
Sbjct  257   FSGYHNDQLQIALSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGF-IGETSKACCG-GG  314

Query  1052  GQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             G YNY+ + +CG  G  +C NP Q+I WDG+H T+ AH  I++ ++
Sbjct  315   GPYNYNASALCGDAGASACENPAQFISWDGLHSTEAAHRWITKAIL  360



>ref|XP_009792971.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana sylvestris]
Length=384

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/340 (40%), Positives = 197/340 (58%), Gaps = 11/340 (3%)
 Frame = +2

Query  182   VVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDF  361
             +V+  + SI  FG SL DTGNLIR+      + ++  PYG TF   PTGR+SDG LI+DF
Sbjct  21    LVLGCYESIISFGDSLTDTGNLIRLSKSNKHVASSVPPYGETFFHHPTGRFSDGRLIIDF  80

Query  362   IARAVGLPLLNPYLDKNASFTN------GVNFAVTASTALDIGFLAQKGVVVPSITVPLS  523
             IA ++G PL+ PY     + T+      G+NFAV  +TA+DI FL ++GV  P+  V L 
Sbjct  81    IAESMGFPLIPPYAGVMKNMTSSRNSIRGINFAVAGATAVDISFLEKRGVKNPATNVSLG  140

Query  524   GQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDI  703
              ++ W K  L   +C +P+ C++ L  SL  +GEIG ND      QGR+ +EV  +VP++
Sbjct  141   TELEWFKQMLPI-LCNSPTSCREFLGNSLVLMGEIGGNDYNHPFSQGRSREEVQTYVPEV  199

Query  704   TTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTI  880
               ++  A+ E+I++G + ++VPG  P+GC  + L+ F   +  +YD E GC+  +NN   
Sbjct  200   VKAIGLAIHELIELGAQTLIVPGNLPIGCSASYLNTFENSNKDEYDAETGCINWLNNFAE  259

Query  881   FRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQY  1060
             + N  LQ+ +  +R+  P A I+YADYY A           GF      + CCG GGG Y
Sbjct  260   YHNQLLQEEIHRIRELHPQANIIYADYYNAAMQIYQSPKKFGF--TSTIVACCG-GGGPY  316

Query  1061  NYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
             NYD    CGS     C NP  ++ WDGVHLT+ A+  I++
Sbjct  317   NYDSLASCGSPLSNVCNNPSSHVSWDGVHLTEAAYRWIAK  356



>ref|XP_004971765.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=373

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/334 (42%), Positives = 191/334 (57%), Gaps = 9/334 (3%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARL---PYGITFPGRPTGRWSDGLLIVDFIA  367
             + SI+ FG S  DTGN + +G  GPT P   +   PYG+TF G PTGR SDG L +DFIA
Sbjct  27    YTSIFSFGDSFTDTGNFVIIG--GPTTPNLLIINPPYGMTFFGHPTGRISDGRLAIDFIA  84

Query  368   RAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKG-VVVPSITVPLSGQINWLK  544
              A+GLPLL P +  N SF  G NFAV  +TALD  F  + G   V    + L  Q+ W  
Sbjct  85    EALGLPLLPPSMAVNQSFRQGANFAVAGATALDREFFVRDGDTSVTRYNISLGDQLAWFD  144

Query  545   TYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINA  724
               +  S+C +P  C++   ++LF VGE G ND  F L+ G++I E    VP +  ++  A
Sbjct  145   A-MKPSLCGSPQACQEYFAQALFVVGEFGWNDYAFMLMSGKSIDEARTRVPQVVGTICAA  203

Query  725   VREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQQ  904
               ++I  GG+ +VVPG  PLGC    L +F +Q+     + GCL+ +N L+   N  L+Q
Sbjct  204   AEKLIGEGGKTVVVPGVTPLGCSTWNLVRFASQNADYEPDTGCLKGMNRLSREHNKELRQ  263

