BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79301_g1_i1 len=1639 path=[1:0-1638]

Length=1639
                                                                      Score     E

emb|CDO98680.1|  unnamed protein product                                768   0.0      
ref|XP_011073104.1|  PREDICTED: uncharacterized protein LOC105158158    766   0.0      
gb|KDP22579.1|  hypothetical protein JCGZ_26410                         763   0.0      
ref|XP_010663774.1|  PREDICTED: uncharacterized protein LOC100266246    760   0.0      
ref|XP_009757810.1|  PREDICTED: uncharacterized protein LOC104210580    754   0.0      
gb|EYU23062.1|  hypothetical protein MIMGU_mgv1a001626mg                753   0.0      
ref|XP_002511132.1|  zinc finger protein, putative                      754   0.0      Ricinus communis
ref|XP_009600106.1|  PREDICTED: uncharacterized protein LOC104095646    755   0.0      
ref|XP_011042927.1|  PREDICTED: uncharacterized protein LOC105138...    752   0.0      
ref|XP_011044094.1|  PREDICTED: uncharacterized protein LOC105139...    752   0.0      
ref|XP_004235273.1|  PREDICTED: uncharacterized protein LOC101245442    751   0.0      
ref|XP_011023947.1|  PREDICTED: MORC family CW-type zinc finger p...    750   0.0      
ref|XP_011023946.1|  PREDICTED: MORC family CW-type zinc finger p...    750   0.0      
ref|XP_011042926.1|  PREDICTED: uncharacterized protein LOC105138...    748   0.0      
ref|XP_011044093.1|  PREDICTED: uncharacterized protein LOC105139...    747   0.0      
ref|XP_002318152.1|  hypothetical protein POPTR_0012s10460g             748   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006436890.1|  hypothetical protein CICLE_v10030712mg             745   0.0      
gb|KHF99434.1|  MORC family CW-type zinc finger protein 4               739   0.0      
ref|XP_006347630.1|  PREDICTED: uncharacterized protein LOC102598...    744   0.0      
ref|XP_006493261.1|  PREDICTED: uncharacterized protein LOC102608497    749   0.0      
ref|XP_008239518.1|  PREDICTED: uncharacterized protein LOC103338109    737   0.0      
ref|XP_007038064.1|  MORC family CW-type zinc finger protein 4, p...    735   0.0      
ref|XP_007038062.1|  MORC family CW-type zinc finger protein 4, p...    735   0.0      
ref|XP_007038063.1|  Histidine kinase-, DNA gyrase B-, and HSP90-...    730   0.0      
ref|XP_007209067.1|  hypothetical protein PRUPE_ppa025644mg             733   0.0      
ref|XP_008464402.1|  PREDICTED: uncharacterized protein LOC103502300    734   0.0      
ref|XP_010678279.1|  PREDICTED: MORC family CW-type zinc finger p...    734   0.0      
gb|KCW49095.1|  hypothetical protein EUGRSUZ_K02700                     729   0.0      
ref|XP_006584700.1|  PREDICTED: uncharacterized protein LOC100816...    728   0.0      
ref|XP_010037384.1|  PREDICTED: uncharacterized protein LOC104426135    729   0.0      
ref|XP_003532495.1|  PREDICTED: uncharacterized protein LOC100816...    730   0.0      
ref|XP_010249112.1|  PREDICTED: uncharacterized protein LOC104591787    728   0.0      
emb|CDY34330.1|  BnaA01g14330D                                          723   0.0      
emb|CDY03400.1|  BnaC01g16820D                                          722   0.0      
ref|XP_010093927.1|  hypothetical protein L484_008818                   726   0.0      
ref|XP_009137486.1|  PREDICTED: MORC family CW-type zinc finger p...    722   0.0      
emb|CDY11045.1|  BnaA03g47040D                                          722   0.0      
ref|XP_007160001.1|  hypothetical protein PHAVU_002G2846000g            715   0.0      
ref|XP_010536598.1|  PREDICTED: MORC family CW-type zinc finger p...    726   0.0      
ref|XP_009138709.1|  PREDICTED: MORC family CW-type zinc finger p...    721   0.0      
ref|XP_004138252.1|  PREDICTED: uncharacterized protein LOC101222073    725   0.0      
ref|XP_004161374.1|  PREDICTED: uncharacterized LOC101222073            724   0.0      
emb|CDX92664.1|  BnaC07g39220D                                          720   0.0      
ref|XP_006347629.1|  PREDICTED: uncharacterized protein LOC102598...    730   0.0      
ref|XP_006580618.1|  PREDICTED: uncharacterized protein LOC100786679    724   0.0      
ref|XP_010250611.1|  PREDICTED: uncharacterized protein LOC104592...    721   0.0      
ref|XP_009375173.1|  PREDICTED: uncharacterized protein LOC103964021    720   0.0      
ref|XP_009344293.1|  PREDICTED: uncharacterized protein LOC103936174    720   0.0      
ref|XP_008374208.1|  PREDICTED: uncharacterized protein LOC103437509    719   0.0      
ref|XP_006413362.1|  hypothetical protein EUTSA_v10024553mg             712   0.0      
gb|KFK26706.1|  hypothetical protein AALP_AA8G282800                    712   0.0      
ref|XP_009337546.1|  PREDICTED: uncharacterized protein LOC103929994    712   0.0      
ref|XP_002864076.1|  hypothetical protein ARALYDRAFT_495140             712   0.0      
ref|XP_010442337.1|  PREDICTED: uncharacterized protein LOC104725...    709   0.0      
ref|XP_010442329.1|  PREDICTED: uncharacterized protein LOC104725...    709   0.0      
ref|XP_002321726.2|  hypothetical protein POPTR_0015s11300g             708   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004503774.1|  PREDICTED: MORC family CW-type zinc finger p...    708   0.0      
gb|KEH20991.1|  histidine kinase-, DNA gyrase B, putative               707   0.0      
gb|KEH20993.1|  histidine kinase-, DNA gyrase B, putative               707   0.0      
ref|XP_010442558.1|  PREDICTED: uncharacterized protein LOC104725579    707   0.0      
gb|KEH20990.1|  histidine kinase-, DNA gyrase B, putative               707   0.0      
ref|XP_010482379.1|  PREDICTED: uncharacterized protein LOC104761...    706   0.0      
gb|KEH20992.1|  histidine kinase-, DNA gyrase B, putative               706   0.0      
emb|CDX84876.1|  BnaA03g13540D                                          704   0.0      
ref|XP_010482378.1|  PREDICTED: uncharacterized protein LOC104761...    706   0.0      
ref|XP_002869696.1|  hypothetical protein ARALYDRAFT_492340             702   0.0      
ref|XP_010438948.1|  PREDICTED: MORC family CW-type zinc finger p...    701   0.0      
ref|XP_004298543.1|  PREDICTED: uncharacterized protein LOC101292116    704   0.0      
gb|EPS74601.1|  hypothetical protein M569_00153                         701   0.0      
ref|XP_006844594.1|  hypothetical protein AMTR_s00016p00209510          704   0.0      
ref|XP_009132694.1|  PREDICTED: uncharacterized protein LOC103857271    700   0.0      
ref|XP_010448496.1|  PREDICTED: MORC family CW-type zinc finger p...    697   0.0      
ref|XP_006285332.1|  hypothetical protein CARUB_v10006721mg             696   0.0      
ref|XP_010433704.1|  PREDICTED: MORC family CW-type zinc finger p...    696   0.0      
ref|NP_199891.4|  Histidine kinase-, DNA gyrase B-, and HSP90-lik...    698   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAA96991.2|  unnamed protein product                                698   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280042.1|  hypothetical protein CARUB_v10025919mg             695   0.0      
ref|XP_004310229.1|  PREDICTED: uncharacterized protein LOC101309319    694   0.0      
gb|KHG06394.1|  MORC family CW-type zinc finger protein 3               696   0.0      
ref|XP_010250612.1|  PREDICTED: uncharacterized protein LOC104592...    695   0.0      
ref|NP_194227.2|  Histidine kinase-, DNA gyrase B-, and HSP90-lik...    690   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402063.1|  hypothetical protein EUTSA_v10012707mg             693   0.0      
ref|XP_006438815.1|  hypothetical protein CICLE_v10033760mg             686   0.0      
emb|CDY45818.1|  BnaC03g16410D                                          690   0.0      
ref|XP_006483044.1|  PREDICTED: uncharacterized protein LOC102612...    691   0.0      
ref|XP_009383407.1|  PREDICTED: uncharacterized protein LOC103971173    686   0.0      
ref|XP_010943619.1|  PREDICTED: uncharacterized protein LOC105061307    686   0.0      
ref|XP_008222240.1|  PREDICTED: MORC family CW-type zinc finger p...    680   0.0      
ref|XP_008342061.1|  PREDICTED: MORC family CW-type zinc finger p...    675   0.0      
ref|XP_006483045.1|  PREDICTED: uncharacterized protein LOC102612...    677   0.0      
gb|KDO83114.1|  hypothetical protein CISIN_1g045475mg                   672   0.0      
ref|XP_009373812.1|  PREDICTED: MORC family CW-type zinc finger p...    672   0.0      
ref|XP_008379881.1|  PREDICTED: uncharacterized protein LOC103442861    676   0.0      
ref|XP_010239739.1|  PREDICTED: uncharacterized protein LOC100838...    673   0.0      
ref|XP_003581092.1|  PREDICTED: uncharacterized protein LOC100838...    673   0.0      
ref|XP_009336450.1|  PREDICTED: uncharacterized protein LOC103929029    671   0.0      
ref|XP_009758964.1|  PREDICTED: uncharacterized protein LOC104211580    670   0.0      
ref|XP_008389919.1|  PREDICTED: uncharacterized protein LOC103452183    669   0.0      
ref|XP_009624883.1|  PREDICTED: uncharacterized protein LOC104115870    666   0.0      
ref|XP_010090677.1|  hypothetical protein L484_017483                   663   0.0      
ref|XP_002446235.1|  hypothetical protein SORBIDRAFT_06g007940          661   0.0      Sorghum bicolor [broomcorn]
ref|XP_004975253.1|  PREDICTED: uncharacterized protein LOC101775460    659   0.0      
ref|XP_008668234.1|  PREDICTED: uncharacterized protein LOC100304...    656   0.0      
ref|NP_001159313.1|  uncharacterized protein LOC100304405               655   0.0      Zea mays [maize]
gb|EEE60724.1|  hypothetical protein OsJ_14235                          655   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007227005.1|  hypothetical protein PRUPE_ppa001437mg             655   0.0      
ref|XP_007038065.1|  MORC family CW-type zinc finger protein 4, p...    649   0.0      
ref|XP_008454488.1|  PREDICTED: uncharacterized protein LOC103494886    654   0.0      
ref|XP_009606486.1|  PREDICTED: uncharacterized protein LOC104100847    650   0.0      
ref|XP_010943767.1|  PREDICTED: uncharacterized protein LOC105061425    651   0.0      
emb|CDF77347.1|  CRT1-like GHKL ATPase                                  649   0.0      
gb|KCW86968.1|  hypothetical protein EUGRSUZ_B03533                     643   0.0      
ref|XP_009766607.1|  PREDICTED: uncharacterized protein LOC104217949    642   0.0      
ref|XP_006653264.1|  PREDICTED: uncharacterized protein LOC102716495    652   0.0      
gb|KDP26853.1|  hypothetical protein JCGZ_18011                         639   0.0      
ref|XP_008790787.1|  PREDICTED: MORC family CW-type zinc finger p...    640   0.0      
ref|XP_004228853.1|  PREDICTED: uncharacterized protein LOC101267836    637   0.0      
ref|XP_006363783.1|  PREDICTED: MORC family CW-type zinc finger p...    634   0.0      
ref|XP_004168342.1|  PREDICTED: uncharacterized LOC101203924            637   0.0      
ref|XP_001784861.1|  predicted protein                                  621   0.0      
ref|XP_002452053.1|  hypothetical protein SORBIDRAFT_04g017780          629   0.0      Sorghum bicolor [broomcorn]
ref|XP_011087120.1|  PREDICTED: uncharacterized protein LOC105168686    627   0.0      
ref|XP_010312212.1|  PREDICTED: MORC family CW-type zinc finger p...    629   0.0      
ref|XP_001753709.1|  predicted protein                                  614   0.0      
emb|CAH66201.1|  OSIGBa0148D14.7                                        626   0.0      Oryza sativa [red rice]
ref|XP_002514868.1|  zinc finger protein, putative                      625   0.0      Ricinus communis
ref|XP_004952475.1|  PREDICTED: uncharacterized protein LOC101777477    626   0.0      
ref|XP_006339329.1|  PREDICTED: MORC family CW-type zinc finger p...    629   0.0      
ref|XP_004289179.1|  PREDICTED: uncharacterized protein LOC101303459    623   0.0      
ref|XP_001760025.1|  predicted protein                                  608   0.0      
ref|XP_001755592.1|  predicted protein                                  611   0.0      
ref|XP_002304665.2|  hypothetical protein POPTR_0003s16560g             614   0.0      Populus trichocarpa [western balsam poplar]
gb|ACN26838.1|  unknown                                                 614   0.0      Zea mays [maize]
gb|AFW65721.1|  hypothetical protein ZEAMMB73_223977                    614   0.0      
ref|XP_010682927.1|  PREDICTED: uncharacterized protein LOC104897689    612   0.0      
ref|XP_008679744.1|  PREDICTED: uncharacterized protein gpm353 is...    613   0.0      
gb|EEC73139.1|  hypothetical protein OsI_07163                          611   0.0      Oryza sativa Indica Group [Indian rice]
gb|EYU37408.1|  hypothetical protein MIMGU_mgv1a025926mg                601   0.0      
gb|EEE56966.1|  hypothetical protein OsJ_06680                          610   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010556113.1|  PREDICTED: MORC family CW-type zinc finger p...    606   0.0      
ref|NP_001046827.1|  Os02g0469300                                       610   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010235427.1|  PREDICTED: uncharacterized protein LOC100841...    609   0.0      
ref|XP_006280068.1|  hypothetical protein CARUB_v10025950mg             605   0.0      
gb|EYU33525.1|  hypothetical protein MIMGU_mgv1a018572mg                599   0.0      
ref|XP_010235426.1|  PREDICTED: uncharacterized protein LOC100841...    605   0.0      
ref|XP_008679745.1|  PREDICTED: uncharacterized protein gpm353 is...    602   0.0      
ref|XP_004152321.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    602   0.0      
ref|XP_011020816.1|  PREDICTED: MORC family CW-type zinc finger p...    594   0.0      
gb|EYU30357.1|  hypothetical protein MIMGU_mgv1a022451mg                593   0.0      
gb|KFK25545.1|  hypothetical protein AALP_AA8G128800                    595   0.0      
ref|XP_006286668.1|  hypothetical protein CARUB_v10002587mg             588   0.0      
gb|KDO64460.1|  hypothetical protein CISIN_1g0033661mg                  580   0.0      
gb|KDO64456.1|  hypothetical protein CISIN_1g0033661mg                  585   0.0      
gb|KDO64458.1|  hypothetical protein CISIN_1g0033661mg                  583   0.0      
gb|KDO64457.1|  hypothetical protein CISIN_1g0033661mg                  583   0.0      
gb|KDO64459.1|  hypothetical protein CISIN_1g0033661mg                  580   0.0      
ref|XP_006436891.1|  hypothetical protein CICLE_v10030712mg             583   0.0      
ref|XP_006399801.1|  hypothetical protein EUTSA_v10015739mg             585   0.0      
ref|XP_010235428.1|  PREDICTED: uncharacterized protein LOC100841...    582   0.0      
gb|KGN52963.1|  hypothetical protein Csa_4G007680                       573   0.0      
ref|XP_010453370.1|  PREDICTED: MORC family CW-type zinc finger p...    570   0.0      
emb|CDX69668.1|  BnaA10g20170D                                          581   0.0      
ref|XP_002871548.1|  ATP binding protein                                577   0.0      
ref|XP_010492059.1|  PREDICTED: uncharacterized protein LOC104769...    577   0.0      
gb|EEC77006.1|  hypothetical protein OsI_15335                          578   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_001756757.1|  predicted protein                                  565   0.0      
ref|XP_009121795.1|  PREDICTED: uncharacterized protein LOC103846600    580   0.0      
emb|CDX97228.1|  BnaC09g43970D                                          579   0.0      
ref|XP_010492058.1|  PREDICTED: MORC family CW-type zinc finger p...    576   0.0      
ref|XP_010424073.1|  PREDICTED: MORC family CW-type zinc finger p...    573   0.0      
emb|CAC05441.1|  putative protein                                       572   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_196817.2|  histidine kinase-like ATPase domain-containing ...    572   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_001768049.1|  predicted protein                                  561   0.0      
emb|CDY52039.1|  BnaA08g31520D                                          563   0.0      
ref|XP_009110531.1|  PREDICTED: uncharacterized protein LOC103836064    568   0.0      
emb|CDX84021.1|  BnaC08g16240D                                          560   0.0      
gb|KHG07152.1|  MORC family CW-type zinc finger protein 4               562   0.0      
ref|NP_001190300.1|  histidine kinase-like ATPase domain-containi...    558   0.0      
ref|XP_002964030.1|  hypothetical protein SELMODRAFT_61608              535   0.0      
emb|CAE03980.3|  OSJNBa0033H08.4                                        545   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT20981.1|  hypothetical protein F775_52718                         528   1e-178   
emb|CAB36739.1|  putative protein                                       487   6e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235429.1|  PREDICTED: uncharacterized protein LOC100841...    488   7e-161   
gb|EMS56220.1|  MORC family CW-type zinc finger protein 4               464   4e-154   
ref|XP_008806549.1|  PREDICTED: MORC family CW-type zinc finger p...    455   2e-152   
ref|XP_001762322.1|  predicted protein                                  451   6e-151   
ref|XP_006841042.1|  hypothetical protein AMTR_s00085p00139780          461   1e-150   
ref|XP_002990610.1|  hypothetical protein SELMODRAFT_131980             444   2e-148   
ref|XP_002968723.1|  hypothetical protein SELMODRAFT_91078              443   5e-148   
emb|CBI17427.3|  unnamed protein product                                443   1e-144   
ref|XP_002267687.2|  PREDICTED: MORC family CW-type zinc finger p...    443   3e-144   Vitis vinifera
ref|XP_004968953.1|  PREDICTED: MORC family CW-type zinc finger p...    442   1e-143   
ref|XP_006340682.1|  PREDICTED: MORC family CW-type zinc finger p...    439   7e-143   
ref|XP_008675510.1|  PREDICTED: MORC family CW-type zinc finger p...    439   1e-142   
ref|XP_008675511.1|  PREDICTED: MORC family CW-type zinc finger p...    439   2e-142   
ref|XP_004232448.1|  PREDICTED: MORC family CW-type zinc finger p...    437   2e-142   
gb|KDP32669.1|  hypothetical protein JCGZ_13667                         437   3e-142   
ref|XP_008241762.1|  PREDICTED: MORC family CW-type zinc finger p...    436   4e-142   
gb|KGN63461.1|  hypothetical protein Csa_1G001330                       432   6e-142   
ref|XP_008675507.1|  PREDICTED: MORC family CW-type zinc finger p...    437   9e-142   
ref|XP_008675509.1|  PREDICTED: MORC family CW-type zinc finger p...    437   1e-141   
ref|XP_002455787.1|  hypothetical protein SORBIDRAFT_03g025250          436   2e-141   Sorghum bicolor [broomcorn]
ref|XP_008337977.1|  PREDICTED: MORC family CW-type zinc finger p...    435   2e-141   
ref|XP_010679818.1|  PREDICTED: MORC family CW-type zinc finger p...    434   2e-141   
dbj|BAJ95604.1|  predicted protein                                      436   2e-141   
emb|CDF77348.1|  CRT1-like GHKL ATPase                                  435   2e-141   
ref|XP_010268615.1|  PREDICTED: MORC family CW-type zinc finger p...    434   5e-141   
emb|CDP01951.1|  unnamed protein product                                433   6e-141   
ref|XP_004289106.1|  PREDICTED: MORC family CW-type zinc finger p...    432   7e-141   
ref|XP_007204594.1|  hypothetical protein PRUPE_ppa003060mg             432   1e-140   
gb|EEE54777.1|  hypothetical protein OsJ_02172                          433   4e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010660881.1|  PREDICTED: MORC family CW-type zinc finger p...    431   7e-140   
ref|XP_010432184.1|  PREDICTED: MORC family CW-type zinc finger p...    431   7e-140   
ref|XP_008375822.1|  PREDICTED: MORC family CW-type zinc finger p...    432   9e-140   
ref|XP_006645988.1|  PREDICTED: uncharacterized protein LOC102721607    434   2e-139   
emb|CDM83165.1|  unnamed protein product                                430   3e-139   
ref|XP_007156096.1|  hypothetical protein PHAVU_003G258200g             429   3e-139   
ref|XP_010231898.1|  PREDICTED: MORC family CW-type zinc finger p...    430   3e-139   
gb|KHN27040.1|  MORC family CW-type zinc finger protein 4               429   3e-139   
ref|XP_003569179.1|  PREDICTED: MORC family CW-type zinc finger p...    429   4e-139   
ref|XP_007206462.1|  hypothetical protein PRUPE_ppa018433mg             426   8e-139   
emb|CBI34886.3|  unnamed protein product                                427   1e-138   
ref|XP_006828823.1|  hypothetical protein AMTR_s00001p00138970          432   1e-138   
gb|KDO71063.1|  hypothetical protein CISIN_1g006503mg                   425   1e-138   
ref|XP_010251156.1|  PREDICTED: MORC family CW-type zinc finger p...    430   2e-138   
ref|XP_010918978.1|  PREDICTED: MORC family CW-type zinc finger p...    427   2e-138   
gb|KDO71059.1|  hypothetical protein CISIN_1g006503mg                   427   2e-138   
ref|XP_010251155.1|  PREDICTED: MORC family CW-type zinc finger p...    430   2e-138   
gb|KDO71058.1|  hypothetical protein CISIN_1g006503mg                   427   3e-138   
ref|XP_004509325.1|  PREDICTED: MORC family CW-type zinc finger p...    426   4e-138   
gb|KDO71060.1|  hypothetical protein CISIN_1g006503mg                   426   5e-138   
gb|EYU30360.1|  hypothetical protein MIMGU_mgv1a0262021mg               416   6e-138   
ref|XP_002533659.1|  zinc finger protein, putative                      423   6e-138   Ricinus communis
ref|XP_009370695.1|  PREDICTED: MORC family CW-type zinc finger p...    427   8e-138   
ref|XP_006466881.1|  PREDICTED: MORC family CW-type zinc finger p...    426   9e-138   
ref|XP_011083160.1|  PREDICTED: MORC family CW-type zinc finger p...    424   1e-137   
ref|XP_009339592.1|  PREDICTED: MORC family CW-type zinc finger p...    427   1e-137   
ref|XP_007036272.1|  MORC family CW-type zinc finger protein 3 is...    421   2e-137   
ref|XP_008810876.1|  PREDICTED: MORC family CW-type zinc finger p...    424   3e-137   
gb|KFK30262.1|  hypothetical protein AALP_AA7G238400                    424   4e-137   
ref|XP_006283315.1|  hypothetical protein CARUB_v10004354mg             424   4e-137   
ref|XP_008452124.1|  PREDICTED: MORC family CW-type zinc finger p...    421   4e-137   
ref|XP_007046788.1|  Compromised recognition of TCV 1 protein           423   5e-137   
gb|KGN63568.1|  hypothetical protein Csa_1G004350                       424   7e-137   
ref|XP_002511370.1|  zinc finger protein, putative                      426   8e-137   Ricinus communis
ref|XP_002867022.1|  predicted protein                                  422   9e-137   
ref|XP_008452122.1|  PREDICTED: MORC family CW-type zinc finger p...    421   9e-137   
ref|XP_010936621.1|  PREDICTED: uncharacterized protein LOC105056...    426   9e-137   
ref|XP_008452123.1|  PREDICTED: MORC family CW-type zinc finger p...    421   9e-137   
ref|XP_008791185.1|  PREDICTED: MORC family CW-type zinc finger p...    424   1e-136   
ref|XP_008791184.1|  PREDICTED: MORC family CW-type zinc finger p...    424   1e-136   
ref|XP_002278685.1|  PREDICTED: MORC family CW-type zinc finger p...    424   3e-136   Vitis vinifera
ref|XP_007036271.1|  MORC family CW-type zinc finger protein 3 is...    423   4e-136   
gb|KCW56685.1|  hypothetical protein EUGRSUZ_I02381                     416   6e-136   
ref|XP_010113477.1|  hypothetical protein L484_026811                   420   2e-135   
ref|XP_008464553.1|  PREDICTED: MORC family CW-type zinc finger p...    421   2e-135   
ref|XP_010437360.1|  PREDICTED: MORC family CW-type zinc finger p...    421   2e-135   
ref|XP_009145338.1|  PREDICTED: MORC family CW-type zinc finger p...    422   2e-135   
ref|XP_010936597.1|  PREDICTED: MORC family CW-type zinc finger p...    421   2e-135   
ref|XP_011028601.1|  PREDICTED: MORC family CW-type zinc finger p...    420   2e-135   
ref|XP_008464554.1|  PREDICTED: MORC family CW-type zinc finger p...    421   2e-135   
ref|XP_008230565.1|  PREDICTED: MORC family CW-type zinc finger p...    419   2e-135   
ref|XP_009145409.1|  PREDICTED: MORC family CW-type zinc finger p...    421   2e-135   
ref|XP_004167107.1|  PREDICTED: LOW QUALITY PROTEIN: MORC family ...    421   3e-135   
ref|XP_008230567.1|  PREDICTED: MORC family CW-type zinc finger p...    418   3e-135   
ref|XP_010432183.1|  PREDICTED: MORC family CW-type zinc finger p...    419   5e-135   
ref|XP_006412013.1|  hypothetical protein EUTSA_v10024673mg             418   6e-135   
ref|XP_004299917.1|  PREDICTED: MORC family CW-type zinc finger p...    419   6e-135   
ref|XP_006383149.1|  hypothetical protein POPTR_0005s12040g             419   7e-135   
ref|XP_011046172.1|  PREDICTED: MORC family CW-type zinc finger p...    418   7e-135   
ref|NP_195351.2|  Histidine kinase-, DNA gyrase B-, and HSP90-lik...    417   9e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146547.1|  PREDICTED: MORC family CW-type zinc finger p...    414   1e-134   
ref|XP_006476815.1|  PREDICTED: MORC family CW-type zinc finger p...    420   1e-134   
ref|XP_002867023.1|  hypothetical protein ARALYDRAFT_491004             417   1e-134   
ref|XP_010678802.1|  PREDICTED: MORC family CW-type zinc finger p...    418   1e-134   
ref|XP_004160988.1|  PREDICTED: MORC family CW-type zinc finger p...    413   2e-134   
gb|KDO69578.1|  hypothetical protein CISIN_1g005242mg                   419   2e-134   
gb|KGN53281.1|  hypothetical protein Csa_4G044460                       416   2e-134   
ref|NP_568000.1|  compromised recognition of TCV 1 protein              417   2e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230568.1|  PREDICTED: MORC family CW-type zinc finger p...    416   2e-134   
ref|XP_010029725.1|  PREDICTED: MORC family CW-type zinc finger p...    417   3e-134   
gb|AAO22768.1|  unknown protein                                         416   4e-134   
ref|XP_006476816.1|  PREDICTED: MORC family CW-type zinc finger p...    418   5e-134   
ref|XP_010533442.1|  PREDICTED: MORC family CW-type zinc finger p...    417   5e-134   
gb|KCW56684.1|  hypothetical protein EUGRSUZ_I02381                     415   5e-134   
ref|XP_010446808.1|  PREDICTED: MORC family CW-type zinc finger p...    416   5e-134   
gb|AAK26024.1|AF360314_1  unknown protein                               415   8e-134   
ref|XP_008785005.1|  PREDICTED: MORC family CW-type zinc finger p...    414   9e-134   
ref|XP_010663142.1|  PREDICTED: MORC family CW-type zinc finger p...    417   1e-133   
ref|XP_004230214.1|  PREDICTED: MORC family CW-type zinc finger p...    417   1e-133   
gb|AES71491.2|  histidine kinase-, DNA gyrase B                         415   1e-133   
ref|XP_008785004.1|  PREDICTED: MORC family CW-type zinc finger p...    414   1e-133   
ref|XP_011040469.1|  PREDICTED: MORC family CW-type zinc finger p...    416   2e-133   
ref|XP_010923156.1|  PREDICTED: MORC family CW-type zinc finger p...    416   2e-133   
emb|CDP16925.1|  unnamed protein product                                414   2e-133   
ref|XP_010923147.1|  PREDICTED: MORC family CW-type zinc finger p...    416   3e-133   
ref|XP_008785003.1|  PREDICTED: MORC family CW-type zinc finger p...    414   4e-133   
ref|XP_010532289.1|  PREDICTED: MORC family CW-type zinc finger p...    415   4e-133   
ref|XP_011046173.1|  PREDICTED: MORC family CW-type zinc finger p...    413   4e-133   
ref|XP_010446809.1|  PREDICTED: MORC family CW-type zinc finger p...    412   1e-132   
ref|XP_009145256.1|  PREDICTED: MORC family CW-type zinc finger p...    412   1e-132   
ref|XP_010660880.1|  PREDICTED: MORC family CW-type zinc finger p...    412   2e-132   
gb|KHG17271.1|  MORC family CW-type zinc finger protein 4               411   2e-132   
ref|XP_007138045.1|  hypothetical protein PHAVU_009G176500g             407   2e-132   
ref|XP_009396713.1|  PREDICTED: MORC family CW-type zinc finger p...    413   2e-132   
ref|XP_009418918.1|  PREDICTED: MORC family CW-type zinc finger p...    413   4e-132   
ref|XP_011046171.1|  PREDICTED: MORC family CW-type zinc finger p...    410   6e-132   
ref|XP_011046167.1|  PREDICTED: MORC family CW-type zinc finger p...    410   6e-132   
ref|XP_011071897.1|  PREDICTED: MORC family CW-type zinc finger p...    413   7e-132   
gb|KCW83322.1|  hypothetical protein EUGRSUZ_B00251                     409   1e-131   
ref|XP_002321614.2|  hypothetical protein POPTR_0015s09070g             410   1e-131   
ref|XP_006374532.1|  hypothetical protein POPTR_0015s09070g             409   1e-131   
ref|XP_006344837.1|  PREDICTED: uncharacterized protein LOC102603698    415   2e-131   
ref|XP_007138044.1|  hypothetical protein PHAVU_009G176500g             410   2e-131   
ref|XP_008805993.1|  PREDICTED: MORC family CW-type zinc finger p...    409   3e-131   
ref|XP_009791922.1|  PREDICTED: MORC family CW-type zinc finger p...    410   3e-131   
ref|XP_010027421.1|  PREDICTED: MORC family CW-type zinc finger p...    410   3e-131   
gb|KFK30261.1|  hypothetical protein AALP_AA7G238200                    409   4e-131   
ref|XP_009605485.1|  PREDICTED: MORC family CW-type zinc finger p...    409   5e-131   
tpg|DAA38322.1|  TPA: hypothetical protein ZEAMMB73_052419              404   5e-131   
ref|XP_004501902.1|  PREDICTED: MORC family CW-type zinc finger p...    409   5e-131   
ref|XP_004501904.1|  PREDICTED: MORC family CW-type zinc finger p...    408   6e-131   
ref|XP_009605484.1|  PREDICTED: MORC family CW-type zinc finger p...    410   7e-131   
ref|XP_008805991.1|  PREDICTED: MORC family CW-type zinc finger p...    410   7e-131   
ref|XP_009791921.1|  PREDICTED: MORC family CW-type zinc finger p...    410   7e-131   
ref|XP_006376880.1|  hypothetical protein POPTR_0012s09080g             409   8e-131   
ref|XP_002318684.2|  hypothetical protein POPTR_0012s09080g             409   9e-131   
ref|NP_173344.2|  protein DEFECTIVE IN MERISTEM SILENCING 11            407   2e-130   
gb|KHN30927.1|  MORC family CW-type zinc finger protein 3               408   2e-130   
ref|XP_010526779.1|  PREDICTED: MORC family CW-type zinc finger p...    406   3e-130   
ref|XP_011046170.1|  PREDICTED: MORC family CW-type zinc finger p...    406   3e-130   
ref|XP_010498319.1|  PREDICTED: MORC family CW-type zinc finger p...    406   3e-130   
ref|XP_003523086.1|  PREDICTED: MORC family CW-type zinc finger p...    406   8e-130   
gb|EEC70857.1|  hypothetical protein OsI_02368                          404   2e-129   
emb|CDX69218.1|  BnaC01g02350D                                          421   2e-129   
ref|XP_009377191.1|  PREDICTED: MORC family CW-type zinc finger p...    404   3e-129   
gb|AAK70637.1|AC091238_15  Unknown protein                              403   3e-129   
ref|XP_011040466.1|  PREDICTED: MORC family CW-type zinc finger p...    405   5e-129   
ref|XP_002992990.1|  hypothetical protein SELMODRAFT_136312             394   5e-129   
ref|XP_011040464.1|  PREDICTED: MORC family CW-type zinc finger p...    405   6e-129   
emb|CDX75568.1|  BnaA01g01340D                                          420   7e-129   
ref|XP_010678928.1|  PREDICTED: MORC family CW-type zinc finger p...    402   1e-128   
ref|XP_002890317.1|  hypothetical protein ARALYDRAFT_472130             403   1e-128   
ref|XP_008674932.1|  PREDICTED: MORC family CW-type zinc finger p...    400   2e-128   
ref|XP_009145153.1|  PREDICTED: MORC family CW-type zinc finger p...    398   2e-128   
ref|XP_006416538.1|  hypothetical protein EUTSA_v10006991mg             402   2e-128   
ref|XP_009117567.1|  PREDICTED: MORC family CW-type zinc finger p...    402   3e-128   
ref|XP_009117568.1|  PREDICTED: MORC family CW-type zinc finger p...    402   3e-128   
dbj|BAK06836.1|  predicted protein                                      402   3e-128   
ref|XP_008674930.1|  PREDICTED: MORC family CW-type zinc finger p...    403   4e-128   
ref|XP_008674931.1|  PREDICTED: MORC family CW-type zinc finger p...    403   5e-128   
ref|XP_010533444.1|  PREDICTED: MORC family CW-type zinc finger p...    398   5e-128   
ref|XP_008674929.1|  PREDICTED: MORC family CW-type zinc finger p...    403   7e-128   
dbj|BAK03982.1|  predicted protein                                      400   7e-128   
ref|XP_006347442.1|  PREDICTED: MORC family CW-type zinc finger p...    398   1e-127   
ref|XP_004972220.1|  PREDICTED: MORC family CW-type zinc finger p...    402   1e-127   
ref|XP_006306962.1|  hypothetical protein CARUB_v10008534mg             399   2e-127   
ref|XP_010678805.1|  PREDICTED: MORC family CW-type zinc finger p...    399   2e-127   
ref|XP_010678803.1|  PREDICTED: MORC family CW-type zinc finger p...    399   3e-127   
ref|XP_010477111.1|  PREDICTED: MORC family CW-type zinc finger p...    398   5e-127   
ref|XP_010477110.1|  PREDICTED: MORC family CW-type zinc finger p...    398   6e-127   
ref|XP_010046677.1|  PREDICTED: uncharacterized protein LOC104435666    392   1e-126   
gb|KDO71065.1|  hypothetical protein CISIN_1g006503mg                   390   3e-126   
ref|XP_006600635.1|  PREDICTED: MORC family CW-type zinc finger p...    396   4e-126   
gb|EEE50660.1|  hypothetical protein OsJ_30890                          394   4e-126   
gb|EEC66647.1|  hypothetical protein OsI_32911                          394   4e-126   
ref|NP_001064253.1|  Os10g0181700                                       394   4e-126   
ref|XP_009609083.1|  PREDICTED: MORC family CW-type zinc finger p...    392   5e-126   
ref|XP_004508898.1|  PREDICTED: MORC family CW-type zinc finger p...    396   5e-126   
gb|EMS64080.1|  MORC family CW-type zinc finger protein 3               396   5e-126   
ref|XP_009396962.1|  PREDICTED: MORC family CW-type zinc finger p...    391   6e-126   
ref|XP_006662229.1|  PREDICTED: MORC family CW-type zinc finger p...    394   7e-126   
ref|XP_006439858.1|  hypothetical protein CICLE_v10019081mg             397   9e-126   
ref|XP_009396961.1|  PREDICTED: MORC family CW-type zinc finger p...    393   1e-125   
ref|XP_009396960.1|  PREDICTED: MORC family CW-type zinc finger p...    394   1e-125   
emb|CDF77346.1|  CRT1-like GHKL ATPase                                  392   2e-125   
ref|XP_008657148.1|  PREDICTED: MORC family CW-type zinc finger p...    395   2e-125   
ref|XP_008657147.1|  PREDICTED: MORC family CW-type zinc finger p...    396   3e-125   
dbj|BAJ92329.1|  predicted protein                                      392   5e-125   
ref|XP_004501903.1|  PREDICTED: MORC family CW-type zinc finger p...    393   5e-125   
gb|EAY80816.1|  hypothetical protein OsI_35996                          394   7e-125   
ref|XP_009609077.1|  PREDICTED: MORC family CW-type zinc finger p...    390   7e-125   
gb|ABA93498.1|  ATPase, histidine kinase, DNA gyrase B-, and HSP9...    394   2e-124   
ref|XP_010322547.1|  PREDICTED: MORC family CW-type zinc finger p...    389   2e-124   
ref|XP_004241493.1|  PREDICTED: MORC family CW-type zinc finger p...    389   4e-124   
ref|XP_004983344.1|  PREDICTED: MORC family CW-type zinc finger p...    389   5e-124   
ref|XP_004983343.1|  PREDICTED: MORC family CW-type zinc finger p...    389   6e-124   
ref|XP_004983342.1|  PREDICTED: MORC family CW-type zinc finger p...    389   6e-124   
ref|XP_010462783.1|  PREDICTED: MORC family CW-type zinc finger p...    384   6e-124   
emb|CDM84565.1|  unnamed protein product                                391   8e-124   
ref|XP_003573822.1|  PREDICTED: MORC family CW-type zinc finger p...    388   1e-123   
ref|XP_010232457.1|  PREDICTED: LOW QUALITY PROTEIN: MORC family ...    388   1e-123   
ref|XP_006646406.1|  PREDICTED: uncharacterized protein LOC102714606    391   3e-123   
gb|EEC80607.1|  hypothetical protein OsI_22965                          392   1e-122   
ref|XP_008661512.1|  PREDICTED: uncharacterized protein LOC100217...    384   2e-122   
ref|XP_010045526.1|  PREDICTED: LOW QUALITY PROTEIN: MORC family ...    386   2e-122   
ref|XP_002977828.1|  hypothetical protein SELMODRAFT_107847             377   3e-122   
ref|XP_006656963.1|  PREDICTED: uncharacterized protein LOC102722779    390   5e-122   
ref|XP_004965405.1|  PREDICTED: uncharacterized protein LOC101777572    396   6e-122   
ref|XP_007031542.1|  Histidine kinase-, DNA gyrase B-, and HSP90-...    390   1e-121   
gb|EAZ18266.1|  hypothetical protein OsJ_33803                          383   2e-121   
ref|XP_010110366.1|  hypothetical protein L484_002916                   381   3e-121   
gb|EYU42193.1|  hypothetical protein MIMGU_mgv1a022246mg                376   6e-121   
ref|XP_010678804.1|  PREDICTED: MORC family CW-type zinc finger p...    379   8e-120   
ref|XP_002445046.1|  hypothetical protein SORBIDRAFT_07g003340          377   8e-120   
emb|CDF77345.1|  CRT1-like GHKL ATPase                                  376   4e-119   
emb|CDY41018.1|  BnaC05g14760D                                          378   5e-119   
gb|EEE65716.1|  hypothetical protein OsJ_21353                          389   6e-119   
gb|AFW84846.1|  hypothetical protein ZEAMMB73_765476                    379   1e-118   
ref|XP_010918979.1|  PREDICTED: MORC family CW-type zinc finger p...    375   2e-118   
ref|XP_006425577.1|  hypothetical protein CICLE_v100250762mg            366   3e-118   
ref|XP_006425575.1|  hypothetical protein CICLE_v100250762mg            366   3e-118   
ref|XP_009609084.1|  PREDICTED: MORC family CW-type zinc finger p...    372   4e-118   
gb|KEH31822.1|  histidine kinase-, DNA gyrase B                         374   2e-117   
ref|XP_006425576.1|  hypothetical protein CICLE_v100250762mg            366   4e-117   
ref|XP_006425570.1|  hypothetical protein CICLE_v100250762mg            368   7e-117   
ref|XP_006425573.1|  hypothetical protein CICLE_v100250762mg            366   2e-116   
ref|XP_002867024.1|  hypothetical protein ARALYDRAFT_912734             370   4e-116   
emb|CDY21683.1|  BnaA09g44340D                                          369   1e-115   
ref|XP_008659550.1|  PREDICTED: uncharacterized protein LOC103638...    374   1e-115   
ref|XP_010660883.1|  PREDICTED: MORC family CW-type zinc finger p...    367   1e-115   
ref|XP_008659547.1|  PREDICTED: uncharacterized protein LOC103638...    374   3e-115   
gb|EMT22600.1|  MORC family CW-type zinc finger protein 3               364   2e-114   
ref|XP_010027434.1|  PREDICTED: MORC family CW-type zinc finger p...    364   3e-114   
gb|EMS52949.1|  MORC family CW-type zinc finger protein 3               360   3e-114   
ref|XP_010936624.1|  PREDICTED: uncharacterized protein LOC105056...    366   4e-114   
ref|XP_008356577.1|  PREDICTED: MORC family CW-type zinc finger p...    352   2e-113   
ref|XP_008791187.1|  PREDICTED: uncharacterized protein LOC103708...    363   2e-113   
ref|XP_006425578.1|  hypothetical protein CICLE_v100250762mg            351   3e-112   
gb|KHG29908.1|  MORC family CW-type zinc finger protein 4               359   1e-111   
ref|XP_006425574.1|  hypothetical protein CICLE_v100250762mg            352   3e-111   
ref|XP_010936631.1|  PREDICTED: uncharacterized protein LOC105056...    357   8e-111   
gb|KDP31071.1|  hypothetical protein JCGZ_11447                         352   8e-111   
ref|XP_006425571.1|  hypothetical protein CICLE_v100250762mg            353   1e-110   
ref|XP_006425572.1|  hypothetical protein CICLE_v100250762mg            352   1e-110   
ref|XP_010459563.1|  PREDICTED: MORC family CW-type zinc finger p...    347   4e-110   
ref|XP_010462784.1|  PREDICTED: MORC family CW-type zinc finger p...    349   2e-109   
ref|XP_011040471.1|  PREDICTED: MORC family CW-type zinc finger p...    350   2e-109   
ref|XP_011040470.1|  PREDICTED: MORC family CW-type zinc finger p...    348   9e-109   
ref|XP_008341721.1|  PREDICTED: MORC family CW-type zinc finger p...    345   3e-108   
ref|XP_008785007.1|  PREDICTED: MORC family CW-type zinc finger p...    347   5e-108   
ref|XP_002437833.1|  hypothetical protein SORBIDRAFT_10g003370          350   6e-108   
ref|XP_008353397.1|  PREDICTED: MORC family CW-type zinc finger p...    342   7e-107   
ref|XP_010322549.1|  PREDICTED: MORC family CW-type zinc finger p...    341   3e-106   
gb|EMT01812.1|  MORC family CW-type zinc finger protein 4               342   1e-105   
ref|XP_010322548.1|  PREDICTED: MORC family CW-type zinc finger p...    338   5e-105   
ref|XP_009628706.1|  PREDICTED: MORC family CW-type zinc finger p...    332   1e-103   
dbj|BAG99855.1|  unnamed protein product                                334   2e-103   
ref|XP_009762163.1|  PREDICTED: MORC family CW-type zinc finger p...    331   3e-103   
ref|XP_010679819.1|  PREDICTED: MORC family CW-type zinc finger p...    327   1e-101   
ref|XP_008668235.1|  PREDICTED: uncharacterized protein LOC100304...    334   1e-101   
gb|EMS63904.1|  MORC family CW-type zinc finger protein 4               329   3e-101   
gb|KHN18442.1|  MORC family CW-type zinc finger protein 3               326   7e-100   
ref|XP_011083161.1|  PREDICTED: MORC family CW-type zinc finger p...    318   8e-99    
dbj|BAD19378.1|  ATP-binding region, ATPase-like domain-containin...    313   3e-98    
emb|CAB16854.1|  putative protein (fragment)                            314   1e-97    
gb|AFW86589.1|  hypothetical protein ZEAMMB73_417092                    320   3e-97    
tpg|DAA57243.1|  TPA: hypothetical protein ZEAMMB73_594091              326   4e-97    
ref|XP_011071898.1|  PREDICTED: MORC family CW-type zinc finger p...    317   6e-97    
gb|KEH20396.1|  histidine kinase-, DNA gyrase B                         314   7e-97    
ref|XP_010237453.1|  PREDICTED: MORC family CW-type zinc finger p...    314   2e-96    
dbj|BAJ95725.1|  predicted protein                                      307   1e-95    
ref|XP_002961261.1|  hypothetical protein SELMODRAFT_403001             306   4e-95    
gb|AAF79293.1|AC068602_16  F14D16.25                                    315   5e-95    
ref|XP_009145196.1|  PREDICTED: MORC family CW-type zinc finger p...    309   8e-95    
gb|EMT21601.1|  hypothetical protein F775_23955                         322   4e-94    
gb|ADG03105.1|  CRT1                                                    300   5e-94    
ref|XP_010459565.1|  PREDICTED: MORC family CW-type zinc finger p...    301   2e-92    
dbj|BAJ86715.1|  predicted protein                                      288   5e-88    
ref|NP_195350.5|  ATP binding protein                                   290   3e-87    
dbj|BAK07649.1|  predicted protein                                      280   9e-86    
gb|EMS49451.1|  hypothetical protein TRIUR3_04353                       287   1e-84    
emb|CAA18134.1|  putative protein                                       282   3e-84    
ref|XP_008805994.1|  PREDICTED: MORC family CW-type zinc finger p...    281   1e-83    
ref|XP_003601240.1|  MORC family CW-type zinc finger protein            283   1e-80    
gb|EMT26530.1|  MORC family CW-type zinc finger protein 4               267   3e-80    
gb|AGT16253.1|  hypothetical protein SHCRBa_190_D01_F_220               275   4e-80    
emb|CAN78719.1|  hypothetical protein VITISV_031696                     270   1e-79    
gb|EYU31162.1|  hypothetical protein MIMGU_mgv11b006051mg               266   5e-79    
ref|XP_002979408.1|  hypothetical protein SELMODRAFT_419096             259   4e-78    
ref|XP_007217123.1|  hypothetical protein PRUPE_ppa020667m1g            254   2e-76    
gb|KGN63462.1|  hypothetical protein Csa_1G001340                       248   2e-73    
emb|CAA18133.1|  putative protein                                       251   8e-73    
ref|XP_002992088.1|  hypothetical protein SELMODRAFT_134712             226   2e-66    
emb|CAN83550.1|  hypothetical protein VITISV_001172                     239   3e-66    
ref|XP_002983930.1|  hypothetical protein SELMODRAFT_156304             222   8e-62    
ref|XP_006639157.1|  PREDICTED: MORC family CW-type zinc finger p...    226   1e-60    
ref|XP_008776765.1|  PREDICTED: uncharacterized protein LOC103696...    216   4e-60    
ref|XP_008776764.1|  PREDICTED: uncharacterized protein LOC103696...    215   7e-60    
ref|XP_010511435.1|  PREDICTED: MORC family CW-type zinc finger p...    211   2e-59    
gb|AAH95325.1|  Zgc:162471 protein                                      215   3e-59    
ref|XP_007068316.1|  PREDICTED: MORC family CW-type zinc finger p...    221   6e-59    
gb|EYU30358.1|  hypothetical protein MIMGU_mgv11b019086mg               211   6e-59    
ref|XP_005303372.1|  PREDICTED: MORC family CW-type zinc finger p...    218   3e-58    
ref|XP_005303373.1|  PREDICTED: MORC family CW-type zinc finger p...    218   3e-58    
ref|XP_008163442.1|  PREDICTED: MORC family CW-type zinc finger p...    218   3e-58    
ref|XP_005303375.1|  PREDICTED: MORC family CW-type zinc finger p...    218   3e-58    
ref|XP_005303376.1|  PREDICTED: MORC family CW-type zinc finger p...    218   4e-58    
ref|XP_005303374.1|  PREDICTED: MORC family CW-type zinc finger p...    218   4e-58    
ref|XP_005303371.1|  PREDICTED: MORC family CW-type zinc finger p...    218   5e-58    



>emb|CDO98680.1| unnamed protein product [Coffea canephora]
Length=832

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/473 (77%), Positives = 406/473 (86%), Gaps = 11/473 (2%)
 Frame = -3

Query  1388  RPRKKQK-SAETSSVALPLGFLDplhepveqplllpppapaETSSG----------RAVP  1242
             RP+KK+K    T++V LPLGFLDPL     +     P   A    G          + + 
Sbjct  63    RPKKKKKVDGSTANVKLPLGFLDPLPTKETRLSASSPAPLAVHVPGDDALLALPAPKGIV  122

Query  1241  TCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELL  1062
                +E ++KQFWKAGD+EGAP GDW SS GGMDHVRVHP+FLHSNATSHKWVLGAFAELL
Sbjct  123   AVSLECNAKQFWKAGDYEGAPSGDWDSSFGGMDHVRVHPRFLHSNATSHKWVLGAFAELL  182

Query  1061  DNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADT  882
             DNSLDEV NG+TYVNIDM++++KDG+RML+IEDNGGGM+PDK+RQCMSLGYSAKSKIADT
Sbjct  183   DNSLDEVCNGSTYVNIDMIENKKDGNRMLLIEDNGGGMNPDKMRQCMSLGYSAKSKIADT  242

Query  881   IGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDY  702
             IGQYGNGFKTSTMRLGADVIVFSR  G  G   TQSIGLLSYTFLR TG EDIVVPMLDY
Sbjct  243   IGQYGNGFKTSTMRLGADVIVFSRSRGKEGNRSTQSIGLLSYTFLRGTGKEDIVVPMLDY  302

Query  701   ENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDD  522
             E   + W +IIRSS  DW+RN++TIV+WSPFSSEADLL+QFN MKDHGTRI+IYNLWEDD
Sbjct  303   ERRGQAWDKIIRSSAADWSRNVDTIVKWSPFSSEADLLQQFNWMKDHGTRIIIYNLWEDD  362

Query  521   QGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPS  342
             QGLLELDFDADP DIQIRGVNRD+K+IQMA+Q+PNSRHFLTYRHSLRSYASILYLR+PP 
Sbjct  363   QGLLELDFDADPHDIQIRGVNRDEKNIQMAQQHPNSRHFLTYRHSLRSYASILYLRIPPG  422

Query  341   FRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDV  162
             FRIILRGKDVEHHNIVNDMMMT+EVTYRPQ G DG+P+D NMVA+V IGFVKDA AHIDV
Sbjct  423   FRIILRGKDVEHHNIVNDMMMTKEVTYRPQAGVDGIPRDVNMVAIVNIGFVKDANAHIDV  482

Query  161   QGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             QGFNVYHKNRLIKPFWR+W+P GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  483   QGFNVYHKNRLIKPFWRVWHPPGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  535



>ref|XP_011073104.1| PREDICTED: uncharacterized protein LOC105158158 [Sesamum indicum]
Length=807

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/463 (78%), Positives = 406/463 (88%), Gaps = 3/463 (1%)
 Frame = -3

Query  1382  RKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPT---CIVETSSKQ  1212
             RK++ + E  S  LP+GFLDPL   +    L  P  P++ +     P     +V+ S+KQ
Sbjct  64    RKRRTTVEDFSALLPVGFLDPLPSKLTPSPLPLPSPPSDEACLPLPPAGVNAVVDASAKQ  123

Query  1211  FWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVING  1032
             FWKAGD+EG P GDW SS+GGMDHVRVHPKFLHSNATSHKWVLGA AELLDNSLDEV NG
Sbjct  124   FWKAGDYEGPPGGDWDSSNGGMDHVRVHPKFLHSNATSHKWVLGALAELLDNSLDEVCNG  183

Query  1031  ATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKT  852
             AT+VNIDMVKS+KDGS+ML+IEDNGGGMDPDK+RQCMSLGYSAKSK+ DTIGQYGNGFKT
Sbjct  184   ATFVNIDMVKSKKDGSKMLLIEDNGGGMDPDKMRQCMSLGYSAKSKLVDTIGQYGNGFKT  243

Query  851   STMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQI  672
             STMRLGADVIVFSRC G NGK  T+SIGLLSYTFLRST  EDIVVPMLDYE   +EW ++
Sbjct  244   STMRLGADVIVFSRCCGKNGKRSTRSIGLLSYTFLRSTRKEDIVVPMLDYERRGQEWNRM  303

Query  671   IRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDA  492
             +RSS  DW  N+ETIV+WSPFSSEADLLRQF+QM+D GTRI++YNLWEDDQG+LELDFD 
Sbjct  304   VRSSAADWKLNVETIVQWSPFSSEADLLRQFDQMQDQGTRIIVYNLWEDDQGMLELDFDT  363

Query  491   DPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDV  312
             DP DIQIRGVNRD+K I MAK+YPNS+HFLTYRHSLRSYA+ILYLR+PP+FRIILRG+DV
Sbjct  364   DPHDIQIRGVNRDEKCIDMAKKYPNSKHFLTYRHSLRSYAAILYLRIPPNFRIILRGEDV  423

Query  311   EHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNR  132
             EHHNIVNDMMM+QE+TYRPQ G DG+PKDSNMVAVVT+GFVKDAKAHIDVQGFNVYHKNR
Sbjct  424   EHHNIVNDMMMSQEITYRPQPGVDGIPKDSNMVAVVTVGFVKDAKAHIDVQGFNVYHKNR  483

Query  131   LIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             LIKPFWR+W+P GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  484   LIKPFWRVWHPPGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  526



>gb|KDP22579.1| hypothetical protein JCGZ_26410 [Jatropha curcas]
Length=819

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/459 (78%), Positives = 399/459 (87%), Gaps = 5/459 (1%)
 Frame = -3

Query  1379  KKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKA  1200
             KK++  +   V LP+GF          P      A AE+ S   V   ++  S KQFWKA
Sbjct  74    KKKRKLDELGVVLPVGF-----LAPLLPAPPASAAVAESQSTENVNAGLIRRSCKQFWKA  128

Query  1199  GDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYV  1020
             GD+EGAP GDW  SSGGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV NGATYV
Sbjct  129   GDYEGAPCGDWDLSSGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEVCNGATYV  188

Query  1019  NIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMR  840
             NIDMV++RKDGSRML++EDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMR
Sbjct  189   NIDMVENRKDGSRMLLVEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNGFKTSTMR  248

Query  839   LGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSS  660
             LGADVIVFSRC G +GKSPTQSIGLLSYTFLRSTG EDIVVPMLDYE   ++W +++R S
Sbjct  249   LGADVIVFSRCCGKDGKSPTQSIGLLSYTFLRSTGKEDIVVPMLDYEKKGRQWNKMMRFS  308

Query  659   VEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRD  480
               DWN N ETIV+WSPFSSEADLLRQFN M DHGT+I+IYNLWEDD+GLLELDFD DP D
Sbjct  309   SSDWNINAETIVQWSPFSSEADLLRQFNLMSDHGTQIIIYNLWEDDEGLLELDFDTDPLD  368

Query  479   IQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHN  300
             IQ+RGVNRD+K+IQMA+++PNSRHFLTYRHSLRSYASILYLR+PP FRIILRGKDV+HHN
Sbjct  369   IQLRGVNRDEKNIQMAREFPNSRHFLTYRHSLRSYASILYLRLPPGFRIILRGKDVDHHN  428

Query  299   IVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKP  120
             IVNDMM++QE+TYRPQ GA+GVPKDSNM A+VTIGFVKDAK H+DVQGFNVYHKNRLIKP
Sbjct  429   IVNDMMLSQEITYRPQHGAEGVPKDSNMAAIVTIGFVKDAKYHVDVQGFNVYHKNRLIKP  488

Query  119   FWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FWRLWN  GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  489   FWRLWNATGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  527



>ref|XP_010663774.1| PREDICTED: uncharacterized protein LOC100266246 [Vitis vinifera]
 emb|CBI15707.3| unnamed protein product [Vitis vinifera]
Length=830

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/460 (78%), Positives = 402/460 (87%), Gaps = 2/460 (0%)
 Frame = -3

Query  1376  KQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTC--IVETSSKQFWK  1203
             K+K  +   + LPLGFLDPL       L+          + R+      +VE S K FWK
Sbjct  73    KKKKLDGLGIVLPLGFLDPLPPEEPPALVPKAVTSPTAVAQRSSTANRNLVEQSCKLFWK  132

Query  1202  AGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATY  1023
             AG++EGAP GD+ SS+GG+DHVRVHPKFLHSNATSHKW LGAFAELLDNSLDE+ NGATY
Sbjct  133   AGEYEGAPGGDFDSSAGGLDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEICNGATY  192

Query  1022  VNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTM  843
             VN+DM++++KDG+RML+IEDNGGGMDP+K+RQCMSLGYSAKSKIA+TIGQYGNGFKTSTM
Sbjct  193   VNVDMLENKKDGNRMLLIEDNGGGMDPEKMRQCMSLGYSAKSKIANTIGQYGNGFKTSTM  252

Query  842   RLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRS  663
             RLGADVIVFSRC G +GKSPTQSIGLLSYTFLRSTG EDIVVPM+DYE   +EW ++IRS
Sbjct  253   RLGADVIVFSRCCGKDGKSPTQSIGLLSYTFLRSTGKEDIVVPMIDYEKGGREWNKMIRS  312

Query  662   SVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPR  483
             S  DWN+N+ETI++WSPFSSE DLLRQFN +K+HGTRI+IYNLWEDD G LELDFD DP+
Sbjct  313   SASDWNKNVETIMQWSPFSSELDLLRQFNFIKEHGTRIIIYNLWEDDPGQLELDFDTDPK  372

Query  482   DIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHH  303
             DIQIRGVNRD+K+IQMAKQ+PNSRHFLTYRHSLRSYASILYLR+PP FRIILRGKDVEHH
Sbjct  373   DIQIRGVNRDEKNIQMAKQFPNSRHFLTYRHSLRSYASILYLRLPPGFRIILRGKDVEHH  432

Query  302   NIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIK  123
             N+VNDMMMTQEVTYRPQ  ADGVPKD NMVAVVTIGFVKDAK HIDVQGFNVYHKNRLIK
Sbjct  433   NVVNDMMMTQEVTYRPQPSADGVPKDLNMVAVVTIGFVKDAKHHIDVQGFNVYHKNRLIK  492

Query  122   PFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             PFWRLWN AGSDGRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  493   PFWRLWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTIVL  532



>ref|XP_009757810.1| PREDICTED: uncharacterized protein LOC104210580 [Nicotiana sylvestris]
Length=786

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/515 (76%), Positives = 429/515 (83%), Gaps = 12/515 (2%)
 Frame = -3

Query  1523  MGNPKHRVKKEIFENHGSQPP----STATMPMSVIdlsssdsdsdse----DGRPRKKQK  1368
             M NP   +K+E+ E    + P    S+AT  + +   SS DSDSDS+      RP+KK+K
Sbjct  1     MANPNIVIKQEVVEGFMKKKPPAGSSSATQSVFIDLSSSDDSDSDSDGFVGSNRPKKKRK  60

Query  1367  SAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFE  1188
             S E  +  LPLGFLDPL  P E PL LP P      +G         + SKQFWKAGD+E
Sbjct  61    SVEDVNFPLPLGFLDPLPPPKETPLPLPAP----PLNGSNNKELGSSSESKQFWKAGDYE  116

Query  1187  GAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDM  1008
             G        SSGG+DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEVINGATY NIDM
Sbjct  117   GTSSSASGLSSGGIDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVINGATYANIDM  176

Query  1007  VKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGAD  828
             VK++KDGSRML+IEDNGGGMDPDK+R CMSLGYS KSK+ADTIGQYGNGFKTSTMRLGAD
Sbjct  177   VKNKKDGSRMLLIEDNGGGMDPDKMRHCMSLGYSVKSKVADTIGQYGNGFKTSTMRLGAD  236

Query  827   VIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDW  648
             VIVFSR SG  GKSPTQS+GLLSYTFLRSTGMEDIVVPMLDYE   + W +IIRSS  DW
Sbjct  237   VIVFSRSSGKPGKSPTQSVGLLSYTFLRSTGMEDIVVPMLDYEKRGEGWDKIIRSSTSDW  296

Query  647   NRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIR  468
             ++N+ETI++WSPFSSEADLLRQFN MK  GTRI++YNLWEDDQGLLELDFDADP DIQIR
Sbjct  297   DKNLETIIQWSPFSSEADLLRQFNPMKGQGTRIIVYNLWEDDQGLLELDFDADPHDIQIR  356

Query  467   GVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVND  288
             GVNRD+KSIQMAKQYPNS+HFLTYRHSLRSYASILYLR+PP+FRIILRGKDVEHHNIVND
Sbjct  357   GVNRDEKSIQMAKQYPNSKHFLTYRHSLRSYASILYLRIPPAFRIILRGKDVEHHNIVND  416

Query  287   MMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRL  108
             MMMTQE+TYRP  GADGVPKDSNMVA V IGFVKDAKAHIDVQGFNVYHKNRLIKPFWRL
Sbjct  417   MMMTQEITYRPMPGADGVPKDSNMVATVKIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRL  476

Query  107   WNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             W+  GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  477   WHAPGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  511



>gb|EYU23062.1| hypothetical protein MIMGU_mgv1a001626mg [Erythranthe guttata]
Length=783

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/461 (77%), Positives = 403/461 (87%), Gaps = 5/461 (1%)
 Frame = -3

Query  1382  RKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSG-RAVPTCIVETSSKQFW  1206
             +K++K+AE     LPLGFLDPL    +Q L          SS   AVP    +TS KQFW
Sbjct  66    KKRRKAAEDFGGVLPLGFLDPLPTTTKQALPSERLCLEFPSSRVNAVP----QTSVKQFW  121

Query  1205  KAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGAT  1026
             KAGD+EGAP G W SS+GGMDH R+HP+FLHSNATSHKWVLGAFAELLDNSLDEV NGAT
Sbjct  122   KAGDYEGAPGGAWDSSNGGMDHARIHPRFLHSNATSHKWVLGAFAELLDNSLDEVCNGAT  181

Query  1025  YVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTST  846
             YVN+DMV+S+KDG++ML+IEDNGGGMDPDK+R CMSLGYSAKSKIADTIGQYGNGFKTST
Sbjct  182   YVNVDMVQSKKDGNKMLLIEDNGGGMDPDKLRHCMSLGYSAKSKIADTIGQYGNGFKTST  241

Query  845   MRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIR  666
             MRLGADVIVFSR  G +G  PTQSIGLLSYTFLRSTG EDIVVPMLDYE   ++W +++R
Sbjct  242   MRLGADVIVFSRHCGKDGTRPTQSIGLLSYTFLRSTGKEDIVVPMLDYERKGQDWNRMVR  301

Query  665   SSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADP  486
             SS  DW+RN+E IV WSPFSSEADLLRQFN+M+D GTRI+IYNLWED+QGLLELDFDA+P
Sbjct  302   SSTIDWSRNVEAIVEWSPFSSEADLLRQFNEMQDQGTRIIIYNLWEDEQGLLELDFDAEP  361

Query  485   RDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEH  306
              DIQIRGVNRDDK+I MAK+YPNS+HFLTYRHSLR+Y +ILYLR+PP FRIILRG+DVEH
Sbjct  362   HDIQIRGVNRDDKNIDMAKKYPNSKHFLTYRHSLRNYVAILYLRIPPGFRIILRGEDVEH  421

Query  305   HNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLI  126
             HNIVNDMMM+QE+TYRPQ G DG+P  SNMVA+VT+GFVKDAKAHIDVQGFNVYHKNRLI
Sbjct  422   HNIVNDMMMSQEITYRPQPGVDGIPGHSNMVAIVTVGFVKDAKAHIDVQGFNVYHKNRLI  481

Query  125   KPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KPFW++W+PAGSDGRGVIGVLEANF+EPAHDKQGFERT VL
Sbjct  482   KPFWKIWHPAGSDGRGVIGVLEANFIEPAHDKQGFERTIVL  522



>ref|XP_002511132.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF51734.1| zinc finger protein, putative [Ricinus communis]
Length=816

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/462 (79%), Positives = 398/462 (86%), Gaps = 12/462 (3%)
 Frame = -3

Query  1379  KKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKA  1200
             KK++  E   V LP+GFL         PL   P     T+       C+++ S KQFWKA
Sbjct  68    KKKRKLEELGVVLPVGFL--------APLNQVPAEAMLTTVQGNDNVCLIDQSCKQFWKA  119

Query  1199  GDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYV  1020
             GD+EGAP GDW  S+GGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV  GATYV
Sbjct  120   GDYEGAPCGDWDLSTGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVCYGATYV  179

Query  1019  NIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMR  840
             NIDM+ + KDGSRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMR
Sbjct  180   NIDMLANWKDGSRMLLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNGFKTSTMR  239

Query  839   LGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSS  660
             LGADVIVFSRC G +GKSPTQSIGLLSYTFLRSTG EDIVVPMLDYE   +EW ++IRSS
Sbjct  240   LGADVIVFSRCPGKDGKSPTQSIGLLSYTFLRSTGKEDIVVPMLDYERKGQEWNKMIRSS  299

Query  659   VEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRD  480
               DWNRN+ETIV+WSPFSSEADLLRQFN M DHGTRIVIYNLWEDD+G LELDFD DP D
Sbjct  300   SGDWNRNVETIVQWSPFSSEADLLRQFNLMSDHGTRIVIYNLWEDDEGSLELDFDTDPHD  359

Query  479   IQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHN  300
             IQ+RGVNRD+K+IQMAK++PNSRHFLTYRHSLRSYASILYLR+PP FRIILRGKDVEHHN
Sbjct  360   IQLRGVNRDEKNIQMAKEFPNSRHFLTYRHSLRSYASILYLRLPPCFRIILRGKDVEHHN  419

Query  299   IVNDMMMTQEVTYRPQTGADGVPKDSN---MVAVVTIGFVKDAKAHIDVQGFNVYHKNRL  129
             IVNDMM++QE+TYRPQ+ ADGV KD N   M A+VTIGFVKDAK HIDVQGFNVYHKNRL
Sbjct  420   IVNDMMLSQEITYRPQS-ADGVAKDFNLNHMAAIVTIGFVKDAKHHIDVQGFNVYHKNRL  478

Query  128   IKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             IKPFWRLWN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  479   IKPFWRLWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  520



>ref|XP_009600106.1| PREDICTED: uncharacterized protein LOC104095646 [Nicotiana tomentosiformis]
Length=833

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/553 (72%), Positives = 436/553 (79%), Gaps = 23/553 (4%)
 Frame = -3

Query  1637  FRSFDSTLNSLASLPFLHLKIK*NLEGPSLI*TLFFHLMGNPKHRVKKEIFENHGSQPPS  1458
             F S +S+L +L S  F+               TLF   M NP   +K+E+ E    + P 
Sbjct  20    FTSLNSSLYTLLSSIFVF----------PFCFTLFSFCMANPNIVIKQEVVEGFMKKKPP  69

Query  1457  TATMPMS---VIdlsssdsdsdseDG-----RPRKKQKSAETSSVALPLGFLDplhepve  1302
               + P +    IDLSSSD      DG     RP+KK+KS E  +  LPLGF     +P+ 
Sbjct  70    AVSSPATQSVFIDLSSSDDSDSDSDGFVGSNRPKKKRKSVEDVNFPLPLGF----LDPLP  125

Query  1301  qplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPK  1122
              P   P P PA   +G  +      + SKQFWKAGD+EGA       SSGG+DHVRVHPK
Sbjct  126   PPKEPPLPLPAPPLNGSNIKELGSSSESKQFWKAGDYEGASSSTSGISSGGIDHVRVHPK  185

Query  1121  FLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDP  942
             FLHSNATSHKW LGAFAELLDN+LDEVINGATY NIDMVK++KDGSRML+IEDNGGGMDP
Sbjct  186   FLHSNATSHKWALGAFAELLDNALDEVINGATYANIDMVKNKKDGSRMLLIEDNGGGMDP  245

Query  941   DKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLL  762
             DK+R CMSLGYS KSK+ADTIGQYGNGFKTSTMRLGADVIVFSR  G  GKSPTQSIGLL
Sbjct  246   DKMRHCMSLGYSVKSKVADTIGQYGNGFKTSTMRLGADVIVFSRSGGKPGKSPTQSIGLL  305

Query  761   SYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQ  582
             SYTFLRSTGMEDIVVPMLDYE  E  W +IIRSS  DW++N+ETI+ WSPFSSEADL RQ
Sbjct  306   SYTFLRSTGMEDIVVPMLDYEKREG-WDKIIRSSTSDWDKNLETIIEWSPFSSEADLRRQ  364

Query  581   FNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFL  402
             FN MK  GTRI++YNLWEDDQGLLELDFDADP DIQIRGVNRD+KSIQMAKQYPNSRHFL
Sbjct  365   FNPMKGQGTRIIVYNLWEDDQGLLELDFDADPHDIQIRGVNRDEKSIQMAKQYPNSRHFL  424

Query  401   TYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDS  222
             TYRHSLRSYASILYLR+PP+FRIILRGKDVEHHNIVNDMMMTQE+TYRP  GADGVPKDS
Sbjct  425   TYRHSLRSYASILYLRIPPAFRIILRGKDVEHHNIVNDMMMTQEITYRPMPGADGVPKDS  484

Query  221   NMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEP  42
             NMVA V IGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLW+  GSDGRGVIGVLEANFVEP
Sbjct  485   NMVATVKIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWHAPGSDGRGVIGVLEANFVEP  544

Query  41    AHDKQGFERTTVL  3
             AHDKQGFERTTVL
Sbjct  545   AHDKQGFERTTVL  557



>ref|XP_011042927.1| PREDICTED: uncharacterized protein LOC105138522 isoform X2 [Populus 
euphratica]
Length=815

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/453 (78%), Positives = 387/453 (85%), Gaps = 1/453 (0%)
 Frame = -3

Query  1361  ETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGA  1182
             E   V LPLGFL     P                S  +    +   SSKQFWKAGD+EGA
Sbjct  82    EDLGVVLPLGFL-APITPPPDSETPSEAEIMAVESTESRRVSLTGQSSKQFWKAGDYEGA  140

Query  1181  PRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVK  1002
             PR +W SS GGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE  NGA +VNIDMV+
Sbjct  141   PRANWDSSFGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEFDNGARFVNIDMVE  200

Query  1001  SRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVI  822
             S+KD SRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMRLGADVI
Sbjct  201   SKKDQSRMLLIEDNGGGMDPDKLRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVI  260

Query  821   VFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNR  642
             VFSRC G +GK PTQSIGLLSYTFLR+TG EDIVVPMLDYE   +EW ++ RSS  DWNR
Sbjct  261   VFSRCQGKDGKFPTQSIGLLSYTFLRNTGKEDIVVPMLDYERKGREWSRMFRSSTGDWNR  320

Query  641   NIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGV  462
             N+ETIV WSPFSSEADLLRQF  M DHGTRI+IYNLWEDDQG+LELDFD+DP DIQ+RGV
Sbjct  321   NVETIVHWSPFSSEADLLRQFKLMSDHGTRIIIYNLWEDDQGMLELDFDSDPHDIQLRGV  380

Query  461   NRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMM  282
             NRD+K IQMAK++PNSRHFLTYRHSLR+Y SILYLR+PPSFRIILRGKDVEHHNIVNDMM
Sbjct  381   NRDEKHIQMAKEFPNSRHFLTYRHSLRNYTSILYLRLPPSFRIILRGKDVEHHNIVNDMM  440

Query  281   MTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWN  102
             ++QE+TYRPQ  AD VPKD+NM AVVTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN
Sbjct  441   LSQEITYRPQPSADSVPKDTNMTAVVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWN  500

Query  101   PAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
              AGSDGRGVIGVLEANF+EPAHDKQGFERTTVL
Sbjct  501   AAGSDGRGVIGVLEANFIEPAHDKQGFERTTVL  533



>ref|XP_011044094.1| PREDICTED: uncharacterized protein LOC105139379 isoform X2 [Populus 
euphratica]
Length=815

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/453 (78%), Positives = 387/453 (85%), Gaps = 1/453 (0%)
 Frame = -3

Query  1361  ETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGA  1182
             E   V LPLGFL     P                S  +    +   SSKQFWKAGD+EGA
Sbjct  82    EDLGVVLPLGFL-APITPPPDSETPSEAEIMAVESTESRRVSLTGQSSKQFWKAGDYEGA  140

Query  1181  PRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVK  1002
             PR +W SS GGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE  NGA +VNIDMV+
Sbjct  141   PRANWDSSFGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEFGNGARFVNIDMVE  200

Query  1001  SRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVI  822
             S+KD SRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMRLGADVI
Sbjct  201   SKKDQSRMLLIEDNGGGMDPDKLRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVI  260

Query  821   VFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNR  642
             VFSRC G +GK PTQSIGLLSYTFLR+TG EDIVVPMLDYE   +EW ++ RSS  DWNR
Sbjct  261   VFSRCQGKDGKFPTQSIGLLSYTFLRNTGKEDIVVPMLDYERKGREWSRMFRSSTGDWNR  320

Query  641   NIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGV  462
             N+ETIV WSPFSSEADLLRQF  M DHGTRI+IYNLWEDDQG+LELDFD+DP DIQ+RGV
Sbjct  321   NVETIVHWSPFSSEADLLRQFKLMSDHGTRIIIYNLWEDDQGMLELDFDSDPHDIQLRGV  380

Query  461   NRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMM  282
             NRD+K IQMAK++PNSRHFLTYRHSLR+Y SILYLR+PPSFRIILRGKDVEHHNIVNDMM
Sbjct  381   NRDEKHIQMAKEFPNSRHFLTYRHSLRNYTSILYLRLPPSFRIILRGKDVEHHNIVNDMM  440

Query  281   MTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWN  102
             ++QE+TYRPQ  AD VPKD+NM AVVTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN
Sbjct  441   LSQEITYRPQPSADSVPKDTNMTAVVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWN  500

Query  101   PAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
              AGSDGRGVIGVLEANF+EPAHDKQGFERTTVL
Sbjct  501   AAGSDGRGVIGVLEANFIEPAHDKQGFERTTVL  533



>ref|XP_004235273.1| PREDICTED: uncharacterized protein LOC101245442 [Solanum lycopersicum]
Length=834

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/520 (73%), Positives = 414/520 (80%), Gaps = 19/520 (4%)
 Frame = -3

Query  1523  MGNPKHRVKKEIFENHGSQPPSTAT-MPMSVI------------dlsssdsdsdseDGRP  1383
             M N    +K+EI E    +PP  ++  P SV               S S S S +   RP
Sbjct  1     MANSNIVIKQEILEGFTKKPPEKSSPAPQSVFIDLSSSDDSDSDSGSDSGSISGNGSNRP  60

Query  1382  RKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWK  1203
             +KK+K  +  + ALPLGF          P   PP       +G      +  +S KQFWK
Sbjct  61    KKKRKRVQDVNFALPLGF-----LDPLPPPKEPPLPLPAPPNGSNTDLGVSGSSCKQFWK  115

Query  1202  AGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATY  1023
             AGD+EG+     V  SGG+DHVRVHPKFLHSNATSHKWVLGA AELLDNSLDEV NGATY
Sbjct  116   AGDYEGSSSASSVLKSGGIDHVRVHPKFLHSNATSHKWVLGALAELLDNSLDEVSNGATY  175

Query  1022  VNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTM  843
             VNIDMVK++KDGSRML+IEDNGGGMDP+++R CMSLGYS KSK+ADTIGQYGNGFKTSTM
Sbjct  176   VNIDMVKNKKDGSRMLLIEDNGGGMDPERMRHCMSLGYSVKSKMADTIGQYGNGFKTSTM  235

Query  842   RLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRS  663
             RLGADVIVFSR  G  GKSPTQSIGLLSYTFLR+ GMEDIVVPMLDYE  E  W +IIRS
Sbjct  236   RLGADVIVFSRSDGKPGKSPTQSIGLLSYTFLRNKGMEDIVVPMLDYEKREG-WDRIIRS  294

Query  662   SVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPR  483
             S +DW++N+ETI+ WSPFSSEADLLRQFN MK  GTRIV+YNLWEDDQGLLELDFDADP 
Sbjct  295   SSDDWDKNLETIIEWSPFSSEADLLRQFNPMKGQGTRIVVYNLWEDDQGLLELDFDADPH  354

Query  482   DIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHH  303
             DIQIRGVNRD++SIQMAKQYPNSRHFLTYRHSLRSYASILYLRV P FRIILRGKDVEHH
Sbjct  355   DIQIRGVNRDERSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVAPGFRIILRGKDVEHH  414

Query  302   NIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIK  123
             NIVNDMMMTQEVTYRP  GADGVPKDSNMVA V IGFVKDAK+HIDVQGFNVYHKNRLIK
Sbjct  415   NIVNDMMMTQEVTYRPMPGADGVPKDSNMVATVKIGFVKDAKSHIDVQGFNVYHKNRLIK  474

Query  122   PFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             PFWRLW+  GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  475   PFWRLWHAPGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  514



>ref|XP_011023947.1| PREDICTED: MORC family CW-type zinc finger protein 4-like isoform 
X2 [Populus euphratica]
Length=838

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/449 (79%), Positives = 390/449 (87%), Gaps = 1/449 (0%)
 Frame = -3

Query  1349  VALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGAPRGD  1170
             V LPLGFL           L      A   S  ++   +   +SKQFWKAGD+EGAP  +
Sbjct  88    VVLPLGFL-APLPQPPSSELPTEAEMAVVESTESMMVSLTGQTSKQFWKAGDYEGAPHAN  146

Query  1169  WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKD  990
             W  SSGGMD VRVHPKFLHSNATSHKW LGAFAEL+DN+LDE  NGAT+VNIDMV+S+KD
Sbjct  147   WDLSSGGMDRVRVHPKFLHSNATSHKWALGAFAELMDNALDEFGNGATFVNIDMVESKKD  206

Query  989   GSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSR  810
              SRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMRLGADVIVFSR
Sbjct  207   RSRMLLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVIVFSR  266

Query  809   CSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIET  630
             C G +GKSPTQSIGLLSYTFLRSTG EDIVVPMLD++   +EW ++IR S  DWNRN+ET
Sbjct  267   CPGKDGKSPTQSIGLLSYTFLRSTGKEDIVVPMLDFQRKGREWSRMIRYSASDWNRNVET  326

Query  629   IVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDD  450
             I+ WSPFSSEADLLRQFN M DHGTRI+IYNLWEDDQGLLELDFD+DP DIQ+RGVNRD+
Sbjct  327   IICWSPFSSEADLLRQFNLMSDHGTRIIIYNLWEDDQGLLELDFDSDPHDIQLRGVNRDE  386

Query  449   KSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQE  270
             K I+MAK++PNSRHFLTYRHSLR+YASILYLR+P  FRIILRGKDVEHHNIVNDMM++QE
Sbjct  387   KHIKMAKEFPNSRHFLTYRHSLRNYASILYLRLPSCFRIILRGKDVEHHNIVNDMMLSQE  446

Query  269   VTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGS  90
             +TYRPQ GADGVPKD+NM AVVTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN AGS
Sbjct  447   ITYRPQPGADGVPKDTNMTAVVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNAAGS  506

Query  89    DGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             DGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  507   DGRGVIGVLEANFVEPAHDKQGFERTTVL  535



>ref|XP_011023946.1| PREDICTED: MORC family CW-type zinc finger protein 4-like isoform 
X1 [Populus euphratica]
Length=850

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/449 (79%), Positives = 390/449 (87%), Gaps = 1/449 (0%)
 Frame = -3

Query  1349  VALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGAPRGD  1170
             V LPLGFL           L      A   S  ++   +   +SKQFWKAGD+EGAP  +
Sbjct  88    VVLPLGFL-APLPQPPSSELPTEAEMAVVESTESMMVSLTGQTSKQFWKAGDYEGAPHAN  146

Query  1169  WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKD  990
             W  SSGGMD VRVHPKFLHSNATSHKW LGAFAEL+DN+LDE  NGAT+VNIDMV+S+KD
Sbjct  147   WDLSSGGMDRVRVHPKFLHSNATSHKWALGAFAELMDNALDEFGNGATFVNIDMVESKKD  206

Query  989   GSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSR  810
              SRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMRLGADVIVFSR
Sbjct  207   RSRMLLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVIVFSR  266

Query  809   CSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIET  630
             C G +GKSPTQSIGLLSYTFLRSTG EDIVVPMLD++   +EW ++IR S  DWNRN+ET
Sbjct  267   CPGKDGKSPTQSIGLLSYTFLRSTGKEDIVVPMLDFQRKGREWSRMIRYSASDWNRNVET  326

Query  629   IVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDD  450
             I+ WSPFSSEADLLRQFN M DHGTRI+IYNLWEDDQGLLELDFD+DP DIQ+RGVNRD+
Sbjct  327   IICWSPFSSEADLLRQFNLMSDHGTRIIIYNLWEDDQGLLELDFDSDPHDIQLRGVNRDE  386

Query  449   KSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQE  270
             K I+MAK++PNSRHFLTYRHSLR+YASILYLR+P  FRIILRGKDVEHHNIVNDMM++QE
Sbjct  387   KHIKMAKEFPNSRHFLTYRHSLRNYASILYLRLPSCFRIILRGKDVEHHNIVNDMMLSQE  446

Query  269   VTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGS  90
             +TYRPQ GADGVPKD+NM AVVTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN AGS
Sbjct  447   ITYRPQPGADGVPKDTNMTAVVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNAAGS  506

Query  89    DGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             DGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  507   DGRGVIGVLEANFVEPAHDKQGFERTTVL  535



>ref|XP_011042926.1| PREDICTED: uncharacterized protein LOC105138522 isoform X1 [Populus 
euphratica]
Length=816

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/454 (78%), Positives = 387/454 (85%), Gaps = 2/454 (0%)
 Frame = -3

Query  1361  ETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGA  1182
             E   V LPLGFL     P                S  +    +   SSKQFWKAGD+EGA
Sbjct  82    EDLGVVLPLGFL-APITPPPDSETPSEAEIMAVESTESRRVSLTGQSSKQFWKAGDYEGA  140

Query  1181  PRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVK  1002
             PR +W SS GGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE  NGA +VNIDMV+
Sbjct  141   PRANWDSSFGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEFDNGARFVNIDMVE  200

Query  1001  SRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVI  822
             S+KD SRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMRLGADVI
Sbjct  201   SKKDQSRMLLIEDNGGGMDPDKLRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVI  260

Query  821   VFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNR  642
             VFSRC G +GK PTQSIGLLSYTFLR+TG EDIVVPMLDYE   +EW ++ RSS  DWNR
Sbjct  261   VFSRCQGKDGKFPTQSIGLLSYTFLRNTGKEDIVVPMLDYERKGREWSRMFRSSTGDWNR  320

Query  641   NIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGV  462
             N+ETIV WSPFSSEADLLRQF  M DHGTRI+IYNLWEDDQG+LELDFD+DP DIQ+RGV
Sbjct  321   NVETIVHWSPFSSEADLLRQFKLMSDHGTRIIIYNLWEDDQGMLELDFDSDPHDIQLRGV  380

Query  461   NRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMM  282
             NRD+K IQMAK++PNSRHFLTYRHSLR+Y SILYLR+PPSFRIILRGKDVEHHNIVNDMM
Sbjct  381   NRDEKHIQMAKEFPNSRHFLTYRHSLRNYTSILYLRLPPSFRIILRGKDVEHHNIVNDMM  440

Query  281   MTQEVTYRPQTGADGVPKDSN-MVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLW  105
             ++QE+TYRPQ  AD VPKD+N M AVVTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLW
Sbjct  441   LSQEITYRPQPSADSVPKDTNQMTAVVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLW  500

Query  104   NPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             N AGSDGRGVIGVLEANF+EPAHDKQGFERTTVL
Sbjct  501   NAAGSDGRGVIGVLEANFIEPAHDKQGFERTTVL  534



>ref|XP_011044093.1| PREDICTED: uncharacterized protein LOC105139379 isoform X1 [Populus 
euphratica]
Length=816

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/454 (78%), Positives = 387/454 (85%), Gaps = 2/454 (0%)
 Frame = -3

Query  1361  ETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGA  1182
             E   V LPLGFL     P                S  +    +   SSKQFWKAGD+EGA
Sbjct  82    EDLGVVLPLGFL-APITPPPDSETPSEAEIMAVESTESRRVSLTGQSSKQFWKAGDYEGA  140

Query  1181  PRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVK  1002
             PR +W SS GGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE  NGA +VNIDMV+
Sbjct  141   PRANWDSSFGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEFGNGARFVNIDMVE  200

Query  1001  SRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVI  822
             S+KD SRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMRLGADVI
Sbjct  201   SKKDQSRMLLIEDNGGGMDPDKLRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVI  260

Query  821   VFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNR  642
             VFSRC G +GK PTQSIGLLSYTFLR+TG EDIVVPMLDYE   +EW ++ RSS  DWNR
Sbjct  261   VFSRCQGKDGKFPTQSIGLLSYTFLRNTGKEDIVVPMLDYERKGREWSRMFRSSTGDWNR  320

Query  641   NIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGV  462
             N+ETIV WSPFSSEADLLRQF  M DHGTRI+IYNLWEDDQG+LELDFD+DP DIQ+RGV
Sbjct  321   NVETIVHWSPFSSEADLLRQFKLMSDHGTRIIIYNLWEDDQGMLELDFDSDPHDIQLRGV  380

Query  461   NRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMM  282
             NRD+K IQMAK++PNSRHFLTYRHSLR+Y SILYLR+PPSFRIILRGKDVEHHNIVNDMM
Sbjct  381   NRDEKHIQMAKEFPNSRHFLTYRHSLRNYTSILYLRLPPSFRIILRGKDVEHHNIVNDMM  440

Query  281   MTQEVTYRPQTGADGVPKDSN-MVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLW  105
             ++QE+TYRPQ  AD VPKD+N M AVVTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLW
Sbjct  441   LSQEITYRPQPSADSVPKDTNQMTAVVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLW  500

Query  104   NPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             N AGSDGRGVIGVLEANF+EPAHDKQGFERTTVL
Sbjct  501   NAAGSDGRGVIGVLEANFIEPAHDKQGFERTTVL  534



>ref|XP_002318152.1| hypothetical protein POPTR_0012s10460g [Populus trichocarpa]
 gb|EEE96372.1| hypothetical protein POPTR_0012s10460g [Populus trichocarpa]
Length=862

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/454 (79%), Positives = 388/454 (85%), Gaps = 2/454 (0%)
 Frame = -3

Query  1361  ETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGA  1182
             E   V LPLGFL     P                S  +    +   SSKQFWKAGD+EGA
Sbjct  82    EDLGVVLPLGFL-APITPPPDSETPSEAEMMAVESTESRRVSLTGQSSKQFWKAGDYEGA  140

Query  1181  PRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVK  1002
             PR +W SS GGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE  NGA +VNIDMV+
Sbjct  141   PRANWDSSFGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEFGNGARFVNIDMVE  200

Query  1001  SRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVI  822
             S+KD SRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMRLGADVI
Sbjct  201   SKKDQSRMLLIEDNGGGMDPDKLRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVI  260

Query  821   VFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNR  642
             VFSRC G +GK PTQSIGLLSYTFLRSTG EDIVVPMLDYE   +EW ++ RSS  DWNR
Sbjct  261   VFSRCQGKDGKFPTQSIGLLSYTFLRSTGKEDIVVPMLDYERKGREWSRMGRSSTGDWNR  320

Query  641   NIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGV  462
             N+ETIV WSPFSSEADLLRQF  M DHGTRI+IYNLWEDDQG+LELDFD+DP DIQ+RGV
Sbjct  321   NVETIVHWSPFSSEADLLRQFKLMSDHGTRIIIYNLWEDDQGMLELDFDSDPHDIQLRGV  380

Query  461   NRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMM  282
             NRD+K IQMAK++PNSRHFLTYRHSLR+Y SILYLR+PPSFRIILRGKDVEHHNIVNDMM
Sbjct  381   NRDEKHIQMAKEFPNSRHFLTYRHSLRNYTSILYLRLPPSFRIILRGKDVEHHNIVNDMM  440

Query  281   MTQEVTYRPQTGADGVPKDSN-MVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLW  105
             ++QE+TYRPQ GAD VPKD+N M AVVTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLW
Sbjct  441   LSQEITYRPQPGADSVPKDTNQMTAVVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLW  500

Query  104   NPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             N AGSDGRGVIGVLEANF+EPAHDKQGFERTTVL
Sbjct  501   NAAGSDGRGVIGVLEANFIEPAHDKQGFERTTVL  534



>ref|XP_006436890.1| hypothetical protein CICLE_v10030712mg [Citrus clementina]
 gb|ESR50130.1| hypothetical protein CICLE_v10030712mg [Citrus clementina]
Length=826

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/463 (77%), Positives = 398/463 (86%), Gaps = 10/463 (2%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             GRP K++K  +   V LP+GFL+PL  P   P           ++G      +   S KQ
Sbjct  62    GRPNKRRKMPQDLEVVLPVGFLEPLPAPERLPG----------AAGNDKAVSVGLQSCKQ  111

Query  1211  FWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVING  1032
             FWKAGD+EGAP G W  S+GGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV NG
Sbjct  112   FWKAGDYEGAPSGGWEFSTGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEVCNG  171

Query  1031  ATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKT  852
             ATY NIDM+ +RKDGSRML+IEDNGGGM+PDK+R CMSLGYSAKSK A+TIGQYGNGFKT
Sbjct  172   ATYSNIDMLINRKDGSRMLLIEDNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKT  231

Query  851   STMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQI  672
             STMRLGADVIVFS C G +GKSPT+SIGLLSYTFLRS G EDIVVPMLDYE +++EW +I
Sbjct  232   STMRLGADVIVFSCCCGKDGKSPTRSIGLLSYTFLRSAGKEDIVVPMLDYEGSQQEWKKI  291

Query  671   IRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDA  492
             IRSS++DWNRN+ETIV+WSPFSSEADLL QFN MKDHGTRI+IYNLWEDDQGLLELDFD+
Sbjct  292   IRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDS  351

Query  491   DPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDV  312
             D  DIQ+RGVNRD+++I+MA+ YPNSRHFLTYRHSLRSYASILYLR+PP FRII+RGKDV
Sbjct  352   DKHDIQLRGVNRDEQNIKMAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDV  411

Query  311   EHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNR  132
             EHHNIVNDMM++++VTYRPQ GA G+P D +M   VTIGFVKDAK HIDVQGFNVYHKNR
Sbjct  412   EHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNR  471

Query  131   LIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             LIKPFWRLWN +GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  472   LIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  514



>gb|KHF99434.1| MORC family CW-type zinc finger protein 4 [Gossypium arboreum]
Length=827

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/405 (84%), Positives = 372/405 (92%), Gaps = 0/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EGAP   W  S+GGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV 
Sbjct  133   KQFWKAGDYEGAPSSAWELSTGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEVC  192

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGATYVN+D++KS+KDGS+ML+IEDNGGGMDPDK+RQCMSLGYS KSKIA+TIGQYGNGF
Sbjct  193   NGATYVNVDVLKSKKDGSQMLVIEDNGGGMDPDKMRQCMSLGYSVKSKIANTIGQYGNGF  252

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSRC G +GK PTQSIGLLSYTFL STG EDIVVPMLD+E  + EW 
Sbjct  253   KTSTMRLGADVIVFSRCCGKDGKRPTQSIGLLSYTFLTSTGKEDIVVPMLDFEWKQDEWS  312

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +I RS+V DW+RN ETIV+WSPFSSEADLLRQFN MKDHGTRI+IYNLWEDDQGLLELDF
Sbjct  313   KITRSTVSDWDRNAETIVQWSPFSSEADLLRQFNLMKDHGTRIIIYNLWEDDQGLLELDF  372

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
              AD  DIQ+RGVNRD+K+IQMAK++PNSRHFLTYRHSLRSYASILYLR+PP+FRIILRGK
Sbjct  373   HADQHDIQLRGVNRDEKNIQMAKEFPNSRHFLTYRHSLRSYASILYLRLPPNFRIILRGK  432

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHHNIVNDMM+T+ +TYRP   A+G PKD N+ A+VTIGFVKDAK HIDVQGFNVYHK
Sbjct  433   DVEHHNIVNDMMLTEMITYRPNPSAEGAPKDLNLAALVTIGFVKDAKYHIDVQGFNVYHK  492

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  493   NRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  537



>ref|XP_006347630.1| PREDICTED: uncharacterized protein LOC102598943 isoform X2 [Solanum 
tuberosum]
Length=977

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/462 (79%), Positives = 393/462 (85%), Gaps = 6/462 (1%)
 Frame = -3

Query  1388  RPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQF  1209
             RP+KK+KS +  + ALPLGFL         P   PP       +G      +  ++ KQF
Sbjct  62    RPKKKRKSVQDVNFALPLGFL-----DPLPPPKEPPLQLPAPPNGSNRDLSVSGSNCKQF  116

Query  1208  WKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGA  1029
             WKAGD+EG+P       SGG+DHVRVHPKFLHSNATSHKWVLGA AELLDNSLDEV NGA
Sbjct  117   WKAGDYEGSPSASSGLKSGGIDHVRVHPKFLHSNATSHKWVLGALAELLDNSLDEVSNGA  176

Query  1028  TYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTS  849
             TYVNIDMVK++KDGSRML+IEDNGGGMDP+++R CMSLGYS KSK+ADTIGQYGNGFKTS
Sbjct  177   TYVNIDMVKNKKDGSRMLLIEDNGGGMDPERMRHCMSLGYSVKSKMADTIGQYGNGFKTS  236

Query  848   TMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQII  669
             TMRLGADVIVFSR  G  GKSPTQSIGLLSYTFLR+ GMEDI+VPMLDYE  E  W +II
Sbjct  237   TMRLGADVIVFSRSGGKPGKSPTQSIGLLSYTFLRNKGMEDIIVPMLDYEKREG-WDKII  295

Query  668   RSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDAD  489
             RSS  DW++N+ETIV WSPFSSE DLLRQFN MK  GTRI++YNLWEDDQGLLELDFDAD
Sbjct  296   RSSPGDWDKNLETIVEWSPFSSEVDLLRQFNPMKGQGTRIIVYNLWEDDQGLLELDFDAD  355

Query  488   PRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVE  309
             P DIQIRGVNRD++SIQMAKQYPNSRHFLTYRHSLRSYASILYLRV P FRIILRGKDVE
Sbjct  356   PHDIQIRGVNRDERSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVAPGFRIILRGKDVE  415

Query  308   HHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRL  129
             HHNIVNDMMMTQEVTYRP  GADGVPKDSNMVA V IGFVKDAK+HIDVQGFNVYHKNRL
Sbjct  416   HHNIVNDMMMTQEVTYRPMPGADGVPKDSNMVATVKIGFVKDAKSHIDVQGFNVYHKNRL  475

Query  128   IKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             IKPFWRLW+  GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  476   IKPFWRLWHAPGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  517



>ref|XP_006493261.1| PREDICTED: uncharacterized protein LOC102608497 [Citrus sinensis]
Length=1112

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/463 (77%), Positives = 399/463 (86%), Gaps = 10/463 (2%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             GRP K++K  +   V LP+GFL+PL  P   P           ++G      +   S KQ
Sbjct  62    GRPNKRRKMPQDLEVVLPVGFLEPLPAPERLPG----------AAGNDKAVSVGLQSCKQ  111

Query  1211  FWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVING  1032
             FWKAGD+EGAP G W  S+GGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV NG
Sbjct  112   FWKAGDYEGAPSGGWEFSTGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEVCNG  171

Query  1031  ATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKT  852
             ATY NIDM+ +RKDGSRML+IEDNGGGM+PDK+R CMSLGYSAKSK A+TIGQYGNGFKT
Sbjct  172   ATYSNIDMLINRKDGSRMLLIEDNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKT  231

Query  851   STMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQI  672
             STMRLGADVIVFS C G +GKSPT+SIGLLSYTFLRSTG EDIVVPMLDYE +++EW +I
Sbjct  232   STMRLGADVIVFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKI  291

Query  671   IRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDA  492
             IRSS++DWNRN+ETIV+WSPFSSEADLL QFN MKDHGTRI+IYNLWEDDQGLLELDFD+
Sbjct  292   IRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDS  351

Query  491   DPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDV  312
             D  DIQ+RGVNRD+++I+MA+ YPNSRHFLTYRHSLRSYASILYLR+PP FRII+RGKDV
Sbjct  352   DKHDIQLRGVNRDEQNIKMAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDV  411

Query  311   EHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNR  132
             EHHNIVNDMM++++VTYRPQ GA G+P D +M   VTIGFVKDAK HIDVQGFNVYHKNR
Sbjct  412   EHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNR  471

Query  131   LIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             LIKPFWRLWN +GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  472   LIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  514


 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -3

Query  119  FWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             WRLWN +GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  762  MWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  800



>ref|XP_008239518.1| PREDICTED: uncharacterized protein LOC103338109 [Prunus mume]
Length=841

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/459 (77%), Positives = 399/459 (87%), Gaps = 5/459 (1%)
 Frame = -3

Query  1376  KQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVE-TSSKQFWKA  1200
             K++  +   V LP+GFL PL      P+L  P A       R   T +V   S KQFWKA
Sbjct  69    KKRKLDGMGVVLPVGFLSPLPPEGVAPMLPEPDAAVT----RVEKTVVVSGPSCKQFWKA  124

Query  1199  GDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYV  1020
             GD+EGAP G+W S++GGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV +GATYV
Sbjct  125   GDYEGAPCGNWESTAGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVCSGATYV  184

Query  1019  NIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMR  840
             N+DMV+++KD SRML+IEDNGGGMDPDK+R CMSLGYSAKSK+A+TIGQYGNGFKTSTMR
Sbjct  185   NLDMVENKKDQSRMLLIEDNGGGMDPDKMRHCMSLGYSAKSKVANTIGQYGNGFKTSTMR  244

Query  839   LGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSS  660
             LGADVIVFSRC+G +GKS TQSIGLLSYTFL+STG EDIVVPMLDYE  +  W +++RSS
Sbjct  245   LGADVIVFSRCNGKDGKSATQSIGLLSYTFLKSTGKEDIVVPMLDYERRQGAWSKMLRSS  304

Query  659   VEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRD  480
             + DWN+N ETIV+WSPFSSE DL  QF  MK+HGTRI+IYNLWEDD+G LELDFDADP D
Sbjct  305   LSDWNKNAETIVQWSPFSSEEDLHHQFYMMKNHGTRIIIYNLWEDDEGQLELDFDADPHD  364

Query  479   IQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHN  300
             IQIRGVNR +K+IQMAK++PNSR FLTYRHSLRSYASILYLR+P +FRIILRGKDVEHHN
Sbjct  365   IQIRGVNRAEKNIQMAKEFPNSRFFLTYRHSLRSYASILYLRLPHNFRIILRGKDVEHHN  424

Query  299   IVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKP  120
             IVNDMMM+Q+VTYRPQ GADG+PKDSNMVAVVT+GFVKDAK HIDVQGFNVYHKNRLIKP
Sbjct  425   IVNDMMMSQQVTYRPQPGADGIPKDSNMVAVVTVGFVKDAKHHIDVQGFNVYHKNRLIKP  484

Query  119   FWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FWRLWN AGSDGRGVIG+LEANFVEPAHDKQGFERTTVL
Sbjct  485   FWRLWNAAGSDGRGVIGLLEANFVEPAHDKQGFERTTVL  523



>ref|XP_007038064.1| MORC family CW-type zinc finger protein 4, putative isoform 3 
[Theobroma cacao]
 gb|EOY22565.1| MORC family CW-type zinc finger protein 4, putative isoform 3 
[Theobroma cacao]
Length=828

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/406 (83%), Positives = 371/406 (91%), Gaps = 0/406 (0%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              KQFWKAGD++G P  DW  SSGGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV
Sbjct  133   CKQFWKAGDYDGTPPADWDLSSGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEV  192

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              +GATYVNIDM+KS+KDG+ ML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNG
Sbjct  193   CSGATYVNIDMLKSKKDGNNMLLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNG  252

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSRC G +GK PTQSIGLLSYTFL STG EDIVVPMLDYE  ++EW
Sbjct  253   FKTSTMRLGADVIVFSRCCGKDGKHPTQSIGLLSYTFLTSTGKEDIVVPMLDYEWQQREW  312

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
              +IIRS+V DW+RN+ET+V+WSPFSS  DLLRQFN MKDHGTRI+IYNLWEDDQGL ELD
Sbjct  313   KKIIRSTVSDWDRNVETVVQWSPFSSATDLLRQFNLMKDHGTRIIIYNLWEDDQGLSELD  372

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             F ADP DIQ+RGVNRD+K+IQMAK+ PNSRHFLTYRHSLRSYASILYLR+ P+FRIILRG
Sbjct  373   FHADPHDIQLRGVNRDEKNIQMAKECPNSRHFLTYRHSLRSYASILYLRLHPNFRIILRG  432

Query  320   KDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             KDVEHHNIVNDMM+T+ VTYRP   A+G PKD N+ AVVTIGFVKDAK H+DVQGFNVYH
Sbjct  433   KDVEHHNIVNDMMLTEMVTYRPNPSAEGAPKDLNLAAVVTIGFVKDAKHHVDVQGFNVYH  492

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  493   KNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  538



>ref|XP_007038062.1| MORC family CW-type zinc finger protein 4, putative isoform 1 
[Theobroma cacao]
 gb|EOY22563.1| MORC family CW-type zinc finger protein 4, putative isoform 1 
[Theobroma cacao]
Length=827