Query  905   ALGSLRKEFPDAV-ILYADYYAAFQSFLARAPLLGFHQN-KLYMTCCGSGGGQYNYDRNK  1078
             AL  LR   P  V I+YAD+YA    F A     GF         CCG GGG+YN + + 
Sbjct  264   ALARLRGRSPAGVRIVYADFYAPIVDFAAAPGRYGFDGTYGALRVCCGDGGGRYNVNLSM  323

Query  1079  VCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
              CG+ GV +CP+P  Y++WDG+HLT+ A+  I+ 
Sbjct  324   ACGTPGVSACPDPSAYVNWDGIHLTEAANHRIAD  357



>emb|CDY43309.1| BnaC03g58810D [Brassica napus]
Length=390

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/331 (39%), Positives = 196/331 (59%), Gaps = 4/331 (1%)
 Frame = +2

Query  194   PFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARA  373
             P++SI  FG S+ DTGN +R+  +     AA LPYG TF   P+GR+SDG LI+DFIA  
Sbjct  32    PYKSIISFGDSIADTGNYLRLSDVNHLPQAAFLPYGETFFHPPSGRYSDGRLIIDFIAEF  91

Query  374   VGLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTY  550
             +GLP + PY   +N S   G+NFAV  +TALD  FL +KG+      V L+ Q+N  K  
Sbjct  92    LGLPYVPPYFGSQNVSIEQGINFAVYGATALDRAFLMEKGIESDFTNVSLNVQLNTFKQV  151

Query  551   LSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVR  730
             L +   ++  DC++ L  SL  +GEIG ND  +   +G+T+ E+   VP I  ++ +A+ 
Sbjct  152   LPNLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEGKTVNEIKELVPLIIKTISSAIV  211

Query  731   EVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQA  907
             +++ +GG+  +VPG FP+GC  + L+ F     +++D   GC+  +N    + N+ L+  
Sbjct  212   DLVDLGGKTFLVPGNFPIGCSASYLTLFHNAKEEEHDPFTGCIPWLNEFGEYHNDQLKTE  271

Query  908   LGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCG  1087
             L  L+K +P   I+YADYY +  +F       GF +N+    CCG  GG+YN+  N+ CG
Sbjct  272   LKRLQKLYPHVNIIYADYYNSIYTFFQEPAKYGF-KNRPLAACCGV-GGKYNFTVNEECG  329

Query  1088  STGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
               GV  C NP +Y++WDG HLT+ A+  I+ 
Sbjct  330   YRGVNYCQNPSEYVNWDGYHLTEAAYRKIAH  360



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 198/330 (60%), Gaps = 5/330 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             F+SI  FG S+ DTGNL+ +         A  PYG TF    TGR+S+G LI+DFIA  +
Sbjct  30    FKSIISFGDSIADTGNLLGLSDPNDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAEYL  89

Query  377   GLPLLNP-YLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYL  553
             GLPL+ P Y  +NA+F  GVNFAV  +TAL+  FL ++G+      V L  Q+   K  L
Sbjct  90    GLPLVPPFYGSQNANFDKGVNFAVGGATALERSFLEERGIHFAYTNVSLGVQLQSFKGLL  149

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
              + +C +PS+C+D ++ +L  +GE+G ND+ +A   G+ I+E+   +P + T++ +A+ E
Sbjct  150   PN-LCDSPSECRDMIEDALILMGEVGGNDLNYAFFVGKPIEEIKELIPLVITTISSAITE  208

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQAL  910
             +I +GGR  +VPG FPLGC    L+ + T + ++YD + GCL+ +N    + N  LQ  L
Sbjct  209   LIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNVEEYDPVTGCLKWLNKFAEYFNEQLQAEL  268

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LRK +P   I+YADYY A           GF  N+    CCG  GGQYNY   K CG 
Sbjct  269   DRLRKMYPHVNIIYADYYNALSRIFQEPAKFGF-MNRPLPACCGL-GGQYNYTPGKKCGF  326

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
              GV  C +P +Y++WDGVH+T+ A+  I++
Sbjct  327   EGVEYCDDPSKYVNWDGVHMTEAAYRLIAE  356