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/406 (83%), Positives = 371/406 (91%), Gaps = 0/406 (0%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              KQFWKAGD++G P  DW  SSGGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV
Sbjct  133   CKQFWKAGDYDGTPPADWDLSSGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEV  192

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              +GATYVNIDM+KS+KDG+ ML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNG
Sbjct  193   CSGATYVNIDMLKSKKDGNNMLLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNG  252

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSRC G +GK PTQSIGLLSYTFL STG EDIVVPMLDYE  ++EW
Sbjct  253   FKTSTMRLGADVIVFSRCCGKDGKHPTQSIGLLSYTFLTSTGKEDIVVPMLDYEWQQREW  312

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
              +IIRS+V DW+RN+ET+V+WSPFSS  DLLRQFN MKDHGTRI+IYNLWEDDQGL ELD
Sbjct  313   KKIIRSTVSDWDRNVETVVQWSPFSSATDLLRQFNLMKDHGTRIIIYNLWEDDQGLSELD  372

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             F ADP DIQ+RGVNRD+K+IQMAK+ PNSRHFLTYRHSLRSYASILYLR+ P+FRIILRG
Sbjct  373   FHADPHDIQLRGVNRDEKNIQMAKECPNSRHFLTYRHSLRSYASILYLRLHPNFRIILRG  432

Query  320   KDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             KDVEHHNIVNDMM+T+ VTYRP   A+G PKD N+ AVVTIGFVKDAK H+DVQGFNVYH
Sbjct  433   KDVEHHNIVNDMMLTEMVTYRPNPSAEGAPKDLNLAAVVTIGFVKDAKHHVDVQGFNVYH  492

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  493   KNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  538



>ref|XP_007038063.1| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family 
protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22564.1| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family 
protein, putative isoform 2 [Theobroma cacao]
Length=708

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/406 (83%), Positives = 371/406 (91%), Gaps = 0/406 (0%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              KQFWKAGD++G P  DW  SSGGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV
Sbjct  133   CKQFWKAGDYDGTPPADWDLSSGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEV  192

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              +GATYVNIDM+KS+KDG+ ML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNG
Sbjct  193   CSGATYVNIDMLKSKKDGNNMLLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNG  252

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSRC G +GK PTQSIGLLSYTFL STG EDIVVPMLDYE  ++EW
Sbjct  253   FKTSTMRLGADVIVFSRCCGKDGKHPTQSIGLLSYTFLTSTGKEDIVVPMLDYEWQQREW  312

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
              +IIRS+V DW+RN+ET+V+WSPFSS  DLLRQFN MKDHGTRI+IYNLWEDDQGL ELD
Sbjct  313   KKIIRSTVSDWDRNVETVVQWSPFSSATDLLRQFNLMKDHGTRIIIYNLWEDDQGLSELD  372

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             F ADP DIQ+RGVNRD+K+IQMAK+ PNSRHFLTYRHSLRSYASILYLR+ P+FRIILRG
Sbjct  373   FHADPHDIQLRGVNRDEKNIQMAKECPNSRHFLTYRHSLRSYASILYLRLHPNFRIILRG  432

Query  320   KDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             KDVEHHNIVNDMM+T+ VTYRP   A+G PKD N+ AVVTIGFVKDAK H+DVQGFNVYH
Sbjct  433   KDVEHHNIVNDMMLTEMVTYRPNPSAEGAPKDLNLAAVVTIGFVKDAKHHVDVQGFNVYH  492

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  493   KNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  538



>ref|XP_007209067.1| hypothetical protein PRUPE_ppa025644mg [Prunus persica]
 gb|EMJ10266.1| hypothetical protein PRUPE_ppa025644mg [Prunus persica]
Length=790

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/406 (83%), Positives = 377/406 (93%), Gaps = 0/406 (0%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              KQFWKAGD+EGAP G+W S++GGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV
Sbjct  118   CKQFWKAGDYEGAPCGNWESTAGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEV  177

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              +GATYVN+DMV+++KD SRML+IEDNGGGMDPDK+R CMSLGYSAKSK+A+TIGQYGNG
Sbjct  178   CSGATYVNLDMVENKKDQSRMLLIEDNGGGMDPDKMRHCMSLGYSAKSKVANTIGQYGNG  237

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSRC+G +GKS TQSIGLLSYTFL+STG EDIVVPMLDYE  +  W
Sbjct  238   FKTSTMRLGADVIVFSRCNGKDGKSATQSIGLLSYTFLKSTGKEDIVVPMLDYERRQGAW  297

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
              +++RSS+ DWN+N+ETIV+WSPFS+E DL  QF  MK+HGTRI+IYNLWEDD+G LELD
Sbjct  298   SKMLRSSLSDWNKNVETIVQWSPFSNEEDLHHQFYMMKNHGTRIIIYNLWEDDEGQLELD  357

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             FDADP DIQIRGVNR +K+IQMAK++PNSR FLTYRHSLRSYASILYLR+P +FRIILRG
Sbjct  358   FDADPHDIQIRGVNRAEKNIQMAKEFPNSRFFLTYRHSLRSYASILYLRLPHNFRIILRG  417

Query  320   KDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             KDVEHHNIVNDMMM+Q+VTYRPQ GADG+PK+SNMVAVVTIGFVKDAK HIDVQGFNVYH
Sbjct  418   KDVEHHNIVNDMMMSQQVTYRPQPGADGIPKESNMVAVVTIGFVKDAKHHIDVQGFNVYH  477

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWRLWN AGSDGRGVIG+LEANFVEPAHDKQGFERTTVL
Sbjct  478   KNRLIKPFWRLWNAAGSDGRGVIGLLEANFVEPAHDKQGFERTTVL  523



>ref|XP_008464402.1| PREDICTED: uncharacterized protein LOC103502300 [Cucumis melo]
Length=821

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/462 (77%), Positives = 396/462 (86%), Gaps = 4/462 (1%)
 Frame = -3

Query  1376  KQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSS-KQFWKA  1200
             K++      V  PLGFL P     +  + +  P  AE  +G+ + T     S+ KQFWKA
Sbjct  73    KKRRLNELEVVKPLGFLPPASLDEKHSMAVILPPSAEAGNGQEMRTSNANGSACKQFWKA  132

Query  1199  GDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYV  1020
             GD+EGAP  +W SSSGGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV +GAT+V
Sbjct  133   GDYEGAPCSNWDSSSGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEVSSGATHV  192

Query  1019  NIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMR  840
             NIDM+ ++KD ++ML+IEDNGGGM PDK+R CMSLGYS K+K+ADTIGQYGNGFKTSTMR
Sbjct  193   NIDMLVNKKDRTKMLLIEDNGGGMSPDKMRHCMSLGYSEKTKLADTIGQYGNGFKTSTMR  252

Query  839   LGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSS  660
             LGADVIVFSRC G  GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE    EW +I+RSS
Sbjct  253   LGADVIVFSRCCGQYGKSGTQSIGLLSYTFLRSTGKEDIVVPMLDYERKGGEWVKIVRSS  312

Query  659   VEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRD  480
             + DWN+N+ET+ +WSPF++EA+LLRQF  MKDHGTRI+IYNLWEDDQG LELDFD DP D
Sbjct  313   LSDWNKNVETVAQWSPFANEAELLRQFYLMKDHGTRIIIYNLWEDDQGQLELDFDTDPHD  372

Query  479   IQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHN  300
             IQIRGVNRD+KSIQMAK++PNSRHFLTYRHSLRSYASILYLR+PP FRIILRG+DVEHHN
Sbjct  373   IQIRGVNRDEKSIQMAKKFPNSRHFLTYRHSLRSYASILYLRLPPGFRIILRGRDVEHHN  432

Query  299   IVNDMMMTQEVTYRPQTGADG---VPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRL  129
             IVNDMMM+QEVTYRPQ GADG   V KD+NMVAVVTIGFVKDAK HIDVQGFNVYHKNRL
Sbjct  433   IVNDMMMSQEVTYRPQPGADGAGTVGKDTNMVAVVTIGFVKDAKHHIDVQGFNVYHKNRL  492

Query  128   IKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             IKPFWRLWN +GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  493   IKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  534



>ref|XP_010678279.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Beta 
vulgaris subsp. vulgaris]
Length=856

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/462 (77%), Positives = 408/462 (88%), Gaps = 10/462 (2%)
 Frame = -3

Query  1385  PRKKQKSAE-TSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQF  1209
             P KKQK  E +SSV+LP GFLDP+    E PLL+PP + A  S+         ++  KQF
Sbjct  60    PAKKQKINEYSSSVSLPPGFLDPIPPLPESPLLVPPLSSASVST---------QSGCKQF  110

Query  1208  WKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGA  1029
             WKAGD+EGAP G W +++GGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV NGA
Sbjct  111   WKAGDYEGAPYGSWDNNTGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVCNGA  170

Query  1028  TYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTS  849
             T+VNIDM+ ++KDG +ML++EDNGGGMDPDK+RQCMSLGYS KSK+A+TIGQYGNGFKTS
Sbjct  171   TFVNIDMLVNKKDGCKMLLVEDNGGGMDPDKVRQCMSLGYSLKSKLANTIGQYGNGFKTS  230

Query  848   TMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQII  669
             TMRLGADVIVFSR  G +GKS TQSIGLLSYTFLRSTG EDIVVP+LDYE  E+EW +++
Sbjct  231   TMRLGADVIVFSRSCGKDGKSFTQSIGLLSYTFLRSTGKEDIVVPILDYEMKEREWHKMM  290

Query  668   RSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDAD  489
             RSS +DW RN++TI+ WSP+SSE +LL+QFN MKD GTRI+IYNLWEDDQGLLELDF +D
Sbjct  291   RSSADDWRRNVDTIINWSPYSSETELLQQFNLMKDRGTRIIIYNLWEDDQGLLELDFTSD  350

Query  488   PRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVE  309
               DIQIRGVNRD+KSI+MAK+YPNS+HFLTYRHSLRSYASILYLR+ P+FRIILRGKDVE
Sbjct  351   RHDIQIRGVNRDEKSIEMAKEYPNSKHFLTYRHSLRSYASILYLRLSPNFRIILRGKDVE  410

Query  308   HHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRL  129
             HHN+VNDMMM++EVTYRPQ GADGVP++++MVA+VTIGFVKDA AHIDVQGFNVYHKNRL
Sbjct  411   HHNVVNDMMMSEEVTYRPQPGADGVPRNADMVAIVTIGFVKDATAHIDVQGFNVYHKNRL  470

Query  128   IKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             IKPFWR+W+ AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  471   IKPFWRVWSAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  512



>gb|KCW49095.1| hypothetical protein EUGRSUZ_K02700 [Eucalyptus grandis]
Length=757

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/405 (83%), Positives = 372/405 (92%), Gaps = 1/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EG P G W S SGG+DHVRVHPKFLHSNATSHKW LGAFAELLDN++DEV 
Sbjct  102   KQFWKAGDYEGRPGGGWDSYSGGIDHVRVHPKFLHSNATSHKWALGAFAELLDNAMDEVS  161

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGATYV IDM+K+RKDGSRML+IEDNGGGMDPD++RQCMSLGYSAKSK+A+TIGQYGNGF
Sbjct  162   NGATYVKIDMLKNRKDGSRMLLIEDNGGGMDPDRLRQCMSLGYSAKSKMANTIGQYGNGF  221

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSRC G +GKS TQSIG+LSYTFLRSTG EDIVVPMLDYE  E  W 
Sbjct  222   KTSTMRLGADVIVFSRCRGKDGKSVTQSIGMLSYTFLRSTGKEDIVVPMLDYERREGSWN  281

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             Q+IRSS  DW RN+ETI++WSPFS+E DL +QF+ M D+GTRI+IYNLWEDDQG LELDF
Sbjct  282   QLIRSSFSDWKRNLETIIQWSPFSAEEDLFQQFSLMGDNGTRIIIYNLWEDDQGFLELDF  341

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             DADP D+Q+RGVNRD+K+IQMAK++PNSRHFLTYRHSLRSYASILYLR+PP FR+ILRGK
Sbjct  342   DADPYDMQLRGVNRDEKNIQMAKKFPNSRHFLTYRHSLRSYASILYLRIPPRFRMILRGK  401

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             D+EHHNIVNDMM++QEVTYRPQ GADGV KD+ M AVVTIGFVKDAK HIDVQGFNVYHK
Sbjct  402   DIEHHNIVNDMMLSQEVTYRPQPGADGVYKDT-MAAVVTIGFVKDAKHHIDVQGFNVYHK  460

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWRLWNPAGS GRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  461   NRLIKPFWRLWNPAGSCGRGVIGVLEANFVEPAHDKQGFERTTVL  505



>ref|XP_006584700.1| PREDICTED: uncharacterized protein LOC100816702 isoform X2 [Glycine 
max]
Length=758

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/469 (75%), Positives = 394/469 (84%), Gaps = 8/469 (2%)
 Frame = -3

Query  1385  PRKKQKSAETSSVALPLGFLDplhepveqplllpppap------aETSSGRA-VPTCIVE  1227
             P KK++++E   V LP+GFL PL                     A  S+ R         
Sbjct  62    PSKKRRTSEAGGVVLPVGFLTPLPPAPVPVPPPAAVLSLPAPEWASNSASRVNASKSFSL  121

Query  1226  TSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
              SSKQFWKAGD++GAP G   SS+ GMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLD
Sbjct  122   NSSKQFWKAGDYDGAPLGGSGSSTVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLD  181

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV NGATYVN+DM+ ++KDG+RML++EDNGGGMDP+K+RQCMSLGYS KSK+A+TIGQYG
Sbjct  182   EVCNGATYVNVDMLINKKDGTRMLLVEDNGGGMDPEKMRQCMSLGYSMKSKMANTIGQYG  241

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGADVIVFSR  G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE   +
Sbjct  242   NGFKTSTMRLGADVIVFSRYPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRGQ  301

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             EW +IIR+S++DWN+N+ETIV+WSPFS+EADLL QFN +KDHGTR++IYNLWEDDQG LE
Sbjct  302   EWNKIIRTSLDDWNKNVETIVQWSPFSNEADLLLQFNLVKDHGTRVIIYNLWEDDQGQLE  361

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQIRGVNRD+K+IQM+K++PNSRHFLTYRHSLRSY SILYLR+P  FRIIL
Sbjct  362   LDFDEDPHDIQIRGVNRDEKNIQMSKEFPNSRHFLTYRHSLRSYTSILYLRLPSGFRIIL  421

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADG-VPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             RGKD+ HHNIVNDMMM+QEVTYRPQ G DG +PKDSNMVAVVTIGFVKDA  H+DV GFN
Sbjct  422   RGKDILHHNIVNDMMMSQEVTYRPQAGVDGLLPKDSNMVAVVTIGFVKDAVHHVDVSGFN  481

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLIKPFWR+WNPAGS GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  482   VYHKNRLIKPFWRIWNPAGSGGRGVIGVLEANFVEPAHDKQGFERTLVL  530



>ref|XP_010037384.1| PREDICTED: uncharacterized protein LOC104426135 [Eucalyptus grandis]
Length=787

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/405 (83%), Positives = 372/405 (92%), Gaps = 1/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EG P G W S SGG+DHVRVHPKFLHSNATSHKW LGAFAELLDN++DEV 
Sbjct  102   KQFWKAGDYEGRPGGGWDSYSGGIDHVRVHPKFLHSNATSHKWALGAFAELLDNAMDEVS  161

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGATYV IDM+K+RKDGSRML+IEDNGGGMDPD++RQCMSLGYSAKSK+A+TIGQYGNGF
Sbjct  162   NGATYVKIDMLKNRKDGSRMLLIEDNGGGMDPDRLRQCMSLGYSAKSKMANTIGQYGNGF  221

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSRC G +GKS TQSIG+LSYTFLRSTG EDIVVPMLDYE  E  W 
Sbjct  222   KTSTMRLGADVIVFSRCRGKDGKSVTQSIGMLSYTFLRSTGKEDIVVPMLDYERREGSWN  281

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             Q+IRSS  DW RN+ETI++WSPFS+E DL +QF+ M D+GTRI+IYNLWEDDQG LELDF
Sbjct  282   QLIRSSFSDWKRNLETIIQWSPFSAEEDLFQQFSLMGDNGTRIIIYNLWEDDQGFLELDF  341

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             DADP D+Q+RGVNRD+K+IQMAK++PNSRHFLTYRHSLRSYASILYLR+PP FR+ILRGK
Sbjct  342   DADPYDMQLRGVNRDEKNIQMAKKFPNSRHFLTYRHSLRSYASILYLRIPPRFRMILRGK  401

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             D+EHHNIVNDMM++QEVTYRPQ GADGV KD+ M AVVTIGFVKDAK HIDVQGFNVYHK
Sbjct  402   DIEHHNIVNDMMLSQEVTYRPQPGADGVYKDT-MAAVVTIGFVKDAKHHIDVQGFNVYHK  460

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWRLWNPAGS GRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  461   NRLIKPFWRLWNPAGSCGRGVIGVLEANFVEPAHDKQGFERTTVL  505



>ref|XP_003532495.1| PREDICTED: uncharacterized protein LOC100816702 isoform X1 [Glycine 
max]
 gb|KHN16862.1| MORC family CW-type zinc finger protein 4 [Glycine soja]
Length=820

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/469 (75%), Positives = 394/469 (84%), Gaps = 8/469 (2%)
 Frame = -3

Query  1385  PRKKQKSAETSSVALPLGFLDplhepveqplllpppap------aETSSGRA-VPTCIVE  1227
             P KK++++E   V LP+GFL PL                     A  S+ R         
Sbjct  62    PSKKRRTSEAGGVVLPVGFLTPLPPAPVPVPPPAAVLSLPAPEWASNSASRVNASKSFSL  121

Query  1226  TSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
              SSKQFWKAGD++GAP G   SS+ GMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLD
Sbjct  122   NSSKQFWKAGDYDGAPLGGSGSSTVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLD  181

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV NGATYVN+DM+ ++KDG+RML++EDNGGGMDP+K+RQCMSLGYS KSK+A+TIGQYG
Sbjct  182   EVCNGATYVNVDMLINKKDGTRMLLVEDNGGGMDPEKMRQCMSLGYSMKSKMANTIGQYG  241

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGADVIVFSR  G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE   +
Sbjct  242   NGFKTSTMRLGADVIVFSRYPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRGQ  301

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             EW +IIR+S++DWN+N+ETIV+WSPFS+EADLL QFN +KDHGTR++IYNLWEDDQG LE
Sbjct  302   EWNKIIRTSLDDWNKNVETIVQWSPFSNEADLLLQFNLVKDHGTRVIIYNLWEDDQGQLE  361

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQIRGVNRD+K+IQM+K++PNSRHFLTYRHSLRSY SILYLR+P  FRIIL
Sbjct  362   LDFDEDPHDIQIRGVNRDEKNIQMSKEFPNSRHFLTYRHSLRSYTSILYLRLPSGFRIIL  421

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADG-VPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             RGKD+ HHNIVNDMMM+QEVTYRPQ G DG +PKDSNMVAVVTIGFVKDA  H+DV GFN
Sbjct  422   RGKDILHHNIVNDMMMSQEVTYRPQAGVDGLLPKDSNMVAVVTIGFVKDAVHHVDVSGFN  481

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLIKPFWR+WNPAGS GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  482   VYHKNRLIKPFWRIWNPAGSGGRGVIGVLEANFVEPAHDKQGFERTLVL  530



>ref|XP_010249112.1| PREDICTED: uncharacterized protein LOC104591787 [Nelumbo nucifera]
Length=807

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/463 (76%), Positives = 391/463 (84%), Gaps = 10/463 (2%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             G   KKQK  +   V LPLGFLDPL      PL  P              + +V  S KQ
Sbjct  63    GSSSKKQK-LDGMGVILPLGFLDPLPPEEALPLSEPVSKSQ---------SAVVVASCKQ  112

Query  1211  FWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVING  1032
             FWKAGD+EGA   D  SS GGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDE+ +G
Sbjct  113   FWKAGDYEGASGCDTASSFGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEICHG  172

Query  1031  ATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKT  852
             ATYV+IDM+K++KDGSRML++EDNGGGMDPDK+RQCMSLGYSAKSK A+TIGQYGNGFKT
Sbjct  173   ATYVSIDMLKNKKDGSRMLLVEDNGGGMDPDKMRQCMSLGYSAKSKSANTIGQYGNGFKT  232

Query  851   STMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQI  672
             STMRLGADVIVFSRC G +GKS TQS+G+LSYTFLRSTG EDIVVPMLDYEN  + W ++
Sbjct  233   STMRLGADVIVFSRCCGKDGKSSTQSVGMLSYTFLRSTGKEDIVVPMLDYENVGRNWNKM  292

Query  671   IRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDA  492
              R S  DWNRN+ETIV+WSP+SSEADLL QFN ++DHGTRI+IYNLWEDD G LELDFD 
Sbjct  293   TRLSPGDWNRNVETIVQWSPYSSEADLLHQFNSLEDHGTRIIIYNLWEDDHGELELDFDT  352

Query  491   DPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDV  312
             DP DIQIRGVNRD+K IQMAKQ+PNS+HFLTYR+SLRSYASILYLR+P  FRIILR KDV
Sbjct  353   DPHDIQIRGVNRDEKKIQMAKQFPNSKHFLTYRNSLRSYASILYLRLPHGFRIILREKDV  412

Query  311   EHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNR  132
             EHHN+V+DMM TQEVTYRPQ GADGV ++SNMVAVVTIGFVKDAK HIDVQGFNVYHKNR
Sbjct  413   EHHNLVDDMMFTQEVTYRPQPGADGVSRESNMVAVVTIGFVKDAKDHIDVQGFNVYHKNR  472

Query  131   LIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             LIKPFWR+WN AGSDGRG+IGVLEANFVEPAHDKQGFERT VL
Sbjct  473   LIKPFWRVWNAAGSDGRGIIGVLEANFVEPAHDKQGFERTIVL  515



>emb|CDY34330.1| BnaA01g14330D [Brassica napus]
Length=676

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 380/421 (90%), Gaps = 7/421 (2%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
              SSGR V +C      KQFWKAGD+EGAP G+W  SSGG DHVRVHPKFLHSNATSHKW 
Sbjct  93    ASSGR-VGSC------KQFWKAGDYEGAPGGNWDLSSGGFDHVRVHPKFLHSNATSHKWA  145

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
             LGAFAELLDN+LDEV +GATYVN+DM++++K+G+RML+IEDNGGGMDP+K+RQCMSLGYS
Sbjct  146   LGAFAELLDNALDEVASGATYVNVDMLENKKEGNRMLLIEDNGGGMDPEKMRQCMSLGYS  205

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
             AKSK+A+TIGQYGNGFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG ED
Sbjct  206   AKSKLANTIGQYGNGFKTSTMRLGADVIVFSRCLGKDGKSSTQSIGLLSYTFLRSTGKED  265

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPMLDYE  + EW +++RSS+ DW++N++TI++WSPFSSE DLLRQF  M +HGTRI+
Sbjct  266   IVVPMLDYERRDTEWSKVVRSSLSDWDKNVKTIIQWSPFSSEEDLLRQFALMNEHGTRII  325

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASI  366
             IYNLWEDDQG+LELDFDADP DIQ+RGVNRD+K+I+M  Q+PNSRHFLTY+HSLRSYASI
Sbjct  326   IYNLWEDDQGMLELDFDADPHDIQLRGVNRDEKNIKMGAQFPNSRHFLTYKHSLRSYASI  385

Query  365   LYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVK  186
             LYLR+PPSFRIILRG+DVEHHN+VNDMM T+++TYRPQ GAD   KDSNM AVV +GFVK
Sbjct  386   LYLRIPPSFRIILRGRDVEHHNVVNDMMQTEQITYRPQYGADSYVKDSNMSAVVVLGFVK  445

Query  185   DAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             DAK H+DVQGFNVYHKNRLIKPFWR+WN  GSDGRGVIGVLEANFVEPAHDKQGFERTTV
Sbjct  446   DAKHHVDVQGFNVYHKNRLIKPFWRIWNATGSDGRGVIGVLEANFVEPAHDKQGFERTTV  505

Query  5     L  3
             L
Sbjct  506   L  506



>emb|CDY03400.1| BnaC01g16820D [Brassica napus]
Length=673

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/459 (75%), Positives = 391/459 (85%), Gaps = 21/459 (5%)
 Frame = -3

Query  1379  KKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKA  1200
             KK+ +A+     LP GF               P    E SSGR V +C      KQFWKA
Sbjct  66    KKKPTADELKFVLPEGF--------------GPSITTEASSGR-VGSC------KQFWKA  104

Query  1199  GDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYV  1020
             GD+EGAP G+W  SSGG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV +GATYV
Sbjct  105   GDYEGAPGGNWDLSSGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVASGATYV  164

Query  1019  NIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMR  840
             N+DM++++K+G+RML+IEDNGGGM+P+K+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMR
Sbjct  165   NVDMLENKKEGNRMLLIEDNGGGMNPEKMRQCMSLGYSAKSKLANTIGQYGNGFKTSTMR  224

Query  839   LGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSS  660
             LGADVIVFSR  G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE  + EW +I+RSS
Sbjct  225   LGADVIVFSRSPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRDTEWSKIVRSS  284

Query  659   VEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRD  480
             + DW++N++TI++WSPFSSE DLLRQF  M DHGTRI+IYNLWEDDQG+LELDFDADP D
Sbjct  285   LSDWDKNVKTIIQWSPFSSEEDLLRQFALMNDHGTRIIIYNLWEDDQGMLELDFDADPHD  344

Query  479   IQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHN  300
             IQ+RGVNRD+K+I+MA Q+PNSRHFLTY+HSLRSYASILYLR+PPSFRIILRG DVEHHN
Sbjct  345   IQLRGVNRDEKNIKMAAQFPNSRHFLTYKHSLRSYASILYLRIPPSFRIILRGSDVEHHN  404

Query  299   IVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKP  120
             +VNDMM T+++TYRPQ GAD   KDSNM AVV +GFVKDAK H+DVQGFNVYHKNRLIKP
Sbjct  405   VVNDMMQTEQITYRPQYGADSYVKDSNMSAVVILGFVKDAKHHVDVQGFNVYHKNRLIKP  464

Query  119   FWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FWR+WN  GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  465   FWRIWNATGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  503



>ref|XP_010093927.1| hypothetical protein L484_008818 [Morus notabilis]
 gb|EXB54890.1| hypothetical protein L484_008818 [Morus notabilis]
Length=788

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/405 (83%), Positives = 369/405 (91%), Gaps = 0/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+ GAP GDW SSSGGMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  108   KQFWKAGDYLGAPCGDWDSSSGGMDHVRVHPKFLHSNATSHKWSLGAFAELLDNALDEVC  167

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
              GAT+VNIDM+ ++KDGS ML+IEDNGGGMDPDK+R CMSLGYS KSKIA+TIGQYGNGF
Sbjct  168   YGATFVNIDMIVNKKDGSNMLLIEDNGGGMDPDKMRHCMSLGYSVKSKIANTIGQYGNGF  227

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSRC G  GK PTQSIGLLSYTFLRSTG EDIVVPMLDYE+    W 
Sbjct  228   KTSTMRLGADVIVFSRCRGKEGKRPTQSIGLLSYTFLRSTGKEDIVVPMLDYESEGGRWR  287

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             ++IRSS+ DWN+N+ETI++WSPFS+EADLL QF+ M DHGTRI+IYNLWEDDQ   ELDF
Sbjct  288   KMIRSSLGDWNKNVETILQWSPFSTEADLLHQFSVMNDHGTRIIIYNLWEDDQRYSELDF  347

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
              AD  DIQIRGVNRD+K+IQMAK++PNSRHFLTYRHSLRSYASILYLR+PP FRIILRGK
Sbjct  348   GADQHDIQIRGVNRDEKNIQMAKKFPNSRHFLTYRHSLRSYASILYLRLPPGFRIILRGK  407

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHHNIVNDMM +++VTYRPQ GADG+PKD+NM+AVVTIGFVKDAK HIDVQGFNVYHK
Sbjct  408   DVEHHNIVNDMMYSEKVTYRPQHGADGIPKDTNMMAVVTIGFVKDAKHHIDVQGFNVYHK  467

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWRLWN AGSDGRGVIGVLEANFVEPAHDKQGFERTT L
Sbjct  468   NRLIKPFWRLWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTAL  512



>ref|XP_009137486.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Brassica 
rapa]
Length=696

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 380/421 (90%), Gaps = 7/421 (2%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             +SSGR V +C      KQFWKAGD+EGAP G+W  SSGG DHVRVHPKFLHSNATSHKW 
Sbjct  113   SSSGR-VGSC------KQFWKAGDYEGAPGGNWDLSSGGFDHVRVHPKFLHSNATSHKWA  165

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
             LGAFAELLDN+LDEV +GATYVN+DM++++K+G+RML+IEDNGGGMDP+K+RQCMSLGYS
Sbjct  166   LGAFAELLDNALDEVASGATYVNVDMLENKKEGNRMLLIEDNGGGMDPEKMRQCMSLGYS  225

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
             AKSK+A+TIGQYGNGFKTSTMRLGADVIVFSRC G NGKS TQSIGLLSYTFLRSTG ED
Sbjct  226   AKSKLANTIGQYGNGFKTSTMRLGADVIVFSRCPGKNGKSATQSIGLLSYTFLRSTGKED  285

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPMLDYE  + EW +I+RSS+ DW++N+ TI++WSPFSSE DLLRQF  MK+ GTRI+
Sbjct  286   IVVPMLDYEKRDTEWSKIVRSSLSDWDKNVRTIIQWSPFSSEEDLLRQFGLMKNCGTRII  345

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASI  366
             IYNLWEDD GLLELDFDADP DIQ+RGVNRD+K+I+MA Q+PNSRHFLT++HSLRSY SI
Sbjct  346   IYNLWEDDHGLLELDFDADPHDIQLRGVNRDEKNIKMAAQFPNSRHFLTFKHSLRSYVSI  405

Query  365   LYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVK  186
             LYLR+PP+FRIILRGKDVEHHN+VNDMM T+++TYRPQ GAD   KDSNM AVV +GFVK
Sbjct  406   LYLRIPPAFRIILRGKDVEHHNVVNDMMQTEQITYRPQYGADTYVKDSNMSAVVVLGFVK  465

Query  185   DAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             DAK H+DVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTV
Sbjct  466   DAKHHVDVQGFNVYHKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  525

Query  5     L  3
             L
Sbjct  526   L  526



>emb|CDY11045.1| BnaA03g47040D [Brassica napus]
Length=697

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 380/421 (90%), Gaps = 7/421 (2%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             +SSGR V +C      KQFWKAGD+EGAP G+W  SSGG DHVRVHPKFLHSNATSHKW 
Sbjct  114   SSSGR-VGSC------KQFWKAGDYEGAPGGNWDLSSGGFDHVRVHPKFLHSNATSHKWA  166

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
             LGAFAELLDN+LDEV +GATYVN+DM++++K+G+RML+IEDNGGGMDP+K+RQCMSLGYS
Sbjct  167   LGAFAELLDNALDEVASGATYVNVDMLENKKEGNRMLLIEDNGGGMDPEKMRQCMSLGYS  226

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
             AKSK+A+TIGQYGNGFKTSTMRLGADVIVFSRC G NGKS TQSIGLLSYTFLRSTG ED
Sbjct  227   AKSKLANTIGQYGNGFKTSTMRLGADVIVFSRCPGKNGKSSTQSIGLLSYTFLRSTGKED  286

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPMLDYE  + EW +I+RSS+ DW++N+ TI++WSPFSSE DLLRQF  MK+ GTRI+
Sbjct  287   IVVPMLDYEKRDTEWSKIVRSSLSDWDKNVRTIIQWSPFSSEEDLLRQFGLMKNCGTRII  346

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASI  366
             IYNLWEDD GLLELDFDADP DIQ+RGVNRD+K+I+MA Q+PNSRHFLT++HSLRSY SI
Sbjct  347   IYNLWEDDHGLLELDFDADPHDIQLRGVNRDEKNIKMAAQFPNSRHFLTFKHSLRSYVSI  406

Query  365   LYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVK  186
             LYLR+PP+FRIILRGKDVEHHN+VNDMM T+++TYRPQ GAD   KDSNM AVV +GFVK
Sbjct  407   LYLRIPPAFRIILRGKDVEHHNVVNDMMQTEQITYRPQYGADTYVKDSNMSAVVVLGFVK  466

Query  185   DAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             DAK H+DVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTV
Sbjct  467   DAKHHVDVQGFNVYHKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  526

Query  5     L  3
             L
Sbjct  527   L  527



>ref|XP_007160001.1| hypothetical protein PHAVU_002G2846000g, partial [Phaseolus vulgaris]
 gb|ESW31995.1| hypothetical protein PHAVU_002G2846000g, partial [Phaseolus vulgaris]
Length=535

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/469 (75%), Positives = 397/469 (85%), Gaps = 7/469 (1%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppa-----paETSSGRAVPTCIVE  1227
             GR  KK+K+++ + V LP GFL PL    E P             + ++SG         
Sbjct  65    GRSSKKRKTSD-AGVVLPAGFLSPLPPAPESPPEPLLALPAPEWASNSASGSNAYMRPGV  123

Query  1226  TSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
              SSKQFWKAGD++GAP G   SS+ GMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLD
Sbjct  124   NSSKQFWKAGDYDGAPSGGSASSTVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLD  183

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV NGATYVN+DM+ ++KDGSRML+IEDNGGGMDPDK+RQCMSLGYS KSK+A+TIGQYG
Sbjct  184   EVCNGATYVNVDMLINKKDGSRMLLIEDNGGGMDPDKMRQCMSLGYSVKSKLANTIGQYG  243

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGADVIVFSR    +G S +QSIGLLSYTFLRSTG EDIVVPMLDYE   +
Sbjct  244   NGFKTSTMRLGADVIVFSRYPEKDGTSSSQSIGLLSYTFLRSTGKEDIVVPMLDYERRGQ  303

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             +W +IIR+S++DWN+N+ET+V+WSPFS EADLLRQFN +KDHGTR++IYNLWEDDQG LE
Sbjct  304   KWDKIIRTSLDDWNKNVETMVQWSPFSDEADLLRQFNLVKDHGTRVIIYNLWEDDQGQLE  363

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFDADP DIQIRGVNRD+K+IQMAK++PNSRHFLTYRHSLRSYASILYLR+P  FRIIL
Sbjct  364   LDFDADPHDIQIRGVNRDEKNIQMAKEFPNSRHFLTYRHSLRSYASILYLRLPSGFRIIL  423

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADG-VPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             RG+D+ HHNIVNDMMM+QEVTYRPQ G DG +PKDS MVAVVTIGFVKDA  H+DV GFN
Sbjct  424   RGEDILHHNIVNDMMMSQEVTYRPQAGVDGLLPKDSYMVAVVTIGFVKDAVHHVDVSGFN  483

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLIKPFWR+WNPAGS GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  484   VYHKNRLIKPFWRIWNPAGSGGRGVIGVLEANFVEPAHDKQGFERTLVL  532



>ref|XP_010536598.1| PREDICTED: MORC family CW-type zinc finger protein 4 [Tarenaya 
hassleriana]
Length=818

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/405 (81%), Positives = 368/405 (91%), Gaps = 0/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             + FWKAGD+EGA  G W  SSG  DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  153   RSFWKAGDYEGASGGGWEQSSGSFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVA  212

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             +GATYVN+DM+++RKDGSRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGF
Sbjct  213   SGATYVNVDMIQNRKDGSRMLLIEDNGGGMDPDKMRQCMSLGYSAKSKLANTIGQYGNGF  272

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSRC G  GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE    EW 
Sbjct  273   KTSTMRLGADVIVFSRCPGKEGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRGPEWS  332

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +I+RS+  DW++N+ET+++WSPFSSE DLLRQFN MKD GTRI+IYNLWEDDQG+LELDF
Sbjct  333   KILRSTFSDWDKNVETMIQWSPFSSEEDLLRQFNLMKDRGTRIIIYNLWEDDQGMLELDF  392

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             DADP DIQ+RGVNRD+K I+MA ++PNS+HFLTY+HSLRSY SILYLR+PP FRIILRG+
Sbjct  393   DADPHDIQLRGVNRDEKHIRMASKFPNSKHFLTYKHSLRSYVSILYLRIPPGFRIILRGR  452

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHHNIVNDMM T+++TYRP + ADGV KDSNM AVVTIGFVKDAK H+DVQGFNVYHK
Sbjct  453   DVEHHNIVNDMMQTKQITYRPASDADGVAKDSNMSAVVTIGFVKDAKHHVDVQGFNVYHK  512

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  513   NRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  557



>ref|XP_009138709.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Brassica 
rapa]
Length=695

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 380/421 (90%), Gaps = 7/421 (2%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
              SSGR V +C      KQFWKAGD+EGAP G+W  SSGG DHVRVHPKFLHSNATSHKW 
Sbjct  112   ASSGR-VGSC------KQFWKAGDYEGAPGGNWDLSSGGFDHVRVHPKFLHSNATSHKWA  164

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
             LGAFAELLDN+LDEV +GATYVN+DM++++K+G+RML+IEDNGGGM+P+K+RQCMSLGYS
Sbjct  165   LGAFAELLDNALDEVASGATYVNVDMLENKKEGNRMLLIEDNGGGMNPEKMRQCMSLGYS  224

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
             AKSK+A+TIGQYGNGFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG ED
Sbjct  225   AKSKLANTIGQYGNGFKTSTMRLGADVIVFSRCLGKDGKSSTQSIGLLSYTFLRSTGKED  284

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPMLDYE  + EW +I+RSS+ DW++N++TI++WSPFSSE DLLRQF  M +HGTRI+
Sbjct  285   IVVPMLDYERRDTEWSKIVRSSLSDWDKNVKTIIQWSPFSSEDDLLRQFALMNEHGTRII  344

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASI  366
             IYNLWEDDQG+LELDFDADP DIQ+RGVNRD+K+I+M  Q+PNSRHFLTY+HSLRSYASI
Sbjct  345   IYNLWEDDQGMLELDFDADPHDIQLRGVNRDEKNIKMGAQFPNSRHFLTYKHSLRSYASI  404

Query  365   LYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVK  186
             LYLR+PPSFRIILRG+DVEHHN+VNDMM T+++TYRPQ GAD   KDSNM AVV +GFVK
Sbjct  405   LYLRIPPSFRIILRGRDVEHHNVVNDMMQTEQITYRPQYGADSYVKDSNMSAVVVLGFVK  464

Query  185   DAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             DAK H+DVQGFNVYHKNRLIKPFWR+WN  GSDGRGVIGVLEANFVEPAHDKQGFERTTV
Sbjct  465   DAKHHVDVQGFNVYHKNRLIKPFWRIWNATGSDGRGVIGVLEANFVEPAHDKQGFERTTV  524

Query  5     L  3
             L
Sbjct  525   L  525



>ref|XP_004138252.1| PREDICTED: uncharacterized protein LOC101222073 [Cucumis sativus]
Length=824

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/470 (76%), Positives = 399/470 (85%), Gaps = 8/470 (2%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSS-K  1215
             G P KK++  E   V  PLGFL P     +  + +  P  AE  + +   T     S+ K
Sbjct  69    GGPSKKRRLNELE-VVKPLGFLAPASLDEKHSMAVILPPSAEAGTVQETGTSKANGSACK  127

Query  1214  QFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVIN  1035
             QFWKAGD+EGAP  +W S+SGGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV +
Sbjct  128   QFWKAGDYEGAPCSNWESTSGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEVSS  187

Query  1034  GATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFK  855
             GAT+VNIDM+ ++KD ++ML+IEDNGGGM P+K+R CMSLGYS K+K+ADTIGQYGNGFK
Sbjct  188   GATHVNIDMLVNKKDRTKMLLIEDNGGGMSPEKMRHCMSLGYSEKTKLADTIGQYGNGFK  247

Query  854   TSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQ  675
             TSTMRLGADVIVFSRC G  GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE    EW +
Sbjct  248   TSTMRLGADVIVFSRCCGQYGKSGTQSIGLLSYTFLRSTGKEDIVVPMLDYERKGGEWVK  307

Query  674   IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFD  495
             I+RSS+ DWN+N++T+V+WSPF++EA+LLRQF  MKDHGTRI+IYNLWEDDQG LELDFD
Sbjct  308   IVRSSLNDWNKNVDTVVQWSPFANEAELLRQFYMMKDHGTRIIIYNLWEDDQGQLELDFD  367

Query  494   ADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKD  315
              DP DIQIRGVNRD+KSIQMAK++PNSRHFLTYRHSLRSYASILYLR+PP FRIILRG+D
Sbjct  368   TDPHDIQIRGVNRDEKSIQMAKKFPNSRHFLTYRHSLRSYASILYLRLPPCFRIILRGRD  427

Query  314   VEHHNIVNDMMMTQEVTYRPQTGADG---VPKDSN---MVAVVTIGFVKDAKAHIDVQGF  153
             VEHHNIVNDMM++QEVTYRPQ GADG   V KD+N   MVAVVTIGFVKDAK HIDVQGF
Sbjct  428   VEHHNIVNDMMISQEVTYRPQPGADGAGTVGKDTNVILMVAVVTIGFVKDAKHHIDVQGF  487

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLIKPFWRLWN +GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  488   NVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  537



>ref|XP_004161374.1| PREDICTED: uncharacterized LOC101222073 [Cucumis sativus]
Length=794

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/470 (76%), Positives = 399/470 (85%), Gaps = 8/470 (2%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSS-K  1215
             G P KK++  E   V  PLGFL P     +  + +  P  AE  + +   T     S+ K
Sbjct  69    GGPSKKRRLNELE-VVKPLGFLAPASLDEKHSMAVILPPSAEAGTVQETGTSKANGSACK  127

Query  1214  QFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVIN  1035
             QFWKAGD+EGAP  +W S+SGGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV +
Sbjct  128   QFWKAGDYEGAPCSNWESTSGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEVSS  187

Query  1034  GATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFK  855
             GAT+VNIDM+ ++KD ++ML+IEDNGGGM P+K+R CMSLGYS K+K+ADTIGQYGNGFK
Sbjct  188   GATHVNIDMLVNKKDRTKMLLIEDNGGGMSPEKMRHCMSLGYSEKTKLADTIGQYGNGFK  247

Query  854   TSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQ  675
             TSTMRLGADVIVFSRC G  GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE    EW +
Sbjct  248   TSTMRLGADVIVFSRCCGQYGKSGTQSIGLLSYTFLRSTGKEDIVVPMLDYERKGGEWVK  307

Query  674   IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFD  495
             I+RSS+ DWN+N++T+V+WSPF++EA+LLRQF  MKDHGTRI+IYNLWEDDQG LELDFD
Sbjct  308   IVRSSLNDWNKNVDTVVQWSPFANEAELLRQFYMMKDHGTRIIIYNLWEDDQGQLELDFD  367

Query  494   ADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKD  315
              DP DIQIRGVNRD+KSIQMAK++PNSRHFLTYRHSLRSYASILYLR+PP FRIILRG+D
Sbjct  368   TDPHDIQIRGVNRDEKSIQMAKKFPNSRHFLTYRHSLRSYASILYLRLPPCFRIILRGRD  427

Query  314   VEHHNIVNDMMMTQEVTYRPQTGADG---VPKDSN---MVAVVTIGFVKDAKAHIDVQGF  153
             VEHHNIVNDMM++QEVTYRPQ GADG   V KD+N   MVAVVTIGFVKDAK HIDVQGF
Sbjct  428   VEHHNIVNDMMISQEVTYRPQPGADGAGTVGKDTNVILMVAVVTIGFVKDAKHHIDVQGF  487

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLIKPFWRLWN +GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  488   NVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  537



>emb|CDX92664.1| BnaC07g39220D [Brassica napus]
Length=692

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/407 (81%), Positives = 374/407 (92%), Gaps = 0/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S KQFWKAGD+EGAP G+W  SSGG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE
Sbjct  116   SCKQFWKAGDYEGAPGGNWDLSSGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDE  175

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V  GATYVN+DM++++K+G+RML+IEDNGGGMDP+K+RQCMSLGYSAKSK+A+TIGQYGN
Sbjct  176   VATGATYVNVDMLENKKEGNRMLLIEDNGGGMDPEKMRQCMSLGYSAKSKLANTIGQYGN  235

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDY+ ++ E
Sbjct  236   GFKTSTMRLGADVIVFSRCPGKDGKSATQSIGLLSYTFLRSTGKEDIVVPMLDYKKSDPE  295

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +I+RSS+ DW++N++TI++WSPFSSE DLLRQF  MKD GTRI+IYNLWEDD GLLEL
Sbjct  296   WSKIVRSSLSDWDKNVKTIIQWSPFSSEEDLLRQFGLMKDRGTRIIIYNLWEDDHGLLEL  355

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFDADP DIQ+RGVNRD+K+I+MA Q+PNSRHFLT++HSLRSY SILYLR+PP+FRIILR
Sbjct  356   DFDADPHDIQLRGVNRDEKNIKMAAQFPNSRHFLTFKHSLRSYVSILYLRIPPAFRIILR  415

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GKDVEHHN+VNDMM T+++TYRPQ GAD   KDSNM AVV +GFVKDAK H+DVQGFNVY
Sbjct  416   GKDVEHHNVVNDMMQTEQITYRPQYGADTYVKDSNMSAVVVLGFVKDAKHHVDVQGFNVY  475

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  476   HKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  522



>ref|XP_006347629.1| PREDICTED: uncharacterized protein LOC102598943 isoform X1 [Solanum 
tuberosum]
Length=1001

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/486 (75%), Positives = 393/486 (81%), Gaps = 30/486 (6%)
 Frame = -3

Query  1388  RPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQF  1209
             RP+KK+KS +  + ALPLGFL         P   PP       +G      +  ++ KQF
Sbjct  62    RPKKKRKSVQDVNFALPLGFL-----DPLPPPKEPPLQLPAPPNGSNRDLSVSGSNCKQF  116

Query  1208  WKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGA  1029
             WKAGD+EG+P       SGG+DHVRVHPKFLHSNATSHKWVLGA AELLDNSLDEV NGA
Sbjct  117   WKAGDYEGSPSASSGLKSGGIDHVRVHPKFLHSNATSHKWVLGALAELLDNSLDEVSNGA  176

Query  1028  TYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTS  849
             TYVNIDMVK++KDGSRML+IEDNGGGMDP+++R CMSLGYS KSK+ADTIGQYGNGFKTS
Sbjct  177   TYVNIDMVKNKKDGSRMLLIEDNGGGMDPERMRHCMSLGYSVKSKMADTIGQYGNGFKTS  236

Query  848   TMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQII  669
             TMRLGADVIVFSR  G  GKSPTQSIGLLSYTFLR+ GMEDI+VPMLDYE  E  W +II
Sbjct  237   TMRLGADVIVFSRSGGKPGKSPTQSIGLLSYTFLRNKGMEDIIVPMLDYEKREG-WDKII  295

Query  668   RSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDAD  489
             RSS  DW++N+ETIV WSPFSSE DLLRQFN MK  GTRI++YNLWEDDQGLLELDFDAD
Sbjct  296   RSSPGDWDKNLETIVEWSPFSSEVDLLRQFNPMKGQGTRIIVYNLWEDDQGLLELDFDAD  355

Query  488   PRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSL------------------------R  381
             P DIQIRGVNRD++SIQMAKQYPNSRHFLTYRHSL                        R
Sbjct  356   PHDIQIRGVNRDERSIQMAKQYPNSRHFLTYRHSLRSSACCCCLLFIVHTTRNSLLFNVR  415

Query  380   SYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVT  201
             SYASILYLRV P FRIILRGKDVEHHNIVNDMMMTQEVTYRP  GADGVPKDSNMVA V 
Sbjct  416   SYASILYLRVAPGFRIILRGKDVEHHNIVNDMMMTQEVTYRPMPGADGVPKDSNMVATVK  475

Query  200   IGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGF  21
             IGFVKDAK+HIDVQGFNVYHKNRLIKPFWRLW+  GSDGRGVIGVLEANFVEPAHDKQGF
Sbjct  476   IGFVKDAKSHIDVQGFNVYHKNRLIKPFWRLWHAPGSDGRGVIGVLEANFVEPAHDKQGF  535

Query  20    ERTTVL  3
             ERTTVL
Sbjct  536   ERTTVL  541



>ref|XP_006580618.1| PREDICTED: uncharacterized protein LOC100786679 [Glycine max]
Length=826

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/470 (75%), Positives = 396/470 (84%), Gaps = 9/470 (2%)
 Frame = -3

Query  1385  PRKKQKSAETSSVALPLGFLDplhepveqplllppp--------apaETSSGRAVPTCIV  1230
             P KK++++E   V LP+GFL PL                     A   T+S       + 
Sbjct  67    PSKKRRTSEAGGVVLPVGFLTPLPPAPAPTPPPTAVLSLPAPEWASNSTASRANASKSLS  126

Query  1229  ETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSL  1050
               SSKQFWKAGD++GAP G   SS+ GMDHVRVHPKFLHSNATSHKW LGA AELLDNSL
Sbjct  127   LNSSKQFWKAGDYDGAPLGGSGSSTVGMDHVRVHPKFLHSNATSHKWALGALAELLDNSL  186

Query  1049  DEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQY  870
             DEV +GATYVN+DM+ ++KDG+RML+IEDNGGGMDP+K+RQCMSLGYS KSK+A+TIGQY
Sbjct  187   DEVCSGATYVNVDMLTNKKDGTRMLLIEDNGGGMDPEKMRQCMSLGYSVKSKMANTIGQY  246

Query  869   GNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNE  690
             GNGFKTSTMRLGADVIVFSR  G + KS +QSIGLLSYTFLRSTG EDIVVPMLDYE   
Sbjct  247   GNGFKTSTMRLGADVIVFSRYPGKDMKSSSQSIGLLSYTFLRSTGKEDIVVPMLDYERRG  306

Query  689   KEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLL  510
             +EW +IIR+S++DW++N+ETIV+WSPFS+EADLLRQFN +KDHGTR++IYNLWEDDQG L
Sbjct  307   QEWNKIIRTSLDDWDKNVETIVQWSPFSNEADLLRQFNLVKDHGTRVIIYNLWEDDQGQL  366

Query  509   ELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRII  330
             ELDFD DP DIQIRGVNRD+K+IQMAK++PNSRHFLTYRHSLRSYASILYLR+PP FRII
Sbjct  367   ELDFDEDPHDIQIRGVNRDEKNIQMAKEFPNSRHFLTYRHSLRSYASILYLRLPPGFRII  426

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADG-VPKDSNMVAVVTIGFVKDAKAHIDVQGF  153
             LRGKD+ HHNIVNDMMM+QEVTYRPQ G DG +PKDSNMVAVVTIGFVKDA  HIDV GF
Sbjct  427   LRGKDILHHNIVNDMMMSQEVTYRPQAGVDGLLPKDSNMVAVVTIGFVKDAVHHIDVSGF  486

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLIKPFWR+WNPAGS GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  487   NVYHKNRLIKPFWRIWNPAGSGGRGVIGVLEANFVEPAHDKQGFERTLVL  536



>ref|XP_010250611.1| PREDICTED: uncharacterized protein LOC104592813 isoform X1 [Nelumbo 
nucifera]
Length=794

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/463 (76%), Positives = 389/463 (84%), Gaps = 13/463 (3%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             G   KKQK      V LPLGFLDPL      P+      P             V +S KQ
Sbjct  61    GDSSKKQKF----DVVLPLGFLDPLPPEEPVPMRETVTPPQPQG---------VASSCKQ  107

Query  1211  FWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVING  1032
             FWKAGD+EGAP     SS  GMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDE+ +G
Sbjct  108   FWKAGDYEGAPGDCPTSSLSGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEICHG  167

Query  1031  ATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKT  852
             ATYVNIDM+K+ KDGSR+L++EDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKT
Sbjct  168   ATYVNIDMLKNEKDGSRVLLVEDNGGGMDPDKMRQCMSLGYSAKSKLANTIGQYGNGFKT  227

Query  851   STMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQI  672
             STMRLGADVIVFSRC G +GKSPTQSIG+LSYTFLRSTG EDIVVPM+DYE     W ++
Sbjct  228   STMRLGADVIVFSRCHGKDGKSPTQSIGMLSYTFLRSTGKEDIVVPMIDYEKVGSNWKKV  287

Query  671   IRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDA  492
             +RSS  DWN N++TIV+WSP+S E DLL+QFN +K+ GTRI+IYNLWEDDQG LELDFD 
Sbjct  288   LRSSPGDWNTNLDTIVQWSPYSDEDDLLQQFNYLKEQGTRILIYNLWEDDQGELELDFDT  347

Query  491   DPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDV  312
             DP DIQIRGVNRD+K IQMAKQ+PNSRHFLTYRHSLRSY+SILYLR+P  FRIILRGKDV
Sbjct  348   DPHDIQIRGVNRDEKKIQMAKQFPNSRHFLTYRHSLRSYSSILYLRLPHGFRIILRGKDV  407

Query  311   EHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNR  132
             EHHN+V DMM+T+++TYRPQ GA GVPK+SNMVAVVTIGFVKDAK HID+QGFNVYHKNR
Sbjct  408   EHHNLVKDMMLTEKITYRPQPGAYGVPKESNMVAVVTIGFVKDAKDHIDIQGFNVYHKNR  467

Query  131   LIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             LIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  468   LIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  510



>ref|XP_009375173.1| PREDICTED: uncharacterized protein LOC103964021 [Pyrus x bretschneideri]
Length=809

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/405 (82%), Positives = 370/405 (91%), Gaps = 0/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EGAP GDW SS+GG+DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  114   KQFWKAGDYEGAPCGDWDSSAGGIDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVC  173

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             +GATYVNIDM++++KD SRML+IEDNGGGMDPDK+R C+SLGYSAKSK+A+TIGQYGNGF
Sbjct  174   SGATYVNIDMLENKKDRSRMLLIEDNGGGMDPDKMRHCLSLGYSAKSKVANTIGQYGNGF  233

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSR SG +GKS TQSIGLLSYTFL STG EDIVVPMLDYE  +  W 
Sbjct  234   KTSTMRLGADVIVFSRSSGKDGKSATQSIGLLSYTFLTSTGKEDIVVPMLDYERGQGAWN  293

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +++RSS  DW++N+ETI++WSPF  E +LL QF  MK HGTRI+IYNLWEDD+G LELDF
Sbjct  294   KMLRSSSIDWDKNLETIIQWSPFFDEEELLHQFYMMKTHGTRIIIYNLWEDDEGQLELDF  353

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             +ADP DIQIRGVNRD+KSIQMAK +PNSR FLTY+HSLRSY SILYLR+P +FRIILRGK
Sbjct  354   EADPHDIQIRGVNRDEKSIQMAKDHPNSRFFLTYQHSLRSYVSILYLRIPHNFRIILRGK  413

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHHNIVNDMMM+Q+VTYRPQ GADGV KDSNMVAVVTIGFVKDAK HIDVQGFNVYHK
Sbjct  414   DVEHHNIVNDMMMSQQVTYRPQPGADGVTKDSNMVAVVTIGFVKDAKHHIDVQGFNVYHK  473

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWRLWN AGSDGRGVIG+LEANFVEPAHDKQGFERTTVL
Sbjct  474   NRLIKPFWRLWNAAGSDGRGVIGLLEANFVEPAHDKQGFERTTVL  518



>ref|XP_009344293.1| PREDICTED: uncharacterized protein LOC103936174 [Pyrus x bretschneideri]
Length=809

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/405 (82%), Positives = 370/405 (91%), Gaps = 0/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EGAP GDW SS+GG+DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  114   KQFWKAGDYEGAPCGDWDSSAGGIDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVC  173

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             +GATYVNIDM++++KD SRML+IEDNGGGMDPDK+R C+SLGYSAKSK+A+TIGQYGNGF
Sbjct  174   SGATYVNIDMLENKKDRSRMLLIEDNGGGMDPDKMRHCLSLGYSAKSKVANTIGQYGNGF  233

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSR SG +GKS TQSIGLLSYTFL STG EDIVVPMLDYE  +  W 
Sbjct  234   KTSTMRLGADVIVFSRSSGKDGKSATQSIGLLSYTFLTSTGKEDIVVPMLDYERGQGAWN  293

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +++RSS  DW++N+ETI++WSPF  E +LL QF  MK HGTRI+IYNLWEDD+G LELDF
Sbjct  294   KMLRSSSIDWDKNLETIIQWSPFFDEEELLHQFYMMKTHGTRIIIYNLWEDDEGQLELDF  353

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             +ADP DIQIRGVNRD+KSIQMAK +PNSR FLTY+HSLRSY SILYLR+P +FRIILRGK
Sbjct  354   EADPHDIQIRGVNRDEKSIQMAKDHPNSRFFLTYQHSLRSYVSILYLRIPHNFRIILRGK  413

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHHNIVNDMMM+Q+VTYRPQ GADGV KDSNMVAVVTIGFVKDAK HIDVQGFNVYHK
Sbjct  414   DVEHHNIVNDMMMSQQVTYRPQPGADGVTKDSNMVAVVTIGFVKDAKHHIDVQGFNVYHK  473

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWRLWN AGSDGRGVIG+LEANFVEPAHDKQGFERTTVL
Sbjct  474   NRLIKPFWRLWNAAGSDGRGVIGLLEANFVEPAHDKQGFERTTVL  518



>ref|XP_008374208.1| PREDICTED: uncharacterized protein LOC103437509 [Malus domestica]
Length=809

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/405 (82%), Positives = 369/405 (91%), Gaps = 0/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EG+P GDW SS+GG+DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  114   KQFWKAGDYEGSPCGDWDSSAGGIDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVC  173

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             +GATYVNIDM++++KD SRML+IEDNGGGM PDK+R CMSLGYSAKSK+A+TIGQYGNGF
Sbjct  174   SGATYVNIDMLENKKDRSRMLLIEDNGGGMGPDKMRHCMSLGYSAKSKVANTIGQYGNGF  233

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSR SG +GKS TQSIGLLSYTFL STG EDIVVPMLDYE  +  W 
Sbjct  234   KTSTMRLGADVIVFSRSSGKDGKSATQSIGLLSYTFLTSTGKEDIVVPMLDYERGQGAWN  293

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +++RSS  DW++N+ETI++WSPF  E DLL QF  MK HGTRI+IYNLWEDD+G LELDF
Sbjct  294   KMLRSSSIDWDKNLETIIQWSPFFDEEDLLHQFYMMKTHGTRIIIYNLWEDDEGQLELDF  353

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             +ADP DIQIRGVNRD+KSIQMAK +PNSR FLTY+HSLRSY SILYLR+P +FRIILRGK
Sbjct  354   EADPHDIQIRGVNRDEKSIQMAKDHPNSRFFLTYQHSLRSYVSILYLRIPHNFRIILRGK  413

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHHNIVNDMMM+Q+VTYRPQ GADGV KDSNMVAVVTIGFVKDAK HIDVQGFNVYHK
Sbjct  414   DVEHHNIVNDMMMSQQVTYRPQPGADGVTKDSNMVAVVTIGFVKDAKHHIDVQGFNVYHK  473

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWRLWN AGSDGRGVIG+LEANFVEPAHDKQGFERTTVL
Sbjct  474   NRLIKPFWRLWNAAGSDGRGVIGLLEANFVEPAHDKQGFERTTVL  518



>ref|XP_006413362.1| hypothetical protein EUTSA_v10024553mg [Eutrema salsugineum]
 gb|ESQ54815.1| hypothetical protein EUTSA_v10024553mg [Eutrema salsugineum]
Length=707

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/407 (80%), Positives = 367/407 (90%), Gaps = 0/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S KQFWKAGD+EG P G+W  SSGG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE
Sbjct  137   SCKQFWKAGDYEGPPGGNWDVSSGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDE  196

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V +GAT VN+DM++++K G RML+IEDNGGGMDP+K+RQCMSLGYSAKSK+ +TIGQYGN
Sbjct  197   VASGATQVNVDMLENKKAGDRMLLIEDNGGGMDPEKMRQCMSLGYSAKSKLVNTIGQYGN  256

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE  E E
Sbjct  257   GFKTSTMRLGADVIVFSRCPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRESE  316

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +++RS + DW++N++TI++WSPFSSE DLL QF QM D GTRI+IYNLWEDDQG+LEL
Sbjct  317   WSKLVRSCLSDWDKNVKTILQWSPFSSEEDLLSQFEQMNDRGTRIIIYNLWEDDQGMLEL  376

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFDADP DIQ+RGVNRD+K+I+MA Q+PNSRHFLT++HSLRSY SILYLR+PPSFRIILR
Sbjct  377   DFDADPEDIQLRGVNRDEKNIKMASQFPNSRHFLTFKHSLRSYVSILYLRIPPSFRIILR  436

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             G+DVEHHN+VNDMM T+++TYRPQ GAD   KD NM AVVTIGFVKDA  H+DVQGFNVY
Sbjct  437   GRDVEHHNVVNDMMQTEQITYRPQYGADTYVKDFNMAAVVTIGFVKDANHHVDVQGFNVY  496

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRGVIGVLEANF+EPAHDKQGFERTTVL
Sbjct  497   HKNRLIKPFWRIWNAAGSDGRGVIGVLEANFIEPAHDKQGFERTTVL  543



>gb|KFK26706.1| hypothetical protein AALP_AA8G282800 [Arabis alpina]
Length=789

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/405 (80%), Positives = 363/405 (90%), Gaps = 0/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EGA  GDW  S+GG DH RVHPKFLHSNATSHKW LGAFAELLDN+LDE+ 
Sbjct  125   KQFWKAGDYEGASGGDWEVSAGGFDHARVHPKFLHSNATSHKWALGAFAELLDNALDEIH  184

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             +GAT+VN+D+V +RKDG+RML+IEDNGGGM+PDK+R CMSLGYSAKSK+A+TIGQYGNGF
Sbjct  185   SGATHVNVDVVHNRKDGTRMLLIEDNGGGMNPDKMRHCMSLGYSAKSKLANTIGQYGNGF  244

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGAD IVFSRC G +GKS TQSIGLLSYTFL STG EDIVVPMLDYE +  EW 
Sbjct  245   KTSTMRLGADAIVFSRCRGKDGKSFTQSIGLLSYTFLTSTGKEDIVVPMLDYERSGSEWS  304

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
              I+RSS  DW +N+ET+V+WSPFSSE DLL QFN MKDHGTRI+IYNLWE++QG+LELDF
Sbjct  305   PIVRSSSSDWKKNVETVVQWSPFSSEDDLLCQFNLMKDHGTRIIIYNLWEEEQGMLELDF  364

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             D DP+DIQ+RG NRD+KSI MA Q+PNS+HFLTY+HSLRSY SILYLRVPP FRIILRG+
Sbjct  365   DTDPQDIQLRGANRDEKSINMATQFPNSKHFLTYKHSLRSYVSILYLRVPPEFRIILRGR  424

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHHNIVNDMM T+++TYRP+ G DG+ K S M A+VTIGFVKDAK HIDVQGFNVYHK
Sbjct  425   DVEHHNIVNDMMYTEQITYRPKDGVDGLSKSSTMSAIVTIGFVKDAKHHIDVQGFNVYHK  484

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWRLWN AGS+GRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  485   NRLIKPFWRLWNAAGSNGRGVIGVLEANFVEPAHDKQGFERTTVL  529



>ref|XP_009337546.1| PREDICTED: uncharacterized protein LOC103929994 [Pyrus x bretschneideri]
Length=808

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/411 (80%), Positives = 371/411 (90%), Gaps = 0/411 (0%)
 Frame = -3

Query  1235  IVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             +  ++ KQFWKAGD+EGAP  +W SS+GG+DHVRVHPKFLHSNATSHKW LGAFAELLDN
Sbjct  109   VSRSNCKQFWKAGDYEGAPCANWDSSAGGIDHVRVHPKFLHSNATSHKWALGAFAELLDN  168

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             +LDEV +GATYVN+DM++++KD SRML+IEDNGGGMDPDK+R CMSLGYSAKSK+A+TIG
Sbjct  169   ALDEVCSGATYVNVDMLENKKDRSRMLLIEDNGGGMDPDKMRHCMSLGYSAKSKLANTIG  228

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADVIVFSR SG +GKS TQSIGLLSYTFL STG EDIVVPMLDYE 
Sbjct  229   QYGNGFKTSTMRLGADVIVFSRSSGKDGKSATQSIGLLSYTFLTSTGKEDIVVPMLDYER  288

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
              +  W +++RSS  DW++N+ETIV+W+PF  E DL  QF  MK+HGTRI+IYNLWEDD+G
Sbjct  289   GQGTWSKMLRSSSSDWDKNLETIVQWAPFFDEEDLHHQFYMMKNHGTRIIIYNLWEDDEG  348

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDF+ADP DIQIRGVNRD+KSI+MAK YPNSR FLTY+HSLRSY SILYLR+P +FR
Sbjct  349   QLELDFEADPHDIQIRGVNRDEKSIRMAKDYPNSRFFLTYQHSLRSYVSILYLRLPHNFR  408

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             IILRGKDVEHHNIVNDMM++Q+VTYRPQ G DGVPK+ NMVAVVTIGFVKDAK HIDVQG
Sbjct  409   IILRGKDVEHHNIVNDMMLSQQVTYRPQPGLDGVPKELNMVAVVTIGFVKDAKHHIDVQG  468

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWRLWN AGSDGRGVIG+LEANFVEPAHDKQGFERTTVL
Sbjct  469   FNVYHKNRLIKPFWRLWNAAGSDGRGVIGLLEANFVEPAHDKQGFERTTVL  519



>ref|XP_002864076.1| hypothetical protein ARALYDRAFT_495140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40335.1| hypothetical protein ARALYDRAFT_495140 [Arabidopsis lyrata subsp. 
lyrata]
Length=804

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/407 (80%), Positives = 366/407 (90%), Gaps = 0/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S KQFWKAGD+EG   GDW  S+GG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE
Sbjct  126   SCKQFWKAGDYEGTSGGDWEVSAGGFDHVRVHPKFLHSNATSHKWSLGAFAELLDNALDE  185

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V  GAT+VN+DM++++KDGS+M++IED+GGGM+P+K+R CMSLGYSAKSK+ADTIGQYGN
Sbjct  186   VHTGATFVNVDMIENKKDGSKMVVIEDDGGGMNPEKMRHCMSLGYSAKSKLADTIGQYGN  245

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFL+STG EDIVVPMLDYE  + E
Sbjct  246   GFKTSTMRLGADVIVFSRCLGKDGKSSTQSIGLLSYTFLKSTGKEDIVVPMLDYERRDSE  305

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W  I RSSV DW +N+ETIV+WSPF +E DLLRQFN +K HGTRI+IYNLWEDDQG+LEL
Sbjct  306   WCPITRSSVSDWEKNVETIVQWSPFPTEEDLLRQFNLVKKHGTRIIIYNLWEDDQGMLEL  365

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD DP DIQ+RGVNRD+K+I MA Q+PNSRH+LTY+HSLRSYASILYL++P  FRIILR
Sbjct  366   DFDTDPHDIQLRGVNRDEKNIDMASQFPNSRHYLTYKHSLRSYASILYLKIPREFRIILR  425

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GKDVEHHNIVNDMM T+++TYRP+ GADG  K SN+ AVVTIGFVKDAK H+DVQGFNVY
Sbjct  426   GKDVEHHNIVNDMMQTEKITYRPKEGADGCAKYSNLSAVVTIGFVKDAKHHVDVQGFNVY  485

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  486   HKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  532



>ref|XP_010442337.1| PREDICTED: uncharacterized protein LOC104725361 isoform X2 [Camelina 
sativa]
Length=792

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/416 (78%), Positives = 372/416 (89%), Gaps = 0/416 (0%)
 Frame = -3

Query  1250  AVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFA  1071
             A P+     S KQFWKAGD+EG   GDW  S+GG DHVRVHPKFLHSNATSHKW LGAFA
Sbjct  107   AAPSPSPWGSCKQFWKAGDYEGTSGGDWEISAGGFDHVRVHPKFLHSNATSHKWSLGAFA  166

Query  1070  ELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKI  891
             ELLDN+LDEV  GATYVN+DM+++RKDGS+M++IED+GGGM+P+K+R CMSLGYSAKSK+
Sbjct  167   ELLDNALDEVQTGATYVNVDMIQNRKDGSKMVLIEDDGGGMNPEKMRHCMSLGYSAKSKL  226

Query  890   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPM  711
             ADTIGQYGNGFKTSTMRLGADVIVFSRCSG +GKS TQSIGLLSYTFL+STG EDIVVPM
Sbjct  227   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGKDGKSSTQSIGLLSYTFLKSTGKEDIVVPM  286

Query  710   LDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLW  531
             LDYE    EW  I+RSSV DW++N++T+V+WSPF++E DLLRQFN +K+HGTRI+IYNLW
Sbjct  287   LDYERRGSEWCPIMRSSVSDWDKNVDTVVQWSPFANEEDLLRQFNLVKNHGTRIIIYNLW  346

Query  530   EDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRV  351
             EDDQG+LELDFD DP DIQ+RGVNRD+K+I MA ++PNSRHFLTY+HSLRSYASILYL++
Sbjct  347   EDDQGMLELDFDTDPHDIQLRGVNRDEKNIDMASRFPNSRHFLTYKHSLRSYASILYLKI  406

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAH  171
                FRIILRGKDVE+HNIVNDMM T+++TYRP+ GADG  K SN+ AVVTIGFVKDAK H
Sbjct  407   THGFRIILRGKDVEYHNIVNDMMHTEKITYRPKEGADGCTKYSNLSAVVTIGFVKDAKHH  466

Query  170   IDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             +DVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  467   VDVQGFNVYHKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  522



>ref|XP_010442329.1| PREDICTED: uncharacterized protein LOC104725361 isoform X1 [Camelina 
sativa]
Length=795

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/416 (78%), Positives = 372/416 (89%), Gaps = 0/416 (0%)
 Frame = -3

Query  1250  AVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFA  1071
             A P+     S KQFWKAGD+EG   GDW  S+GG DHVRVHPKFLHSNATSHKW LGAFA
Sbjct  110   AAPSPSPWGSCKQFWKAGDYEGTSGGDWEISAGGFDHVRVHPKFLHSNATSHKWSLGAFA  169

Query  1070  ELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKI  891
             ELLDN+LDEV  GATYVN+DM+++RKDGS+M++IED+GGGM+P+K+R CMSLGYSAKSK+
Sbjct  170   ELLDNALDEVQTGATYVNVDMIQNRKDGSKMVLIEDDGGGMNPEKMRHCMSLGYSAKSKL  229

Query  890   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPM  711
             ADTIGQYGNGFKTSTMRLGADVIVFSRCSG +GKS TQSIGLLSYTFL+STG EDIVVPM
Sbjct  230   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGKDGKSSTQSIGLLSYTFLKSTGKEDIVVPM  289

Query  710   LDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLW  531
             LDYE    EW  I+RSSV DW++N++T+V+WSPF++E DLLRQFN +K+HGTRI+IYNLW
Sbjct  290   LDYERRGSEWCPIMRSSVSDWDKNVDTVVQWSPFANEEDLLRQFNLVKNHGTRIIIYNLW  349

Query  530   EDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRV  351
             EDDQG+LELDFD DP DIQ+RGVNRD+K+I MA ++PNSRHFLTY+HSLRSYASILYL++
Sbjct  350   EDDQGMLELDFDTDPHDIQLRGVNRDEKNIDMASRFPNSRHFLTYKHSLRSYASILYLKI  409

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAH  171
                FRIILRGKDVE+HNIVNDMM T+++TYRP+ GADG  K SN+ AVVTIGFVKDAK H
Sbjct  410   THGFRIILRGKDVEYHNIVNDMMHTEKITYRPKEGADGCTKYSNLSAVVTIGFVKDAKHH  469

Query  170   IDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             +DVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  470   VDVQGFNVYHKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  525



>ref|XP_002321726.2| hypothetical protein POPTR_0015s11300g [Populus trichocarpa]
 gb|EEF05853.2| hypothetical protein POPTR_0015s11300g [Populus trichocarpa]
Length=826

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/449 (76%), Positives = 375/449 (84%), Gaps = 12/449 (3%)
 Frame = -3

Query  1349  VALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGAPRGD  1170
             V LPLGFL                  A   S  +    ++  SSKQFWKAGD+EGAP  +
Sbjct  88    VVLPLGFL-APLPQPPSSEPPTEAEMAVVESTESTMVNLIGQSSKQFWKAGDYEGAPHAN  146

Query  1169  WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKD  990
             W  SSGGMD VRVHPKFLHSNATSHKW LGAFAEL+DN+LDE  NGAT+VNIDMV+S+KD
Sbjct  147   WDLSSGGMDRVRVHPKFLHSNATSHKWALGAFAELMDNALDEFGNGATFVNIDMVESKKD  206

Query  989   GSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSR  810
              SRML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTSTMRLGADVIVFSR
Sbjct  207   RSRMLLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVIVFSR  266

Query  809   CSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIET  630
             C G +GKSPTQSIGLLSYTFLRSTG EDIVVPMLD++   +EW ++IR S  DWNRN   
Sbjct  267   CPGKDGKSPTQSIGLLSYTFLRSTGKEDIVVPMLDFQRKGREWSRMIRYSASDWNRNFP-  325

Query  629   IVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDD  450
               R + F         FN M DHGTRI+IYNLWEDDQGLLELDFD+DP DIQ+RGVNRD+
Sbjct  326   -ARQTFF---------FNLMSDHGTRIIIYNLWEDDQGLLELDFDSDPHDIQLRGVNRDE  375

Query  449   KSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQE  270
             K I+MAK++PNSRHFLTYRHSLR+YASILYLR+P SFRIILRGKDVEHHNIVNDMM++QE
Sbjct  376   KHIKMAKEFPNSRHFLTYRHSLRNYASILYLRLPSSFRIILRGKDVEHHNIVNDMMLSQE  435

Query  269   VTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGS  90
             VTYRPQ GADGVPKD+NM AVVTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN AGS
Sbjct  436   VTYRPQPGADGVPKDTNMTAVVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNAAGS  495

Query  89    DGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             DGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  496   DGRGVIGVLEANFVEPAHDKQGFERTTVL  524



>ref|XP_004503774.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Cicer 
arietinum]
Length=823

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/470 (73%), Positives = 385/470 (82%), Gaps = 8/470 (2%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVET----  1224
             G P KK+K  E     LP+GFL PL              PA   +    P    ++    
Sbjct  67    GSPFKKRKVNEKGGF-LPIGFLSPLPPQQPSSSDAVLYLPAPEWASNTTPNRFNKSVNFT  125

Query  1223  --SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSL  1050
                 KQFWKAGD++G P   + +S+ GMDHVRVHPKFLHSNATSHKW LGAFAELLDN+L
Sbjct  126   LQGCKQFWKAGDYDGPPARAFETSTVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNAL  185

Query  1049  DEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQY  870
             DEV NGATYVN+DM+ S+KDGSRML++EDNGGGMDPDKIRQCMSLGYS KSKIA+TIGQY
Sbjct  186   DEVCNGATYVNVDMLVSKKDGSRMLLVEDNGGGMDPDKIRQCMSLGYSVKSKIANTIGQY  245

Query  869   GNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNE  690
             GNGFKTSTMRLGADVIVFSRC G +GK  TQSIGLLSYTFLR+T  EDIVVPMLDYE + 
Sbjct  246   GNGFKTSTMRLGADVIVFSRCQGKDGKRSTQSIGLLSYTFLRNTRKEDIVVPMLDYERDG  305

Query  689   KEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLL  510
             + W +++R+S++DWN N+ETIV+WSPFS EADL RQFN +KD GTR++IYNLWEDDQG L
Sbjct  306   QGWNKMLRTSLDDWNNNVETIVQWSPFSDEADLRRQFNLLKDQGTRVIIYNLWEDDQGQL  365

Query  509   ELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRII  330
             ELDFD DP DIQIRGVNRD+K I+MAK +PNS HFLTYRHSLRSYASILYLR P  FRII
Sbjct  366   ELDFDEDPNDIQIRGVNRDEKHIKMAKDFPNSTHFLTYRHSLRSYASILYLRFPRGFRII  425

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTG-ADGVPKDSNMVAVVTIGFVKDAKAHIDVQGF  153
             LRGKDV HHNIVNDMMM+QEVTYRPQ+G ADG+ KDSNMVA+VTIGFVKDA  HIDV GF
Sbjct  426   LRGKDVLHHNIVNDMMMSQEVTYRPQSGVADGILKDSNMVAIVTIGFVKDAVHHIDVSGF  485

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLIKPFWR+WNPAGS GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  486   NVYHKNRLIKPFWRIWNPAGSGGRGVIGVLEANFVEPAHDKQGFERTLVL  535



>gb|KEH20991.1| histidine kinase-, DNA gyrase B, putative [Medicago truncatula]
Length=802

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/406 (80%), Positives = 366/406 (90%), Gaps = 1/406 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+ G+P   + SS+ GMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  124   KQFWKAGDYGGSPARAFESSTVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVC  183

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGATYVN+DM+ S+KDGSRML++EDNGGGMDPDKIRQCMSLGYS KSK+A+TIGQYGNGF
Sbjct  184   NGATYVNVDMLASKKDGSRMLLVEDNGGGMDPDKIRQCMSLGYSEKSKMANTIGQYGNGF  243

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFS C G +GK PT+SIGLLSYTFLR+TG EDIVVPMLDYE + + W 
Sbjct  244   KTSTMRLGADVIVFSCCQGKDGKRPTRSIGLLSYTFLRNTGKEDIVVPMLDYEKDGQGWK  303

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +++R+S++DWN N+ET+V+WSPFS EADLL QFN +K+ GTR++IYNLWEDDQG LEL+F
Sbjct  304   KMLRTSLDDWNNNVETVVQWSPFSDEADLLCQFNLLKNQGTRVIIYNLWEDDQGQLELNF  363

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             D DP DIQI+GVNRD+K+I+MA+ YPNS HFLTYRHSLRSYASILYLR+P  FRIILRGK
Sbjct  364   DEDPHDIQIQGVNRDEKNIKMAQDYPNSTHFLTYRHSLRSYASILYLRIPQGFRIILRGK  423

Query  317   DVEHHNIVNDMMMTQEVTYRPQTG-ADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             DV HHNIVNDMM +QEVTYRPQ+G ADG+ KDSNMVA VTIGFVKDAK HIDV GFNVYH
Sbjct  424   DVLHHNIVNDMMYSQEVTYRPQSGVADGLLKDSNMVATVTIGFVKDAKHHIDVSGFNVYH  483

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WNPAGS GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  484   KNRLIKPFWRIWNPAGSGGRGVIGVLEANFVEPAHDKQGFERTLVL  529



>gb|KEH20993.1| histidine kinase-, DNA gyrase B, putative [Medicago truncatula]
Length=798

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/406 (80%), Positives = 366/406 (90%), Gaps = 1/406 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+ G+P   + SS+ GMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  124   KQFWKAGDYGGSPARAFESSTVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVC  183

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGATYVN+DM+ S+KDGSRML++EDNGGGMDPDKIRQCMSLGYS KSK+A+TIGQYGNGF
Sbjct  184   NGATYVNVDMLASKKDGSRMLLVEDNGGGMDPDKIRQCMSLGYSEKSKMANTIGQYGNGF  243

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFS C G +GK PT+SIGLLSYTFLR+TG EDIVVPMLDYE + + W 
Sbjct  244   KTSTMRLGADVIVFSCCQGKDGKRPTRSIGLLSYTFLRNTGKEDIVVPMLDYEKDGQGWK  303

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +++R+S++DWN N+ET+V+WSPFS EADLL QFN +K+ GTR++IYNLWEDDQG LEL+F
Sbjct  304   KMLRTSLDDWNNNVETVVQWSPFSDEADLLCQFNLLKNQGTRVIIYNLWEDDQGQLELNF  363

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             D DP DIQI+GVNRD+K+I+MA+ YPNS HFLTYRHSLRSYASILYLR+P  FRIILRGK
Sbjct  364   DEDPHDIQIQGVNRDEKNIKMAQDYPNSTHFLTYRHSLRSYASILYLRIPQGFRIILRGK  423

Query  317   DVEHHNIVNDMMMTQEVTYRPQTG-ADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             DV HHNIVNDMM +QEVTYRPQ+G ADG+ KDSNMVA VTIGFVKDAK HIDV GFNVYH
Sbjct  424   DVLHHNIVNDMMYSQEVTYRPQSGVADGLLKDSNMVATVTIGFVKDAKHHIDVSGFNVYH  483

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WNPAGS GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  484   KNRLIKPFWRIWNPAGSGGRGVIGVLEANFVEPAHDKQGFERTLVL  529



>ref|XP_010442558.1| PREDICTED: uncharacterized protein LOC104725579 [Camelina sativa]
Length=798

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/416 (77%), Positives = 371/416 (89%), Gaps = 0/416 (0%)
 Frame = -3

Query  1250  AVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFA  1071
             A P+     S KQFWKAGD+EG   GDW  S+GG DHVRVHPKFLHSNATSHKW LGAFA
Sbjct  112   AAPSSSPWGSCKQFWKAGDYEGTSGGDWEISAGGFDHVRVHPKFLHSNATSHKWSLGAFA  171

Query  1070  ELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKI  891
             ELLDN+LDEV  GAT+VN+DM+++RKDGS+M++IED+GGGM+P+K+R CMSLGYSAKSK+
Sbjct  172   ELLDNALDEVQTGATFVNVDMIQNRKDGSKMVLIEDDGGGMNPEKMRHCMSLGYSAKSKL  231

Query  890   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPM  711
             ADTIGQYGNGFKTSTMRLGADVIVF+RCSG +G S TQSIGLLSYTFL+STG EDIVVPM
Sbjct  232   ADTIGQYGNGFKTSTMRLGADVIVFTRCSGKDGNSSTQSIGLLSYTFLKSTGKEDIVVPM  291

Query  710   LDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLW  531
             LDYE    EW  I+RSSV DW++N++T+V+WSPF++E DLLRQFN +K+HGTRI+IYNLW
Sbjct  292   LDYERRGSEWCPIMRSSVSDWDKNVDTVVQWSPFATEEDLLRQFNLVKNHGTRIIIYNLW  351

Query  530   EDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRV  351
             EDDQG+LELDFD DP DIQ+RGVNRD+K+I MA ++PNSRHFLTY+HSLRSYASILYL++
Sbjct  352   EDDQGMLELDFDTDPHDIQLRGVNRDEKNIDMASRFPNSRHFLTYKHSLRSYASILYLKI  411

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAH  171
                FRIILRGKDVE+HNIVNDMM T+++TYRP+ GADG  K SN+ AVVTIGFVKDAK H
Sbjct  412   ANGFRIILRGKDVEYHNIVNDMMHTEKITYRPKEGADGCAKYSNLSAVVTIGFVKDAKHH  471

Query  170   IDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             +DVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  472   VDVQGFNVYHKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  527



>gb|KEH20990.1| histidine kinase-, DNA gyrase B, putative [Medicago truncatula]
Length=804

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/406 (80%), Positives = 366/406 (90%), Gaps = 1/406 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+ G+P   + SS+ GMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  124   KQFWKAGDYGGSPARAFESSTVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVC  183

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGATYVN+DM+ S+KDGSRML++EDNGGGMDPDKIRQCMSLGYS KSK+A+TIGQYGNGF
Sbjct  184   NGATYVNVDMLASKKDGSRMLLVEDNGGGMDPDKIRQCMSLGYSEKSKMANTIGQYGNGF  243

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFS C G +GK PT+SIGLLSYTFLR+TG EDIVVPMLDYE + + W 
Sbjct  244   KTSTMRLGADVIVFSCCQGKDGKRPTRSIGLLSYTFLRNTGKEDIVVPMLDYEKDGQGWK  303

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +++R+S++DWN N+ET+V+WSPFS EADLL QFN +K+ GTR++IYNLWEDDQG LEL+F
Sbjct  304   KMLRTSLDDWNNNVETVVQWSPFSDEADLLCQFNLLKNQGTRVIIYNLWEDDQGQLELNF  363

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             D DP DIQI+GVNRD+K+I+MA+ YPNS HFLTYRHSLRSYASILYLR+P  FRIILRGK
Sbjct  364   DEDPHDIQIQGVNRDEKNIKMAQDYPNSTHFLTYRHSLRSYASILYLRIPQGFRIILRGK  423

Query  317   DVEHHNIVNDMMMTQEVTYRPQTG-ADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             DV HHNIVNDMM +QEVTYRPQ+G ADG+ KDSNMVA VTIGFVKDAK HIDV GFNVYH
Sbjct  424   DVLHHNIVNDMMYSQEVTYRPQSGVADGLLKDSNMVATVTIGFVKDAKHHIDVSGFNVYH  483

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WNPAGS GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  484   KNRLIKPFWRIWNPAGSGGRGVIGVLEANFVEPAHDKQGFERTLVL  529



>ref|XP_010482379.1| PREDICTED: uncharacterized protein LOC104761060 isoform X2 [Camelina 
sativa]
Length=800

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/416 (77%), Positives = 370/416 (89%), Gaps = 0/416 (0%)
 Frame = -3

Query  1250  AVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFA  1071
             A P+     S KQFWKAGD+EG   GDW  S+GG DHVRVHPKFLHSNATSHKW LGAFA
Sbjct  114   AAPSPSAWGSCKQFWKAGDYEGTSGGDWEVSAGGFDHVRVHPKFLHSNATSHKWSLGAFA  173

Query  1070  ELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKI  891
             ELLDN+LDEV  GAT+VN+DM+++RKDGS+M++IED+GGGM+P+K+R CMSLGYSAKSK+
Sbjct  174   ELLDNALDEVQTGATFVNVDMIQNRKDGSKMVLIEDDGGGMNPEKMRHCMSLGYSAKSKL  233

Query  890   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPM  711
             ADTIGQYGNGFKTSTMRLGADVIVFSRCSG +G S TQSIGLLSYTFL+STG EDIVVPM
Sbjct  234   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGKDGNSSTQSIGLLSYTFLKSTGKEDIVVPM  293

Query  710   LDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLW  531
             LDYE    EW  I+RSSV DW++N++T+V+WSPF++E DLLRQFN +K+HGTRI+IYNLW
Sbjct  294   LDYERRGSEWCPIMRSSVSDWDKNVDTVVQWSPFATEEDLLRQFNLVKNHGTRIIIYNLW  353

Query  530   EDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRV  351
             EDDQG+LELDFD DP DIQ+RGVNRD+K+I MA ++PNSRHFLTY+HSLRSYASILYL++
Sbjct  354   EDDQGMLELDFDTDPHDIQLRGVNRDEKNIDMASRFPNSRHFLTYKHSLRSYASILYLKI  413

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAH  171
                FRIILRGKDVE+HNIVNDMM T+++TYRP+ GADG  K SN+ AVVTIGFVKDA  H
Sbjct  414   ANGFRIILRGKDVEYHNIVNDMMHTEKITYRPKEGADGCAKYSNLSAVVTIGFVKDAIHH  473

Query  170   IDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             +DVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  474   VDVQGFNVYHKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  529



>gb|KEH20992.1| histidine kinase-, DNA gyrase B, putative [Medicago truncatula]
Length=827

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/406 (80%), Positives = 366/406 (90%), Gaps = 1/406 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+ G+P   + SS+ GMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  124   KQFWKAGDYGGSPARAFESSTVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVC  183

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGATYVN+DM+ S+KDGSRML++EDNGGGMDPDKIRQCMSLGYS KSK+A+TIGQYGNGF
Sbjct  184   NGATYVNVDMLASKKDGSRMLLVEDNGGGMDPDKIRQCMSLGYSEKSKMANTIGQYGNGF  243

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFS C G +GK PT+SIGLLSYTFLR+TG EDIVVPMLDYE + + W 
Sbjct  244   KTSTMRLGADVIVFSCCQGKDGKRPTRSIGLLSYTFLRNTGKEDIVVPMLDYEKDGQGWK  303

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +++R+S++DWN N+ET+V+WSPFS EADLL QFN +K+ GTR++IYNLWEDDQG LEL+F
Sbjct  304   KMLRTSLDDWNNNVETVVQWSPFSDEADLLCQFNLLKNQGTRVIIYNLWEDDQGQLELNF  363

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             D DP DIQI+GVNRD+K+I+MA+ YPNS HFLTYRHSLRSYASILYLR+P  FRIILRGK
Sbjct  364   DEDPHDIQIQGVNRDEKNIKMAQDYPNSTHFLTYRHSLRSYASILYLRIPQGFRIILRGK  423

Query  317   DVEHHNIVNDMMMTQEVTYRPQTG-ADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             DV HHNIVNDMM +QEVTYRPQ+G ADG+ KDSNMVA VTIGFVKDAK HIDV GFNVYH
Sbjct  424   DVLHHNIVNDMMYSQEVTYRPQSGVADGLLKDSNMVATVTIGFVKDAKHHIDVSGFNVYH  483

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WNPAGS GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  484   KNRLIKPFWRIWNPAGSGGRGVIGVLEANFVEPAHDKQGFERTLVL  529



>emb|CDX84876.1| BnaA03g13540D [Brassica napus]
Length=758

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/422 (77%), Positives = 366/422 (87%), Gaps = 5/422 (1%)
 Frame = -3

Query  1253  RAVPTCIVETSS-----KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKW  1089
             +A P  +V  SS     KQFWKAGD+EG   G W  S+GG DHVRVHPKFLHSNATSHKW
Sbjct  80    QATPCNVVRPSSSAASCKQFWKAGDYEGTSGGHWEVSAGGFDHVRVHPKFLHSNATSHKW  139

Query  1088  VLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGY  909
              LGAFAELLDN+LDEV +GATYVN++M+ ++KDGSRML+IEDNGGGM+P+K+R CMSLGY
Sbjct  140   ALGAFAELLDNALDEVHSGATYVNVNMLTNKKDGSRMLLIEDNGGGMNPEKMRHCMSLGY  199

Query  908   SAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGME  729
             SAKSK+A+TIGQYGNGFKTSTMRLGADVIVFSRC G +G S TQ+IGLLSYTFL+STG E
Sbjct  200   SAKSKLANTIGQYGNGFKTSTMRLGADVIVFSRCPGKDGDSFTQTIGLLSYTFLKSTGKE  259

Query  728   DIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRI  549
             DIVVPMLDYE    EW  I+RSS  DWN+N++TIV+WSPFS+E +LL QFN MK+HGTRI
Sbjct  260   DIVVPMLDYEREGSEWSPIVRSSASDWNKNVDTIVQWSPFSTEDELLCQFNLMKEHGTRI  319

Query  548   VIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYAS  369
             +IYNLWEDDQGLLELDFD DP DIQ+RGVNRD+KSI MA QYPNSRHFLTYRHSLRSY S
Sbjct  320   IIYNLWEDDQGLLELDFDTDPHDIQLRGVNRDEKSISMAAQYPNSRHFLTYRHSLRSYVS  379

Query  368   ILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFV  189
             ILYLRVPP FRIILRG+DVEHHNIVNDMM T ++TYRP+ G  G    SNM AVVTIGFV
Sbjct  380   ILYLRVPPEFRIILRGRDVEHHNIVNDMMHTNQITYRPKEGPGGQSNFSNMSAVVTIGFV  439

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTT  9
             KDAK H+DVQGFNVYHKNRLIKPFWR+WN AGS GRG+IGVLEA+FVEPAHDKQGFERTT
Sbjct  440   KDAKHHVDVQGFNVYHKNRLIKPFWRIWNAAGSQGRGIIGVLEADFVEPAHDKQGFERTT  499

Query  8     VL  3
             VL
Sbjct  500   VL  501



>ref|XP_010482378.1| PREDICTED: uncharacterized protein LOC104761060 isoform X1 [Camelina 
sativa]
Length=803

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/416 (77%), Positives = 370/416 (89%), Gaps = 0/416 (0%)
 Frame = -3

Query  1250  AVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFA  1071
             A P+     S KQFWKAGD+EG   GDW  S+GG DHVRVHPKFLHSNATSHKW LGAFA
Sbjct  117   AAPSPSAWGSCKQFWKAGDYEGTSGGDWEVSAGGFDHVRVHPKFLHSNATSHKWSLGAFA  176

Query  1070  ELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKI  891
             ELLDN+LDEV  GAT+VN+DM+++RKDGS+M++IED+GGGM+P+K+R CMSLGYSAKSK+
Sbjct  177   ELLDNALDEVQTGATFVNVDMIQNRKDGSKMVLIEDDGGGMNPEKMRHCMSLGYSAKSKL  236

Query  890   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPM  711
             ADTIGQYGNGFKTSTMRLGADVIVFSRCSG +G S TQSIGLLSYTFL+STG EDIVVPM
Sbjct  237   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGKDGNSSTQSIGLLSYTFLKSTGKEDIVVPM  296

Query  710   LDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLW  531
             LDYE    EW  I+RSSV DW++N++T+V+WSPF++E DLLRQFN +K+HGTRI+IYNLW
Sbjct  297   LDYERRGSEWCPIMRSSVSDWDKNVDTVVQWSPFATEEDLLRQFNLVKNHGTRIIIYNLW  356

Query  530   EDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRV  351
             EDDQG+LELDFD DP DIQ+RGVNRD+K+I MA ++PNSRHFLTY+HSLRSYASILYL++
Sbjct  357   EDDQGMLELDFDTDPHDIQLRGVNRDEKNIDMASRFPNSRHFLTYKHSLRSYASILYLKI  416

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAH  171
                FRIILRGKDVE+HNIVNDMM T+++TYRP+ GADG  K SN+ AVVTIGFVKDA  H
Sbjct  417   ANGFRIILRGKDVEYHNIVNDMMHTEKITYRPKEGADGCAKYSNLSAVVTIGFVKDAIHH  476

Query  170   IDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             +DVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  477   VDVQGFNVYHKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  532



>ref|XP_002869696.1| hypothetical protein ARALYDRAFT_492340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45955.1| hypothetical protein ARALYDRAFT_492340 [Arabidopsis lyrata subsp. 
lyrata]
Length=709

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/405 (80%), Positives = 368/405 (91%), Gaps = 2/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EGAP  +W  SSGG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  136   KQFWKAGDYEGAPGANWDLSSGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVA  195

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             +GATYV +DM++++K G+RML+IEDNGGGMDP+K+RQCMSLGYSAKSK+A+TIGQYGNGF
Sbjct  196   SGATYVKVDMLENKKAGNRMLLIEDNGGGMDPEKMRQCMSLGYSAKSKLANTIGQYGNGF  255

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE  E EW 
Sbjct  256   KTSTMRLGADVIVFSRCPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERREPEWS  315

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +IIRSS+ DW++N+ETI++WSPFSSE DLL QF+ MKD GTRI+IYNLWEDDQG+LELDF
Sbjct  316   KIIRSSLSDWDKNVETIIQWSPFSSEEDLLHQFDLMKDRGTRIIIYNLWEDDQGMLELDF  375

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             DADP DIQ+RGVNR++K+I+MA Q+PNSRHFLTY+HSLRSY SILYLR+PP FRIILRGK
Sbjct  376   DADPYDIQLRGVNREEKNIKMASQFPNSRHFLTYKHSLRSYVSILYLRIPPGFRIILRGK  435

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHH++VNDMM T+++TYRPQ+ + GV   +NM A+V IGFVKDAK H+DVQGFNVYHK
Sbjct  436   DVEHHSVVNDMMQTEQITYRPQSESYGVV--TNMSAIVIIGFVKDAKHHVDVQGFNVYHK  493

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWR+WN  GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  494   NRLIKPFWRIWNATGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  538



>ref|XP_010438948.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Camelina 
sativa]
Length=720

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/407 (80%), Positives = 367/407 (90%), Gaps = 2/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S KQFWKAGD+EGAP   W  SSGG DH+RVHPKFLHSNATSHKW LGAFAELLDN+LDE
Sbjct  148   SCKQFWKAGDYEGAPGATWDLSSGGFDHIRVHPKFLHSNATSHKWALGAFAELLDNALDE  207

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V +GATYVN+DM+++ K GSRML+IEDNGGGMDP+K+RQCMSLGYSAKSKIA+TIGQYGN
Sbjct  208   VASGATYVNVDMLENNKAGSRMLLIEDNGGGMDPEKMRQCMSLGYSAKSKIANTIGQYGN  267

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE  + E
Sbjct  268   GFKTSTMRLGADVIVFSRCPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRDSE  327

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +IIRSS+ DW +N+ETIV+WSPFSSE DLL QF+ MKD GTRIVIYN+WEDDQG+LEL
Sbjct  328   WSKIIRSSLSDWVKNVETIVQWSPFSSEEDLLHQFDLMKDRGTRIVIYNMWEDDQGMLEL  387

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFDADP DIQ+RGVNR++K+I+MA Q+PNSRHFLTY+HSLRSY SILYLR+PP FRIILR
Sbjct  388   DFDADPLDIQLRGVNREEKNIKMASQFPNSRHFLTYKHSLRSYVSILYLRIPPGFRIILR  447

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GKDVEHH++VNDMM T+++TYRPQ+ + GV  D  M A+V IGFVKDAK H+DVQGFNVY
Sbjct  448   GKDVEHHSVVNDMMQTEQITYRPQSESYGVLTD--MSAIVMIGFVKDAKHHVDVQGFNVY  505

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  506   HKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  552



>ref|XP_004298543.1| PREDICTED: uncharacterized protein LOC101292116 [Fragaria vesca 
subsp. vesca]
Length=822

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/407 (80%), Positives = 363/407 (89%), Gaps = 1/407 (0%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              KQFWKAG+FE  P GD  SS+GGMDHVR+HPKFLHSNATSHKW LGAFAELLDN+LDEV
Sbjct  100   CKQFWKAGEFEAVPCGDTESSAGGMDHVRIHPKFLHSNATSHKWALGAFAELLDNALDEV  159

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
               GATYV +DM++++KDGSRML+IEDNGGGM+PDKIR CMSLG+S KSKIA+TIGQYGNG
Sbjct  160   STGATYVIVDMLENQKDGSRMLLIEDNGGGMNPDKIRDCMSLGFSTKSKIANTIGQYGNG  219

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG ED VVPMLDYE    +W
Sbjct  220   FKTSTMRLGADVIVFSRCCGKDGKSATQSIGLLSYTFLRSTGKEDTVVPMLDYEKQGTDW  279

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
              +I RSS+ DWN+N+ETI++WSPFS+E DL  QF  +K+ GTR++IYNLWEDD+G LELD
Sbjct  280   HRIRRSSLSDWNKNVETILQWSPFSTEEDLDHQFCMIKNQGTRVIIYNLWEDDEGQLELD  339

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             FD D  DIQIRGVNRD+K+IQMAKQYPNSRHFLTYRHSLRSYA+ILYLR+P  FRIILRG
Sbjct  340   FDVDRYDIQIRGVNRDEKNIQMAKQYPNSRHFLTYRHSLRSYAAILYLRLPIDFRIILRG  399

Query  320   KDVEHHNIVNDMMMTQEVTYRPQ-TGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             KDVEHHNIVNDMMM+Q+VTYRPQ T  DG+ KD+NM A VTIGFVKDAK HIDVQGFNVY
Sbjct  400   KDVEHHNIVNDMMMSQKVTYRPQSTTTDGILKDANMAATVTIGFVKDAKYHIDVQGFNVY  459

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWRLWN AGSDGRGVIG+LEANFVEPAHDKQGFERTT+L
Sbjct  460   HKNRLIKPFWRLWNAAGSDGRGVIGLLEANFVEPAHDKQGFERTTIL  506



>gb|EPS74601.1| hypothetical protein M569_00153, partial [Genlisea aurea]
Length=764

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/462 (71%), Positives = 388/462 (84%), Gaps = 10/462 (2%)
 Frame = -3

Query  1388  RPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQF  1209
             R +KK+   +   V LP GFLDPL    +Q + +         S       +   S +QF
Sbjct  32    RKKKKRYEGDKFGVVLPPGFLDPLPSKQKQVMAV---------SCSESSFALAAVSDRQF  82

Query  1208  WKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGA  1029
             WKAGDF+ +  GDW S SGGMDHVRVHP+FLHSNATSHKWVLGAFAELLDN+LDE+ NGA
Sbjct  83    WKAGDFDDSSGGDW-SYSGGMDHVRVHPRFLHSNATSHKWVLGAFAELLDNALDEIRNGA  141

Query  1028  TYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTS  849
             TYV +DMV++ KD S+ML+IEDNGGGM PDK+R CMSLGYSAKSK+A+TIGQYGNGFKTS
Sbjct  142   TYVAVDMVQNMKDDSKMLLIEDNGGGMSPDKMRHCMSLGYSAKSKMANTIGQYGNGFKTS  201

Query  848   TMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQII  669
             TMRLGADVIVFSRC G +G+ PTQ+IG+LSYTFLRST  EDIVVPMLDYE   + W +I+
Sbjct  202   TMRLGADVIVFSRCRGVDGERPTQTIGMLSYTFLRSTRKEDIVVPMLDYEKRGQAWSKIM  261

Query  668   RSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDAD  489
             +S+  DW  N++ IV WSPF+SE +LL+QF+ +K+ GTRI+IYNLWED++G LELDFDA+
Sbjct  262   KSTAGDWENNVDAIVNWSPFTSEENLLQQFDHVKNQGTRIIIYNLWEDEEGQLELDFDAN  321

Query  488   PRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVE  309
               DIQIRGVNRDDKSI+MA+++PNSRHFLTYRHSLRSYA+ILYLR+PP FRI LRGKDV 
Sbjct  322   EHDIQIRGVNRDDKSIEMAQRFPNSRHFLTYRHSLRSYAAILYLRIPPQFRITLRGKDVA  381

Query  308   HHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRL  129
             HHNIV+DMMM+QE+TYRPQ G++G+PK SNMVAVVT+GFVKDAKAHIDVQGFNVYHKNRL
Sbjct  382   HHNIVSDMMMSQEITYRPQPGSEGIPKSSNMVAVVTVGFVKDAKAHIDVQGFNVYHKNRL  441

Query  128   IKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             IKPFWR+W+P GSDGRGVIGVLEANFVEPAHDKQGFERTT+L
Sbjct  442   IKPFWRVWHPPGSDGRGVIGVLEANFVEPAHDKQGFERTTIL  483