>ref|XP_009113646.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
 emb|CDY34093.1| BnaA09g27190D [Brassica napus]
Length=397

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 201/347 (58%), Gaps = 8/347 (2%)
 Frame = +2

Query  131   FLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF  310
             FL+     + V +E Q      F+SI  FG S+ DTGNL+ +  +     +A  PYG TF
Sbjct  16    FLITLLTTAAVTSEQQ---CRNFKSIIIFGDSITDTGNLLHLSDLNNLPQSAFPPYGETF  72

Query  311   PGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQK  487
                PTGR+S+G LI+DFIA  + LP + PY    N SF  GVNFAV  +TAL+  FL  +
Sbjct  73    FHVPTGRFSNGRLIIDFIAEFLRLPYVPPYFGSPNESFQKGVNFAVAGATALERSFLESR  132

Query  488   GVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGR  667
             G+      V L  Q+   K  L + IC +PSDC++ +  +L  VGEIG ND  + L+ G+
Sbjct  133   GIHYAYTNVSLGVQLKSFKKSLPN-ICGSPSDCREMIGDALIIVGEIGGNDYNYGLLVGK  191

Query  668   TIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL  847
             +I+E+   VP + +++ + + E++ +GGR I+VP   P+GC+ + L+Q+ T + ++Y+ L
Sbjct  192   SIEEIKELVPLVISTISSVITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNPL  251

Query  848   -GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKL  1024
              GCL  +N      N  LQ+ L  L+K +P   ILYADYY A           GF  N+ 
Sbjct  252   TGCLNWLNEFVEHHNKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGF-VNRP  310

Query  1025  YMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAH  1165
                CCG+ GG YN++    CG+ GV  C +P +Y+HWDG HLT+ A+
Sbjct  311   LSACCGT-GGPYNFNNGSQCGTKGVDCCTDPSKYVHWDGFHLTESAY  356



>ref|XP_009421257.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Musa acuminata 
subsp. malaccensis]
Length=360

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/336 (43%), Positives = 195/336 (58%), Gaps = 27/336 (8%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             + ++Y FG S+ DTGN +R+G         RLPYG+TF GR TGR SDG L++DFIA+ +
Sbjct  22    YNALYNFGDSMSDTGN-VRIG---------RLPYGMTFFGRATGRCSDGRLVIDFIAQDL  71

Query  377   GLPLLNP---YLDKNASFTNGVNFAVTASTALDIGFLAQKGV-----VVPSITVPLSGQI  532
             G PLL P   +LD +  F  G NFAV A+T L   F  ++G+     V  SI +    Q+
Sbjct  72    GFPLLPPSSEFLDHD--FKQGANFAVVAATTLGFEFFNERGLSKGLWVNASIYI----QV  125

Query  533   NWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTS  712
                +  L + IC AP DCKD L +SLF VGE G ND + AL  GR I EV+ FVP + ++
Sbjct  126   ERFEKLLPT-ICGAPQDCKDFLSKSLFIVGEFGGNDYSTALFFGRRIDEVSTFVPHVVSA  184

Query  713   VINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYD-ELGCLRSINNLTIFRN  889
             + + V  +I +G   IVVPG  P+GCFP  L+ + T DP+DY  + GC R  N L+   N
Sbjct  185   ISDGVERLIGLGAVDIVVPGLLPVGCFPLYLTNYHTPDPEDYGPKTGCGRKYNALSWLHN  244

Query  890   NHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYD  1069
               L++AL  L  ++P   I YADYY+    F       GF    L  TCCG+GGG YNYD
Sbjct  245   AMLRKALDHLHSKYPSVSIRYADYYSQIIDFTLNPLKYGFTAGAL-RTCCGNGGGIYNYD  303

Query  1070  RNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
             + + C   G   C N   ++ WDG+H+T+ AH  I+
Sbjct  304   QGRRCNDKGYTVCENVSTHVSWDGIHMTEAAHRVIA  339