>ref|XP_006844594.1| hypothetical protein AMTR_s00016p00209510 [Amborella trichopoda]
 gb|ERN06269.1| hypothetical protein AMTR_s00016p00209510 [Amborella trichopoda]
Length=849

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/407 (80%), Positives = 360/407 (88%), Gaps = 0/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S KQFWKAGD+EG+P        G MDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE
Sbjct  109   SCKQFWKAGDYEGSPALSSNVPVGSMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDE  168

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYVNIDM+ ++KDGSRML+IEDNGGGM PDK+R CMSLGYSAKSK+A+TIGQYGN
Sbjct  169   VCNGATYVNIDMLTNKKDGSRMLLIEDNGGGMTPDKLRACMSLGYSAKSKLANTIGQYGN  228

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADV+VFSR  G +G S TQSIG+LSYTFLRSTG EDIVVPM+DYE     
Sbjct  229   GFKTSTMRLGADVVVFSRSRGKDGTSSTQSIGMLSYTFLRSTGHEDIVVPMIDYEKGIGG  288

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W  ++RSS +DW RN+ETIV+WSP+ SE DLL QFN +K+ GTRI+IYN+WEDDQG LEL
Sbjct  289   WSMLVRSSADDWKRNMETIVQWSPYLSEVDLLHQFNSLKNQGTRIIIYNIWEDDQGELEL  348

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD DP DIQIRGVNRDDK IQMAK +PNSRHFLTYRHSLRSYASILYLR+PP FR+ILR
Sbjct  349   DFDEDPHDIQIRGVNRDDKKIQMAKHFPNSRHFLTYRHSLRSYASILYLRLPPRFRMILR  408

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GKDV HHN+++DMM+TQEVTYRPQ GADG+PKD NMVA+V IGFVKDAK HIDVQGFNVY
Sbjct  409   GKDVGHHNLLDDMMLTQEVTYRPQPGADGIPKDFNMVAIVKIGFVKDAKDHIDVQGFNVY  468

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  469   HKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  515



>ref|XP_009132694.1| PREDICTED: uncharacterized protein LOC103857271 [Brassica rapa]
Length=759

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/422 (77%), Positives = 365/422 (86%), Gaps = 5/422 (1%)
 Frame = -3

Query  1253  RAVPTCIVETSS-----KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKW  1089
             +A P  +V  SS     KQFWKAGD+EG   G W  S+GG DHVRVHPKFLHSNATSHKW
Sbjct  81    QATPCNVVRPSSSAPSCKQFWKAGDYEGTSGGHWEVSAGGFDHVRVHPKFLHSNATSHKW  140

Query  1088  VLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGY  909
              LGAFAELLDN+LDEV +GATYVN++M+ ++KDGSRML+IEDNGGGM+P+K+R CMSLGY
Sbjct  141   ALGAFAELLDNALDEVHSGATYVNVNMLTNKKDGSRMLLIEDNGGGMNPEKMRHCMSLGY  200

Query  908   SAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGME  729
             SAKSK+A+TIGQYGNGFKTSTMRLGADVIVFSRC G +G S TQ+IGLLSYTFL+STG E
Sbjct  201   SAKSKLANTIGQYGNGFKTSTMRLGADVIVFSRCPGKDGDSFTQTIGLLSYTFLKSTGKE  260

Query  728   DIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRI  549
             DIVVPMLDYE    EW  I+RSS  DWN+N++TIV+WSPFS+E +LL QFN MK+HGTRI
Sbjct  261   DIVVPMLDYEREGSEWSPIVRSSASDWNKNVDTIVQWSPFSTEDELLCQFNLMKEHGTRI  320

Query  548   VIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYAS  369
             +IYNLWEDDQGLLELDFD DP DIQ+RGVNRD+KSI MA QYPNSRHFLTYRHSLRSY S
Sbjct  321   IIYNLWEDDQGLLELDFDTDPHDIQLRGVNRDEKSISMAAQYPNSRHFLTYRHSLRSYVS  380

Query  368   ILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFV  189
             ILYLRVPP FRIILR +DVEHHNIVNDMM T ++TYRP+ G  G    SNM AVVTIGFV
Sbjct  381   ILYLRVPPEFRIILRRRDVEHHNIVNDMMHTNQITYRPKEGPGGQSNFSNMSAVVTIGFV  440

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTT  9
             KDAK H+DVQGFNVYHKNRLIKPFWR+WN AGS GRG+IGVLEA+FVEPAHDKQGFERTT
Sbjct  441   KDAKHHVDVQGFNVYHKNRLIKPFWRIWNAAGSQGRGIIGVLEADFVEPAHDKQGFERTT  500

Query  8     VL  3
             VL
Sbjct  501   VL  502



>ref|XP_010448496.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Camelina 
sativa]
Length=715

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/407 (80%), Positives = 365/407 (90%), Gaps = 2/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S KQFWKAGD+EGAP   W  SSGG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE
Sbjct  143   SCKQFWKAGDYEGAPGSTWDLSSGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDE  202

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V +GATYV +DM+++ K G+RML+IEDNGGGMDP+K+RQCMSLGYSAKSKIA+TIGQYGN
Sbjct  203   VASGATYVKVDMLENNKAGNRMLLIEDNGGGMDPEKMRQCMSLGYSAKSKIANTIGQYGN  262

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIGL+SYTFLRSTG EDIVVPMLDYE  + E
Sbjct  263   GFKTSTMRLGADVIVFSRCPGKDGKSSTQSIGLVSYTFLRSTGKEDIVVPMLDYERRDSE  322

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +IIRSS+ DW +N+ETIV WSPFSSE DLL QF+ MKD GTRIVIYN+WEDDQG+LEL
Sbjct  323   WSKIIRSSLSDWVKNLETIVEWSPFSSEEDLLHQFDLMKDRGTRIVIYNMWEDDQGMLEL  382

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFDADP DIQ+RGVNR++K+I+MA Q+PNSRHFLTYRHSLRSY SILYLR+PP FRIILR
Sbjct  383   DFDADPLDIQLRGVNREEKNIKMAAQFPNSRHFLTYRHSLRSYVSILYLRIPPGFRIILR  442

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GKDVEHH++VNDMM T+++TYRPQ+ + GV  D  M A+V IGFVKDAK H+DVQGFNVY
Sbjct  443   GKDVEHHSVVNDMMQTEQITYRPQSESYGVFTD--MSAIVMIGFVKDAKHHVDVQGFNVY  500

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  501   HKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  547



>ref|XP_006285332.1| hypothetical protein CARUB_v10006721mg [Capsella rubella]
 gb|EOA18230.1| hypothetical protein CARUB_v10006721mg [Capsella rubella]
Length=713

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/407 (79%), Positives = 368/407 (90%), Gaps = 2/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S KQFWKAGD+EGAP  +W  SSGG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE
Sbjct  138   SCKQFWKAGDYEGAPGVNWDLSSGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDE  197

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V +GATYV +DM+++ K G+RML+IEDNGGGMDP+K+RQCMSLGYSAKSK+A+TIGQYGN
Sbjct  198   VASGATYVKVDMLENNKAGNRMLLIEDNGGGMDPEKMRQCMSLGYSAKSKLANTIGQYGN  257

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE  + E
Sbjct  258   GFKTSTMRLGADVIVFSRCPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRDPE  317

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +IIRSS+ DW++N+ETIV+WSPFSSE DLL QF+ MKD GTRI+IYNLWEDDQG+LEL
Sbjct  318   WSKIIRSSLSDWDKNVETIVQWSPFSSEEDLLHQFDLMKDRGTRIIIYNLWEDDQGMLEL  377

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFDADP DIQ+RGVNR++K+I+MA Q+PNSRHFLTY+HSLRSY SILYLR+PP FRIILR
Sbjct  378   DFDADPLDIQLRGVNREEKNIKMASQFPNSRHFLTYKHSLRSYVSILYLRIPPGFRIILR  437

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GKDVEHH++VNDMM T+++TYRPQ+ + G    +NM A+V IGFVKDAK H+DVQGFNVY
Sbjct  438   GKDVEHHSVVNDMMQTEQITYRPQSESYGF--TTNMSAIVIIGFVKDAKHHVDVQGFNVY  495

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN +GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  496   HKNRLIKPFWRIWNTSGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  542



>ref|XP_010433704.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Camelina 
sativa]
Length=724

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/407 (80%), Positives = 365/407 (90%), Gaps = 2/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S KQFWKAGD+EGAP   W  SSGG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE
Sbjct  152   SCKQFWKAGDYEGAPGATWDLSSGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDE  211

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V +GATYV +DM+++ K GSRML+IEDNGGGMDP+K+RQCMSLGYSAKSKIA+TIGQYGN
Sbjct  212   VASGATYVKVDMLENNKAGSRMLLIEDNGGGMDPEKMRQCMSLGYSAKSKIANTIGQYGN  271

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE  +  
Sbjct  272   GFKTSTMRLGADVIVFSRCPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRDSG  331

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +IIRSS+ DW +N+ETIV+WSPFSSE DLL QF+ MKD GTRIVIYN+WEDDQG+LEL
Sbjct  332   WSKIIRSSLSDWVKNVETIVQWSPFSSEEDLLHQFDLMKDRGTRIVIYNMWEDDQGMLEL  391

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFDADP DIQ+RGVNR++K+I+MA Q+PNSRHFLTY+HSLRSY SILYLR+PP FRIILR
Sbjct  392   DFDADPLDIQLRGVNREEKNIKMASQFPNSRHFLTYKHSLRSYVSILYLRIPPGFRIILR  451

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GKDVEHH++VNDMM T+++TYRPQ+ + GV  D  M A+V IGFVKDAK H+DVQGFNVY
Sbjct  452   GKDVEHHSVVNDMMQTEQITYRPQSESYGVWTD--MSAIVMIGFVKDAKHHVDVQGFNVY  509

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  510   HKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  556



>ref|NP_199891.4| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family 
protein [Arabidopsis thaliana]
 gb|AED95991.1| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family 
protein [Arabidopsis thaliana]
Length=819

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/447 (73%), Positives = 375/447 (84%), Gaps = 26/447 (6%)
 Frame = -3

Query  1265  TSSGRAV------PTCIVET-----SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKF  1119
             T+SG+A+      P  +V       S KQFWKAGD+EG   GDW  S+GG DHVRVHPKF
Sbjct  100   TTSGQAILALPATPCNVVAAPSSWGSCKQFWKAGDYEGTSGGDWEVSAGGFDHVRVHPKF  159

Query  1118  LHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPD  939
             LHSNATSHKW LGAFAELLDN+LDEV +GAT+VN+DM+++RKDGS+M++IEDNGGGM+P+
Sbjct  160   LHSNATSHKWSLGAFAELLDNALDEVRSGATFVNVDMIQNRKDGSKMILIEDNGGGMNPE  219

Query  938   KIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLS  759
             K+R CMSLGYSAKSK+ADTIGQYGNGFKTSTMRLGADVIVFSRC G +GKS TQSIGLLS
Sbjct  220   KMRHCMSLGYSAKSKLADTIGQYGNGFKTSTMRLGADVIVFSRCLGKDGKSSTQSIGLLS  279

Query  758   YTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQF  579
             YTFL+STG EDIVVPMLDYE  + EW  I RSSV DW +N+ET+V+WSP+++E +LL QF
Sbjct  280   YTFLKSTGKEDIVVPMLDYERRDSEWCPITRSSVSDWEKNVETVVQWSPYATEEELLCQF  339

Query  578   NQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLT  399
             N MK HGTRI+IYNLWEDD+G+LELDFD DP DIQ+RGVNRDDK+I MA Q+PNSRH+LT
Sbjct  340   NLMKKHGTRIIIYNLWEDDEGMLELDFDTDPHDIQLRGVNRDDKNIVMASQFPNSRHYLT  399

Query  398   YRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSN  219
             Y+HSLRSYASILYL++   FRIILRGKDVEHHNIVNDMM T+++TYRP+  ADG  K SN
Sbjct  400   YKHSLRSYASILYLKISHEFRIILRGKDVEHHNIVNDMMQTEKITYRPKEAADGCAKYSN  459

Query  218   MV---------------AVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDG  84
             +                AVVTIGFVKDAK H+DVQGFNVYHKNRLIKPFWR+WN AGSDG
Sbjct  460   LYNLKIWLLVLHVSQLSAVVTIGFVKDAKHHVDVQGFNVYHKNRLIKPFWRIWNAAGSDG  519

Query  83    RGVIGVLEANFVEPAHDKQGFERTTVL  3
             RGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  520   RGVIGVLEANFVEPAHDKQGFERTTVL  546



>dbj|BAA96991.2| unnamed protein product [Arabidopsis thaliana]
Length=823

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/447 (73%), Positives = 375/447 (84%), Gaps = 26/447 (6%)
 Frame = -3

Query  1265  TSSGRAV------PTCIVET-----SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKF  1119
             T+SG+A+      P  +V       S KQFWKAGD+EG   GDW  S+GG DHVRVHPKF
Sbjct  100   TTSGQAILALPATPCNVVAAPSSWGSCKQFWKAGDYEGTSGGDWEVSAGGFDHVRVHPKF  159

Query  1118  LHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPD  939
             LHSNATSHKW LGAFAELLDN+LDEV +GAT+VN+DM+++RKDGS+M++IEDNGGGM+P+
Sbjct  160   LHSNATSHKWSLGAFAELLDNALDEVRSGATFVNVDMIQNRKDGSKMILIEDNGGGMNPE  219

Query  938   KIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLS  759
             K+R CMSLGYSAKSK+ADTIGQYGNGFKTSTMRLGADVIVFSRC G +GKS TQSIGLLS
Sbjct  220   KMRHCMSLGYSAKSKLADTIGQYGNGFKTSTMRLGADVIVFSRCLGKDGKSSTQSIGLLS  279

Query  758   YTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQF  579
             YTFL+STG EDIVVPMLDYE  + EW  I RSSV DW +N+ET+V+WSP+++E +LL QF
Sbjct  280   YTFLKSTGKEDIVVPMLDYERRDSEWCPITRSSVSDWEKNVETVVQWSPYATEEELLCQF  339

Query  578   NQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLT  399
             N MK HGTRI+IYNLWEDD+G+LELDFD DP DIQ+RGVNRDDK+I MA Q+PNSRH+LT
Sbjct  340   NLMKKHGTRIIIYNLWEDDEGMLELDFDTDPHDIQLRGVNRDDKNIVMASQFPNSRHYLT  399

Query  398   YRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSN  219
             Y+HSLRSYASILYL++   FRIILRGKDVEHHNIVNDMM T+++TYRP+  ADG  K SN
Sbjct  400   YKHSLRSYASILYLKISHEFRIILRGKDVEHHNIVNDMMQTEKITYRPKEAADGCAKYSN  459

Query  218   MV---------------AVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDG  84
             +                AVVTIGFVKDAK H+DVQGFNVYHKNRLIKPFWR+WN AGSDG
Sbjct  460   LYNLKIWLLVLHVSQLSAVVTIGFVKDAKHHVDVQGFNVYHKNRLIKPFWRIWNAAGSDG  519

Query  83    RGVIGVLEANFVEPAHDKQGFERTTVL  3
             RGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  520   RGVIGVLEANFVEPAHDKQGFERTTVL  546



>ref|XP_006280042.1| hypothetical protein CARUB_v10025919mg [Capsella rubella]
 gb|EOA12940.1| hypothetical protein CARUB_v10025919mg [Capsella rubella]
Length=777

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/416 (76%), Positives = 368/416 (88%), Gaps = 0/416 (0%)
 Frame = -3

Query  1250  AVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFA  1071
             A P+     S KQFWKAGD+EG   GDW  S+GG DHVRVHPKFLHSNATSHKW LGAFA
Sbjct  94    AAPSSSPWGSCKQFWKAGDYEGTSGGDWEISAGGFDHVRVHPKFLHSNATSHKWSLGAFA  153

Query  1070  ELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKI  891
             ELLDN+LDEV +GAT+VN+DM+++RKDGS+M++IED+GGGM+P+K+R CMSLGYS KSK+
Sbjct  154   ELLDNALDEVRSGATFVNVDMLQNRKDGSKMILIEDDGGGMNPEKMRHCMSLGYSVKSKL  213

Query  890   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPM  711
             ADTIGQYGNGFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFL+STG EDIVVPM
Sbjct  214   ADTIGQYGNGFKTSTMRLGADVIVFSRCLGKDGKSLTQSIGLLSYTFLKSTGKEDIVVPM  273

Query  710   LDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLW  531
             LDYE +  EW  I+RSSV DW++N+ET+V+WSPF++E DLLRQFN +K+HGTRI+IYNLW
Sbjct  274   LDYERSGSEWCPIMRSSVSDWDKNVETVVQWSPFATEEDLLRQFNLVKNHGTRIIIYNLW  333

Query  530   EDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRV  351
             EDDQ +LELDFD D  DIQ+RGVNRD+K+I MA Q+PNSRHFLTY+HSLRSYASILY ++
Sbjct  334   EDDQEMLELDFDTDQYDIQLRGVNRDEKNIVMASQFPNSRHFLTYKHSLRSYASILYRKI  393

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAH  171
             P  FRIILRGKD+++HNI NDMM T+++TYRP+ GA G  K SN+ AVVTIGFVKDAK H
Sbjct  394   PHGFRIILRGKDIDYHNIENDMMYTEKITYRPKEGAGGCTKHSNLFAVVTIGFVKDAKHH  453

Query  170   IDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             +DVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  454   VDVQGFNVYHKNRLIKPFWRIWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  509



>ref|XP_004310229.1| PREDICTED: uncharacterized protein LOC101309319 [Fragaria vesca 
subsp. vesca]
Length=764

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/408 (78%), Positives = 364/408 (89%), Gaps = 2/408 (0%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
              KQFWKAGD+EG    D  S  SS GMDH R+HPKFLHSNATSHKW LGAFAELLDNSLD
Sbjct  131   CKQFWKAGDYEGDKENDSKSAFSSAGMDHARIHPKFLHSNATSHKWALGAFAELLDNSLD  190

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV NGATYVNIDM+ ++KDG+ ML++EDNGGGM P+K+RQCMSLGYSAKSK+A+TIGQYG
Sbjct  191   EVCNGATYVNIDMLINKKDGNLMLVVEDNGGGMTPEKMRQCMSLGYSAKSKMANTIGQYG  250

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGADVIVFSRC G NG SPTQ+IGLLSYTFLR+TG EDIVVPM+DYE + +
Sbjct  251   NGFKTSTMRLGADVIVFSRCQGINGTSPTQTIGLLSYTFLRTTGKEDIVVPMIDYEKSGR  310

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              W +++R+S +DW RN+ETIV+WSP+SSE DLL+QF   + HGTRIVIYNLWEDD+G LE
Sbjct  311   GWNKMMRASPDDWTRNLETIVQWSPYSSEEDLLQQFKLFRGHGTRIVIYNLWEDDEGHLE  370

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQIRGVNRD+KSIQM+++YPNSRHFLTYRHSLRSYASILYLR+P  FR+IL
Sbjct  371   LDFDTDPHDIQIRGVNRDEKSIQMSRKYPNSRHFLTYRHSLRSYASILYLRLPSQFRMIL  430

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG+D+EHHNIVNDMMMT+ VTY+P    +G+PKDSNMVA VT+GFVKDA++HID+QGFNV
Sbjct  431   RGEDIEHHNIVNDMMMTRVVTYKPVNLPEGMPKDSNMVAKVTLGFVKDARSHIDIQGFNV  490

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  491   YHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTNVL  538



>gb|KHG06394.1| MORC family CW-type zinc finger protein 3 [Gossypium arboreum]
Length=814

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/468 (71%), Positives = 380/468 (81%), Gaps = 6/468 (1%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFL-----DplhepveqplllpppapaETSSGRAVPTCIVE  1227
             GR RKK+K  +     LP+GFL     D         +                 + I  
Sbjct  68    GRIRKKRKVNDVD-FQLPVGFLSTLPPDDPVPAQLDSITAVAEVQVVLRQPEQAASRISS  126

Query  1226  TSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
                KQFWKAG+++G         SGGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLD
Sbjct  127   VLCKQFWKAGEYDGVSSTVCDLPSGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLD  186

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV NGATYVN+DM+K +KDG++ML+IEDNGGGMDP K+RQCMSLGYSAKSK+A+ IGQYG
Sbjct  187   EVCNGATYVNMDMLKCKKDGNQMLLIEDNGGGMDPGKMRQCMSLGYSAKSKLANAIGQYG  246

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTS+MRLGADVIVFSRC G +GK PTQSIGLLSYTFL STG EDIVVPMLDYE  ++
Sbjct  247   NGFKTSSMRLGADVIVFSRCHGKDGKHPTQSIGLLSYTFLTSTGKEDIVVPMLDYEWRQE  306

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             EW +IIRS+  DW RN++TIV WSPF SEADLLRQF+ MKDHGT+I+IYNLWEDDQGLLE
Sbjct  307   EWSKIIRSTDGDWYRNLDTIVEWSPFYSEADLLRQFSLMKDHGTQIIIYNLWEDDQGLLE  366

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDF  DP DIQ+RGV+RD+ +IQMAKQ+PNSRHFLTY+HSLRSYASILYL++PP+FRIIL
Sbjct  367   LDFLGDPHDIQLRGVSRDETNIQMAKQFPNSRHFLTYKHSLRSYASILYLKLPPNFRIIL  426

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGKDVEHH+IVNDMM+T  VTYRP   A+G PKD ++ A+V IGFVKDAK HIDVQGFNV
Sbjct  427   RGKDVEHHDIVNDMMLTDRVTYRPNPSAEGAPKDLHLSAMVIIGFVKDAKHHIDVQGFNV  486

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRL+KPFWR+WN +GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  487   YHKNRLVKPFWRVWNSSGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  534



>ref|XP_010250612.1| PREDICTED: uncharacterized protein LOC104592813 isoform X2 [Nelumbo 
nucifera]
Length=785

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/463 (74%), Positives = 380/463 (82%), Gaps = 22/463 (5%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             G   KKQK      V LPLGFLDPL      P+      P             V +S KQ
Sbjct  61    GDSSKKQKF----DVVLPLGFLDPLPPEEPVPMRETVTPPQPQG---------VASSCKQ  107

Query  1211  FWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVING  1032
             FWKAGD+EGAP     SS  GMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDE+ +G
Sbjct  108   FWKAGDYEGAPGDCPTSSLSGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEICHG  167

Query  1031  ATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKT  852
             ATYVNIDM+K+ KDGSR+L++EDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNGFKT
Sbjct  168   ATYVNIDMLKNEKDGSRVLLVEDNGGGMDPDKMRQCMSLGYSAKSKLANTIGQYGNGFKT  227

Query  851   STMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQI  672
             STMRLGADVIVFSRC G +GKSPTQSIG+LSYTFLRSTG EDIVVPM+DYE     W ++
Sbjct  228   STMRLGADVIVFSRCHGKDGKSPTQSIGMLSYTFLRSTGKEDIVVPMIDYEKVGSNWKKV  287

Query  671   IRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDA  492
             +RSS  DWN N++TIV+WSP+S E DLL+QFN +K+ GTRI+IYNLWEDDQG LELDFD 
Sbjct  288   LRSSPGDWNTNLDTIVQWSPYSDEDDLLQQFNYLKEQGTRILIYNLWEDDQGELELDFDT  347

Query  491   DPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDV  312
             DP DIQIRGVNRD+K IQMAKQ+PNSRHFLTYRHSLRSY+SILYLR+P  FRIILRGKDV
Sbjct  348   DPHDIQIRGVNRDEKKIQMAKQFPNSRHFLTYRHSLRSYSSILYLRLPHGFRIILRGKDV  407

Query  311   EHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNR  132
             EHHN+V DMM+T+++TYRPQ GA GVPK+SNMVAVVTIGFVKDAK HID+QGFN      
Sbjct  408   EHHNLVKDMMLTEKITYRPQPGAYGVPKESNMVAVVTIGFVKDAKDHIDIQGFN------  461

Query  131   LIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
                PFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  462   ---PFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  501



>ref|NP_194227.2| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family 
protein [Arabidopsis thaliana]
 gb|AEE84983.1| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family 
protein [Arabidopsis thaliana]
Length=707

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 364/405 (90%), Gaps = 2/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EGA   +W  SSGG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  136   KQFWKAGDYEGAAGDNWDLSSGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVA  195

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             +GATYV +DM+++ K G+RML+IEDNGGGMDP+K+RQCMSLGYSAKSK+A+TIGQYGNGF
Sbjct  196   SGATYVKVDMLENNKGGNRMLLIEDNGGGMDPEKMRQCMSLGYSAKSKLANTIGQYGNGF  255

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE  + EW 
Sbjct  256   KTSTMRLGADVIVFSRCPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRDPEWS  315

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +IIRSS  DW++N+ETI++WSPFSSE DLL QF+ MKD GTRI+IYNLWEDDQG+LELDF
Sbjct  316   KIIRSSTRDWDKNVETIIQWSPFSSEEDLLHQFDLMKDRGTRIIIYNLWEDDQGMLELDF  375

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             DADP DIQ+RGVNR++++I+MA Q+PNSRHFLTY+HSLRSY SILYLR+PP FRIILRG 
Sbjct  376   DADPYDIQLRGVNREERNIKMASQFPNSRHFLTYKHSLRSYVSILYLRIPPGFRIILRGI  435

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHH++VNDMM T+++TYRPQ+ + GV   +NM A+V IGFVKDAK H+DVQGFNVYHK
Sbjct  436   DVEHHSVVNDMMQTEQITYRPQSESYGVV--TNMSAIVIIGFVKDAKHHVDVQGFNVYHK  493

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWR+WN  GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  494   NRLIKPFWRIWNATGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  538



>ref|XP_006402063.1| hypothetical protein EUTSA_v10012707mg [Eutrema salsugineum]
 gb|ESQ43516.1| hypothetical protein EUTSA_v10012707mg [Eutrema salsugineum]
Length=818

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/405 (79%), Positives = 360/405 (89%), Gaps = 0/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EG   G W  S+GG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  138   KQFWKAGDYEGTGGGGWEVSAGGYDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVH  197

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
              GATYVN+DM+ +RKD S+M++IEDNGGGM+P+K+R CMSLGYS KSK+A+TIGQYGNGF
Sbjct  198   TGATYVNVDMLINRKDASKMVLIEDNGGGMNPEKMRHCMSLGYSVKSKLANTIGQYGNGF  257

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSR  G +G S TQSIGLLSYTFL+STG EDIVVPMLDYE  + EW 
Sbjct  258   KTSTMRLGADVIVFSRFRGKDGDSFTQSIGLLSYTFLKSTGKEDIVVPMLDYERRDSEWS  317

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
              I+RSS  DW +N+ET+V+WSPFSSE DLL QFN MKDHGTRI+IYNLWEDD+G+LELDF
Sbjct  318   PILRSSASDWLKNVETVVQWSPFSSEDDLLSQFNLMKDHGTRIIIYNLWEDDEGMLELDF  377

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             D DP DIQ+RGVNRD+K+I MA Q+PNSRHFLTY+HSLRSY SILYLRVPP FRIILRGK
Sbjct  378   DIDPHDIQLRGVNRDEKNIDMATQFPNSRHFLTYKHSLRSYVSILYLRVPPEFRIILRGK  437

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHHN+VNDMM+T+++TYRP+ G+ G+   +NM AVVTIGFVKDAK H+DVQGFNVYHK
Sbjct  438   DVEHHNLVNDMMLTEQITYRPKDGSAGLSNSTNMSAVVTIGFVKDAKHHVDVQGFNVYHK  497

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWR+WN AGSDGRGVIGVLEA+FVEPAHDKQGFERTTVL
Sbjct  498   NRLIKPFWRIWNAAGSDGRGVIGVLEADFVEPAHDKQGFERTTVL  542



>ref|XP_006438815.1| hypothetical protein CICLE_v10033760mg, partial [Citrus clementina]
 gb|ESR52055.1| hypothetical protein CICLE_v10033760mg, partial [Citrus clementina]
Length=662

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/407 (76%), Positives = 362/407 (89%), Gaps = 0/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             + KQFWKAGD+EG   GD +S+S GMDH+RVHPKFLHSNATSHKW LGAFAELLDNSLDE
Sbjct  141   ACKQFWKAGDYEGGNAGDSLSNSVGMDHLRVHPKFLHSNATSHKWALGAFAELLDNSLDE  200

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYV +D++K++ DG+ ML++EDNGGGM PDK+RQCMSLGYSAKSK+A+TIGQYGN
Sbjct  201   VCNGATYVQVDLLKNKTDGTHMLLVEDNGGGMTPDKMRQCMSLGYSAKSKLANTIGQYGN  260

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIG+LSYTFLR TG EDIVVPM+DYE   + 
Sbjct  261   GFKTSTMRLGADVIVFSRCQGTDGKSSTQSIGMLSYTFLRGTGKEDIVVPMVDYEKRGEH  320

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W  ++RSS EDW+RN+ET+V+WSP++SE DL +QFN MKD GTRIV+YNLWEDD+G LE+
Sbjct  321   WDMLVRSSPEDWSRNLETVVQWSPYTSEEDLTQQFNFMKDQGTRIVMYNLWEDDEGKLEM  380

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD+DP DIQ+RGVNR++K+I+MAK+YPNSRHFLTYRHSLRSYASILYLR+PP FRIILR
Sbjct  381   DFDSDPHDIQLRGVNREEKNIEMAKKYPNSRHFLTYRHSLRSYASILYLRLPPGFRIILR  440

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             G+DVEHHNIVNDMM+ +++ Y+P +  + VP+D NM A VTIGFVKDA  HID+QGFNVY
Sbjct  441   GQDVEHHNIVNDMMLIKKLRYKPTSLPEQVPRDLNMAANVTIGFVKDAHYHIDIQGFNVY  500

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRG IGVLEANFVEPAHDKQGFERT VL
Sbjct  501   HKNRLIKPFWRVWNAAGSDGRGAIGVLEANFVEPAHDKQGFERTPVL  547



>emb|CDY45818.1| BnaC03g16410D [Brassica napus]
Length=775

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/426 (76%), Positives = 361/426 (85%), Gaps = 21/426 (5%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+EG   G W  S+GG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDEV 
Sbjct  99    KQFWKAGDYEGTSGGHWEVSAGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDEVH  158

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             +GATYVN++M+ ++KDGSRML+IEDNGGGM+P+K+R CMSLGYSAKSK+A+TIGQYGNGF
Sbjct  159   SGATYVNVNMLNNKKDGSRMLLIEDNGGGMNPEKMRHCMSLGYSAKSKLANTIGQYGNGF  218

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSRC G +G S TQ+IGLLSYTFL+STG EDIVVPMLDYE +  EW 
Sbjct  219   KTSTMRLGADVIVFSRCPGKDGDSFTQTIGLLSYTFLKSTGKEDIVVPMLDYERDGSEWS  278

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
              I+RSSV DWN+N++TIV+WSPFS+E +LL QFN MK+HGTRI+IYNLWEDDQGLLELDF
Sbjct  279   PIVRSSVSDWNKNVDTIVQWSPFSTEDELLCQFNLMKEHGTRIIIYNLWEDDQGLLELDF  338

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             D DP DIQ+RGVNRD+KSI MA QYPNSRHFLTYRHSLRSY SILYLRVPP FRIILRG+
Sbjct  339   DTDPHDIQLRGVNRDEKSISMAAQYPNSRHFLTYRHSLRSYVSILYLRVPPEFRIILRGR  398

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSN---------------------MVAVVT  201
             DVEHHNIVNDMM T ++TYRP+ G  G    SN                     M AVVT
Sbjct  399   DVEHHNIVNDMMHTNQITYRPKEGPGGQSNFSNLYSKDLFLQILFEELAQFLNMMSAVVT  458

Query  200   IGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGF  21
             IGFVKDAK H+DVQGFNVYHKNRLIKPFWR+WN AGS GRG+IGVLEA+FVEPAHDKQGF
Sbjct  459   IGFVKDAKHHVDVQGFNVYHKNRLIKPFWRIWNAAGSQGRGIIGVLEADFVEPAHDKQGF  518

Query  20    ERTTVL  3
             ERTTVL
Sbjct  519   ERTTVL  524



>ref|XP_006483044.1| PREDICTED: uncharacterized protein LOC102612384 isoform X1 [Citrus 
sinensis]
Length=806

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/407 (76%), Positives = 362/407 (89%), Gaps = 0/407 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             + KQFWKAGD+EG   GD +S+S GMDH+RVHPKFLHSNATSHKW LGAFAELLDNSLDE
Sbjct  141   ACKQFWKAGDYEGGNAGDSLSNSVGMDHLRVHPKFLHSNATSHKWALGAFAELLDNSLDE  200

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYV +D++K++ DG+ ML++EDNGGGM PDK+RQCMSLGYSAKSK+A+TIGQYGN
Sbjct  201   VCNGATYVQVDLLKNKTDGTHMLLVEDNGGGMTPDKMRQCMSLGYSAKSKLANTIGQYGN  260

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIG+LSYTFLR TG EDIVVPM+DYE   + 
Sbjct  261   GFKTSTMRLGADVIVFSRCQGTDGKSSTQSIGMLSYTFLRGTGKEDIVVPMVDYEKRGEH  320

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W  ++RSS EDW+RN+ET+V+WSP++SE DL +QFN MKD GTRIV+YNLWEDD+G LE+
Sbjct  321   WDMLVRSSPEDWSRNLETVVQWSPYTSEEDLTQQFNFMKDQGTRIVMYNLWEDDEGKLEM  380

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD+DP DIQ+RGVNR++K+I+MAK+YPNSRHFLTYRHSLRSYASILYLR+PP FRIILR
Sbjct  381   DFDSDPHDIQLRGVNREEKNIEMAKKYPNSRHFLTYRHSLRSYASILYLRLPPGFRIILR  440

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             G+DVEHHNIVNDMM+ +++ Y+P +  + VP+D NM A VTIGFVKDA  HID+QGFNVY
Sbjct  441   GQDVEHHNIVNDMMLIKKLRYKPTSLPEQVPRDLNMAANVTIGFVKDAHYHIDIQGFNVY  500

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRG IGVLEANFVEPAHDKQGFERT VL
Sbjct  501   HKNRLIKPFWRVWNAAGSDGRGAIGVLEANFVEPAHDKQGFERTPVL  547



>ref|XP_009383407.1| PREDICTED: uncharacterized protein LOC103971173 [Musa acuminata 
subsp. malaccensis]
Length=827

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/405 (78%), Positives = 365/405 (90%), Gaps = 2/405 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGDF+ +   +  +   GMDHVRVHPKFLHSNATSHKW LGA AELLDNSLDEV 
Sbjct  94    KQFWKAGDFDESLNPN-PTPLRGMDHVRVHPKFLHSNATSHKWALGALAELLDNSLDEVC  152

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NG+T+VNIDM+ ++K+GS+ML++EDNGGGMDPDK+RQCMSLGYSAKSKIA+TIGQYGNGF
Sbjct  153   NGSTFVNIDMLINKKNGSKMLLVEDNGGGMDPDKMRQCMSLGYSAKSKIANTIGQYGNGF  212

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSR  G +G+ PTQ+IG+LSYTFLR+TG EDIVVPMLDYE   K W 
Sbjct  213   KTSTMRLGADVIVFSRSHGKDGRRPTQTIGMLSYTFLRNTGKEDIVVPMLDYEKG-KVWS  271

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             +++RSS+ DWN N+ETI++WSP+SSEADLL+QF+ +KD GTRIVIYNLWEDDQG LELDF
Sbjct  272   KMLRSSLADWNTNLETIIQWSPYSSEADLLQQFSSVKDQGTRIVIYNLWEDDQGELELDF  331

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             DAD  DIQ+RGVNRD+K I+MA ++PNSRHFLTYRHSLRSYASILYLR+P  FR+ILRGK
Sbjct  332   DADEHDIQVRGVNRDEKKIEMAMKFPNSRHFLTYRHSLRSYASILYLRLPNVFRMILRGK  391

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             ++EHHNIVNDMM+ QEVTY+PQ+ A+GVPKD NMVAVVTIGFVKDAK HIDVQGFNVYHK
Sbjct  392   EIEHHNIVNDMMLKQEVTYKPQSVAEGVPKDPNMVAVVTIGFVKDAKDHIDVQGFNVYHK  451

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIKPFWR+W+ AGSDGRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  452   NRLIKPFWRVWSAAGSDGRGVIGVLEANFIEPAHDKQDFERTTIL  496



>ref|XP_010943619.1| PREDICTED: uncharacterized protein LOC105061307 [Elaeis guineensis]
Length=838

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/464 (72%), Positives = 383/464 (83%), Gaps = 2/464 (0%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             G P KK ++    + ALPLGFLDPL   +  PL LP P P   +     P        KQ
Sbjct  68    GGPFKKLRAEGGLAAALPLGFLDPLPPDIPPPLPLPLPLPLAVAGPPPPPPATGFQGCKQ  127

Query  1211  FWKAGDFEGAPRGD-WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVIN  1035
             FWKAGD+E  P  D  +  + GMDHVRVHPKFLHSNATSHKW LGA AELLDNSLDEV N
Sbjct  128   FWKAGDYEERPIADSTLHYASGMDHVRVHPKFLHSNATSHKWALGALAELLDNSLDEVCN  187

Query  1034  GATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFK  855
             GATYVNIDM+ + KDG+RML++EDNGGGMDPDK+RQCMSLGYSAKSK+A TIGQYGNGFK
Sbjct  188   GATYVNIDMLDNEKDGTRMLLVEDNGGGMDPDKMRQCMSLGYSAKSKVASTIGQYGNGFK  247

Query  854   TSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQ  675
             TSTMRLGADVIVFSR     G+ PTQSIG+LSYTFLR+T  EDIVVPML YE  +  W +
Sbjct  248   TSTMRLGADVIVFSRSCAKGGRRPTQSIGMLSYTFLRNTAKEDIVVPMLHYEKGQT-WNK  306

Query  674   IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFD  495
             + +SS+ DW+ N+ETI++WSP+SSEADLL+QF+ MKD GTRI+IYNLWEDDQG LELDFD
Sbjct  307   MEQSSLVDWSTNLETILQWSPYSSEADLLQQFSSMKDQGTRIIIYNLWEDDQGELELDFD  366

Query  494   ADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKD  315
              D  DIQ+RGVNRD++ IQMAKQ+PNSRHFLTYRHSLRSYASILYLR+P  F+++LRGK+
Sbjct  367   VDKHDIQVRGVNRDERKIQMAKQFPNSRHFLTYRHSLRSYASILYLRLPHFFKMVLRGKE  426

Query  314   VEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKN  135
             +EHHN+VNDMM+ QEVTY+P   ADGVP+D NMVAVVTIGFVKDAK HIDVQGFNVYHKN
Sbjct  427   IEHHNLVNDMMLKQEVTYKPHPSADGVPRDPNMVAVVTIGFVKDAKNHIDVQGFNVYHKN  486

Query  134   RLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             RLIKPFWR+W+ AGSDGRGVIGVLEANFVEPAHDKQ FERTT+L
Sbjct  487   RLIKPFWRVWSAAGSDGRGVIGVLEANFVEPAHDKQDFERTTIL  530



>ref|XP_008222240.1| PREDICTED: MORC family CW-type zinc finger protein 3 [Prunus 
mume]
Length=711

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/412 (77%), Positives = 361/412 (88%), Gaps = 2/412 (0%)
 Frame = -3

Query  1232  VETSSKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLD  1059
             V  S KQFWKAGD+EG   G   S  SS GMDHVRVHPKFLHSNATSHKW LGAFAELLD
Sbjct  132   VLRSCKQFWKAGDYEGGSEGIANSGFSSVGMDHVRVHPKFLHSNATSHKWALGAFAELLD  191

Query  1058  NSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTI  879
             N+LDE+  GA+YV+IDM++++KDGS MLM+EDNGGGM PDK+RQCMSLGYSAKSK+A+TI
Sbjct  192   NALDEICYGASYVHIDMLRNKKDGSEMLMVEDNGGGMAPDKMRQCMSLGYSAKSKMANTI  251

Query  878   GQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYE  699
             GQYGNGFKTSTMRLGADVIVFSRC G +G SPTQ+IG+LSY+FLR TG EDIVVPM+DYE
Sbjct  252   GQYGNGFKTSTMRLGADVIVFSRCRGIDGGSPTQTIGMLSYSFLRDTGKEDIVVPMVDYE  311

Query  698   NNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQ  519
                + W +++R S++DW RN+ TIV+WSP+ SE  LL+QF   K+HGTRIVIYNLWEDD+
Sbjct  312   KRGQGWNRMVRGSLDDWERNLATIVQWSPYLSEEVLLQQFMLFKEHGTRIVIYNLWEDDE  371

Query  518   GLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSF  339
             G LELDFD DP DIQIRGVNRD+K I MAKQYPNSRHFLTYRHSLRSYASILYL++P +F
Sbjct  372   GQLELDFDTDPHDIQIRGVNRDEKKIHMAKQYPNSRHFLTYRHSLRSYASILYLKLPYNF  431

Query  338   RIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQ  159
             RIILRGKDVEHHNIVNDMM+T+EVTYRP    +G+PKD NM+A VT+GFVKDA+ HIDVQ
Sbjct  432   RIILRGKDVEHHNIVNDMMLTKEVTYRPLHLPEGIPKDVNMIANVTLGFVKDARFHIDVQ  491

Query  158   GFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             GFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  492   GFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTIVL  543



>ref|XP_008342061.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Malus 
domestica]
Length=728

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/412 (77%), Positives = 365/412 (89%), Gaps = 6/412 (1%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGD-WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
             S KQFWKAGD+EGAP  D   S++GGMD VRVHP+FLHSNATSHKW LGAFAELLDN+LD
Sbjct  39    SCKQFWKAGDYEGAPCSDNHTSAAGGMDRVRVHPRFLHSNATSHKWALGAFAELLDNALD  98

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV +GATYVN+D+++S+KDGSRML+I+D+GGGMDP K+R CMSLGYS KSK+A+TIGQYG
Sbjct  99    EVCSGATYVNVDVLESKKDGSRMLLIQDDGGGMDPKKMRHCMSLGYSVKSKVANTIGQYG  158

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNE-  690
             NGFKTSTMRLGADVIVFSRC G +GKS T+SIGLLSYTFL+STG EDIVVPMLDYE    
Sbjct  159   NGFKTSTMRLGADVIVFSRCEGKDGKSDTRSIGLLSYTFLKSTGKEDIVVPMLDYEKRGG  218

Query  689   ---KEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQ  519
                ++  Q   SS  DW +N+ETIV+WSPFSSE +L RQF  +K+HGT+I+IYNLWEDD+
Sbjct  219   GAWRKMFQSSESSESDWKKNVETIVQWSPFSSEEELHRQFLMIKNHGTQIIIYNLWEDDE  278

Query  518   GLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSF  339
               LELDFD DP DIQ++GVNRD+K+IQMA+ Y NSR FLTY+HSLRSYASILYLR+PP+F
Sbjct  279   DQLELDFDTDPHDIQLKGVNRDEKNIQMAQDYSNSRVFLTYQHSLRSYASILYLRLPPNF  338

Query  338   RIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQ  159
             RIILRGK+VEHHNIVNDMMM+Q+VTYRP TGADG+  ++N +AVVTIGFVKDAK+HIDVQ
Sbjct  339   RIILRGKEVEHHNIVNDMMMSQQVTYRP-TGADGIQTNANAIAVVTIGFVKDAKSHIDVQ  397

Query  158   GFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             GFNVYHKNRLIKPFWRLWN AGSDGRGV+GVLEANFVEPAHDKQGFERTTVL
Sbjct  398   GFNVYHKNRLIKPFWRLWNAAGSDGRGVMGVLEANFVEPAHDKQGFERTTVL  449



>ref|XP_006483045.1| PREDICTED: uncharacterized protein LOC102612384 isoform X2 [Citrus 
sinensis]
Length=800

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/407 (76%), Positives = 359/407 (88%), Gaps = 6/407 (1%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             + KQFWKAGD+EG   GD +S+S GMDH+RVHPKFLHSNATSHKW LGAFAELLDNSLDE
Sbjct  141   ACKQFWKAGDYEGGNAGDSLSNSVGMDHLRVHPKFLHSNATSHKWALGAFAELLDNSLDE  200

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYV +D++K++ DG+ ML++EDNGGGM PDK+RQCMSLGYSAKSK+A+TIGQYGN
Sbjct  201   VCNGATYVQVDLLKNKTDGTHMLLVEDNGGGMTPDKMRQCMSLGYSAKSKLANTIGQYGN  260

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIG+LSYTFLR TG EDIVVPM+DYE   + 
Sbjct  261   GFKTSTMRLGADVIVFSRCQGTDGKSSTQSIGMLSYTFLRGTGKEDIVVPMVDYEKRGEH  320

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W  ++RSS EDW+RN+ET+V+WSP++SE DL +QFN MKD GTRIV+YNLWEDD+G LE+
Sbjct  321   WDMLVRSSPEDWSRNLETVVQWSPYTSEEDLTQQFNFMKDQGTRIVMYNLWEDDEGKLEM  380

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD+DP DIQ+RGVNR++K+I+MAK+YPNSRHFLTYRHSLRSYASILYLR+PP FRIILR
Sbjct  381   DFDSDPHDIQLRGVNREEKNIEMAKKYPNSRHFLTYRHSLRSYASILYLRLPPGFRIILR  440

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             G+DVEHHNIVNDMM+ +++ Y+P +    +P+   M A VTIGFVKDA  HID+QGFNVY
Sbjct  441   GQDVEHHNIVNDMMLIKKLRYKPTS----LPE--QMAANVTIGFVKDAHYHIDIQGFNVY  494

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRG IGVLEANFVEPAHDKQGFERT VL
Sbjct  495   HKNRLIKPFWRVWNAAGSDGRGAIGVLEANFVEPAHDKQGFERTPVL  541



>gb|KDO83114.1| hypothetical protein CISIN_1g045475mg, partial [Citrus sinensis]
Length=662

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/407 (76%), Positives = 358/407 (88%), Gaps = 6/407 (1%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             + KQFWKAGD+EG   GD +S+S GMDH+RVHPKFLHSNATSHKW LGAFAELLDNSLDE
Sbjct  90    ACKQFWKAGDYEGGNAGDSLSNSVGMDHLRVHPKFLHSNATSHKWALGAFAELLDNSLDE  149

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYV +D++K++ DG+ ML++EDNGGGM PDK+RQCMSLGYSAKSK+A+TIGQYGN
Sbjct  150   VCNGATYVQVDLLKNKTDGTHMLLVEDNGGGMTPDKMRQCMSLGYSAKSKLANTIGQYGN  209

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GK  TQSIG+LSYTFLR TG EDIVVPM+DYE   + 
Sbjct  210   GFKTSTMRLGADVIVFSRCQGTDGKCSTQSIGMLSYTFLRGTGKEDIVVPMVDYEKRGEH  269

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W  ++RSS EDW+RN+ET+V+WSP++SE DL +QFN MKD GTRIV+YNLWEDD+G LE+
Sbjct  270   WDMLVRSSPEDWSRNLETVVQWSPYTSEEDLTQQFNFMKDQGTRIVMYNLWEDDEGKLEM  329

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD+DP DIQ+RGVNR++K+I+MAK+YPNSRHFLTYRHSLRSYASILYLR+PP FRIILR
Sbjct  330   DFDSDPHDIQLRGVNREEKNIEMAKKYPNSRHFLTYRHSLRSYASILYLRLPPGFRIILR  389

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             G+DVEHHNIVNDMM+ +E+ Y+P +    +P+   M A VTIGFVKDA  HID+QGFNVY
Sbjct  390   GQDVEHHNIVNDMMLIKELRYKPTS----LPE--RMAANVTIGFVKDAHYHIDIQGFNVY  443

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+WN AGSDGRG IGVLEANFVEPAHDKQGFERT VL
Sbjct  444   HKNRLIKPFWRVWNAAGSDGRGAIGVLEANFVEPAHDKQGFERTPVL  490



>ref|XP_009373812.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Pyrus 
x bretschneideri]
Length=734

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/415 (76%), Positives = 365/415 (88%), Gaps = 6/415 (1%)
 Frame = -3

Query  1232  VETSSKQFWKAGDFEGAPRGD-WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
              + S KQFWKAGD+EGAP  D   S++G MD VRVHP+FLHSNATSHKW LGAFAELLDN
Sbjct  36    AQQSCKQFWKAGDYEGAPCSDNHTSAAGEMDRVRVHPRFLHSNATSHKWALGAFAELLDN  95

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             +LDEV +GATYVN+D+++S+KDGSRML+I+D+GGGMDP K+R CMSLGYS KSK+A+TIG
Sbjct  96    ALDEVCSGATYVNVDVLESKKDGSRMLVIQDDGGGMDPKKMRHCMSLGYSVKSKVANTIG  155

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFL++TG EDIVVPMLDYE 
Sbjct  156   QYGNGFKTSTMRLGADVIVFSRCEGKDGKSNTQSIGLLSYTFLKNTGKEDIVVPMLDYEK  215

Query  695   N-EKEWGQIIR---SSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWE  528
                  W ++ R   SS  DW +N+ETIV+WSPFSSE +L  QF  +K+HGT+I+IYNLWE
Sbjct  216   RGGGAWRKMFRSSESSESDWKKNVETIVQWSPFSSEEELHHQFLMIKNHGTQIIIYNLWE  275

Query  527   DDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVP  348
             DD+  LELDFD DP DIQ++GVNRD+K+IQMA+ YPNSR FLTY+HSLRSYASILYLR+P
Sbjct  276   DDEDQLELDFDTDPHDIQLKGVNRDEKNIQMAQDYPNSRVFLTYQHSLRSYASILYLRLP  335

Query  347   PSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHI  168
             P+FRI LRGK+VEHHNIVNDMMM+Q+VTYRP TGA+G+  ++N +AVVTIGFVKDAK+HI
Sbjct  336   PNFRITLRGKEVEHHNIVNDMMMSQQVTYRP-TGANGIQTNANAIAVVTIGFVKDAKSHI  394

Query  167   DVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             DVQGFNVYHKNRLIKPFWRLWN AGSDGRGV+GVLEANFVEPAHDKQGFERTTVL
Sbjct  395   DVQGFNVYHKNRLIKPFWRLWNAAGSDGRGVMGVLEANFVEPAHDKQGFERTTVL  449



>ref|XP_008379881.1| PREDICTED: uncharacterized protein LOC103442861 [Malus domestica]
Length=837

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/408 (78%), Positives = 363/408 (89%), Gaps = 2/408 (0%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAP-RGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
             S KQFWKAGD+EGAP   D  S++GG+DHVRVHP+FLHSNATSHKW LGAFAELLDN+LD
Sbjct  145   SCKQFWKAGDYEGAPCSDDHTSAAGGIDHVRVHPRFLHSNATSHKWALGAFAELLDNALD  204

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV +GATYVN+D+++++KDGSRML+I+D+GGGMDP K+R CMSLGYS KSKI DTIGQYG
Sbjct  205   EVCSGATYVNVDVLENKKDGSRMLLIQDDGGGMDPSKMRHCMSLGYSVKSKIRDTIGQYG  264

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGADVIVFSRC G +GKS T+SIGLLSYTFL+STG EDIVVPMLDYE    
Sbjct  265   NGFKTSTMRLGADVIVFSRCEGIDGKSDTRSIGLLSYTFLKSTGKEDIVVPMLDYERRGG  324