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/330 (42%), Positives = 198/330 (60%), Gaps = 5/330 (2%)
 Frame = +2

Query  197   FRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDFIARAV  376
             F+SI  FG S+ DTGNL+ +         A  PYG TF    TGR+S+G LI+DFIA  +
Sbjct  36    FKSIISFGNSIADTGNLLGLSDPNDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAEYL  95

Query  377   GLPLLNP-YLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQINWLKTYL  553
             GLPL+ P Y  +NA+F  GVNFAV  +TAL+  FL ++G+      V L  Q+   K  L
Sbjct  96    GLPLVPPFYGSQNANFEKGVNFAVGGATALERSFLEERGIHFAYTNVSLGVQLQSFKGLL  155

Query  554   SSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVINAVRE  733
              + +C +PS+C+D ++ +L  +GE+G ND+ +A   G+ I+E+   VP + T++ +A+ E
Sbjct  156   PN-LCDSPSECRDMIENALILMGEVGGNDLNYAFFVGKPIEEIRELVPLVITTISSAITE  214

Query  734   VIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL-GCLRSINNLTIFRNNHLQQAL  910
             +I +GGR  +VPG FPLGC    L+ + T + ++YD + GCL+ +N    + N  LQ  L
Sbjct  215   LIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNMEEYDPVTGCLKWLNKFAEYFNEQLQAEL  274

Query  911   GSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGS  1090
               LRK +P   I+YADYY A           GF  N+    CCG  GGQYNY   K CG 
Sbjct  275   DRLRKLYPHVNIIYADYYNALARLFQEPAKYGF-MNRPLPACCGF-GGQYNYTPGKKCGF  332

Query  1091  TGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
              GV  C +P +Y++WDGVH+T+ A+  I++
Sbjct  333   EGVDYCKDPSKYVNWDGVHMTEAAYRLIAE  362



>gb|EMT33597.1| GDSL esterase/lipase [Aegilops tauschii]
Length=384

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 138/355 (39%), Positives = 199/355 (56%), Gaps = 20/355 (6%)
 Frame = +2

Query  119   CILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGA-IGPTLPAARLP  295
             CI  FLL   A+      N         SI+ FG S  DTGN +++ A + P +P + LP
Sbjct  9     CIAFFLLPLLASVHYAQANPGR--GSIHSIFSFGNSYADTGNFVKLAAPLLPIIPFSNLP  66

Query  296   YGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGF  475
             YG TF GRPTGR S+G +I+DFIA   GLP + P L +  +FT G NFAV  +TALD+ +
Sbjct  67    YGETFFGRPTGRASNGRIILDFIADEFGLPFVPPILGEEHNFTRGANFAVVGATALDLSY  126

Query  476   LAQKGVV-VPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFA  652
               +  +  VP     LS Q+ W +  L S++C+ P  C+D  +RS+F +GE G ND TF 
Sbjct  127   FYENNITSVPPFNSSLSVQLGWFQK-LKSTLCSTPQGCRDYFRRSVFLMGEFGGNDYTFI  185

Query  653   LVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPK  832
             +  G+T+ +VA+FVP+I  S+   V ++++ GGR +VVPG  P+GC P +L+ + + + K
Sbjct  186   MAAGKTLDQVASFVPEIVQSISAGVEQLVKEGGRYVVVPGQPPMGCIPIVLTLYASPNKK  245

Query  833   DYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFH  1012
              YD                  L +A+  LR ++P   I+YADYY     FL      GF 
Sbjct  246   HYDP--------------GPVLLEAVHRLRIKYPATKIVYADYYTPVMEFLREPTRFGFS  291

Query  1013  QNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
              +     CCG+ GG YNY+    CG  G  +C NP  +I+WDG+HLT+  +  I+
Sbjct  292   ASSRLHVCCGA-GGPYNYNLTAACGLPGASACANPATHINWDGIHLTESVYRLIA  345



>gb|KDP44570.1| hypothetical protein JCGZ_22152 [Jatropha curcas]
Length=367

 Score =   256 bits (653),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/351 (39%), Positives = 203/351 (58%), Gaps = 15/351 (4%)
 Frame = +2

Query  176   QKVVVCPFRSIYQFGASLHDTGN-LIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLI  352
             Q +  C F  IYQFG S  D GN +I +    P    AR PYGIT   + TGR +DG L+
Sbjct  26    QDLKACKFDQIYQFGDSQSDPGNSIIEI----PQAYHARPPYGITI-NKATGRSNDGKLM  80

Query  353   VDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSGQI  532
             +D+IA + GLP + PY + N++  +G NFAV   TAL +  L +  + +P     L  Q+
Sbjct  81    IDYIAESAGLPWIEPYENPNSTLVHGANFAVAGVTALRVEDLIKWKIPLPYTNSSLLVQL  140

Query  533   NWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVA-AFVPDITT  709
              W    ++ +     ++CKD+LK +LF VG IG ND  FA  +GR + E+    VP +  
Sbjct  141   EWFDKLMAKT---CQTNCKDKLKSALFVVGTIGANDYDFAAYEGRGVGEIKDVMVPGVMK  197

Query  710   SVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRN  889
             ++   + E+I+ G  RIV PG F LGC P+LL+ F T     YD LGCL+  N+L I+ N
Sbjct  198   NIKQVIEEIIRYGAVRIVAPGVFQLGCTPSLLTLFETNKTALYDSLGCLKDYNDLFIYHN  257

Query  890   NHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYD  1069
               LQ+ L  L++++PD  ILY D Y+A Q  L     LGF   K    CCG+ GG+YN+ 
Sbjct  258   TLLQEMLKELQQKYPDVTILYGDIYSALQWILEDLTKLGFKSFK--QGCCGT-GGKYNFT  314

Query  1070  --RNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVIPNILSRIQC  1216
                  +CG+ GV  CPNP +Y+ WDG H + +A+  +++ ++ +++ +++C
Sbjct  315   PGLKHMCGAPGVPVCPNPREYVFWDGGHFSDQANKYLAEWLLKDLVPKLKC  365



>ref|NP_001242505.1| uncharacterized protein LOC100815771 precursor [Glycine max]
 gb|ACU18018.1| unknown [Glycine max]
Length=375

 Score =   256 bits (653),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 144/336 (43%), Positives = 195/336 (58%), Gaps = 10/336 (3%)
 Frame = +2

Query  194   PFRSIYQFGASLHDTGNLIRVGAIGPTLPA-ARLPYGITFPGRPTGRWSDGLLIVDFIAR  370
             P+ +I+ FG SL DTGN +  GAI    P   +LPYG TF  R TGR SDG L++DFIA 
Sbjct  29    PYTAIFNFGDSLSDTGNFLASGAI--LFPVIGKLPYGQTFFKRATGRCSDGRLMIDFIAE  86

Query  371   AVGLPLLNPY--LDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITV-PLSGQINWL  541
             A  LP L PY  L K+     GVNFAV  +TALD  F  + G+     T   L+ Q+ W 
Sbjct  87    AYDLPYLPPYPALTKDQYIQRGVNFAVAGATALDAKFFIEAGLAKYLWTNNSLNIQLGWF  146

Query  542   KTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITTSVIN  721
             K  L  S+C    DC    KRSLF VGEIG ND  +A + G   Q + + VP +  ++  
Sbjct  147   KK-LKPSLCTTKQDCDSYFKRSLFLVGEIGGNDYNYAAIAGNVTQ-LQSTVPPVVEAITM  204

Query  722   AVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRNNHLQ  901
             A+  +I  G R ++VPG FP+GC    L+ F +++ +DYDE GCL++ N    + N  L+
Sbjct  205   AINGLIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYDESGCLKTFNGFAEYHNRELK  264

Query  902   QALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYDRNKV  1081
              AL +LRK+ P A ILYADYY A + F       GF    L   CCG GGG +N++ +  
Sbjct  265   LALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGAL-RACCG-GGGPFNFNISAR  322