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              W ++ RSS  DW +N+ETIV+WSPFSSE +L RQF  +K+HGT+I+IYNLWEDD+  LE
Sbjct  325   AWSKMFRSSERDWKKNVETIVQWSPFSSEEELHRQFLTIKNHGTQIIIYNLWEDDEDQLE  384

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQ+RGVNRD+K+IQMA+ YPNSR FLTY+HSLRSYASILYLR+P +FRIIL
Sbjct  385   LDFDTDPNDIQLRGVNRDEKNIQMAQDYPNSRVFLTYQHSLRSYASILYLRLPSNFRIIL  444

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGK+VEHHNIVNDMMM+Q+VTYRP TGADG    +N++A VTIGFVKDA +HIDVQGFNV
Sbjct  445   RGKEVEHHNIVNDMMMSQQVTYRP-TGADGNQTSANVMATVTIGFVKDAXSHIDVQGFNV  503

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWRLWN AGSDGRGV+GVLEANFVEPAHDKQGFERTTVL
Sbjct  504   YHKNRLIKPFWRLWNAAGSDGRGVMGVLEANFVEPAHDKQGFERTTVL  551



>ref|XP_010239739.1| PREDICTED: uncharacterized protein LOC100838258 isoform X2 [Brachypodium 
distachyon]
Length=797

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/411 (75%), Positives = 363/411 (88%), Gaps = 4/411 (1%)
 Frame = -3

Query  1226  TSSKQFWKAGDFEGAPRGD---WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             +++KQFWKAGD++G P G+     S S G++HVRVHPKFLHSNATSHKW LGA AELLDN
Sbjct  103   SATKQFWKAGDYDGKPLGNREPQPSVSSGLEHVRVHPKFLHSNATSHKWALGALAELLDN  162

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             SLDEVINGAT VNIDM+++RKD +RML+++DNGGGMDPDK+RQCMSLGYSAKS++A TIG
Sbjct  163   SLDEVINGATVVNIDMLENRKDKTRMLLVQDNGGGMDPDKMRQCMSLGYSAKSQVASTIG  222

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADV+VFSR  G  GK PTQSIG+LSYTFLRSTG EDIVVPM+DYE 
Sbjct  223   QYGNGFKTSTMRLGADVLVFSRSHGKEGKRPTQSIGMLSYTFLRSTGKEDIVVPMIDYEK  282

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
             ++++W + +R+++ DWN ++ TI+ WSP++SEA+LL QF+ +K+ GTR++IYNLWEDDQG
Sbjct  283   DDQKWIRKLRTTLTDWNTSLRTIISWSPYTSEAELLEQFSSIKEQGTRVIIYNLWEDDQG  342

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDFD D  DIQIRG NRD+KSIQMAKQ+PNS+HFLTYRHSLRSYASILYLRVP +F+
Sbjct  343   DLELDFDTDVNDIQIRGGNRDEKSIQMAKQFPNSKHFLTYRHSLRSYASILYLRVPDAFQ  402

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK++EHHNIV DMM+ +EVTYRP    +GVPKDSNMVA VTIGFVKDAK H+DVQG
Sbjct  403   MILRGKEIEHHNIVTDMMLKKEVTYRP-VATNGVPKDSNMVADVTIGFVKDAKHHVDVQG  461

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  462   FNVYHKNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  512



>ref|XP_003581092.1| PREDICTED: uncharacterized protein LOC100838258 isoform X1 [Brachypodium 
distachyon]
Length=798

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/411 (75%), Positives = 363/411 (88%), Gaps = 4/411 (1%)
 Frame = -3

Query  1226  TSSKQFWKAGDFEGAPRGD---WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             +++KQFWKAGD++G P G+     S S G++HVRVHPKFLHSNATSHKW LGA AELLDN
Sbjct  103   SATKQFWKAGDYDGKPLGNREPQPSVSSGLEHVRVHPKFLHSNATSHKWALGALAELLDN  162

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             SLDEVINGAT VNIDM+++RKD +RML+++DNGGGMDPDK+RQCMSLGYSAKS++A TIG
Sbjct  163   SLDEVINGATVVNIDMLENRKDKTRMLLVQDNGGGMDPDKMRQCMSLGYSAKSQVASTIG  222

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADV+VFSR  G  GK PTQSIG+LSYTFLRSTG EDIVVPM+DYE 
Sbjct  223   QYGNGFKTSTMRLGADVLVFSRSHGKEGKRPTQSIGMLSYTFLRSTGKEDIVVPMIDYEK  282

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
             ++++W + +R+++ DWN ++ TI+ WSP++SEA+LL QF+ +K+ GTR++IYNLWEDDQG
Sbjct  283   DDQKWIRKLRTTLTDWNTSLRTIISWSPYTSEAELLEQFSSIKEQGTRVIIYNLWEDDQG  342

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDFD D  DIQIRG NRD+KSIQMAKQ+PNS+HFLTYRHSLRSYASILYLRVP +F+
Sbjct  343   DLELDFDTDVNDIQIRGGNRDEKSIQMAKQFPNSKHFLTYRHSLRSYASILYLRVPDAFQ  402

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK++EHHNIV DMM+ +EVTYRP    +GVPKDSNMVA VTIGFVKDAK H+DVQG
Sbjct  403   MILRGKEIEHHNIVTDMMLKKEVTYRP-VATNGVPKDSNMVADVTIGFVKDAKHHVDVQG  461

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  462   FNVYHKNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  512



>ref|XP_009336450.1| PREDICTED: uncharacterized protein LOC103929029 [Pyrus x bretschneideri]
Length=788

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/409 (76%), Positives = 359/409 (88%), Gaps = 3/409 (1%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
              KQFWKAGD+EG   G  +S  SS GMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LD
Sbjct  138   CKQFWKAGDYEGDSGGIAISGFSSAGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALD  197

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV NGA +V +DMV+++KDG+ MLM+ED+GGGM P+K+RQCMSLGYSAKSK+A+TIGQYG
Sbjct  198   EVCNGANHVCVDMVRNKKDGNEMLMVEDDGGGMTPEKMRQCMSLGYSAKSKLANTIGQYG  257

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGADVIVFSRC G +G+ PTQ+IG+LSYTFLR TG EDIVVPM+DYE   +
Sbjct  258   NGFKTSTMRLGADVIVFSRCEGEDGRRPTQTIGVLSYTFLRVTGKEDIVVPMVDYEKRGQ  317

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              W +++R S +DW++N+ TIV+WSP+ SE DLL+QFN  K+HGTRI+IYNLWEDD+G LE
Sbjct  318   GWNKMMRGSPDDWHKNLATIVQWSPYLSEEDLLQQFNLFKEHGTRIIIYNLWEDDEGKLE  377

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQIRGVNRD+K+IQMAK+YPN RHFLTY+HSLRSYASILYLR+P +FRIIL
Sbjct  378   LDFDTDPHDIQIRGVNRDEKNIQMAKRYPNCRHFLTYQHSLRSYASILYLRLPYNFRIIL  437

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGV-PKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             RGKDVEHHNIVNDMM+T+EVTYRP    +G+ PK +NM A VT+GFVKDAK HIDVQGF+
Sbjct  438   RGKDVEHHNIVNDMMLTKEVTYRPLQLPEGLSPKFANMTANVTLGFVKDAKYHIDVQGFS  497

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLIKPFWRLWNPA S GRG+IGVLEA+FVEP HDKQGFERT VL
Sbjct  498   VYHKNRLIKPFWRLWNPAASHGRGIIGVLEADFVEPTHDKQGFERTAVL  546



>ref|XP_009758964.1| PREDICTED: uncharacterized protein LOC104211580 [Nicotiana sylvestris]
Length=763

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/415 (74%), Positives = 354/415 (85%), Gaps = 6/415 (1%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAE  1068
             +P+C      KQFWKAGD+EG   G     S GMDHVRVHPKFLHSNATSHKW LGAFAE
Sbjct  134   IPSC------KQFWKAGDYEGIDGGFSAGHSVGMDHVRVHPKFLHSNATSHKWALGAFAE  187

Query  1067  LLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIA  888
             LLDN++DEV NGATYV++D++ ++K+  +ML++EDNGGGM PDK+RQCMSLGYSAKSK+A
Sbjct  188   LLDNAMDEVCNGATYVSVDVLDNKKEKGKMLLVEDNGGGMTPDKMRQCMSLGYSAKSKLA  247

Query  887   DTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPML  708
             +TIGQYGNGFKTS+MRLGADVIVFSRC G +G S TQS+G+LSYTFLRSTG EDIVVPM+
Sbjct  248   NTIGQYGNGFKTSSMRLGADVIVFSRCQGRDGTSTTQSVGMLSYTFLRSTGKEDIVVPMI  307

Query  707   DYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWE  528
             D+   E+ W  + RSSV+DW RN ETIV+WS + SE DL +QF  + D GTRI+IYNLWE
Sbjct  308   DFVKREETWEMLTRSSVDDWKRNSETIVQWSAYESEEDLFQQFELLNDQGTRIIIYNLWE  367

Query  527   DDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVP  348
             D++G  ELDFD DP+DIQIRGV+RD+K I+MAKQYPNSRHFLTY+HSLRSYASILYLR+ 
Sbjct  368   DEEGATELDFDTDPQDIQIRGVSRDEKKIEMAKQYPNSRHFLTYQHSLRSYASILYLRLA  427

Query  347   PSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHI  168
             P FRIILRGKDVEHHN+VNDMM+++E+TYRPQ   D   KD N VAVVTIGFVKDA+ HI
Sbjct  428   PGFRIILRGKDVEHHNLVNDMMLSEEITYRPQPVGDETSKDPNAVAVVTIGFVKDAEHHI  487

Query  167   DVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             D+QGFNVYHKNRLIKPFWR+WN AGSDGRG IGVLEANFVEPAHDKQGFERT VL
Sbjct  488   DIQGFNVYHKNRLIKPFWRVWNAAGSDGRGAIGVLEANFVEPAHDKQGFERTIVL  542



>ref|XP_008389919.1| PREDICTED: uncharacterized protein LOC103452183 [Malus domestica]
Length=790

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/409 (76%), Positives = 359/409 (88%), Gaps = 3/409 (1%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
              KQFWKAGD+EG   G  +S  SS GMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LD
Sbjct  140   CKQFWKAGDYEGDSGGIAISGFSSAGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALD  199

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV NGA  V +D+V+++KDG+ MLM+ED+GGGM P+K+R+CMSLGYSAKSK+A+TIGQYG
Sbjct  200   EVCNGANNVCVDVVRNKKDGNEMLMVEDDGGGMTPEKMRECMSLGYSAKSKLANTIGQYG  259

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGADVIVFSRC G +G+ PTQ+IG+LSYTFLR TG EDIVVPM+DYE   +
Sbjct  260   NGFKTSTMRLGADVIVFSRCEGEDGRRPTQTIGVLSYTFLRGTGKEDIVVPMIDYEKRGQ  319

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              W +++R S +DW+RN+ TIV+WSP+ SE DLL+QFN  K+HGTRI+IYNLWEDD+G LE
Sbjct  320   GWNKMMRGSPDDWHRNLATIVQWSPYLSEEDLLQQFNLFKEHGTRIIIYNLWEDDEGKLE  379

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQIRGVNRD+K+IQMAK+YPNSRHFLTYRHSLRSYASILYLR+P +FRIIL
Sbjct  380   LDFDTDPHDIQIRGVNRDEKNIQMAKRYPNSRHFLTYRHSLRSYASILYLRLPYNFRIIL  439

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGV-PKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             RGKDVEHHNIVNDMM+T+EVTYRP    +G+ PK +NM A VT+GFVKDAK HI VQGF+
Sbjct  440   RGKDVEHHNIVNDMMLTKEVTYRPLQLPEGMSPKVANMTANVTLGFVKDAKDHIAVQGFS  499

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLIKPFWRLWNPAGS GRG+IGVLEA+FVEP HDKQGFERT VL
Sbjct  500   VYHKNRLIKPFWRLWNPAGSQGRGIIGVLEADFVEPTHDKQGFERTAVL  548



>ref|XP_009624883.1| PREDICTED: uncharacterized protein LOC104115870 [Nicotiana tomentosiformis]
Length=765

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/408 (74%), Positives = 352/408 (86%), Gaps = 0/408 (0%)
 Frame = -3

Query  1226  TSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
             TS KQFWKAGD+EG   G   + S GMDHVRVHPKFLHSNATSHKW LGAFAELLDN++D
Sbjct  137   TSCKQFWKAGDYEGIDGGFSAAHSVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNAMD  196

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV NGATYV++D++ ++K+  +ML++EDNGGGM PDK+RQCMSLGYSAKSK+A+TIGQYG
Sbjct  197   EVCNGATYVSVDVLDNKKEKGKMLLVEDNGGGMTPDKMRQCMSLGYSAKSKLANTIGQYG  256

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTS+MRLGADVIVFSRC G +G S TQS+G+LSYTFLRSTG EDIVVPM+D+    +
Sbjct  257   NGFKTSSMRLGADVIVFSRCQGRDGTSTTQSVGMLSYTFLRSTGKEDIVVPMIDFVKRAE  316

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              W  + RSSV+DW R  ETIV+WSP+ SE DL +QF  + D GTRI+IYNLWED++G  E
Sbjct  317   TWEMLTRSSVDDWKRISETIVQWSPYESEEDLFQQFELLNDQGTRIIIYNLWEDEEGSTE  376

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP+DIQI+GV+RD+K I+MAKQYPNS+HFLTY+HSLRSYASILYLR+ P FRIIL
Sbjct  377   LDFDTDPQDIQIKGVSRDEKKIEMAKQYPNSKHFLTYQHSLRSYASILYLRLTPGFRIIL  436

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGKDVEHHN+VNDMM+++E+TYRPQ   D   KD N VAVVTIGFVKDA+ HID+QGFNV
Sbjct  437   RGKDVEHHNLVNDMMLSEEITYRPQPIGDETSKDPNAVAVVTIGFVKDAEHHIDIQGFNV  496

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+WN AGSDGRG IGVLEANFVEPAHDKQGFERT VL
Sbjct  497   YHKNRLIKPFWRVWNAAGSDGRGAIGVLEANFVEPAHDKQGFERTIVL  544



>ref|XP_010090677.1| hypothetical protein L484_017483 [Morus notabilis]
 gb|EXB40341.1| hypothetical protein L484_017483 [Morus notabilis]
Length=754

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/407 (77%), Positives = 363/407 (89%), Gaps = 1/407 (0%)
 Frame = -3

Query  1226  TSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
             ++ +QFWKAGD+EG    + VSSS GMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLD
Sbjct  147   SNCRQFWKAGDYEGDANENSVSSSVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLD  206

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV NGATYVN+DM+K++KDGS+ML++ED+GGGM PDK+RQCMSLGYSAKSK+A+TIGQYG
Sbjct  207   EVCNGATYVNVDMLKNKKDGSKMLLVEDDGGGMTPDKMRQCMSLGYSAKSKLANTIGQYG  266

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGADVIVFSRC GNNG+ PTQSIG+LSY+FLR TG EDIVVP+LDYE ++ 
Sbjct  267   NGFKTSTMRLGADVIVFSRCPGNNGRRPTQSIGMLSYSFLRGTGKEDIVVPILDYEISDH  326

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
                 + R+S +DW RN+ TI+RWSP+SSE  LL+QFN MK+HGTR+VIYNLWED++  LE
Sbjct  327   GLKNLTRTSADDWYRNLATIIRWSPYSSEEHLLQQFNCMKEHGTRVVIYNLWEDEEEQLE  386

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFDADP DIQIRGVNR++K+IQMAKQYPNS+HFLTYRHSLRSY SILYLR+PP FRIIL
Sbjct  387   LDFDADPHDIQIRGVNRNEKNIQMAKQYPNSKHFLTYRHSLRSYVSILYLRLPPGFRIIL  446

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG DVEHHN+ +DMM+T+EVTYRPQ   +G+P+++++ A V IGFVKDA AHIDVQGFNV
Sbjct  447   RGVDVEHHNLEDDMMLTEEVTYRPQL-YEGMPRNTHICANVKIGFVKDAYAHIDVQGFNV  505

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             YHKNRLIKPFWR+WN AGSDGRGVIGVLE NF+EPAHDKQGFERT V
Sbjct  506   YHKNRLIKPFWRVWNAAGSDGRGVIGVLEPNFIEPAHDKQGFERTFV  552



>ref|XP_002446235.1| hypothetical protein SORBIDRAFT_06g007940 [Sorghum bicolor]
 gb|EES10563.1| hypothetical protein SORBIDRAFT_06g007940 [Sorghum bicolor]
Length=792

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/421 (73%), Positives = 365/421 (87%), Gaps = 8/421 (2%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAF  1074
             +P  +   ++KQFWKAGD++G P GD V+  S  GMDHVRVHP+FLHSNATSHKW LGA 
Sbjct  94    LPVPLAACATKQFWKAGDYDGKPLGDGVAQPSVSGMDHVRVHPRFLHSNATSHKWALGAL  153

Query  1073  AELLDNSLDEVINGATYVNIDMVKSRK----DGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
             AELLDNSLDEVINGATYVNID++++ K    + SRML++ED+GGGMDPDK+RQCMSLGYS
Sbjct  154   AELLDNSLDEVINGATYVNIDVLENDKGIDKEKSRMLLVEDDGGGMDPDKMRQCMSLGYS  213

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              KSK+A TIGQYGNGFKTSTMRLGADV+VFSR  G +GK PTQSIG+LSYTFLRSTG ED
Sbjct  214   VKSKVASTIGQYGNGFKTSTMRLGADVLVFSRSRGKSGKRPTQSIGMLSYTFLRSTGKED  273

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             I+VPM+DYE  +  W +++R++++DW+ +++TI+ WSP+S+EA+LL QF+ MKD GTRI+
Sbjct  274   IIVPMIDYEYKQG-WERMVRTTLDDWSTSLQTIITWSPYSTEAELLEQFSSMKDRGTRII  332

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASI  366
             IYNLWEDDQG LELDFDA+  DIQ+RG NRD+K+IQMAKQ+PNS+H+LTYRHSLRSYASI
Sbjct  333   IYNLWEDDQGDLELDFDAEVHDIQLRGGNRDEKNIQMAKQFPNSKHYLTYRHSLRSYASI  392

Query  365   LYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVK  186
             LYLR+P  F++ILRGKD+EHHNIV DMM+ +EVTYRP    +G PKDSNMVA VTIGFVK
Sbjct  393   LYLRLPTYFQMILRGKDIEHHNIVTDMMLKKEVTYRP-VAPNGHPKDSNMVADVTIGFVK  451

Query  185   DAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             DAK HIDVQGFNVYHKNRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+
Sbjct  452   DAKHHIDVQGFNVYHKNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTL  511

Query  5     L  3
             L
Sbjct  512   L  512



>ref|XP_004975253.1| PREDICTED: uncharacterized protein LOC101775460 [Setaria italica]
Length=796

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/413 (75%), Positives = 359/413 (87%), Gaps = 8/413 (2%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSL  1050
             ++KQFWKAGD++G P G+ V   S+ GMDHVRVHP+FLHSNATSHKW LGA AELLDNSL
Sbjct  113   ATKQFWKAGDYDGKPLGNGVPQPSASGMDHVRVHPRFLHSNATSHKWALGALAELLDNSL  172

Query  1049  DEVINGATYVNIDMVKSRKDG----SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADT  882
             DEVINGATYVNIDM+++ KD     SRML++ED+GGGMDPDK+RQCMSLGYS KSKIA T
Sbjct  173   DEVINGATYVNIDMLENEKDSDKEMSRMLLVEDDGGGMDPDKMRQCMSLGYSVKSKIAST  232

Query  881   IGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDY  702
             IGQYGNGFKTSTMRLGADV+VFSR  G +GK PTQSIG+LSYTFLRSTG EDI+VPM+DY
Sbjct  233   IGQYGNGFKTSTMRLGADVLVFSRSRGKSGKRPTQSIGMLSYTFLRSTGKEDIIVPMIDY  292

Query  701   ENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDD  522
             E  +  W +++R++ +DWN ++ TI+ WSP+S+EA+LL QFN MK+ GTRI+IYNLWEDD
Sbjct  293   EYKQG-WERMVRTTSDDWNTSLRTIIAWSPYSTEAELLEQFNSMKEQGTRIIIYNLWEDD  351

Query  521   QGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPS  342
             QG LELDFDAD  DIQ+RG NRD+K+IQMA Q+PNS+H+LTYRHSLRSYASILYLR+P  
Sbjct  352   QGDLELDFDADVHDIQLRGGNRDEKNIQMANQFPNSKHYLTYRHSLRSYASILYLRLPNY  411

Query  341   FRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDV  162
             F++ILRGK++EHHNIV DMM+ +EVTYRP    +G PKDSNMVA VTIGFVKDAK HIDV
Sbjct  412   FQMILRGKEIEHHNIVTDMMLKKEVTYRP-VAPNGHPKDSNMVADVTIGFVKDAKHHIDV  470

Query  161   QGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             QGFNVYHKNRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  471   QGFNVYHKNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  523



>ref|XP_008668234.1| PREDICTED: uncharacterized protein LOC100304405 isoform X1 [Zea 
mays]
Length=797

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/417 (73%), Positives = 361/417 (87%), Gaps = 8/417 (2%)
 Frame = -3

Query  1235  IVETSSKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELL  1062
             +   ++KQFWKAGD++G P GD V+  S  GMDHVRVHP+FLHSNATSHKW LGA AELL
Sbjct  104   LAACATKQFWKAGDYDGKPLGDGVAQQSVSGMDHVRVHPRFLHSNATSHKWALGALAELL  163

Query  1061  DNSLDEVINGATYVNIDMVKSRKD----GSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSK  894
             DNSLDEVINGATYVNID++++ KD     SRML++ED+GGGMDPDK+RQCMSLGYSAKSK
Sbjct  164   DNSLDEVINGATYVNIDVLENDKDIDKKKSRMLLVEDDGGGMDPDKMRQCMSLGYSAKSK  223

Query  893   IADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVP  714
             +A TIGQYGNGFKTSTMRLGADV+VFSR  G +GK PTQSIG+LSYTFLRSTG EDI+VP
Sbjct  224   VASTIGQYGNGFKTSTMRLGADVLVFSRSPGKSGKRPTQSIGMLSYTFLRSTGKEDIIVP  283

Query  713   MLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNL  534
             M+DYE  +  W +++R++++DW+ + +TI+ WSP+S+EA+LL QF+ MKD GTRI+IYNL
Sbjct  284   MIDYEYKQG-WERMVRTTLDDWSTSFQTIITWSPYSTEAELLEQFSSMKDRGTRIIIYNL  342

Query  533   WEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLR  354
             WEDDQG LELDFDA+  DIQ+RG NRD+K+IQMA Q+PNS+H+LTYRHSLRSYASILYLR
Sbjct  343   WEDDQGDLELDFDAEIHDIQLRGGNRDEKNIQMANQFPNSKHYLTYRHSLRSYASILYLR  402

Query  353   VPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKA  174
             +P  F++ILRGK++EHHNIV DMM+ +EVTYRP    +G PKDSNMVA VTIGFVKDAK 
Sbjct  403   LPTYFQMILRGKEIEHHNIVTDMMLKKEVTYRP-VAPNGHPKDSNMVADVTIGFVKDAKH  461

Query  173   HIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HIDVQGFNVYH NRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  462   HIDVQGFNVYHMNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  518



>ref|NP_001159313.1| uncharacterized protein LOC100304405 [Zea mays]
 gb|ACN25753.1| unknown [Zea mays]
 tpg|DAA38321.1| TPA: hypothetical protein ZEAMMB73_052419 [Zea mays]
Length=798

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/417 (73%), Positives = 361/417 (87%), Gaps = 8/417 (2%)
 Frame = -3

Query  1235  IVETSSKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELL  1062
             +   ++KQFWKAGD++G P GD V+  S  GMDHVRVHP+FLHSNATSHKW LGA AELL
Sbjct  104   LAACATKQFWKAGDYDGKPLGDGVAQQSVSGMDHVRVHPRFLHSNATSHKWALGALAELL  163

Query  1061  DNSLDEVINGATYVNIDMVKSRKD----GSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSK  894
             DNSLDEVINGATYVNID++++ KD     SRML++ED+GGGMDPDK+RQCMSLGYSAKSK
Sbjct  164   DNSLDEVINGATYVNIDVLENDKDIDKKKSRMLLVEDDGGGMDPDKMRQCMSLGYSAKSK  223

Query  893   IADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVP  714
             +A TIGQYGNGFKTSTMRLGADV+VFSR  G +GK PTQSIG+LSYTFLRSTG EDI+VP
Sbjct  224   VASTIGQYGNGFKTSTMRLGADVLVFSRSPGKSGKRPTQSIGMLSYTFLRSTGKEDIIVP  283

Query  713   MLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNL  534
             M+DYE  +  W +++R++++DW+ + +TI+ WSP+S+EA+LL QF+ MKD GTRI+IYNL
Sbjct  284   MIDYEYKQG-WERMVRTTLDDWSTSFQTIITWSPYSTEAELLEQFSSMKDRGTRIIIYNL  342

Query  533   WEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLR  354
             WEDDQG LELDFDA+  DIQ+RG NRD+K+IQMA Q+PNS+H+LTYRHSLRSYASILYLR
Sbjct  343   WEDDQGDLELDFDAEIHDIQLRGGNRDEKNIQMANQFPNSKHYLTYRHSLRSYASILYLR  402

Query  353   VPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKA  174
             +P  F++ILRGK++EHHNIV DMM+ +EVTYRP    +G PKDSNMVA VTIGFVKDAK 
Sbjct  403   LPTYFQMILRGKEIEHHNIVTDMMLKKEVTYRP-VAPNGHPKDSNMVADVTIGFVKDAKH  461

Query  173   HIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HIDVQGFNVYH NRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  462   HIDVQGFNVYHMNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  518



>gb|EEE60724.1| hypothetical protein OsJ_14235 [Oryza sativa Japonica Group]
Length=788

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/411 (74%), Positives = 357/411 (87%), Gaps = 4/411 (1%)
 Frame = -3

Query  1229  ETSSKQFWKAGDFEGAPRGDWV--SSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             ++++KQFWKAGD++G P GD    SS  G+DHVRVHPKFLHSNATSHKW LGA AELLDN
Sbjct  91    KSATKQFWKAGDYDGKPLGDGAPQSSVSGLDHVRVHPKFLHSNATSHKWALGALAELLDN  150

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             SLDEVINGATYVNIDM+++ KD +RML++ED+GGGMDPDK+RQCMSLGYSAKSK+A TIG
Sbjct  151   SLDEVINGATYVNIDMLENNKDKTRMLLVEDDGGGMDPDKMRQCMSLGYSAKSKVASTIG  210

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADV+VFSR  G  GK  TQS+G+LSYTFLRST  EDIVVPM+DYE 
Sbjct  211   QYGNGFKTSTMRLGADVLVFSRSGGKGGKRLTQSVGMLSYTFLRSTNKEDIVVPMIDYE-  269

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
             N++ W +  R++  DWN +++TI+ WSP+S+EA+LL QF+ +K+ GTRI+IYNLWEDD+G
Sbjct  270   NQQGWKRKPRTTFADWNTSLQTIITWSPYSTEAELLEQFSSIKEQGTRIIIYNLWEDDEG  329

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDFD D  DIQ+RG NRD+K+I MAKQ+PNS+HFLTYRHSLRSYASILYLRVP  F+
Sbjct  330   HLELDFDEDIHDIQLRGGNRDEKNILMAKQFPNSKHFLTYRHSLRSYASILYLRVPSFFQ  389

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK++EHHNIV DMM+ +EV Y+P    +GVPKDSNMVA VTIGFVKDAK H+DVQG
Sbjct  390   MILRGKEIEHHNIVTDMMLKKEVKYKP-VAPNGVPKDSNMVADVTIGFVKDAKHHVDVQG  448

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  449   FNVYHKNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  499



>ref|XP_007227005.1| hypothetical protein PRUPE_ppa001437mg [Prunus persica]
 gb|EMJ28204.1| hypothetical protein PRUPE_ppa001437mg [Prunus persica]
Length=829

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/413 (75%), Positives = 350/413 (85%), Gaps = 17/413 (4%)
 Frame = -3

Query  1235  IVETSSKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELL  1062
             +V  S KQFWKAGD+EG   G   S  SS GMDHVRVHPKFLHSNATSHKW LGAFAELL
Sbjct  131   LVLRSCKQFWKAGDYEGGSEGMANSGFSSVGMDHVRVHPKFLHSNATSHKWALGAFAELL  190

Query  1061  DNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADT  882
             DN+LDE+  GA+YV+IDM++++KDGS MLM+EDNGGGM PDK+RQCMSLGYSAKSK+A+T
Sbjct  191   DNALDEICYGASYVHIDMLRNKKDGSEMLMVEDNGGGMAPDKMRQCMSLGYSAKSKMANT  250

Query  881   IGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDY  702
             IGQYGNGFKTSTMRLGADVIVFSRC G +G SPTQ+IG+LSY+FLR TG EDIVVP++DY
Sbjct  251   IGQYGNGFKTSTMRLGADVIVFSRCRGIDGGSPTQTIGMLSYSFLRDTGKEDIVVPIVDY  310

Query  701   ENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDD  522
             E   + W +++R S++DW RN+ TI               F   K+HGTRI+IYNLWEDD
Sbjct  311   EKTGQGWNRMVRGSLDDWERNLATI---------------FTLFKEHGTRIIIYNLWEDD  355

Query  521   QGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPS  342
             +G LELDFD DP DIQIRGVNRD+K I MAKQYPNSRHFLTYRHSLRSYASILYL++P +
Sbjct  356   EGQLELDFDTDPHDIQIRGVNRDEKKIHMAKQYPNSRHFLTYRHSLRSYASILYLKLPYN  415

Query  341   FRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDV  162
             FRIILRGKDVEHHNIVNDMM+T+EVTYRP    +G+PKD NM+A VT+GFVKDA+ HIDV
Sbjct  416   FRIILRGKDVEHHNIVNDMMLTKEVTYRPLHLPEGIPKDVNMIANVTLGFVKDARFHIDV  475

Query  161   QGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             QGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  476   QGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTIVL  528



>ref|XP_007038065.1| MORC family CW-type zinc finger protein 4, putative isoform 4 
[Theobroma cacao]
 gb|EOY22566.1| MORC family CW-type zinc finger protein 4, putative isoform 4 
[Theobroma cacao]
Length=673

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/406 (76%), Positives = 339/406 (83%), Gaps = 35/406 (9%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              KQFWKAGD++G P  DW  SSGGMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDEV
Sbjct  133   CKQFWKAGDYDGTPPADWDLSSGGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDEV  192

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              +GATYVNIDM+KS+KDG+ ML+IEDNGGGMDPDK+RQCMSLGYSAKSK+A+TIGQYGNG
Sbjct  193   CSGATYVNIDMLKSKKDGNNMLLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNG  252

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSRC G +GK PTQSIGLLSYTFL STG EDIVVPMLDYE  ++EW
Sbjct  253   FKTSTMRLGADVIVFSRCCGKDGKHPTQSIGLLSYTFLTSTGKEDIVVPMLDYEWQQREW  312

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
              +IIRS+V DW+RN+ET+V+WSPFSS  DLLRQFN MKDHGTRI+IYNLWEDDQGL ELD
Sbjct  313   KKIIRSTVSDWDRNVETVVQWSPFSSATDLLRQFNLMKDHGTRIIIYNLWEDDQGLSELD  372

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             F ADP DIQ+RGVNRD+K+IQMAK+ PNSRHFLTYRHSLRSYASILYLR+ P+FRIILRG
Sbjct  373   FHADPHDIQLRGVNRDEKNIQMAKECPNSRHFLTYRHSLRSYASILYLRLHPNFRIILRG  432

Query  320   KDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             KDVEHHNIVNDMM+T+ VTYRP   A+G PKD                            
Sbjct  433   KDVEHHNIVNDMMLTEMVTYRPNPSAEGAPKD----------------------------  464

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
                    FWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  465   -------FWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  503



>ref|XP_008454488.1| PREDICTED: uncharacterized protein LOC103494886 [Cucumis melo]
Length=818

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/408 (74%), Positives = 354/408 (87%), Gaps = 3/408 (1%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S +QFWKAGD+EG    D +SSS GMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDE
Sbjct  147   SCRQFWKAGDYEGNCNCDPISSSVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDE  206

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYVNIDM+ + +DGSRML+IEDNGGGM PDKIR+CMSLGYS+K  + +TIGQYGN
Sbjct  207   VCNGATYVNIDMLINERDGSRMLLIEDNGGGMCPDKIRRCMSLGYSSKRNMPNTIGQYGN  266

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRCSG++ + PTQSIG+LSYTFLR TG EDIVVPM+D+E  +  
Sbjct  267   GFKTSTMRLGADVIVFSRCSGSDQRGPTQSIGMLSYTFLRDTGKEDIVVPMVDFEFKDDC  326

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +++RS  +DWN+N++ I +WSP+S E +L +QFN +KDHGTRI+IYNLWEDD+  LEL
Sbjct  327   WSKMMRSE-DDWNKNLKIIAQWSPYSIE-ELFKQFNFVKDHGTRIIIYNLWEDDEDHLEL  384

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD D  DIQIRGVNRD+K+++MA+QYPNSRH+LTYRHSLR YASILYL +PP F+IILR
Sbjct  385   DFDTDLHDIQIRGVNRDEKNVKMAQQYPNSRHYLTYRHSLRIYASILYLNLPPRFKIILR  444

Query  323   GKDVEHHNIVNDMMMTQEVTYRP-QTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             GKDV+HHN+V+D+M T+E+ Y+P Q     + K SNM   VTIGFVKDA++HIDVQGFNV
Sbjct  445   GKDVKHHNVVDDLMFTKEIIYKPHQLHEKAIKKQSNMCVKVTIGFVKDARSHIDVQGFNV  504

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+WNPAGSDGRGV+GVLEANFVEPAHDKQGFERT VL
Sbjct  505   YHKNRLIKPFWRIWNPAGSDGRGVVGVLEANFVEPAHDKQGFERTIVL  552



>ref|XP_009606486.1| PREDICTED: uncharacterized protein LOC104100847 [Nicotiana tomentosiformis]
Length=792

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/419 (72%), Positives = 351/419 (84%), Gaps = 10/419 (2%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVSS---SGGMDHVRVHPKFLHSNATSHKWVLGA  1077
             +P+C      KQFWKAGD++G   G + +    + GMDHVRVHPKFLHSNATSHKW LGA
Sbjct  89    IPSC------KQFWKAGDYDGTNGGVFAAGHDHTVGMDHVRVHPKFLHSNATSHKWALGA  142

Query  1076  FAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKS  897
             FAELLDN++DEV NGATYV++D++ ++K   +ML++EDNGGGM PD++RQCMSLGYS KS
Sbjct  143   FAELLDNAMDEVCNGATYVSVDVLDNKKQKGKMLLVEDNGGGMTPDRMRQCMSLGYSVKS  202

Query  896   KIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVV  717
             K+A+TIGQYGNGFKTS+MRLGADVIVFSR       + TQS+G+LSYTFLRSTG EDIVV
Sbjct  203   KLANTIGQYGNGFKTSSMRLGADVIVFSRVGDRTSNTITQSVGMLSYTFLRSTGKEDIVV  262

Query  716   PMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQM-KDHGTRIVIY  540
             PM+D+   E+ W  +IRSS +DW RN ETIV+WSP+ SE DL +QF  + KD GTR++IY
Sbjct  263   PMIDFVKREETWETLIRSSADDWRRNSETIVQWSPYESEEDLFQQFELLNKDQGTRVIIY  322

Query  539   NLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILY  360
             NLWED++G  ELDFDADP DIQIRGV+RD+K IQMA +YPNSRHFLTY+HSLRSYASILY
Sbjct  323   NLWEDEEGCTELDFDADPHDIQIRGVSRDEKKIQMATEYPNSRHFLTYQHSLRSYASILY  382

Query  359   LRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDA  180
             LR+ P FRIILRGKDVEHHN+VNDMM+++E+TYRPQ       KD N+ AVVTIGFVKDA
Sbjct  383   LRLAPGFRIILRGKDVEHHNLVNDMMLSEEITYRPQCIGYETLKDPNVAAVVTIGFVKDA  442

Query  179   KAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             K HIDVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  443   KQHIDVQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTIVL  501



>ref|XP_010943767.1| PREDICTED: uncharacterized protein LOC105061425 [Elaeis guineensis]
Length=819

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/448 (72%), Positives = 373/448 (83%), Gaps = 4/448 (1%)
 Frame = -3

Query  1343  LPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWV  1164
             LPLGFLDPL   ++   +  P       S  A+P   V    ++FW+AG++EG P  D  
Sbjct  73    LPLGFLDPLTPEIQPMSMPAPIPMPMPIS-VALPATSVARVCRKFWQAGEYEGLPMDDSA  131

Query  1163  SSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGS  984
             S S GMDHVRVHPKFLHSNATSHKW LGA AELLDNSLDEV NGAT+VN+DM+++RKDG+
Sbjct  132   SFSAGMDHVRVHPKFLHSNATSHKWALGALAELLDNSLDEVCNGATFVNVDMLENRKDGT  191

Query  983   RMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCS  804
             +ML+IED+GGGMDPD +RQCMSLGYS KSK A+TIGQYGNGFKTSTMRLGAD IVFSR  
Sbjct  192   KMLLIEDDGGGMDPDGMRQCMSLGYSLKSKSANTIGQYGNGFKTSTMRLGADAIVFSRSC  251

Query  803   GNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQII-RSSVEDWNRNIETI  627
             G +G+ PTQSIG+LSYTFLR+TG EDI+VP++DYE   + W ++    SV  WN N+ETI
Sbjct  252   GKDGRRPTQSIGILSYTFLRTTGKEDIIVPIIDYEKEGETWSKMTWCPSV--WNNNLETI  309

Query  626   VRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDK  447
             ++WSP+ SEADLL QF+ M   GTRIVIYNLWEDDQG LELDF AD  DIQIRGVNRD++
Sbjct  310   IQWSPYFSEADLLEQFSSMSHQGTRIVIYNLWEDDQGELELDFGADIHDIQIRGVNRDER  369

Query  446   SIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEV  267
              I+M+KQ PNSRHFLTYRHSLRSYASILYLR+PPSFR+ILRGK++EHHN+V+DMM+  EV
Sbjct  370   KIEMSKQLPNSRHFLTYRHSLRSYASILYLRIPPSFRMILRGKEIEHHNLVDDMMLKHEV  429

Query  266   TYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSD  87
              Y+PQ GADG+ KDSNMVAVVT+GFVKDAK HIDVQGFNVYHKNRLIKPFWR+WN AGSD
Sbjct  430   IYKPQPGADGLLKDSNMVAVVTVGFVKDAKDHIDVQGFNVYHKNRLIKPFWRVWNAAGSD  489

Query  86    GRGVIGVLEANFVEPAHDKQGFERTTVL  3
             GRGVIGVLEANFVEPAHDKQ FERTTVL
Sbjct  490   GRGVIGVLEANFVEPAHDKQDFERTTVL  517



>emb|CDF77347.1| CRT1-like GHKL ATPase [Hordeum vulgare]
Length=792

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/409 (73%), Positives = 355/409 (87%), Gaps = 3/409 (1%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRG--DWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSL  1050
             ++KQFWKAGD++G P G  +   S+ G++HVRVHPKFLHSNATSHKW LGA AELLDNSL
Sbjct  101   TTKQFWKAGDYDGNPAGAVEPPPSASGLEHVRVHPKFLHSNATSHKWALGALAELLDNSL  160

Query  1049  DEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQY  870
             DEV NGAT+VNIDM+++ KD +RML++EDNGGGMDPDK+RQCMSLGYSAKS+ A+TIGQY
Sbjct  161   DEVRNGATFVNIDMLENSKDKTRMLLVEDNGGGMDPDKMRQCMSLGYSAKSQAANTIGQY  220

Query  869   GNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNE  690
             GNGFKTSTMRLGADV+VFSR  G  GK PTQSIG+LSYTFLRST  EDIVVPM+DYE N 
Sbjct  221   GNGFKTSTMRLGADVLVFSRSRGKEGKRPTQSIGMLSYTFLRSTCKEDIVVPMIDYEKNG  280

Query  689   KEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLL  510
               W + +RS+  DWN +++TI+ WSP+ +EA+LL QF+ +K+ GTR++IYNLWEDDQG L
Sbjct  281   MNWTRKLRSTFADWNTSLQTIITWSPYGTEAELLEQFSSIKEQGTRVIIYNLWEDDQGDL  340

Query  509   ELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRII  330
             ELDFDAD  DIQ+RG NRD+K+I+MAK++P S+HFLTYRHSLRSYASILYLR+  +F+II
Sbjct  341   ELDFDADVNDIQLRGGNRDEKNIEMAKRFPTSKHFLTYRHSLRSYASILYLRLSDAFQII  400

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             LRGK++EHHNIV DMM+ +EVTYRP    +G+PKDSNMVA VTIGFVKDAK HIDVQGFN
Sbjct  401   LRGKEIEHHNIVTDMMLKKEVTYRP-VATNGLPKDSNMVADVTIGFVKDAKFHIDVQGFN  459

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYH+NRLIKPFWR+W  +GS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  460   VYHRNRLIKPFWRVWTASGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  508



>gb|KCW86968.1| hypothetical protein EUGRSUZ_B03533 [Eucalyptus grandis]
Length=787

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/406 (73%), Positives = 347/406 (85%), Gaps = 1/406 (0%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSG-GMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             +QFWKAGD+EG    D ++S   GMD VRVHPKFLHSNATSHKW LGAFAELLDN++DEV
Sbjct  137   RQFWKAGDYEGESNRDVLASRDVGMDRVRVHPKFLHSNATSHKWALGAFAELLDNAVDEV  196

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGATYV++D++++++     L+IEDNGGGM PDK+R+CMSLGYSAKSK A+TIGQYGNG
Sbjct  197   CNGATYVHLDLLENKRKNFIALVIEDNGGGMTPDKMRKCMSLGYSAKSKAANTIGQYGNG  256

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR     G S +QSIG+LSYTFLR+TG EDI+VP++DY+   +EW
Sbjct  257   FKTSTMRLGADVIVFSRSGKLGGMSASQSIGMLSYTFLRATGKEDIIVPIVDYQKKGQEW  316

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
              +IIRSS EDWNRN ETI+ WSPF ++ +LL+QFN +++ GTRI+IYNLWEDD G LEL+
Sbjct  317   SKIIRSSTEDWNRNFETILHWSPFENKEELLQQFNSLQNQGTRIMIYNLWEDDDGSLELN  376

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             FD DP DIQIRGVNR++K I+MAKQ+PN +HFLTYRHSLRSYASILYLR PP FRIILRG
Sbjct  377   FDTDPHDIQIRGVNREEKKIKMAKQFPNLKHFLTYRHSLRSYASILYLRRPPDFRIILRG  436

Query  320   KDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
              DV HH++VNDMM++Q++TY+P   AD VP +SNMVA VTIGFVKDA  HIDVQGFNVYH
Sbjct  437   ADVRHHSLVNDMMLSQKITYKPSNVADSVPNNSNMVASVTIGFVKDASYHIDVQGFNVYH  496

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WN AGSDGRGVIGVLE NF+EPAHDKQ FERT VL
Sbjct  497   KNRLIKPFWRVWNAAGSDGRGVIGVLEVNFIEPAHDKQDFERTIVL  542



>ref|XP_009766607.1| PREDICTED: uncharacterized protein LOC104217949 [Nicotiana sylvestris]
Length=778

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/418 (71%), Positives = 348/418 (83%), Gaps = 9/418 (2%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVSS---SGGMDHVRVHPKFLHSNATSHKWVLGA  1077
             +P+C      KQFWKAGD++G   G + +    + GMDHVRVHPKFLHSNATSHKW LGA
Sbjct  89    IPSC------KQFWKAGDYDGTNGGFFAAGHDHTVGMDHVRVHPKFLHSNATSHKWALGA  142

Query  1076  FAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKS  897
             FAELLDN++DEV NGATYV++D++ + K   +ML++EDNGGGM PD++RQCMSLGYS KS
Sbjct  143   FAELLDNAMDEVCNGATYVSVDVLDNMKQKGKMLVVEDNGGGMTPDRMRQCMSLGYSVKS  202

Query  896   KIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVV  717
             ++A+TIGQYGNGFKTS+MRLGADVIVFSR       + TQ +G+LSYTFLRSTG EDIVV
Sbjct  203   RLANTIGQYGNGFKTSSMRLGADVIVFSRGRDRTSNTITQIVGMLSYTFLRSTGKEDIVV  262

Query  716   PMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYN  537
             PM+D+   E+ W  +IRSS +DW RN +TIV+WSP+ SE DL +QF  ++D GTRIVIYN
Sbjct  263   PMIDFVKREETWEMLIRSSADDWRRNSDTIVQWSPYESEQDLFQQFEFLEDQGTRIVIYN  322

Query  536   LWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYL  357
             LWED++G  ELDFDADP DIQIRGV+RD+K IQMA +YPNS HFLTY+HSLRSYASILYL
Sbjct  323   LWEDEEGCTELDFDADPHDIQIRGVSRDEKKIQMATEYPNSSHFLTYQHSLRSYASILYL  382

Query  356   RVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAK  177
             R+ P FRIILRGKDVEHHN+VNDMM+++E+TYRPQ       KD N+ AVVTIGFVKDAK
Sbjct  383   RLAPGFRIILRGKDVEHHNLVNDMMLSEEITYRPQCIGYETLKDPNVAAVVTIGFVKDAK  442

Query  176   AHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
              HIDVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  443   HHIDVQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTIVL  500



>ref|XP_006653264.1| PREDICTED: uncharacterized protein LOC102716495 [Oryza brachyantha]
Length=1071

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/462 (68%), Positives = 376/462 (81%), Gaps = 18/462 (4%)
 Frame = -3

Query  1382  RKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQFWK  1203
             ++ + SA  ++  +P GFLDPL +                ++G        ++++KQFWK
Sbjct  337   KRARVSAAGAAGDVPPGFLDPLPQA--------------VAAGEVEVEAPSKSATKQFWK  382

Query  1202  AGDFEGAPRGDWV--SSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGA  1029
             AGD++G P GD     S  G+DHVRVHPKFLHSNATSHKW LGA AELLDNSLDEVINGA
Sbjct  383   AGDYDGKPLGDGARQPSVSGLDHVRVHPKFLHSNATSHKWALGALAELLDNSLDEVINGA  442

Query  1028  TYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTS  849
             TYVNIDM+++ KD +RML++ED+GGGMDPDK+RQCMSLGYSAKSK+A TIGQYGNGFKTS
Sbjct  443   TYVNIDMLENDKDKTRMLLVEDDGGGMDPDKMRQCMSLGYSAKSKVASTIGQYGNGFKTS  502

Query  848   TMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQII  669
             TMRLGADV+VFSR  G  GK  TQSIG+LSYTFLRST  EDIVVPM+DYE NE+ W + +
Sbjct  503   TMRLGADVLVFSRSGGKGGKRHTQSIGMLSYTFLRSTNKEDIVVPMIDYE-NEQGWKRKL  561

Query  668   RSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDAD  489
             R++  DWN +++TI+ WSP+S+EA+LL QF+ +KD GTRI+IYNLWEDD+G LELDFDAD
Sbjct  562   RTTSADWNTSLQTIITWSPYSTEAELLEQFSSIKDQGTRIIIYNLWEDDEGHLELDFDAD  621

Query  488   PRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVE  309
               DIQ+RG NRD+K+I MAK++PNS+HFLTYRHSLRSYASILYLRVP  F++ILRGK++E
Sbjct  622   INDIQLRGGNRDEKNIDMAKKFPNSKHFLTYRHSLRSYASILYLRVPSFFQMILRGKEIE  681

Query  308   HHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRL  129
             HHNIV DMM+ +EV Y+P    +G PKDSNMVA VTIGFVKDAK H+DVQGFNVYHKNRL
Sbjct  682   HHNIVTDMMLKKEVKYKPVV-PNGAPKDSNMVADVTIGFVKDAKYHVDVQGFNVYHKNRL  740

Query  128   IKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             IKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  741   IKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  782



>gb|KDP26853.1| hypothetical protein JCGZ_18011 [Jatropha curcas]
Length=731

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/417 (71%), Positives = 350/417 (84%), Gaps = 8/417 (2%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAE  1068
             +    +    KQFWKAGD+E     D   S+ GMDHVRVHPKFLHSNATSHKW LGAFAE
Sbjct  133   LAVATISRGCKQFWKAGDYEEDVATDSTYSAIGMDHVRVHPKFLHSNATSHKWALGAFAE  192

Query  1067  LLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIA  888
             LLDN+LDEV NGATYVN+D+++++KDGS M+++EDNGGGM+PDK+RQCMSLGYSAKSK++
Sbjct  193   LLDNALDEVCNGATYVNVDVLENQKDGSMMILVEDNGGGMNPDKMRQCMSLGYSAKSKMS  252

Query  887   DTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPML  708
             + IGQYGNGFKTSTMRLGADVIVFSRC  ++GKSPTQSIGLLSYTFLR+TG EDIVVPM+
Sbjct  253   NAIGQYGNGFKTSTMRLGADVIVFSRC--DDGKSPTQSIGLLSYTFLRATGKEDIVVPMI  310

Query  707   DYENNEK--EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNL  534
             D+E   K  +W + IRSS+ DWN N E I++WSPF SE DL +QF  ++D GTRI+IYNL
Sbjct  311   DFEKKGKSNKWNKKIRSSLNDWNANSEIILQWSPFISEEDLFKQFEFLEDQGTRIIIYNL  370

Query  533   WEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLR  354
             WEDD+G LELDFD +P DIQIRGVNRD+++IQMAKQYP++RHFLTY+HSLRSYA+ILYLR
Sbjct  371   WEDDEGNLELDFDTNPHDIQIRGVNRDERNIQMAKQYPSARHFLTYQHSLRSYAAILYLR  430

Query  353   VPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKA  174
             +P  FRI LRGKDVEHH+IVNDM++ + + YRPQ     V  D ++ A  TIGFVKDA  
Sbjct  431   LPTGFRIFLRGKDVEHHDIVNDMILAKNIVYRPQH----VENDPDVAAYGTIGFVKDAHH  486

Query  173   HIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HIDVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIG++E NFVEPAHDKQGFERT  L
Sbjct  487   HIDVQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGLMEVNFVEPAHDKQGFERTNGL  543



>ref|XP_008790787.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Phoenix 
dactylifera]
Length=823

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/416 (75%), Positives = 356/416 (86%), Gaps = 1/416 (0%)
 Frame = -3

Query  1250  AVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFA  1071
             A+P   V    + FW AG++EG P  D  S S G+DHVRVHPKFLHSNATSHKW LGA A
Sbjct  108   ALPEPSVVRVCRNFWNAGEYEGLPMDDSTSFSVGIDHVRVHPKFLHSNATSHKWALGALA  167