Query  1082  CGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQIVI  1189
             CG TG  +C +P  Y +WDG+HLT+ A+  I++ +I
Sbjct  323   CGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLI  358



>ref|NP_001042391.1| Os01g0214800 [Oryza sativa Japonica Group]
 dbj|BAA94238.1| putative esterase [Oryza sativa Japonica Group]
 dbj|BAB55732.1| putative esterase [Oryza sativa Japonica Group]
 dbj|BAF04305.1| Os01g0214800 [Oryza sativa Japonica Group]
 dbj|BAG89317.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70167.1| hypothetical protein OsI_00888 [Oryza sativa Indica Group]
Length=372

 Score =   255 bits (652),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 139/337 (41%), Positives = 192/337 (57%), Gaps = 9/337 (3%)
 Frame = +2

Query  182   VVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITFPGRPTGRWSDGLLIVDF  361
              V   + +I+ FG SL D GNL+ V  I   L  ARLPYG+T+ G PTGR SDG L+VDF
Sbjct  23    AVAQKYAAIFNFGDSLVDAGNLV-VDGIPDYLATARLPYGMTYFGYPTGRCSDGRLVVDF  81

Query  362   IARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDIGFLAQKGVVVPSITVPLSG----Q  529
             IA+ VGLPLL P   KNA+F  G NFA+T +T+LD  +   +G+     TV  SG    Q
Sbjct  82    IAQEVGLPLLPPSKAKNATFHRGANFAITGATSLDTPYFQGRGL---GHTVWNSGSLHTQ  138

Query  530   INWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGRTIQEVAAFVPDITT  709
             I W +  + +SIC +P +C+D  +RSLF VGE G ND    L   R ++EV  FVPD+  
Sbjct  139   IKWFQD-MKASICKSPQECRDLFRRSLFIVGEFGGNDYNSPLFAFRPLEEVHTFVPDVVD  197

Query  710   SVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDELGCLRSINNLTIFRN  889
             S+   + ++I+ G   +VVPG  P+GCFP  LS F  Q        GC+R +N L+   N
Sbjct  198   SIGKGIEKLIEEGAVELVVPGVLPIGCFPVYLSIFRKQPEMYGRRSGCIRDLNTLSWVHN  257

Query  890   NHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKLYMTCCGSGGGQYNYD  1069
               LQ+ +  LR + P   I+YADYY     F+  A   GF +      C   G G+YN++
Sbjct  258   AALQRKIAELRLKHPGVRIMYADYYTPAIQFVLHAEKYGFLRQTPRACCGAPGVGEYNFN  317

Query  1070  RNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAISQ  1180
                 CG  G  +C +P  +  WDG+HLT+ ++  I++
Sbjct  318   LTSKCGDPGSYACDDPSNHWSWDGIHLTEASYGHIAK  354



>ref|XP_003565533.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=372

 Score =   255 bits (652),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 202/363 (56%), Gaps = 20/363 (6%)
 Frame = +2

Query  110   LNYCILCFLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAAR  289
             L+ C+L  LL  A  +             + +I+ FG SL D GNL+ V  I   L  A+
Sbjct  6     LSACVLVILLAVAGQAAARK---------YAAIFNFGDSLVDAGNLV-VDGIPEYLATAK  55

Query  290   LPYGITFPGRPTGRWSDGLLIVDFIARAVGLPLLNPYLDKNASFTNGVNFAVTASTALDI  469
             LPYG+T+ G PTGR SDG L+VDFIA+ +G+PLL P    NA+F +G NFA+T +TALD 
Sbjct  56    LPYGMTYFGYPTGRCSDGRLVVDFIAQELGMPLLPPSKAHNATFHHGANFAITGATALDT  115

Query  470   GFLAQKGVVVPSITVPLSG----QINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRN  637
              +   KG+     TV  SG    QI WL+  + +SIC++P +CKD  +RSLF VGE G N
Sbjct  116   SYFVAKGL---GKTVWNSGSLHTQIKWLQD-MKASICSSPEECKDLFRRSLFIVGEFGGN  171

Query  638   DITFALVQGRTIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFG  817
             D    L   + ++EV  FVPD+  S+   + ++I  G   +VVPG  P+GCFP  LS F 
Sbjct  172   DYNSPLFAFQPLEEVHKFVPDVVNSIGEGIEKLIAEGAVELVVPGVLPIGCFPVYLSIFK  231

Query  818   TQDPKDYDELGCLRSINNLTIFRNNHLQQALGSLRKEFPDA--VILYADYYAAFQSFLAR  991
              Q        GC+R +N L+   N  LQ+ +  LRK+   A   I+YADYY     F+  
Sbjct  232   KQPEMYGPRSGCIRDLNTLSWVHNVALQRKIAELRKKHAGAGVRIIYADYYTPAIQFVLH  291

Query  992   APLLGFHQNKLYMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLA  1171
             A   GF +      C   G G+YN++    CG  G  +C +P  +  WDG+HLT+ ++  
Sbjct  292   AEKWGFLRQTPRACCGAPGVGEYNFNLTSKCGDPGSYACDDPSNHWSWDGIHLTEASYGH  351

Query  1172  ISQ  1180
             I++
Sbjct  352   IAK  354



>emb|CDY30819.1| BnaC05g21950D [Brassica napus]
Length=397

 Score =   256 bits (654),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 136/351 (39%), Positives = 202/351 (58%), Gaps = 8/351 (2%)
 Frame = +2

Query  131   FLLVYAAASGVENENQKVVVCPFRSIYQFGASLHDTGNLIRVGAIGPTLPAARLPYGITF  310
             FL+     + V +E Q      F+SI  FG S+ DTGNL+ +        +A  PYG TF
Sbjct  16    FLITLLTTAAVTSEQQ---CRNFKSIIIFGDSITDTGNLLHLSEPNNLPQSAFPPYGETF  72

Query  311   PGRPTGRWSDGLLIVDFIARAVGLPLLNPYL-DKNASFTNGVNFAVTASTALDIGFLAQK  487
                PTGR+S+G LI+DFIA  + LP + PY    N SF  G+NFAV  +TAL+  FL  +
Sbjct  73    FHVPTGRFSNGRLIIDFIAEFLRLPYVPPYFGSPNGSFQKGINFAVAGATALEQSFLESR  132

Query  488   GVVVPSITVPLSGQINWLKTYLSSSICAAPSDCKDRLKRSLFFVGEIGRNDITFALVQGR  667
             G+      V L  Q+   K  L + IC +PSDC++ +  +L  VGEIG ND  + L+ G+
Sbjct  133   GIHYAYTNVSLGVQLKSFKQSLPN-ICGSPSDCREMIGDALIIVGEIGGNDYNYGLLVGK  191

Query  668   TIQEVAAFVPDITTSVINAVREVIQVGGRRIVVPGTFPLGCFPNLLSQFGTQDPKDYDEL  847
             +I+E+   VP + +++ + + E++ +GGR I+VP   P+GC+ + L+Q+ T + ++Y+ L
Sbjct  192   SIEEIKELVPLVISTISSVITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNPL  251

Query  848   -GCLRSINNLTIFRNNHLQQALGSLRKEFPDAVILYADYYAAFQSFLARAPLLGFHQNKL  1024
              GCL  +N      N  LQ+ L  L+K +P   ILYADYY A           GF  N+ 
Sbjct  252   TGCLNWLNEFVEHHNKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGF-MNRP  310

Query  1025  YMTCCGSGGGQYNYDRNKVCGSTGVISCPNPPQYIHWDGVHLTQKAHLAIS  1177
                CCG+ GG YN++    CG+ GV  C +P +Y+HWDG HLT+ A+  ++
Sbjct  311   LSACCGT-GGPYNFNNGSQCGTKGVDCCTDPSKYVHWDGFHLTESAYRWVA  360



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3440634590592