Query  1070  ELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKI  891
             ELLDNSLDEV NGAT+VNIDM+++RK G++ML++ED+GGGMDPD +RQCMSLGYS KSK 
Sbjct  168   ELLDNSLDEVCNGATFVNIDMLENRKSGTKMLLVEDDGGGMDPDGMRQCMSLGYSLKSKS  227

Query  890   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPM  711
             A+TIGQYGNGFKTSTMRLGADVIVFSR  G +G+  TQSIG+LSYTFLR+TG EDIVVP+
Sbjct  228   ANTIGQYGNGFKTSTMRLGADVIVFSRSCGKHGQRATQSIGMLSYTFLRTTGKEDIVVPI  287

Query  710   LDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLW  531
             +DYE     W ++ R S   WN N+ETI++WSP+ SEADLL+QF+ M D GTRIVIYNLW
Sbjct  288   IDYEKEGDAWSKMKRCS-SVWNNNLETIIQWSPYFSEADLLQQFSSMSDQGTRIVIYNLW  346

Query  530   EDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRV  351
             EDDQG LELDF AD  DIQIRGVNRD+K I+M K++PNSRHFLTYRHSLRSYASILYLR+
Sbjct  347   EDDQGELELDFGADIHDIQIRGVNRDEKKIEMFKKFPNSRHFLTYRHSLRSYASILYLRI  406

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAH  171
             PPSFR+ILRGK+VEHHN+V+DM++  EV Y+PQ  A+G+ KDSNMVAVVT+GFVKDAK H
Sbjct  407   PPSFRMILRGKEVEHHNLVDDMLLKHEVVYKPQPVANGLLKDSNMVAVVTVGFVKDAKDH  466

Query  170   IDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             IDVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQ FERTTVL
Sbjct  467   IDVQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQDFERTTVL  522



>ref|XP_004228853.1| PREDICTED: uncharacterized protein LOC101267836 [Solanum lycopersicum]
Length=750

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/450 (67%), Positives = 358/450 (80%), Gaps = 1/450 (0%)
 Frame = -3

Query  1349  VALPLGFLDplhepveqplllpppapaETSSG-RAVPTCIVETSSKQFWKAGDFEGAPRG  1173
              ALP+GFLDPL                  ++  R     +V  S+KQFWKAGD+EG   G
Sbjct  67    AALPVGFLDPLPPEERLAFNKSLEVVVRNNNEFRVSQEKVVVASTKQFWKAGDYEGIDGG  126

Query  1172  DWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRK  993
                  + GMDHVRVHPKFLHSNATSHKW LGAFAELLDN++DEV NGATYV++D++ ++K
Sbjct  127   FAAGHAEGMDHVRVHPKFLHSNATSHKWALGAFAELLDNAMDEVCNGATYVSVDVLDNKK  186

Query  992   DGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFS  813
             +  +M+++EDNGGGM PDK+RQCMSL YSAKSK+A+TIGQYGNGFKTS+MRLG DVIVFS
Sbjct  187   EKGKMILVEDNGGGMTPDKMRQCMSLRYSAKSKLANTIGQYGNGFKTSSMRLGGDVIVFS  246

Query  812   RCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIE  633
             RC G +G S TQS+G+LSYTFLR+TG EDI+VPM+D+    + W  ++RSSV+DW RN +
Sbjct  247   RCQGKDGLSTTQSVGMLSYTFLRNTGKEDIIVPMIDFVKRGEIWEMLVRSSVDDWKRNSD  306

Query  632   TIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRD  453
             TIV+WSPF SE DL  QF  + + GTRI+IYNLWED++G  ELDFD DP DIQI+GV+RD
Sbjct  307   TIVQWSPFESEEDLFLQFELLDNQGTRIIIYNLWEDEKGETELDFDTDPHDIQIKGVSRD  366

Query  452   DKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQ  273
             +K I+MAK YPNSRHFLTY+HSLRSYASILYLR+ P FRIILRG+DVEHHN+V+DM   +
Sbjct  367   EKKIEMAKIYPNSRHFLTYQHSLRSYASILYLRLAPGFRIILRGEDVEHHNLVDDMNHAK  426

Query  272   EVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAG  93
             + TYRPQ   D   KD N VAVVTIGFVKDA+ HIDVQGF+VYHKNRLIKPFWR+WN AG
Sbjct  427   KNTYRPQPIGDETSKDPNAVAVVTIGFVKDAEHHIDVQGFSVYHKNRLIKPFWRVWNAAG  486

Query  92    SDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             SDGRG IGVLEANFV+PAHDKQ FERT VL
Sbjct  487   SDGRGAIGVLEANFVKPAHDKQDFERTIVL  516



>ref|XP_006363783.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Solanum 
tuberosum]
Length=673

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/472 (65%), Positives = 366/472 (78%), Gaps = 15/472 (3%)
 Frame = -3

Query  1385  PRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPT-CIVETSSKQF  1209
             P KK K       ALP+GFLDPL                  ++   V T  +V TS+KQF
Sbjct  62    PLKKMKV----EAALPVGFLDPLPPEERVAFNRSLEVVVRNNTELGVGTEKVVVTSNKQF  117

Query  1208  WKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGA  1029
             WKAGD+EG   G     + GMDHVRVHPKFLHSNATSHKW LGAFAELLDN++DEV NGA
Sbjct  118   WKAGDYEGIDGGFAAGHAEGMDHVRVHPKFLHSNATSHKWALGAFAELLDNAMDEVCNGA  177

Query  1028  TYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTS  849
             TYV++D++ ++K+  +M+++EDNGGGM PDK+RQCMSLGYSAKSK+A+TIGQYGNGFKTS
Sbjct  178   TYVSVDVLDNKKEKGKMILVEDNGGGMTPDKMRQCMSLGYSAKSKLANTIGQYGNGFKTS  237

Query  848   TMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQII  669
             +MRLG DVIVFSRC G +G S TQS+G+LSYTFLR+TG EDI+VPM+D+    + W  ++
Sbjct  238   SMRLGGDVIVFSRCQGKDGLSTTQSVGMLSYTFLRTTGKEDIIVPMIDFVKRGEIWEMLV  297

Query  668   RSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDAD  489
             RS+ +DW RN +TIV+WSPF SE DL  QF  + + GTRI+IYNLWED++G  ELDFD D
Sbjct  298   RSTPDDWKRNSDTIVQWSPFESEEDLFLQFELLDNQGTRIIIYNLWEDEKGDTELDFDTD  357

Query  488   PRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVE  309
             P DIQI+GV+RD+K I+MAK YPNSRHFLTY+HSLRSYASILYLR+ P F+IILRGKDVE
Sbjct  358   PHDIQIKGVSRDEKKIEMAKIYPNSRHFLTYQHSLRSYASILYLRLSPGFQIILRGKDVE  417

Query  308   HHNIVNDMMMTQEVTYRPQTGADGVPKDSNM----------VAVVTIGFVKDAKAHIDVQ  159
             HHN++NDM + ++ TYRPQ   D   KD N+          VAVVTIGFVKDA+ HIDVQ
Sbjct  418   HHNLINDMNLAKKNTYRPQPIGDETSKDPNVTSFFLLKFQAVAVVTIGFVKDAEHHIDVQ  477

Query  158   GFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             GFNVYHKNRLIKPFWR+WN AGSDGRG IGVLEANFV+PAHDKQ FERT VL
Sbjct  478   GFNVYHKNRLIKPFWRVWNAAGSDGRGAIGVLEANFVKPAHDKQDFERTIVL  529



>ref|XP_004168342.1| PREDICTED: uncharacterized LOC101203924 [Cucumis sativus]
Length=834

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/414 (73%), Positives = 352/414 (85%), Gaps = 10/414 (2%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S +QFWKAGD+EG   G  +SSS GMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDE
Sbjct  150   SCRQFWKAGDYEGNCNGHPISSSVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDE  209

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYVNIDM+ + +DGSRML+IEDNGGGM PDK+R+CMSLGYS+K  + +TIGQYGN
Sbjct  210   VCNGATYVNIDMLINERDGSRMLLIEDNGGGMCPDKMRRCMSLGYSSKRNMPNTIGQYGN  269

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSR +G++ +  TQSIG+LSYTFLR TG EDIVVPM+D+E  E  
Sbjct  270   GFKTSTMRLGADVIVFSRSNGSDQRGSTQSIGMLSYTFLRETGKEDIVVPMVDFEFKEDC  329

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +++RS  +DWNRN+E I +WSP+S E +LL QFN +KDHGTRI+IYNLWEDD+  LEL
Sbjct  330   WSKMMRSE-DDWNRNLEIIAQWSPYSIE-ELLEQFNFVKDHGTRIIIYNLWEDDEDHLEL  387

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD D  DIQIRGVNRD+K+I+MA+QYPNSRH+LTYRHSLR YASILYL +P  FRIILR
Sbjct  388   DFDTDLHDIQIRGVNRDEKNIKMAQQYPNSRHYLTYRHSLRIYASILYLSLPSGFRIILR  447

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSN-------MVAVVTIGFVKDAKAHID  165
             GKDVEHHN+ +D+M+T+E+ Y+PQ+  D V  + +       M   VTIGFVKDA++HID
Sbjct  448   GKDVEHHNLADDLMLTKEIIYKPQS-MDDVRSNLHSPQLILQMCVKVTIGFVKDARSHID  506

Query  164   VQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VQGFNVYHKNRLIKPFWR+WNPAGSDGRGV+GVLEANFVEPAHDKQGFE+T VL
Sbjct  507   VQGFNVYHKNRLIKPFWRIWNPAGSDGRGVVGVLEANFVEPAHDKQGFEKTIVL  560



>ref|XP_001784861.1| predicted protein [Physcomitrella patens]
 gb|EDQ50324.1| predicted protein [Physcomitrella patens]
Length=438

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/406 (70%), Positives = 347/406 (85%), Gaps = 1/406 (0%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              KQFWKAGD+EG P    +  +G +DHVRVHPKFLHSNATSH+W LGA AEL+DN++DE 
Sbjct  1     CKQFWKAGDYEGQP-AIVMQQAGAIDHVRVHPKFLHSNATSHRWALGAVAELVDNAVDEF  59

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
             +NGAT+VN+D+    ++ S ML+IED+GGGM PD++RQCMSLGYSAKSK A+TIGQYGNG
Sbjct  60    VNGATFVNVDVSLHPRNRSPMLVIEDDGGGMTPDRMRQCMSLGYSAKSKSANTIGQYGNG  119

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR   +NG   TQSIG+LS+TFLR TG +DIVVPM+DYE  + E 
Sbjct  120   FKTSTMRLGADVIVFSRSRASNGHRATQSIGMLSFTFLRQTGHDDIVVPMIDYEIGDGEV  179

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
              +++RS++ DW  N+E I  WSP+ SE +L  QF  MKDHGT+IV+YNLWEDDQG LELD
Sbjct  180   WKMMRSNLNDWVHNLELIQSWSPYGSEEELFDQFTGMKDHGTKIVLYNLWEDDQGQLELD  239

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             FD DP DIQIRG NRD+K I+MA+++PNS H+LTYRHSLRSY SILYLR+PP F+IILRG
Sbjct  240   FDTDPCDIQIRGANRDEKKIKMAQRFPNSSHYLTYRHSLRSYVSILYLRMPPGFKIILRG  299

Query  320   KDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             ++V+HHN+V+D+M TQE+TYRPQ+GAD V K+++M+AVVTIGFVKDAK H+++QGFNVYH
Sbjct  300   QEVQHHNLVDDLMFTQELTYRPQSGADHVAKETDMLAVVTIGFVKDAKDHVNIQGFNVYH  359

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFW++WN  GSDGRG+IGVLEANFVEPAHDKQGFERTTVL
Sbjct  360   KNRLIKPFWKIWNCTGSDGRGIIGVLEANFVEPAHDKQGFERTTVL  405



>ref|XP_002452053.1| hypothetical protein SORBIDRAFT_04g017780 [Sorghum bicolor]
 gb|EES05029.1| hypothetical protein SORBIDRAFT_04g017780 [Sorghum bicolor]
Length=706

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/418 (70%), Positives = 350/418 (84%), Gaps = 8/418 (2%)
 Frame = -3

Query  1244  PTCIVETSSKQFWKAGDFEGAPRGDWV----SSSGGMDHVRVHPKFLHSNATSHKWVLGA  1077
             P     + +KQFWKAGD+ G  + D +     S  GMDHVRVHPKFLHSNATSHKW LGA
Sbjct  104   PPAPGRSVTKQFWKAGDYVG--KSDHLLAVEHSDSGMDHVRVHPKFLHSNATSHKWALGA  161

Query  1076  FAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKS  897
             FAELLDNSLDEV+NGATYV+IDM++S+KDG+RML++EDNGGGM+PDK+R CMSLGYSAKS
Sbjct  162   FAELLDNSLDEVVNGATYVHIDMMESKKDGTRMLLVEDNGGGMNPDKMRHCMSLGYSAKS  221

Query  896   KIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVV  717
             K+ +TIGQYGNGFKTSTMRLGADV+VFSR  G  G  PTQS+G+LSYTFLRST  EDI+V
Sbjct  222   KVKNTIGQYGNGFKTSTMRLGADVLVFSRSRGIKGTRPTQSVGMLSYTFLRSTNKEDIIV  281

Query  716   PMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYN  537
             PM+DYE  EKEW +  R+++ DW  ++ETI++WSP+S+EA+L+++F  + + GTRI+IYN
Sbjct  282   PMIDYE-KEKEWKRKARTTLTDWCMSLETIIQWSPYSTEAELIQEFGSIGEQGTRIIIYN  340

Query  536   LWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYL  357
             LWEDD+G LELDFDAD  DIQIRGVNRD   IQ A Q+PNSRHF TYRHSLRSYASILYL
Sbjct  341   LWEDDEGELELDFDADANDIQIRGVNRDQNKIQKANQFPNSRHFFTYRHSLRSYASILYL  400

Query  356   RVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAK  177
             R+P +F++ILRGK +EHHNI+ND+M+ +++ Y+P T  DG+PKD +M A VTIGFVKDA+
Sbjct  401   RLPDNFKMILRGKKIEHHNIINDLMLKKQLNYKP-TVCDGLPKDMHMAAKVTIGFVKDAR  459

Query  176   AHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
              HID+QGFNVYHKNRLIKPFWR+W  AGS GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  460   QHIDIQGFNVYHKNRLIKPFWRVWTAAGSGGRGIIGVLEVNFVEPAHDKQDFERTNCL  517



>ref|XP_011087120.1| PREDICTED: uncharacterized protein LOC105168686 [Sesamum indicum]
Length=767

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/417 (70%), Positives = 345/417 (83%), Gaps = 0/417 (0%)
 Frame = -3

Query  1253  RAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAF  1074
             +AV +       KQFWKAGD+EG        S   MDH+RVHPKFLHSNATSHKW LGAF
Sbjct  115   KAVTSVAPVRGCKQFWKAGDYEGCRDAGGEVSLADMDHIRVHPKFLHSNATSHKWALGAF  174

Query  1073  AELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSK  894
             AELLDN+LDEV NGATYV +D++++ K+ ++ML+++DNGGGM PDK+RQCMSLGYSAKSK
Sbjct  175   AELLDNALDEVCNGATYVLVDVLENIKEKNKMLVVQDNGGGMTPDKMRQCMSLGYSAKSK  234

Query  893   IADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVP  714
             +A+TIGQYGNGFKTSTMRLGADV+VFSRC G  G+S TQS+G+LSY+FLR TG EDIVVP
Sbjct  235   LANTIGQYGNGFKTSTMRLGADVVVFSRCWGKYGESTTQSVGMLSYSFLRDTGKEDIVVP  294

Query  713   MLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNL  534
             M+DYE   + W   ++SS + W RN+ETIV+WSP+ SE DLLRQFN + D GTRI+IYNL
Sbjct  295   MIDYEKMGETWNMQVKSSSDCWQRNLETIVQWSPYESEEDLLRQFNFLDDQGTRIIIYNL  354

Query  533   WEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLR  354
             WED++G LELD DAD  DIQIRG NRD+K IQMA  Y +SRHFLTYRHSLRSY SILY R
Sbjct  355   WEDEEGSLELDLDADQHDIQIRGANRDEKKIQMANMYSSSRHFLTYRHSLRSYTSILYRR  414

Query  353   VPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKA  174
             +PP FRIILRGKDV+HHNI +D++ T+E+ Y+P   AD   KD NM+AVVT+GFVKDA+ 
Sbjct  415   IPPGFRIILRGKDVDHHNIADDLIHTKELVYKPAASADAAAKDPNMLAVVTLGFVKDARC  474

Query  173   HIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIG+LEANFVEPAHDKQGFERT  L
Sbjct  475   HIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGILEANFVEPAHDKQGFERTIAL  531



>ref|XP_010312212.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Solanum 
lycopersicum]
Length=846

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/423 (71%), Positives = 350/423 (83%), Gaps = 13/423 (3%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVSSSG------GMDHVRVHPKFLHSNATSHKWV  1086
             V + +  TS KQFWKAGD+EG   G+ V  SG      GMDHVRVHPKFLHSNATSHKW 
Sbjct  73    VASPVSVTSCKQFWKAGDYEGKREGNGVFFSGAYDQTVGMDHVRVHPKFLHSNATSHKWA  132

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKD-GSRMLMIEDNGGGMDPDKIRQCMSLGY  909
             LGAFAELLDN++DEV NGATYV++D++ ++KD GS+ML++EDNGGGM PD++RQCMSLGY
Sbjct  133   LGAFAELLDNAMDEVCNGATYVSVDVMDNKKDKGSKMLLVEDNGGGMTPDRMRQCMSLGY  192

Query  908   SAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGME  729
             SAKSK+A+TIGQYGNGFKTS+MRLG DVIVFSR         TQS+G+LSYTFLRSTG E
Sbjct  193   SAKSKLANTIGQYGNGFKTSSMRLGGDVIVFSRGRDRATNMLTQSVGMLSYTFLRSTGKE  252

Query  728   DIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMK-DHGTR  552
             DIVVPM+D+      W  ++RSS + W RN ETIV+WSP+ S  DL +QF  +K D GTR
Sbjct  253   DIVVPMIDFVKRGGTWEMLVRSSADVWKRNSETIVQWSPYESANDLFQQFEFLKGDQGTR  312

Query  551   IVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYA  372
             I+IYNLWED++G  ELDFD DP DIQIRGV+RD+K I+MAK+YPNSRHFLTY+HSLRSYA
Sbjct  313   IIIYNLWEDEEGGTELDFDTDPHDIQIRGVSRDEKKIEMAKEYPNSRHFLTYQHSLRSYA  372

Query  371   SILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGF  192
             SILYLR+ P FRIILRGKDVEHHN+VNDMM+++E+TYRPQ+    V  +S  VA  TIGF
Sbjct  373   SILYLRLAPGFRIILRGKDVEHHNLVNDMMLSEEITYRPQS----VGYES-FVATGTIGF  427

Query  191   VKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERT  12
             VKDAK HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERT
Sbjct  428   VKDAKHHIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERT  487

Query  11    TVL  3
              VL
Sbjct  488   IVL  490



>ref|XP_001753709.1| predicted protein [Physcomitrella patens]
 gb|EDQ81461.1| predicted protein [Physcomitrella patens]
Length=445

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/413 (68%), Positives = 350/413 (85%), Gaps = 6/413 (1%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPR------GDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELL  1062
             + KQFWKAGD++G P       G+   S   +DHVRVHPKFLHSNATSH+WVLGA AEL+
Sbjct  1     ACKQFWKAGDYDGQPAIVMQQAGENSLSCSAIDHVRVHPKFLHSNATSHRWVLGAVAELV  60

Query  1061  DNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADT  882
             DN++DEV+NGAT+VN+D+    ++ S ML+I+D+GGGM PD++RQCMSLGYS+KSK  ++
Sbjct  61    DNAVDEVMNGATFVNVDVSLHPRNRSPMLVIQDDGGGMTPDRMRQCMSLGYSSKSKSDNS  120

Query  881   IGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDY  702
             IGQYGNGFKTSTMRL ADVIVFSR   +NG   TQSIG+LS+TFLR +G +DI+VPM+DY
Sbjct  121   IGQYGNGFKTSTMRLAADVIVFSRSRASNGHRATQSIGMLSFTFLRQSGHDDIIVPMIDY  180

Query  701   ENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDD  522
             E  + E  +I+R+S++DW  N+ETI  WSP+++E +L  QF  M DHGTRIV+YNLWEDD
Sbjct  181   EVGDGEVWKIMRTSLKDWTHNLETIQTWSPYNTEEELFDQFTGMMDHGTRIVLYNLWEDD  240

Query  521   QGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPS  342
             QG LELDFD DP DIQIRG NRD+K IQMA+++PNS HFLTYR+SLRSY SILYL++PP 
Sbjct  241   QGQLELDFDTDPNDIQIRGANRDEKKIQMAQRFPNSSHFLTYRYSLRSYVSILYLKLPPK  300

Query  341   FRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDV  162
             FRIILRG++V+HH++V+D+M TQE+TYRPQ+GA+ V K+++M+AVVTIGFVKDAK H+++
Sbjct  301   FRIILRGQEVQHHSLVDDLMFTQELTYRPQSGAEHVTKETDMLAVVTIGFVKDAKDHVNI  360

Query  161   QGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             QGFNVYHKNRLIKPFW++WN  GSDGRG+IGVLEANFVEPAHDKQGFERTTVL
Sbjct  361   QGFNVYHKNRLIKPFWKIWNCTGSDGRGIIGVLEANFVEPAHDKQGFERTTVL  413



>emb|CAH66201.1| OSIGBa0148D14.7 [Oryza sativa Indica Group]
Length=772

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/411 (71%), Positives = 345/411 (84%), Gaps = 20/411 (5%)
 Frame = -3

Query  1229  ETSSKQFWKAGDFEGAPRGDWV--SSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             ++++KQFWKAGD++G P GD    SS  G+DHVRVHPKFLHSNATSHKW LGA AELLDN
Sbjct  91    KSATKQFWKAGDYDGKPLGDGAPQSSVSGLDHVRVHPKFLHSNATSHKWALGALAELLDN  150

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             SLDEVINGATYVNIDM+++ KD +RML++ED+GGGMDPDK+RQCMSLGYSAKSK+A TIG
Sbjct  151   SLDEVINGATYVNIDMLENNKDKTRMLLVEDDGGGMDPDKMRQCMSLGYSAKSKVASTIG  210

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADV+VFSR  G  GK  TQS+G+LSYTFLRST  EDIVVPM+DYE 
Sbjct  211   QYGNGFKTSTMRLGADVLVFSRSGGKGGKRLTQSVGMLSYTFLRSTNKEDIVVPMIDYE-  269

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
             N++ W +  R++  DWN +++TI+ WSP+S+EA+LL QF+ +K+ GTRI+IYNLWEDD+G
Sbjct  270   NQQGWKRKPRTTFADWNTSLQTIITWSPYSTEAELLEQFSSIKEQGTRIIIYNLWEDDEG  329

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDFD D  DIQ+RG NRD+K+I MAKQ+PNS+HFLTYRHSLRSYASILYLRVP  F+
Sbjct  330   HLELDFDEDIHDIQLRGGNRDEKNILMAKQFPNSKHFLTYRHSLRSYASILYLRVPSFFQ  389

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK++EHHNIV DMM+ +E                 MVA VTIGFVKDAK H+DVQG
Sbjct  390   MILRGKEIEHHNIVTDMMLKKE-----------------MVADVTIGFVKDAKHHVDVQG  432

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  433   FNVYHKNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  483



>ref|XP_002514868.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF47422.1| zinc finger protein, putative [Ricinus communis]
Length=786

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/405 (70%), Positives = 343/405 (85%), Gaps = 5/405 (1%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             KQFWKAGD+E     D   S+ GMDHVR+HPKFLHSNATSHKW LGAFAELLDNSLDE  
Sbjct  130   KQFWKAGDYEEVTAHDHTHSAVGMDHVRMHPKFLHSNATSHKWALGAFAELLDNSLDEYN  189

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGATYVN+D+++++KDGS ML++EDNGGGMDP K+R CMS GYS KS+ AD+IG+YGNGF
Sbjct  190   NGATYVNVDILRNQKDGSVMLLVEDNGGGMDPHKMRGCMSFGYSDKSREADSIGEYGNGF  249

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMR+GADVIVFSR  G +  SPTQSIGLLSYTFLR+TG EDIVVPM+D E   + W 
Sbjct  250   KTSTMRVGADVIVFSRSKGKDNMSPTQSIGLLSYTFLRATGKEDIVVPMIDLEKRGQGWD  309

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             + IRSS+ DWN N++ I++WSPF+SE DL +QFN ++DHGTR++IYNLWED++G +ELDF
Sbjct  310   KKIRSSLNDWNANLDIILQWSPFASEEDLNQQFNSLEDHGTRVIIYNLWEDEEGTMELDF  369

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             DADP DIQIRGVNRD+KSIQMA+ YPN +HFLTY+HSLRSYA+ILYL++P  F+I+LRGK
Sbjct  370   DADPHDIQIRGVNRDEKSIQMAETYPNCKHFLTYKHSLRSYAAILYLKLPIGFKIVLRGK  429

Query  317   DVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHK  138
             DVEHH+I +DMM+ +++TYRPQ+G      + N+VA   IGFVKDA  HID+QGF +YH+
Sbjct  430   DVEHHDISDDMMLAEDITYRPQSG-----NNLNVVAKGKIGFVKDAHHHIDIQGFCIYHR  484

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLIK + RLWN AGSDGRGVIGVLEANFV+PAHDKQGFERT VL
Sbjct  485   NRLIKAYCRLWNAAGSDGRGVIGVLEANFVKPAHDKQGFERTDVL  529



>ref|XP_004952475.1| PREDICTED: uncharacterized protein LOC101777477 [Setaria italica]
Length=811

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/412 (70%), Positives = 349/412 (85%), Gaps = 6/412 (1%)
 Frame = -3

Query  1226  TSSKQFWKAGDFEGAPRGDWVSSS----GGMDHVRVHPKFLHSNATSHKWVLGAFAELLD  1059
             T +KQFWKAGD++G+P    V ++     GM+HVRVHPKFLHSNATSHKW LGAFAELLD
Sbjct  106   TVTKQFWKAGDYDGSPHLLAVEAAEHTDSGMEHVRVHPKFLHSNATSHKWALGAFAELLD  165

Query  1058  NSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTI  879
             NSLDEV NGAT+V IDM++++KDG+RML+IED+GGGM+PDK+R CMSLGYSAKSK+ +TI
Sbjct  166   NSLDEVANGATFVKIDMIENKKDGTRMLLIEDDGGGMNPDKMRHCMSLGYSAKSKVKNTI  225

Query  878   GQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYE  699
             GQYGNGFKTSTMRLGADV+VFSR  G  G   TQSIG+LSYTFLRST  EDI+VPM+DYE
Sbjct  226   GQYGNGFKTSTMRLGADVLVFSRSRGIEGTRSTQSIGMLSYTFLRSTNKEDIIVPMIDYE  285

Query  698   NNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQ  519
               E+ W + +R+   DW  ++ETI++WSP+++EA+L+++F  + + GTRIVIYNLWEDD+
Sbjct  286   -KEQGWKRKVRTRWTDWRMSLETIIQWSPYATEAELIQEFGSIGEQGTRIVIYNLWEDDE  344

Query  518   GLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSF  339
             G LELDFDAD  DIQIRGVNRD K+IQ A Q+PNS+HF TYRHSLRSYASILYL +P +F
Sbjct  345   GELELDFDADANDIQIRGVNRDQKNIQKANQFPNSKHFFTYRHSLRSYASILYLWLPDNF  404

Query  338   RIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQ  159
             R+ILRG ++EHHNIVND+M+ +++TY+P   A+G PKD++M A+VTIGFVKDAK HID+Q
Sbjct  405   RMILRGIEIEHHNIVNDLMLKKKITYKPAM-ANGFPKDTHMAAIVTIGFVKDAKHHIDIQ  463

Query  158   GFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             GFNVYHKNRLIKPFWR+W  AGS GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  464   GFNVYHKNRLIKPFWRVWTAAGSGGRGIIGVLEVNFVEPAHDKQDFERTNCL  515



>ref|XP_006339329.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Solanum 
tuberosum]
Length=945

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/417 (71%), Positives = 344/417 (82%), Gaps = 15/417 (4%)
 Frame = -3

Query  1226  TSSKQFWKAGDFEGAPRGDWVSSSG------GMDHVRVHPKFLHSNATSHKWVLGAFAEL  1065
             TS KQFWKAGD++G   G     SG      GMDHVRVHPKFLHSNATSHKW LGAFAEL
Sbjct  83    TSCKQFWKAGDYDGKKEGCAGFFSGAYDQTVGMDHVRVHPKFLHSNATSHKWALGAFAEL  142

Query  1064  LDNSLDEVINGATYVNIDMVKSRKD-GSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIA  888
             LDN++DEV NGATYV++D++ ++KD GS+ML++EDNGGGM PD++RQCMSLGYSAKSK+A
Sbjct  143   LDNAMDEVCNGATYVSVDVMDNKKDKGSKMLLVEDNGGGMTPDRMRQCMSLGYSAKSKLA  202

Query  887   DTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPML  708
             +TIGQYGNGFKTS+MRLG DVIVFSR         TQS+G+LSYTFLRSTG EDIVVPM+
Sbjct  203   NTIGQYGNGFKTSSMRLGGDVIVFSRGRDRATNMLTQSVGMLSYTFLRSTGKEDIVVPMI  262

Query  707   DYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMK-DHGTRIVIYNLW  531
             D+      W  ++RS+ + W RN ETIV+WSP+ S+ DL +QF  +K D GTRI+IYNLW
Sbjct  263   DFVKRGGTWEMLVRSTADVWKRNSETIVQWSPYESKNDLFQQFELLKGDQGTRIIIYNLW  322

Query  530   EDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRV  351
             ED++G  ELDFD DP DIQIRGV+RD+K I+MAK+YPNSRHFLTY+HSLRSYASILYLR+
Sbjct  323   EDEEGGTELDFDTDPHDIQIRGVSRDEKKIEMAKEYPNSRHFLTYQHSLRSYASILYLRL  382

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQT-GADGVPKDSNMVAVVTIGFVKDAKA  174
              P FRIILRGKDVEHHN+VNDMM ++E+TYRPQ+ G +        VA  TIGFVKDAK 
Sbjct  383   APGFRIILRGKDVEHHNLVNDMMFSEEITYRPQSVGYE------TFVATGTIGFVKDAKH  436

Query  173   HIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HIDVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  437   HIDVQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTIVL  493



>ref|XP_004289179.1| PREDICTED: uncharacterized protein LOC101303459 [Fragaria vesca 
subsp. vesca]
Length=799

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/423 (69%), Positives = 347/423 (82%), Gaps = 20/423 (5%)
 Frame = -3

Query  1229  ETSSKQFWKAGDFEGAPRGDW----VSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELL  1062
             ++ +KQFW+AG++EG  R       +SS+ G DH R+HPKFLHSNATSHKW LGAFAELL
Sbjct  10    QSCTKQFWRAGEYEGVARNTRRNIDLSSTNGFDHARMHPKFLHSNATSHKWALGAFAELL  69

Query  1061  DNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADT  882
             DN+LDEV NGATYVN+D++ ++KDGS+ML++EDNGGGMDP+K+R+CMSLGYS KSK  DT
Sbjct  70    DNALDEVHNGATYVNVDVLDNKKDGSKMLLVEDNGGGMDPEKMRKCMSLGYSEKSKKKDT  129

Query  881   IGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDY  702
             IGQYGNGFKTSTMRLGADVIVFSR SG      TQSIGLLSYTFLRSTG EDIVVP+LDY
Sbjct  130   IGQYGNGFKTSTMRLGADVIVFSRTSG------TQSIGLLSYTFLRSTGKEDIVVPILDY  183

Query  701   ENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDD  522
             E       +++RSS E+WN+N+ETI+ WSPF SE +L  QF  MK  GTRI+IYNLWEDD
Sbjct  184   ERRRGIATEMLRSSSENWNKNLETILEWSPFESEEELKNQFRMMKQQGTRIIIYNLWEDD  243

Query  521   QGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPS  342
             +G LELD D++  DIQ+RGVNRD K+IQMA+QYPNSRHFLTYRHSLRSYA+I+YLR+PP+
Sbjct  244   EGNLELDLDSEAHDIQMRGVNRDAKNIQMAEQYPNSRHFLTYRHSLRSYAAIIYLRLPPN  303

Query  341   FRIILRGKDVEHHNIVNDMMMTQEVTYRPQ----------TGADGVPKDSNMVAVVTIGF  192
             FRIILRGKDVEHHNI+ND+M  Q +TYRP+                 KD+NMVA VT+GF
Sbjct  304   FRIILRGKDVEHHNILNDLMWPQHITYRPKPLEKEETYITKKTKKGKKDTNMVAEVTLGF  363

Query  191   VKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERT  12
             VKDA+ H+DVQGFNVYH+NRLI PFWR+WN AGSDGRGVIGV+EA+++ PAHDKQGFE T
Sbjct  364   VKDAENHLDVQGFNVYHRNRLIMPFWRVWNAAGSDGRGVIGVIEADYINPAHDKQGFEHT  423

Query  11    TVL  3
              +L
Sbjct  424   VLL  426



>ref|XP_001760025.1| predicted protein [Physcomitrella patens]
 gb|EDQ75150.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/421 (68%), Positives = 345/421 (82%), Gaps = 11/421 (3%)
 Frame = -3

Query  1259  SGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLG  1080
             S R  P     TS KQFWKAGD+EG         +G +DHVRVHPKFLHSNATSH+W LG
Sbjct  1     SARKTPES--RTSCKQFWKAGDYEGQ-HAVVTQKAGAIDHVRVHPKFLHSNATSHRWALG  57

Query  1079  AFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDN--GGGMDPDKIRQCMSLGYS  906
             A AEL+DN++DEV+NGA++VN+D+    ++ S ML+IE N  GGGM PD++RQCMSLGYS
Sbjct  58    AVAELVDNAVDEVLNGASFVNVDVSLHPRNRSPMLVIEGNNDGGGMTPDRMRQCMSLGYS  117

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
             AKSK A+TIGQYGNGFKTSTMRL ADVIVFSR   +NG   TQSIG+LS+TFLR TG +D
Sbjct  118   AKSKGANTIGQYGNGFKTSTMRLAADVIVFSRSRASNGHRATQSIGMLSFTFLRQTGHDD  177

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPM+DYE  + E  +++R+++ DW  N+ETI  WSP+ SE +L  QF  MKDHGT+IV
Sbjct  178   IVVPMIDYEIGDGEVWKMLRTTLNDWTHNLETIQTWSPYGSEEELFDQFTGMKDHGTKIV  237

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASI  366
             +YNLWEDDQG LELDFD DP DIQIRG NRD+K IQM +++PNSRHFLTYRHSLRSY SI
Sbjct  238   LYNLWEDDQGQLELDFDTDPSDIQIRGANRDEKKIQMVQRFPNSRHFLTYRHSLRSYVSI  297

Query  365   LYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVK  186
             LYL++PP F+IILRG++V+HHN+ +D+M TQE+TYRPQ+GA+      +MVAVVTIGFVK
Sbjct  298   LYLKMPPGFKIILRGQEVQHHNLTDDLMFTQELTYRPQSGAE------HMVAVVTIGFVK  351

Query  185   DAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             DAK H+++QGFNVYHKNRLIKPFW++WN  GSDGRG+IGVLEANFVEPAHDKQGFERTTV
Sbjct  352   DAKDHVNIQGFNVYHKNRLIKPFWKIWNCTGSDGRGIIGVLEANFVEPAHDKQGFERTTV  411

Query  5     L  3
             L
Sbjct  412   L  412



>ref|XP_001755592.1| predicted protein [Physcomitrella patens]
 gb|EDQ79652.1| predicted protein [Physcomitrella patens]
Length=570

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/409 (69%), Positives = 343/409 (84%), Gaps = 2/409 (0%)
 Frame = -3

Query  1226  TSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLD  1047
              S KQFWKAGD+EG P    +  +G +DHVRVHPKFLHSNATSH+W LGA AEL+DN++D
Sbjct  113   ASCKQFWKAGDYEGQP-AIVMQQAGAIDHVRVHPKFLHSNATSHRWALGAVAELVDNAVD  171

Query  1046  EVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             EV+NGAT+V++D+    ++ S ML+IED+GGGM PD++RQCMSLGYSAKSK A+TIGQYG
Sbjct  172   EVVNGATFVSVDVSLHPRNRSSMLVIEDDGGGMTPDRMRQCMSLGYSAKSKSANTIGQYG  231

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGADVIVFSR   +NG   TQSIGLLS+TFLR TG +DIVVPM+DYE  + 
Sbjct  232   NGFKTSTMRLGADVIVFSRSRASNGHRATQSIGLLSFTFLRQTGHDDIVVPMIDYEIGDG  291

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             E  +++++++ DW  N+ETI  WSP+SSE +L  QF  MKDHGT+IV+YNLWEDDQG LE
Sbjct  292   EVWKMMKTTLNDWTHNLETIQSWSPYSSEEELFDQFAGMKDHGTKIVLYNLWEDDQGQLE  351

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQIRG NRD+K IQMA+++PNS H+LTYRHSLRSY SILYLR+PP FRI+L
Sbjct  352   LDFDTDPYDIQIRGANRDEKKIQMAQRFPNSSHYLTYRHSLRSYVSILYLRMPPGFRIML  411

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQ-TGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             RG++V+H N+V+D+M TQE+TYRPQ    +    DS M+AVVTIGFVKDAK H+++QGFN
Sbjct  412   RGQEVQHRNLVDDLMFTQELTYRPQKISTNYAMCDSQMMAVVTIGFVKDAKDHVNIQGFN  471

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLIKP W++WN  GSDGRG+IGVLEANFVEPAHDKQGFERTTVL
Sbjct  472   VYHKNRLIKPLWKIWNCTGSDGRGIIGVLEANFVEPAHDKQGFERTTVL  520



>ref|XP_002304665.2| hypothetical protein POPTR_0003s16560g [Populus trichocarpa]
 gb|EEE79644.2| hypothetical protein POPTR_0003s16560g [Populus trichocarpa]
Length=748

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/418 (70%), Positives = 345/418 (83%), Gaps = 5/418 (1%)
 Frame = -3

Query  1250  AVPTCIVETSSKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGA  1077
             AVP   V    KQFWKAGD+EG    D  +  S  GMDHVRVHPKFLHSNATSHKW LGA
Sbjct  95    AVP---VVRGCKQFWKAGDYEGGSVADSSADHSGVGMDHVRVHPKFLHSNATSHKWALGA  151

Query  1076  FAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKS  897
             FAELLDN++DEV +GA+ V+ID++ + KD S+ML++EDNGGGM PD++R CMSLGYSAKS
Sbjct  152   FAELLDNAVDEVGHGASCVSIDVLNNSKDFSKMLLVEDNGGGMTPDRMRACMSLGYSAKS  211

Query  896   KIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVV  717
             K+A+TIGQYGNGFKTSTMRLGADVIVFSRC G +G S TQSIGLLSYTFL +TG EDIVV
Sbjct  212   KMANTIGQYGNGFKTSTMRLGADVIVFSRCRGKDGNSVTQSIGLLSYTFLTATGKEDIVV  271

Query  716   PMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYN  537
             PM+D+E   + W + IRSS  DW+ N++TI RWSPF+SE +LL+QFN +KD GTRI+IYN
Sbjct  272   PMIDFEKGGRGWNKKIRSSSNDWDMNLKTISRWSPFASEEELLQQFNFLKDQGTRIIIYN  331

Query  536   LWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYL  357
             LWE++ G LELDF  D  DIQIRG +RD  ++  A +YPNSRHFLTY+HSLRSYASILYL
Sbjct  332   LWEEEDGHLELDFYTDAHDIQIRGDHRDVNNVVKAAKYPNSRHFLTYQHSLRSYASILYL  391

Query  356   RVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAK  177
              +PPSFRIILRGK+VEHH++V DMM+ Q+++Y+P    + V ++ NM A   IGFVKDA 
Sbjct  392   ELPPSFRIILRGKEVEHHDLVKDMMLEQDISYKPVNVLEIVQENKNMAATGKIGFVKDAG  451

Query  176   AHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
              HIDVQGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHDKQGFERT+VL
Sbjct  452   NHIDVQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTSVL  509



>gb|ACN26838.1| unknown [Zea mays]
Length=771

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/411 (68%), Positives = 341/411 (83%), Gaps = 7/411 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWV-----SSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             +KQFWKAGD+ G P           S  GMDHVRVHPKFLHSNATSHKW LGAFAELLDN
Sbjct  86    TKQFWKAGDYVGKPDHLLAVVAAQHSDSGMDHVRVHPKFLHSNATSHKWALGAFAELLDN  145

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             SLDEV++GATYVNIDM++S+KDG+ ML+++DNGGGM+PDK+R CMSLGYSAKSK+ +TIG
Sbjct  146   SLDEVVHGATYVNIDMIESKKDGTPMLLVQDNGGGMNPDKMRHCMSLGYSAKSKVKNTIG  205

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADV+VFS   G  G  PTQS+G+LSYTFLRST  +DI+VPM+DYE 
Sbjct  206   QYGNGFKTSTMRLGADVLVFSCSRGIEGTRPTQSVGMLSYTFLRSTNRDDIIVPMIDYE-  264

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
              E EW +  R+++ DW  ++ETI++WSP+S+EA+L+++F  + + GTRI+IYNLWEDD+G
Sbjct  265   KENEWKRKARTTLTDWCMSLETIIQWSPYSTEAELIQEFGSIGEQGTRIIIYNLWEDDEG  324

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDFDAD  DIQIRGVNRD   I+ A Q+PNS+HF TYRHSLRSYASILYL +P +F+
Sbjct  325   ELELDFDADANDIQIRGVNRDQNKIKKANQFPNSKHFFTYRHSLRSYASILYLMLPDNFQ  384

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK ++HHNI+ND+M+ +++TY P  G DG+PKD ++ A VTIGFVKDA+ HID+QG
Sbjct  385   MILRGKKIDHHNIINDLMLKKQLTYNPTVG-DGLPKDMHVAAKVTIGFVKDARQHIDIQG  443

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWR+W  AG  GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  444   FNVYHKNRLIKPFWRVWTSAGVAGRGIIGVLEVNFVEPAHDKQDFERTNCL  494



>gb|AFW65721.1| hypothetical protein ZEAMMB73_223977 [Zea mays]
Length=792

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/411 (68%), Positives = 341/411 (83%), Gaps = 7/411 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWV-----SSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             +KQFWKAGD+ G P           S  GMDHVRVHPKFLHSNATSHKW LGAFAELLDN
Sbjct  107   TKQFWKAGDYVGKPDHLLAVVAAQHSDSGMDHVRVHPKFLHSNATSHKWALGAFAELLDN  166

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             SLDEV++GATYVNIDM++S+KDG+ ML+++DNGGGM+PDK+R CMSLGYSAKSK+ +TIG
Sbjct  167   SLDEVVHGATYVNIDMIESKKDGTPMLLVQDNGGGMNPDKMRHCMSLGYSAKSKVKNTIG  226

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADV+VFS   G  G  PTQS+G+LSYTFLRST  +DI+VPM+DYE 
Sbjct  227   QYGNGFKTSTMRLGADVLVFSCSRGIEGTRPTQSVGMLSYTFLRSTNRDDIIVPMIDYE-  285

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
              E EW +  R+++ DW  ++ETI++WSP+S+EA+L+++F  + + GTRI+IYNLWEDD+G
Sbjct  286   KENEWKRKARTTLTDWCMSLETIIQWSPYSTEAELIQEFGSIGEQGTRIIIYNLWEDDEG  345

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDFDAD  DIQIRGVNRD   I+ A Q+PNS+HF TYRHSLRSYASILYL +P +F+
Sbjct  346   ELELDFDADANDIQIRGVNRDQNKIKKANQFPNSKHFFTYRHSLRSYASILYLMLPDNFQ  405

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK ++HHNI+ND+M+ +++TY P  G DG+PKD ++ A VTIGFVKDA+ HID+QG
Sbjct  406   MILRGKKIDHHNIINDLMLKKQLTYNPTVG-DGLPKDMHVAAKVTIGFVKDARQHIDIQG  464

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWR+W  AG  GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  465   FNVYHKNRLIKPFWRVWTSAGVAGRGIIGVLEVNFVEPAHDKQDFERTNCL  515



>ref|XP_010682927.1| PREDICTED: uncharacterized protein LOC104897689 [Beta vulgaris 
subsp. vulgaris]
Length=753

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/473 (64%), Positives = 364/473 (77%), Gaps = 34/473 (7%)
 Frame = -3

Query  1349  VALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSS-----KQFWKAGDFEG  1185
             V LP+GFLDPL     +            ++ R+ P  I  T+S     KQFWKAGD+E 
Sbjct  60    VVLPVGFLDPLPPLEREL----------VNAHRSTPINIETTTSNSSTRKQFWKAGDYEP  109

Query  1184  A----PRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVN  1017
             +    P     S+  GMDHVRVHP+FLHSNATSHKWVLGA AELLDN+LDEV NGATYV+
Sbjct  110   SQALVPHALSSSNFAGMDHVRVHPRFLHSNATSHKWVLGALAELLDNALDEVSNGATYVS  169

Query  1016  IDMV---KSR-------KDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             IDMV   K R       KD +RML+++D+GGGM+P ++R CMSLGYSAKSK+A+TIGQYG
Sbjct  170   IDMVINEKDRDKMSIVDKDRNRMLVVQDDGGGMNPSELRSCMSLGYSAKSKMANTIGQYG  229

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLG+DVIVFS C G NG   T+SIG+LSYTFL STG EDIVVPM+DYE   +
Sbjct  230   NGFKTSTMRLGSDVIVFSLCQGKNGSCATRSIGMLSYTFLTSTGKEDIVVPMIDYEKKGE  289

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              W + +  +++DW+ N+E+I+ WSPFSSE DLL++FN + D GT+IVIYNLWEDD+  LE
Sbjct  290   VWIKKLSRTLDDWHVNLESIINWSPFSSEQDLLQEFNSLGDQGTKIVIYNLWEDDKQQLE  349

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD D  DIQIRGVNRD+K I MA++YPNS+H+LTY+HSLRSYASILYLR+PP FRIIL
Sbjct  350   LDFDTDLEDIQIRGVNRDEKKIAMARKYPNSKHYLTYQHSLRSYASILYLRLPPGFRIIL  409

Query  326   RGKDVEHHNIVNDMMMTQEVTYRP-QTGADGVPKDSN----MVAVVTIGFVKDAKAHIDV  162
             RGKDV HHN+ +DM+  +E+TYRP     +G  KD N    M A VT+GFVKDA+ H+D+
Sbjct  410   RGKDVLHHNLKDDMIHRKELTYRPVLLTTEGTEKDLNPSTDMQAFVTMGFVKDAQDHMDI  469

Query  161   QGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             QGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFV PAHDKQGFERTT L
Sbjct  470   QGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVSPAHDKQGFERTTTL  522



>ref|XP_008679744.1| PREDICTED: uncharacterized protein gpm353 isoform X1 [Zea mays]
 gb|AFW65722.1| hypothetical protein ZEAMMB73_223977 [Zea mays]
Length=801

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/411 (68%), Positives = 341/411 (83%), Gaps = 7/411 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWV-----SSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             +KQFWKAGD+ G P           S  GMDHVRVHPKFLHSNATSHKW LGAFAELLDN
Sbjct  107   TKQFWKAGDYVGKPDHLLAVVAAQHSDSGMDHVRVHPKFLHSNATSHKWALGAFAELLDN  166

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             SLDEV++GATYVNIDM++S+KDG+ ML+++DNGGGM+PDK+R CMSLGYSAKSK+ +TIG
Sbjct  167   SLDEVVHGATYVNIDMIESKKDGTPMLLVQDNGGGMNPDKMRHCMSLGYSAKSKVKNTIG  226

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADV+VFS   G  G  PTQS+G+LSYTFLRST  +DI+VPM+DYE 
Sbjct  227   QYGNGFKTSTMRLGADVLVFSCSRGIEGTRPTQSVGMLSYTFLRSTNRDDIIVPMIDYE-  285

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
              E EW +  R+++ DW  ++ETI++WSP+S+EA+L+++F  + + GTRI+IYNLWEDD+G
Sbjct  286   KENEWKRKARTTLTDWCMSLETIIQWSPYSTEAELIQEFGSIGEQGTRIIIYNLWEDDEG  345

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDFDAD  DIQIRGVNRD   I+ A Q+PNS+HF TYRHSLRSYASILYL +P +F+
Sbjct  346   ELELDFDADANDIQIRGVNRDQNKIKKANQFPNSKHFFTYRHSLRSYASILYLMLPDNFQ  405

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK ++HHNI+ND+M+ +++TY P  G DG+PKD ++ A VTIGFVKDA+ HID+QG
Sbjct  406   MILRGKKIDHHNIINDLMLKKQLTYNPTVG-DGLPKDMHVAAKVTIGFVKDARQHIDIQG  464

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWR+W  AG  GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  465   FNVYHKNRLIKPFWRVWTSAGVAGRGIIGVLEVNFVEPAHDKQDFERTNCL  515



>gb|EEC73139.1| hypothetical protein OsI_07163 [Oryza sativa Indica Group]
Length=811

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/467 (64%), Positives = 359/467 (77%), Gaps = 20/467 (4%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             G  R+ +K A   + A+P GFLDPL  P   P   PP     T               +Q
Sbjct  55    GSGREAEKRARILAAAVPPGFLDPLPRPSAPPPPPPPRGRRVT---------------RQ  99

Query  1211  FWKAGDFEGAPR---GD-WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             FW AGD++G P    GD  + S  GMDH+RVHP+FLHSNATSHKW LGAFAELLDNSLDE
Sbjct  100   FWNAGDYDGKPDLLGGDPSLRSDSGMDHIRVHPRFLHSNATSHKWALGAFAELLDNSLDE  159

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYVNIDM++++KDG+RM+ +ED+GGGMDPDK+  CMSLGYSAKSK+ DTIGQYGN
Sbjct  160   VANGATYVNIDMLENKKDGTRMVSVEDDGGGMDPDKMWHCMSLGYSAKSKVKDTIGQYGN  219

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADV+V SR  GN G+  TQSIG+LSYTFLR T  +DI+VPM+DYE  ++ 
Sbjct  220   GFKTSTMRLGADVLVLSRSCGNGGRRRTQSIGMLSYTFLRETRKDDIIVPMIDYEKGQQY  279

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +++R++  DW  ++ TI+ WSP+SSEA+LL++F+ +K+ GTRI+IYNLWE++QG LEL
Sbjct  280   WKRMMRTTSIDWQTSLATIIEWSPYSSEAELLQEFSSIKEQGTRIIIYNLWENEQGELEL  339

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD D  DIQIRG NRD K+IQ+AKQ+PNSRHF TYRHSL+SYASILYLRVP  F++ILR
Sbjct  340   DFDTDVNDIQIRGGNRDQKNIQLAKQFPNSRHFFTYRHSLQSYASILYLRVPSVFQMILR  399

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GK++EHHNI+ DMMM   V Y+P    DG P+D +M+  VTIGFVKDAK HI +QGFNVY
Sbjct  400   GKEIEHHNIIGDMMMKNHVIYKP-VMTDGFPRDIDMMTDVTIGFVKDAKHHIPIQGFNVY  458

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+W   G  GRGVIGVLE NFVEPAHDKQ FERT  L
Sbjct  459   HKNRLIKPFWRVWALPGIQGRGVIGVLEVNFVEPAHDKQDFERTNSL  505



>gb|EYU37408.1| hypothetical protein MIMGU_mgv1a025926mg, partial [Erythranthe 
guttata]
Length=551

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/419 (69%), Positives = 341/419 (81%), Gaps = 8/419 (2%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVS--SSGGMDHVRVHPKFLHSNATSHKWVLGAF  1074
             V T  V  S KQFW+AGD+E +  G      S   MDHVRVHP+FLHSNATSHKW LGAF
Sbjct  106   VTTLAVVRSCKQFWRAGDYEESGGGSSGGDVSVADMDHVRVHPRFLHSNATSHKWALGAF  165

Query  1073  AELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSK  894
             AELLDN+LDEV NGATYVN+DMV   KD ++ML+++DNGGGM PDK+RQCMSLGYSAKSK
Sbjct  166   AELLDNALDEVCNGATYVNVDMVV--KDNNKMLVVQDNGGGMTPDKMRQCMSLGYSAKSK  223

Query  893   IADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVP  714
             +A+TIGQYGNGFKTS+MRLGADVIVFSRC G  G+S TQSIGLLS+TFL+ TG EDI+VP
Sbjct  224   MANTIGQYGNGFKTSSMRLGADVIVFSRCKGQYGQSTTQSIGLLSFTFLQKTGKEDIIVP  283

Query  713   MLDYENN-EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYN  537
             ++DYE   E  W + ++SS E W RN+ET+V+WSP+ SE +L+ QFN ++D GTRIVIYN
Sbjct  284   IVDYEKTGETRWSRRLKSSNECWERNLETVVQWSPYESEDELVGQFNFLEDQGTRIVIYN  343

Query  536   LWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQ-MAKQYPNSRHFLTYRHSLRSYASILY  360
             LWEDDQGLLELDF+AD  DIQ RG NR+DK +   A  +P++R FLTYRHSLRSY SILY
Sbjct  344   LWEDDQGLLELDFEADQNDIQTRGGNREDKKLMDTANDHPSARKFLTYRHSLRSYVSILY  403

Query  359   LRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDA  180
              R+PP F I+LRGK+VE+H++VNDM+  Q+  Y+P   A    KD NM A VT+GF+KDA
Sbjct  404   RRIPPGFSIVLRGKEVENHDLVNDMIHPQKNVYKP--AASAASKDPNMSAAVTLGFIKDA  461

Query  179   KAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             + HIDVQGFNVYHKNRLI+PFWRLWN AGSDGRGVIGVLEANFVEPAHDKQGFERTT L
Sbjct  462   RHHIDVQGFNVYHKNRLIRPFWRLWNAAGSDGRGVIGVLEANFVEPAHDKQGFERTTAL  520



>gb|EEE56966.1| hypothetical protein OsJ_06680 [Oryza sativa Japonica Group]
Length=812

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/467 (63%), Positives = 357/467 (76%), Gaps = 18/467 (4%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             G  R+ +K A   + A+P GFLDPL  P                     P       ++Q
Sbjct  55    GSGREAEKRARILAAAVPPGFLDPLPRPS-------------APPPPPPPPRGRRRVTRQ  101

Query  1211  FWKAGDFEGAPR---GD-WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             FW AGD++G P    GD  + S  GMDH+RVHP+FLHSNATSHKW LGAFAELLDNSLDE
Sbjct  102   FWNAGDYDGKPDLLGGDPSLRSDSGMDHIRVHPRFLHSNATSHKWALGAFAELLDNSLDE  161

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYVNIDM++++KDG+RM+ +ED+GGGMDPDK+  CMSLGYSAKSK+ DTIGQYGN
Sbjct  162   VANGATYVNIDMLENKKDGTRMVSVEDDGGGMDPDKMWHCMSLGYSAKSKVKDTIGQYGN  221

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADV+V SR  GN G+  TQSIG+LSYTFLR T  +DI+VPM+DYE  ++ 
Sbjct  222   GFKTSTMRLGADVLVLSRSCGNGGRRRTQSIGMLSYTFLRETRKDDIIVPMIDYEKGQQY  281

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +++R++  DW  ++ TI+ WSP+SSEA+LL++F+ +K+ GTRI+IYNLWE++QG LEL
Sbjct  282   WKRMMRTTSIDWQTSLATIIEWSPYSSEAELLQEFSSIKEQGTRIIIYNLWENEQGELEL  341

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD D  DIQIRG NRD K+IQ+AKQ+PNSRHF TYRHSL+SYASILYLRVP  F++ILR
Sbjct  342   DFDTDVNDIQIRGGNRDQKNIQLAKQFPNSRHFFTYRHSLQSYASILYLRVPSVFQMILR  401

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GK++EHHNI+ DMMM   V Y+P    DG P+D +M+  VTIGFVKDAK HI +QGFNVY
Sbjct  402   GKEIEHHNIIGDMMMKNHVIYKP-VMTDGFPRDIDMMTDVTIGFVKDAKHHIPIQGFNVY  460

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+W   G  GRGVIGVLE NFVEPAHDKQ FERT  L
Sbjct  461   HKNRLIKPFWRVWALPGIQGRGVIGVLEVNFVEPAHDKQDFERTNSL  507



>ref|XP_010556113.1| PREDICTED: MORC family CW-type zinc finger protein 4 [Tarenaya 
hassleriana]
Length=705

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/430 (67%), Positives = 341/430 (79%), Gaps = 10/430 (2%)
 Frame = -3

Query  1265  TSSGR-----AVPTCIVETS----SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLH  1113
             TS GR     A+P  I         KQFWK GD+E     D+ ++  G D VRVHPKFLH
Sbjct  63    TSDGRIPVLQALPVTISRPEPRRRCKQFWKVGDYEEGLADDYDTNFVGSDRVRVHPKFLH  122

Query  1112  SNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKI  933
             SNATSHKW LGA AELLDNSLDEV NGATYV++D   +++D + ML+IEDNGGGM+P ++
Sbjct  123   SNATSHKWALGAAAELLDNSLDEVSNGATYVHVDSTINQRDKTHMLIIEDNGGGMNPTRV  182

Query  932   RQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYT  753
             RQCMS GYS K K A+TIGQYGNG KTSTMRLGAD IVFSRC GN+G++ TQSI +LS T
Sbjct  183   RQCMSFGYSGKRKQANTIGQYGNGLKTSTMRLGADAIVFSRCRGNDGRNSTQSIAMLSST  242

Query  752   FLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQ  573
             +LR T  EDIVVP++D+E    +W + I ++++DWN  + TI+ WSP+ S ADLL+QF+ 
Sbjct  243   YLRETRQEDIVVPLIDFERIGNKWNETIHTTLDDWNDRLRTIIDWSPYFSRADLLKQFDF  302

Query  572   MKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYR  393
             + + GTRIVIYNLWEDDQ  LELDFD DP DIQ+RGVNRD KSI+MAK+YPNSRHFLTYR
Sbjct  303   LNEQGTRIVIYNLWEDDQERLELDFDTDPYDIQLRGVNRDPKSIEMAKKYPNSRHFLTYR  362

Query  392   HSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMV  213
             HSLRSYASILYLR+P SF+IILRGKDVEHH+I +DMM+ QE+ Y+P    +  P +  +V
Sbjct  363   HSLRSYASILYLRLPRSFKIILRGKDVEHHDITDDMMLVQELMYKPVLNPNEAP-NKTVV  421

Query  212   AVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHD  33
             A + +GFVKDA  HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIGVLEANFVEPAHD
Sbjct  422   ASIKLGFVKDAHNHIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEANFVEPAHD  481

Query  32    KQGFERTTVL  3
             KQGFERTTVL
Sbjct  482   KQGFERTTVL  491



>ref|NP_001046827.1| Os02g0469300 [Oryza sativa Japonica Group]
 dbj|BAD19377.1| ATP-binding region, ATPase-like domain-containing protein-like 
[Oryza sativa Japonica Group]
 dbj|BAF08741.1| Os02g0469300 [Oryza sativa Japonica Group]
 dbj|BAG91204.1| unnamed protein product [Oryza sativa Japonica Group]
Length=803

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/467 (63%), Positives = 357/467 (76%), Gaps = 18/467 (4%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             G  R+ +K A   + A+P GFLDPL  P                     P       ++Q
Sbjct  55    GSGREAEKRARILAAAVPPGFLDPLPRPS-------------APPPPPPPPRGRRRVTRQ  101

Query  1211  FWKAGDFEGAPR---GD-WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             FW AGD++G P    GD  + S  GMDH+RVHP+FLHSNATSHKW LGAFAELLDNSLDE
Sbjct  102   FWNAGDYDGKPDLLGGDPSLRSDSGMDHIRVHPRFLHSNATSHKWALGAFAELLDNSLDE  161

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYVNIDM++++KDG+RM+ +ED+GGGMDPDK+  CMSLGYSAKSK+ DTIGQYGN
Sbjct  162   VANGATYVNIDMLENKKDGTRMVSVEDDGGGMDPDKMWHCMSLGYSAKSKVKDTIGQYGN  221

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADV+V SR  GN G+  TQSIG+LSYTFLR T  +DI+VPM+DYE  ++ 
Sbjct  222   GFKTSTMRLGADVLVLSRSCGNGGRRRTQSIGMLSYTFLRETRKDDIIVPMIDYEKGQQY  281

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +++R++  DW  ++ TI+ WSP+SSEA+LL++F+ +K+ GTRI+IYNLWE++QG LEL
Sbjct  282   WKRMMRTTSIDWQTSLATIIEWSPYSSEAELLQEFSSIKEQGTRIIIYNLWENEQGELEL  341

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD D  DIQIRG NRD K+IQ+AKQ+PNSRHF TYRHSL+SYASILYLRVP  F++ILR
Sbjct  342   DFDTDVNDIQIRGGNRDQKNIQLAKQFPNSRHFFTYRHSLQSYASILYLRVPSVFQMILR  401

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GK++EHHNI+ DMMM   V Y+P    DG P+D +M+  VTIGFVKDAK HI +QGFNVY
Sbjct  402   GKEIEHHNIIGDMMMKNHVIYKP-VMTDGFPRDIDMMTDVTIGFVKDAKHHIPIQGFNVY  460

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLIKPFWR+W   G  GRGVIGVLE NFVEPAHDKQ FERT  L
Sbjct  461   HKNRLIKPFWRVWALPGIQGRGVIGVLEVNFVEPAHDKQDFERTNSL  507



>ref|XP_010235427.1| PREDICTED: uncharacterized protein LOC100841444 isoform X2 [Brachypodium 
distachyon]
Length=798

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/410 (68%), Positives = 344/410 (84%), Gaps = 6/410 (1%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPR----GDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNS  1053
             +KQFWKAG++ G  +         S  GM+HVRVHP+FLHSNATSHKW LGAFAELLDNS
Sbjct  88    TKQFWKAGEYGGNRQLLGSDPAQHSDSGMEHVRVHPRFLHSNATSHKWSLGAFAELLDNS  147

Query  1052  LDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQ  873
             LDEV NGAT+VNIDM++++KDGSRML+ +D+GGGM P+KIR CMSLGYSAKSK+ + IGQ
Sbjct  148   LDEVSNGATFVNIDMLENKKDGSRMLLFQDDGGGMSPEKIRHCMSLGYSAKSKVKNAIGQ  207

Query  872   YGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN  693
             YGNGFKTSTMRLGADV+VFSR   N  +S TQSIG+LSYTFL+STG +DI+VPM+DYE  
Sbjct  208   YGNGFKTSTMRLGADVLVFSRSCSNEERSLTQSIGMLSYTFLKSTGKDDIIVPMIDYEKR  267

Query  692   EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGL  513
             +  W + +R+++ DW  +++TI++WSP+S+EA+LL++F+ + + GTRIVIYNLWED+QG 
Sbjct  268   QA-WNRKVRTTLGDWYTSLQTIIQWSPYSNEAELLQEFSAINEQGTRIVIYNLWEDEQGQ  326

Query  512   LELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRI  333
             LELDFDAD  DIQIRGVNRD+KS  MAKQ+PNS+HF TYRHSLR+YASILYLRVP  FR+
Sbjct  327   LELDFDADVNDIQIRGVNRDEKSSLMAKQFPNSKHFFTYRHSLRTYASILYLRVPYDFRM  386

Query  332   ILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGF  153
             ILRGK++EHHNI+NDMM+  +VTY+P   ++G P D++MVA VT+GFVKDAK H+ +QGF
Sbjct  387   ILRGKEIEHHNIINDMMLKNQVTYKP-VMSNGYPNDTDMVANVTVGFVKDAKHHVPIQGF  445

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYH+NRLIKPFWR+W   GS GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  446   NVYHRNRLIKPFWRVWTLPGSQGRGIIGVLEVNFVEPAHDKQDFERTNSL  495



>ref|XP_006280068.1| hypothetical protein CARUB_v10025950mg, partial [Capsella rubella]
 gb|EOA12966.1| hypothetical protein CARUB_v10025950mg, partial [Capsella rubella]
Length=737

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/416 (68%), Positives = 343/416 (82%), Gaps = 1/416 (0%)
 Frame = -3

Query  1250  AVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFA  1071
             A P  +  T S QF KAGD+EG   G+W  S+GG D VRVHPK+LH+NAT H W LGAFA
Sbjct  95    ATPCNVGATPSSQFSKAGDWEGMSGGNWEVSAGGFDRVRVHPKYLHTNATCHTWSLGAFA  154

Query  1070  ELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKI  891
             ELLDN+ DEV  GAT+VN+D++++RKDG +M++IED+GGGM+ + +R CMSLGYSAKSKI
Sbjct  155   ELLDNAYDEVRTGATFVNVDVLQNRKDGRKMILIEDDGGGMNAEMMRHCMSLGYSAKSKI  214

Query  890   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPM  711
               TIG+YGNGFK+STMRLGADVIVFSRC G +GKS T+SIGLLSYTFLRSTG E+IVVPM
Sbjct  215   EGTIGKYGNGFKSSTMRLGADVIVFSRCLGKDGKSLTKSIGLLSYTFLRSTGREEIVVPM  274

Query  710   LDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLW  531
             L+YE +  EW  + RSS  DW +N+ET+V+WSPF++E DLLRQ N +K+HGTRI+IYNLW
Sbjct  275   LEYERSGFEWCPM-RSSASDWEKNVETMVQWSPFATEEDLLRQLNLVKNHGTRIIIYNLW  333

Query  530   EDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRV  351
             EDDQG+LELDFD DP DIQ+RGVNRD+K+I MA + PNSRHFLTY++SLRSYASILY +V
Sbjct  334   EDDQGMLELDFDTDPHDIQLRGVNRDEKNIDMASKNPNSRHFLTYKYSLRSYASILYKKV  393

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAH  171
                FRIILRGK +E+H+IVNDMM+T++ TY PQ        +S++ A VTIGFVKDAK H
Sbjct  394   TGGFRIILRGKYIEYHDIVNDMMLTKKDTYHPQNRDGECANNSSLSAEVTIGFVKDAKHH  453

Query  170   IDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             +DVQGFNVYH++RLI PFWR+WN AGSDGRGVIGVL ANF+EP+HDKQGF    VL
Sbjct  454   LDVQGFNVYHQHRLIMPFWRVWNAAGSDGRGVIGVLNANFIEPSHDKQGFVTGKVL  509



>gb|EYU33525.1| hypothetical protein MIMGU_mgv1a018572mg, partial [Erythranthe 
guttata]
Length=580

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/408 (70%), Positives = 339/408 (83%), Gaps = 6/408 (1%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             + KQFW+AGD+EG   G  VS +  MDHVRVHP+FLHSNATSHKW LGAFAELLDN+LDE
Sbjct  100   NCKQFWRAGDYEGISNGGDVSLAD-MDHVRVHPRFLHSNATSHKWALGAFAELLDNALDE  158

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYVN+DMV   K  ++ML+++DNGGGM PDK+RQCMSLGYSAKSK+A+TIGQYGN
Sbjct  159   VCNGATYVNVDMVM--KANTKMLVVQDNGGGMTPDKMRQCMSLGYSAKSKMANTIGQYGN  216

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTS+MRLGADVIVFSRC G  G S TQSIGLLS+TFL++TG EDI+VP++DYE   + 
Sbjct  217   GFKTSSMRLGADVIVFSRCRGKYGLSTTQSIGLLSFTFLQNTGKEDIIVPIVDYEKTGET  276

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W + ++SS E W RN+ET+V+WSP+ SE +L+ QFN ++D GTRIVIYNLWEDD+GLLEL
Sbjct  277   WNKRLKSSDECWQRNLETVVQWSPYDSEEELVGQFNFLEDQGTRIVIYNLWEDDEGLLEL  336

Query  503   DFDADPRDIQIRGVNRDDKSIQ-MAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             DF+AD  DIQ R  NRDDK +  +A  +P+SR FLTYRHSLRSYASILY R+PP F IIL
Sbjct  337   DFEADQNDIQTRAGNRDDKKLMTIANDHPSSRRFLTYRHSLRSYASILYRRIPPGFSIIL  396

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGK+VE+H+IV+D++  Q+  Y+P   A    KD NM A VT+GF+KDA  HIDVQGFNV
Sbjct  397   RGKEVEYHDIVDDLIHPQKHVYKPVACASS--KDPNMSAAVTLGFIKDAGHHIDVQGFNV  454

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLI+PFWRLWN +GSDGRGV+GVLEANFVEPAHDKQGFERTT L
Sbjct  455   YHKNRLIRPFWRLWNASGSDGRGVVGVLEANFVEPAHDKQGFERTTAL  502



>ref|XP_010235426.1| PREDICTED: uncharacterized protein LOC100841444 isoform X1 [Brachypodium 
distachyon]
Length=799

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/411 (68%), Positives = 345/411 (84%), Gaps = 7/411 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPR----GDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNS  1053
             +KQFWKAG++ G  +         S  GM+HVRVHP+FLHSNATSHKW LGAFAELLDNS
Sbjct  88    TKQFWKAGEYGGNRQLLGSDPAQHSDSGMEHVRVHPRFLHSNATSHKWSLGAFAELLDNS  147

Query  1052  LDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQ  873
             LDEV NGAT+VNIDM++++KDGSRML+ +D+GGGM P+KIR CMSLGYSAKSK+ + IGQ
Sbjct  148   LDEVSNGATFVNIDMLENKKDGSRMLLFQDDGGGMSPEKIRHCMSLGYSAKSKVKNAIGQ  207

Query  872   YGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN  693
             YGNGFKTSTMRLGADV+VFSR   N  +S TQSIG+LSYTFL+STG +DI+VPM+DYE  
Sbjct  208   YGNGFKTSTMRLGADVLVFSRSCSNEERSLTQSIGMLSYTFLKSTGKDDIIVPMIDYEKR  267

Query  692   EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGL  513
             +  W + +R+++ DW  +++TI++WSP+S+EA+LL++F+ + + GTRIVIYNLWED+QG 
Sbjct  268   QA-WNRKVRTTLGDWYTSLQTIIQWSPYSNEAELLQEFSAINEQGTRIVIYNLWEDEQGQ  326

Query  512   LELDFDAD-PRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
             LELDFDAD  +DIQIRGVNRD+KS  MAKQ+PNS+HF TYRHSLR+YASILYLRVP  FR
Sbjct  327   LELDFDADVNQDIQIRGVNRDEKSSLMAKQFPNSKHFFTYRHSLRTYASILYLRVPYDFR  386

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK++EHHNI+NDMM+  +VTY+P   ++G P D++MVA VT+GFVKDAK H+ +QG
Sbjct  387   MILRGKEIEHHNIINDMMLKNQVTYKP-VMSNGYPNDTDMVANVTVGFVKDAKHHVPIQG  445

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYH+NRLIKPFWR+W   GS GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  446   FNVYHRNRLIKPFWRVWTLPGSQGRGIIGVLEVNFVEPAHDKQDFERTNSL  496



>ref|XP_008679745.1| PREDICTED: uncharacterized protein gpm353 isoform X2 [Zea mays]
Length=798

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/411 (67%), Positives = 338/411 (82%), Gaps = 10/411 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWV-----SSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             +KQFWKAGD+ G P           S  GMDHVRVHPKFLHSNATSHKW LGAFAELLDN
Sbjct  107   TKQFWKAGDYVGKPDHLLAVVAAQHSDSGMDHVRVHPKFLHSNATSHKWALGAFAELLDN  166

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             SLDEV++GATYVNIDM++S+KDG+ ML+++DNGGGM+PDK+R CMSLGYSAKSK+ +TIG
Sbjct  167   SLDEVVHGATYVNIDMIESKKDGTPMLLVQDNGGGMNPDKMRHCMSLGYSAKSKVKNTIG  226

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADV+VFS   G  G  PTQS+G+LSYTFLRST  +DI+VPM+DYE 
Sbjct  227   QYGNGFKTSTMRLGADVLVFSCSRGIEGTRPTQSVGMLSYTFLRSTNRDDIIVPMIDYE-  285

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
              E EW +  R+++ DW  ++ETI++WSP+S+EA+L+++F  + + GTRI+IYNLWEDD+G
Sbjct  286   KENEWKRKARTTLTDWCMSLETIIQWSPYSTEAELIQEFGSIGEQGTRIIIYNLWEDDEG  345

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDFDAD     IRGVNRD   I+ A Q+PNS+HF TYRHSLRSYASILYL +P +F+
Sbjct  346   ELELDFDADA---NIRGVNRDQNKIKKANQFPNSKHFFTYRHSLRSYASILYLMLPDNFQ  402

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK ++HHNI+ND+M+ +++TY P  G DG+PKD ++ A VTIGFVKDA+ HID+QG
Sbjct  403   MILRGKKIDHHNIINDLMLKKQLTYNPTVG-DGLPKDMHVAAKVTIGFVKDARQHIDIQG  461

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWR+W  AG  GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  462   FNVYHKNRLIKPFWRVWTSAGVAGRGIIGVLEVNFVEPAHDKQDFERTNCL  512



>ref|XP_004152321.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101203924 
[Cucumis sativus]
Length=832

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/410 (69%), Positives = 339/410 (83%), Gaps = 4/410 (1%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S +QFWKAGD+EG   G  +SSS GMDHVRVHPKFLHSNATSHKW LGAFAELLDNSLDE
Sbjct  150   SCRQFWKAGDYEGNCNGHPISSSVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNSLDE  209

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYVNIDM+ + +DGSRML+IEDNGGGM PDK+R+CMSLGYS+K  + +TIGQYGN
Sbjct  210   VCNGATYVNIDMLINERDGSRMLLIEDNGGGMCPDKMRRCMSLGYSSKRNMPNTIGQYGN  269

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSR +G++ +  TQSIG+LSYTFLR TG EDIVVPM+D+E  E  
Sbjct  270   GFKTSTMRLGADVIVFSRSNGSDQRGSTQSIGMLSYTFLRETGKEDIVVPMVDFEFKEDC  329

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWE--DDQGLL  510
             W +++RS  +DWNRN+E I +WSP+S E  L + F   +   +  ++Y   +  +++  L
Sbjct  330   WSKMMRSE-DDWNRNLEIIAQWSPYSIEELLEQSFLNXRQSSSFYLMYFAVQFCENEDHL  388

Query  509   ELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRII  330
             ELDFD D  DIQIRGVNRD+K+I+MA+QYPNSRH+LTYRHSLR YASILYL +P  FRII
Sbjct  389   ELDFDTDLHDIQIRGVNRDEKNIKMAQQYPNSRHYLTYRHSLRIYASILYLSLPSGFRII  448

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRP-QTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGF  153
             LRGKDVEHHN+ +D+M+T+E+ Y+P Q     + K S+M   VTIGFVKDA++HIDVQGF
Sbjct  449   LRGKDVEHHNLADDLMLTKEIIYKPHQLPVKAIKKQSDMCVKVTIGFVKDARSHIDVQGF  508

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLIKPFWR+WNPAGSDGRGV+GVLEANFVEPAHDKQGFE+T VL
Sbjct  509   NVYHKNRLIKPFWRIWNPAGSDGRGVVGVLEANFVEPAHDKQGFEKTIVL  558



>ref|XP_011020816.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Populus 
euphratica]
Length=648

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/382 (72%), Positives = 327/382 (86%), Gaps = 0/382 (0%)
 Frame = -3

Query  1148  MDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMI  969
             MDHVRVHPKFLHSNATSHKW LGAFAELLDN++DEV +GA+ V+ID++ + KD S+ML++
Sbjct  1     MDHVRVHPKFLHSNATSHKWALGAFAELLDNAVDEVGHGASCVSIDVLNNSKDFSKMLLV  60

Query  968   EDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGK  789
             EDNGGGM PD++R CMSLGYSAKSK+A+TIGQYGNGFKTSTMRLGADVIVFSRC G +GK
Sbjct  61    EDNGGGMTPDRMRACMSLGYSAKSKMANTIGQYGNGFKTSTMRLGADVIVFSRCRGKDGK  120

Query  788   SPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPF  609
             S TQSIGLLSYTFL +TG EDIVVPM+D+E   + W + IRSS  DW+ N++TI++WSPF
Sbjct  121   SVTQSIGLLSYTFLTATGKEDIVVPMIDFEKGGRGWNKKIRSSPNDWDMNLKTILQWSPF  180

Query  608   SSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAK  429
             +SE +LL+QFN +KD GTRI+IYNLWE++ G LELDF  D  DIQIRG +RD  ++  A 
Sbjct  181   ASEEELLQQFNFLKDQGTRIIIYNLWEEEDGHLELDFYTDAHDIQIRGDHRDVNNVVKAA  240

Query  428   QYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQT  249
             +YPNSRHFLTY+HSLRSYASILYL +PP FRIILRGK+VEHH++V DMM+ Q+++Y+P  
Sbjct  241   KYPNSRHFLTYQHSLRSYASILYLELPPGFRIILRGKEVEHHDLVKDMMLEQDISYKPVN  300

Query  248   GADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIG  69
              A+ V ++ NM A   IGFVKDA  HID+QGFNVYHKNRLIKPFWR+WN AGS GRGVIG
Sbjct  301   VAERVQENKNMAATGKIGFVKDAGNHIDIQGFNVYHKNRLIKPFWRVWNAAGSGGRGVIG  360

Query  68    VLEANFVEPAHDKQGFERTTVL  3
             VLEANFVEPAHDKQGFERT+VL
Sbjct  361   VLEANFVEPAHDKQGFERTSVL  382



>gb|EYU30357.1| hypothetical protein MIMGU_mgv1a022451mg [Erythranthe guttata]
Length=632

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/414 (69%), Positives = 337/414 (81%), Gaps = 16/414 (4%)
 Frame = -3

Query  1241  TCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELL  1062
             T  V  + KQFW+AGD+EG   G  VS +  MDHVRVHP+FLHSNATSHKW LGAFAELL
Sbjct  113   TAAVVRNCKQFWRAGDYEGISNGGDVSLAD-MDHVRVHPRFLHSNATSHKWALGAFAELL  171

Query  1061  DNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADT  882
             DN+LDEV NGATYVN+DMV   K  ++ML+++DNGGGM PDK+RQCMSLGYSAKSK+A+T
Sbjct  172   DNALDEVCNGATYVNVDMVM--KANTKMLVVQDNGGGMTPDKMRQCMSLGYSAKSKMANT  229

Query  881   IGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDY  702
             IGQYGNGFKTS+MRLGADVIVFSRC G  G S TQSIGLLS+TFL++TG EDI+VP++DY
Sbjct  230   IGQYGNGFKTSSMRLGADVIVFSRCRGKYGLSTTQSIGLLSFTFLQNTGKEDIIVPIVDY  289

Query  701   ENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDD  522
             E   + W + ++SS E W RN+ET+V+WSP+ SE +L+ QFN ++D GTRIVIYNLWEDD
Sbjct  290   EKTGETWNKRLKSSDECWQRNLETVVQWSPYDSEEELVGQFNFLEDQGTRIVIYNLWEDD  349

Query  521   QGLLELDFDADPRDIQIRGVNRDDKSIQ-MAKQYPNSRHFLTYRHSLRSYASILYLRVPP  345
             +GLLELDF+AD  DIQ R  NRDDK +  +A  +P+SR FLTYRHSLRSYASILY R+PP
Sbjct  350   EGLLELDFEADQNDIQTRAGNRDDKKLMTIANDHPSSRRFLTYRHSLRSYASILYRRIPP  409

Query  344   SFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHID  165
              F IILRGK+VE+H+IV+D++  Q+  Y+P            M A VT+GF+KDA  HID
Sbjct  410   GFSIILRGKEVEYHDIVDDLIHPQKHVYKP------------MSAAVTLGFIKDAGHHID  457

Query  164   VQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VQGFNVYHKNRLI+PFWRLWN +GSDGRGVIGVLEANFVEPAHDKQGFERTT L
Sbjct  458   VQGFNVYHKNRLIRPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTAL  511



>gb|KFK25545.1| hypothetical protein AALP_AA8G128800 [Arabis alpina]
Length=696

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/422 (67%), Positives = 338/422 (80%), Gaps = 10/422 (2%)
 Frame = -3

Query  1250  AVPTCIVE----TSSKQFWKAGDFEG-APRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             A P  IVE      S+QFWKAGD E   P   + S+      VRVHP+FLH+NATSHKW 
Sbjct  78    AKPLAIVEPVTPKLSRQFWKAGDDEDDVPIPHYCSNDAA---VRVHPQFLHANATSHKWA  134

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKD-GSRMLMIEDNGGGMDPDKIRQCMSLGY  909
             LGA AELLDNSLDE  NGATYV++D   +++D  S +L++EDNGGGM+P++ R+C+SLGY
Sbjct  135   LGALAELLDNSLDEACNGATYVHVDSKTNQRDENSNILIVEDNGGGMNPNRFRECLSLGY  194

Query  908   SAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGME  729
             S K  +A+T+GQYGNGFKTSTMRLGAD IVFSRC G NG +PTQSIG+LSYTFL  T   
Sbjct  195   SRKRNMANTVGQYGNGFKTSTMRLGADAIVFSRCRGTNGNNPTQSIGMLSYTFLYETRKC  254

Query  728   DIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRI  549
             + +VP +D+E  +  W +II SS +DW  N+ETIV+WSP+ S+ DL  QF+ + D GTRI
Sbjct  255   EAIVPTVDFELVDNNWKEIIYSSTDDWFDNLETIVKWSPYLSQQDLFDQFDFLGDQGTRI  314

Query  548   VIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYAS  369
             VIYNLWEDD+G LELDFD DP DIQ+RGVNRD+K+I MAK YPNSRHFLTYRHSLRSYAS
Sbjct  315   VIYNLWEDDEGKLELDFDTDPHDIQLRGVNRDEKNIDMAKTYPNSRHFLTYRHSLRSYAS  374

Query  368   ILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFV  189
             ILYLR+PP+FRIILRGKDVEHHN++NDMMMT+++TYRP+   +    D NMVA + +GFV
Sbjct  375   ILYLRLPPNFRIILRGKDVEHHNLLNDMMMTEDITYRPKCSGEW-SGDQNMVAAIKLGFV  433

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTT  9
             KDA  HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIG+LEANF++PAH+KQGFERT 
Sbjct  434   KDAYHHIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGILEANFIQPAHNKQGFERTV  493

Query  8     VL  3
              L
Sbjct  494   GL  495



>ref|XP_006286668.1| hypothetical protein CARUB_v10002587mg [Capsella rubella]
 gb|EOA19566.1| hypothetical protein CARUB_v10002587mg [Capsella rubella]
Length=716

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/408 (66%), Positives = 328/408 (80%), Gaps = 5/408 (1%)
 Frame = -3

Query  1220  SKQFWKAGDF-EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S+QFWKAGD  E  P   + S+      VRVHP+FLH+NATSHKW LGA AELLDNSLDE
Sbjct  86    SRQFWKAGDDDESVPLPRYCSNDAA---VRVHPQFLHANATSHKWALGALAELLDNSLDE  142

Query  1043  VINGATYVNIDMVKSRKD-GSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             V NGATYV+++   + +D  S +L++EDNGGGM+P   R+C+SLGYS K  +AD +GQYG
Sbjct  143   VNNGATYVHVNSATNERDEKSNILIVEDNGGGMNPSTFRECLSLGYSRKRNMADRVGQYG  202

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGAD IVFSRC G NG +PTQSIG+LSYTFL  T   + +VP +DYE  + 
Sbjct  203   NGFKTSTMRLGADAIVFSRCRGTNGNNPTQSIGMLSYTFLYETRKCEAIVPTVDYELVDN  262

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             EW +I+ +S + W+ N+ETIV+WSP+ SE DLL QF+ +++ GTRIVIYNLWEDD+G LE
Sbjct  263   EWKEIVYNSRDGWSDNLETIVKWSPYLSEQDLLDQFDHLEEQGTRIVIYNLWEDDEGKLE  322

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQ+RGVNRD+K+I+MAK YPNSRHFLTYRHSLRSYASILYL+ PP+FRIIL
Sbjct  323   LDFDTDPHDIQLRGVNRDEKNIEMAKAYPNSRHFLTYRHSLRSYASILYLKRPPNFRIIL  382

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGKDVEHH+I++DMMM +E TY+P    +       M A + +GFVKDA  HID+QGFNV
Sbjct  383   RGKDVEHHSILDDMMMKEEKTYKPVRSPEWSSDQDEMCATIKLGFVKDAHHHIDIQGFNV  442

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+WN AGSDGRGVIG+LEANF++PAH+KQGFERT VL
Sbjct  443   YHKNRLIKPFWRVWNAAGSDGRGVIGILEANFIQPAHNKQGFERTAVL  490



>gb|KDO64460.1| hypothetical protein CISIN_1g0033661mg, partial [Citrus sinensis]
Length=528

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/320 (83%), Positives = 297/320 (93%), Gaps = 0/320 (0%)
 Frame = -3

Query  962  NGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSP  783
            NGGGM+PDK+R CMSLGYSAKSK A+TIGQYGNGFKTSTMRLGADVIVFS C G +GKSP
Sbjct  1    NGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSP  60

Query  782  TQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSS  603
            T+SIGLLSYTFLRSTG EDIVVPMLDYE +++EW +IIRSS++DWNRN+ETIV+WSPFSS
Sbjct  61   TRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSS  120

Query  602  EADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQY  423
            EADLL QFN MKDHGTRI+IYNLWEDDQGLLELDFD+D  DIQ+RGVNRD+++I+MA+ Y
Sbjct  121  EADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHY  180

Query  422  PNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGA  243
            PNSRHFLTYRHSLRSYASILYLR+PP FRII+RGKDVEHHNIVNDMM++++VTYRPQ GA
Sbjct  181  PNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGA  240

Query  242  DGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVL  63
             G+P D +M   VTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN +GSDGRGVIGVL
Sbjct  241  SGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVL  300

Query  62   EANFVEPAHDKQGFERTTVL  3
            EANFVEPAHDKQGFERTTVL
Sbjct  301  EANFVEPAHDKQGFERTTVL  320



>gb|KDO64456.1| hypothetical protein CISIN_1g0033661mg [Citrus sinensis]
Length=666

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = -3

Query  977  LMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGN  798
            +   DNGGGM+PDK+R CMSLGYSAKSK A+TIGQYGNGFKTSTMRLGADVIVFS C G 
Sbjct  30   ICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGK  89

Query  797  NGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRW  618
            +GKSPT+SIGLLSYTFLRSTG EDIVVPMLDYE +++EW +IIRSS++DWNRN+ETIV+W
Sbjct  90   DGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQW  149

Query  617  SPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQ  438
            SPFSSEADLL QFN MKDHGTRI+IYNLWEDDQGLLELDFD+D  DIQ+RGVNRD+++I+
Sbjct  150  SPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIK  209

Query  437  MAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYR  258
            MA+ YPNSRHFLTYRHSLRSYASILYLR+PP FRII+RGKDVEHHNIVNDMM++++VTYR
Sbjct  210  MAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYR  269

Query  257  PQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRG  78
            PQ GA G+P D +M   VTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN +GSDGRG
Sbjct  270  PQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRG  329

Query  77   VIGVLEANFVEPAHDKQGFERTTVL  3
            VIGVLEANFVEPAHDKQGFERTTVL
Sbjct  330  VIGVLEANFVEPAHDKQGFERTTVL  354



>gb|KDO64458.1| hypothetical protein CISIN_1g0033661mg, partial [Citrus sinensis]
Length=606

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/320 (83%), Positives = 297/320 (93%), Gaps = 0/320 (0%)
 Frame = -3

Query  962  NGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSP  783
            NGGGM+PDK+R CMSLGYSAKSK A+TIGQYGNGFKTSTMRLGADVIVFS C G +GKSP
Sbjct  1    NGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSP  60

Query  782  TQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSS  603
            T+SIGLLSYTFLRSTG EDIVVPMLDYE +++EW +IIRSS++DWNRN+ETIV+WSPFSS
Sbjct  61   TRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSS  120

Query  602  EADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQY  423
            EADLL QFN MKDHGTRI+IYNLWEDDQGLLELDFD+D  DIQ+RGVNRD+++I+MA+ Y
Sbjct  121  EADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHY  180

Query  422  PNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGA  243
            PNSRHFLTYRHSLRSYASILYLR+PP FRII+RGKDVEHHNIVNDMM++++VTYRPQ GA
Sbjct  181  PNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGA  240

Query  242  DGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVL  63
             G+P D +M   VTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN +GSDGRGVIGVL
Sbjct  241  SGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVL  300

Query  62   EANFVEPAHDKQGFERTTVL  3
            EANFVEPAHDKQGFERTTVL
Sbjct  301  EANFVEPAHDKQGFERTTVL  320



>gb|KDO64457.1| hypothetical protein CISIN_1g0033661mg, partial [Citrus sinensis]
Length=632

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/320 (83%), Positives = 297/320 (93%), Gaps = 0/320 (0%)
 Frame = -3

Query  962  NGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSP  783
            NGGGM+PDK+R CMSLGYSAKSK A+TIGQYGNGFKTSTMRLGADVIVFS C G +GKSP
Sbjct  1    NGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSP  60

Query  782  TQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSS  603
            T+SIGLLSYTFLRSTG EDIVVPMLDYE +++EW +IIRSS++DWNRN+ETIV+WSPFSS
Sbjct  61   TRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSS  120

Query  602  EADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQY  423
            EADLL QFN MKDHGTRI+IYNLWEDDQGLLELDFD+D  DIQ+RGVNRD+++I+MA+ Y
Sbjct  121  EADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHY  180

Query  422  PNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGA  243
            PNSRHFLTYRHSLRSYASILYLR+PP FRII+RGKDVEHHNIVNDMM++++VTYRPQ GA
Sbjct  181  PNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGA  240

Query  242  DGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVL  63
             G+P D +M   VTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN +GSDGRGVIGVL
Sbjct  241  SGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVL  300

Query  62   EANFVEPAHDKQGFERTTVL  3
            EANFVEPAHDKQGFERTTVL
Sbjct  301  EANFVEPAHDKQGFERTTVL  320



>gb|KDO64459.1| hypothetical protein CISIN_1g0033661mg, partial [Citrus sinensis]
Length=548

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/320 (83%), Positives = 297/320 (93%), Gaps = 0/320 (0%)
 Frame = -3

Query  962  NGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSP  783
            NGGGM+PDK+R CMSLGYSAKSK A+TIGQYGNGFKTSTMRLGADVIVFS C G +GKSP
Sbjct  1    NGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSP  60

Query  782  TQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSS  603
            T+SIGLLSYTFLRSTG EDIVVPMLDYE +++EW +IIRSS++DWNRN+ETIV+WSPFSS
Sbjct  61   TRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSS  120

Query  602  EADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQY  423
            EADLL QFN MKDHGTRI+IYNLWEDDQGLLELDFD+D  DIQ+RGVNRD+++I+MA+ Y
Sbjct  121  EADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHY  180

Query  422  PNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGA  243
            PNSRHFLTYRHSLRSYASILYLR+PP FRII+RGKDVEHHNIVNDMM++++VTYRPQ GA
Sbjct  181  PNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGA  240

Query  242  DGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVL  63
             G+P D +M   VTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN +GSDGRGVIGVL
Sbjct  241  SGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVL  300

Query  62   EANFVEPAHDKQGFERTTVL  3
            EANFVEPAHDKQGFERTTVL
Sbjct  301  EANFVEPAHDKQGFERTTVL  320



>ref|XP_006436891.1| hypothetical protein CICLE_v10030712mg [Citrus clementina]
 gb|ESR50131.1| hypothetical protein CICLE_v10030712mg [Citrus clementina]
Length=666

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/325 (82%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = -3

Query  977  LMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGN  798
            +   DNGGGM+PDK+R CMSLGYSAKSK A+TIGQYGNGFKTSTMRLGADVIVFS C G 
Sbjct  30   ICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGK  89

Query  797  NGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRW  618
            +GKSPT+SIGLLSYTFLRS G EDIVVPMLDYE +++EW +IIRSS++DWNRN+ETIV+W
Sbjct  90   DGKSPTRSIGLLSYTFLRSAGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQW  149

Query  617  SPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQ  438
            SPFSSEADLL QFN MKDHGTRI+IYNLWEDDQGLLELDFD+D  DIQ+RGVNRD+++I+
Sbjct  150  SPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIK  209

Query  437  MAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYR  258
            MA+ YPNSRHFLTYRHSLRSYASILYLR+PP FRII+RGKDVEHHNIVNDMM++++VTYR
Sbjct  210  MAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYR  269

Query  257  PQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRG  78
            PQ GA G+P D +M   VTIGFVKDAK HIDVQGFNVYHKNRLIKPFWRLWN +GSDGRG
Sbjct  270  PQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRG  329

Query  77   VIGVLEANFVEPAHDKQGFERTTVL  3
            VIGVLEANFVEPAHDKQGFERTTVL
Sbjct  330  VIGVLEANFVEPAHDKQGFERTTVL  354



>ref|XP_006399801.1| hypothetical protein EUTSA_v10015739mg [Eutrema salsugineum]
 gb|ESQ41254.1| hypothetical protein EUTSA_v10015739mg [Eutrema salsugineum]
Length=709

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/419 (65%), Positives = 333/419 (79%), Gaps = 9/419 (2%)
 Frame = -3

Query  1244  PTCIVETS----SKQFWKAGD-FEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLG  1080
             P  IVE      S+QFWKAGD  E  P   + S+      VRVHP+FLH+NATSHKW LG
Sbjct  64    PLAIVEADTPKLSRQFWKAGDDKEDEPVPRYCSNDAA---VRVHPQFLHANATSHKWALG  120

Query  1079  AFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAK  900
             A AELLDNSLDEV NGATYV++D   + KDGS +L+++DNGGGM+P + R+C+SLGYS K
Sbjct  121   ALAELLDNSLDEVCNGATYVHVDSTTNEKDGSSILIVKDNGGGMNPSRFRECLSLGYSRK  180

Query  899   SKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIV  720
               +A+T+GQYGNGFKTSTMRLGAD IVFSRC G NG + TQS+G+LSYT+L  T   + +
Sbjct  181   RNMANTVGQYGNGFKTSTMRLGADAIVFSRCRGTNGNNATQSVGMLSYTYLYETRKCEAI  240

Query  719   VPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIY  540
             VP +D+E  +  W +I  +S ++W  N++TIV+WSPF S+ +L  QF+ + + GTRIVIY
Sbjct  241   VPTVDFELVDNNWKEITYNSTDEWFDNVDTIVKWSPFLSQQELFEQFDYLDEQGTRIVIY  300

Query  539   NLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILY  360
             NLWEDD+G LELDFD DP DIQ+RGVNRD+K+I+MAK YPNS HFLTYRHSLRSY SILY
Sbjct  301   NLWEDDEGKLELDFDTDPHDIQLRGVNRDEKNIEMAKAYPNSSHFLTYRHSLRSYVSILY  360

Query  359   LRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDA  180
             LR+PP+FRIILRGKDVEHH++++DMMMT++ TYRP    +    D +MVA + IGFVKDA
Sbjct  361   LRLPPNFRIILRGKDVEHHSLLDDMMMTEDKTYRPVRSLEW-STDEDMVASLKIGFVKDA  419

Query  179   KAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
               HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIG+LEANF++PAH+KQGFERT VL
Sbjct  420   HHHIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGILEANFIQPAHNKQGFERTAVL  478



>ref|XP_010235428.1| PREDICTED: uncharacterized protein LOC100841444 isoform X3 [Brachypodium 
distachyon]
Length=783

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/411 (66%), Positives = 333/411 (81%), Gaps = 23/411 (6%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPR----GDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNS  1053
             +KQFWKAG++ G  +         S  GM+HVRVHP+FLHSNATSHKW LGAFAELLDNS
Sbjct  88    TKQFWKAGEYGGNRQLLGSDPAQHSDSGMEHVRVHPRFLHSNATSHKWSLGAFAELLDNS  147

Query  1052  LDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQ  873
             LDEV NGAT+VNIDM++++KDGSRML+ +D+GGGM P+KIR CMSLGYSAKSK+ + IGQ
Sbjct  148   LDEVSNGATFVNIDMLENKKDGSRMLLFQDDGGGMSPEKIRHCMSLGYSAKSKVKNAIGQ  207

Query  872   YGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN  693
             YGNGFKTSTMRLGADV+VFSR   N  +S TQSIG+LSYTFL+STG +DI+VPM+DYE  
Sbjct  208   YGNGFKTSTMRLGADVLVFSRSCSNEERSLTQSIGMLSYTFLKSTGKDDIIVPMIDYEKR  267

Query  692   EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGL  513
             +  W + +R+++ DW  +++TI++WSP+S+EA+LL++F+ + + GTRIVIYNLWED+QG 
Sbjct  268   QA-WNRKVRTTLGDWYTSLQTIIQWSPYSNEAELLQEFSAINEQGTRIVIYNLWEDEQGQ  326

Query  512   LELDFDAD-PRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
             LELDFDAD  +DIQIRGVNRD+KS  MAKQ+PNS+HF TYRHSLR+YASILYLRVP  FR
Sbjct  327   LELDFDADVNQDIQIRGVNRDEKSSLMAKQFPNSKHFFTYRHSLRTYASILYLRVPYDFR  386

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK++EHHNI+NDMM+  +                 MVA VT+GFVKDAK H+ +QG
Sbjct  387   MILRGKEIEHHNIINDMMLKNQ-----------------MVANVTVGFVKDAKHHVPIQG  429

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYH+NRLIKPFWR+W   GS GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  430   FNVYHRNRLIKPFWRVWTLPGSQGRGIIGVLEVNFVEPAHDKQDFERTNSL  480



>gb|KGN52963.1| hypothetical protein Csa_4G007680 [Cucumis sativus]
Length=543

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/408 (68%), Positives = 329/408 (81%), Gaps = 30/408 (7%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S +QFWKAGD+EG   G  +SSS                         AFAELLDNSLDE
Sbjct  150   SCRQFWKAGDYEGNCNGHPISSS-------------------------AFAELLDNSLDE  184

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGATYVNIDM+ + +DGSRML+IEDNGGGM PDK+R+CMSLGYS+K  + +TIGQYGN
Sbjct  185   VCNGATYVNIDMLINERDGSRMLLIEDNGGGMCPDKMRRCMSLGYSSKRNMPNTIGQYGN  244

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSR +G++ +  TQSIG+LSYTFLR TG EDIVVPM+D+E  E  
Sbjct  245   GFKTSTMRLGADVIVFSRSNGSDQRGSTQSIGMLSYTFLRETGKEDIVVPMVDFEFKEDC  304

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +++RS  +DWNRN+E I +WSP+S E +LL QFN +KDHGTRI+IYNLWEDD+  LEL
Sbjct  305   WSKMMRSE-DDWNRNLEIIAQWSPYSIE-ELLEQFNFVKDHGTRIIIYNLWEDDEDHLEL  362

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD D  DIQIRGVNRD+K+I+MA+QYPNSRH+LTYRHSLR YASILYL +P  FRIILR
Sbjct  363   DFDTDLHDIQIRGVNRDEKNIKMAQQYPNSRHYLTYRHSLRIYASILYLSLPSGFRIILR  422

Query  323   GKDVEHHNIVNDMMMTQEVTYRP-QTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             GKDVEHHN+ +D+M+T+E+ Y+P Q     + K S++  +VTIGFVKDA++HIDVQGFNV
Sbjct  423   GKDVEHHNLADDLMLTKEIIYKPHQLPVKAIKKQSDV--IVTIGFVKDARSHIDVQGFNV  480

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+WNPAGSDGRGV+GVLEANFVEPAHDKQGFE+T VL
Sbjct  481   YHKNRLIKPFWRIWNPAGSDGRGVVGVLEANFVEPAHDKQGFEKTIVL  528



>ref|XP_010453370.1| PREDICTED: MORC family CW-type zinc finger protein 4-like, partial 
[Camelina sativa]
Length=511

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/408 (65%), Positives = 327/408 (80%), Gaps = 5/408 (1%)
 Frame = -3

Query  1220  SKQFWKAG-DFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S+QFWKAG D E  P   + S+      VRVHP+FLH+NATSHKW LGA AELLDNSLDE
Sbjct  102   SRQFWKAGEDDESVPLPHYCSNDAA---VRVHPQFLHANATSHKWALGALAELLDNSLDE  158

Query  1043  VINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             V NGATYV+++   + +DG S +L++EDNGGGM+P   R+C+SLGYS K  +A+ +GQYG
Sbjct  159   VNNGATYVHVNTATNERDGKSNILIVEDNGGGMNPSTFRECLSLGYSRKRNMANRVGQYG  218

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGAD IVFSRC G NG +PTQSIG+LSYTFL  T   + +VP +DYE    
Sbjct  219   NGFKTSTMRLGADAIVFSRCRGTNGNNPTQSIGMLSYTFLYETRKCEAIVPTVDYELVNN  278

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             EW +I+ +S ++W+ N+ETI++WSP+ SE DLL QF+ +++ GTRIVIYNLWEDD+G LE
Sbjct  279   EWKEIVYNSRDEWSDNLETIMKWSPYLSEQDLLDQFDHLEEQGTRIVIYNLWEDDEGKLE  338

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQ+RGVNRD+K+I+MAK  PNSRHFL+YRHSLRSYASILYL  P +FRIIL
Sbjct  339   LDFDTDPHDIQLRGVNRDEKNIEMAKANPNSRHFLSYRHSLRSYASILYLERPSNFRIIL  398

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGKDV+HH+I++DMMM +E TY+P    +     + M A + +GFVKDA+ HID+QGFNV
Sbjct  399   RGKDVQHHSILDDMMMMEEKTYKPMRSPEWSSDQAEMCATIKLGFVKDARHHIDIQGFNV  458

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+W  AGSDGRGVIG+LEANF++PAH+KQGFERT VL
Sbjct  459   YHKNRLIKPFWRVWTAAGSDGRGVIGILEANFIQPAHNKQGFERTAVL  506



>emb|CDX69668.1| BnaA10g20170D [Brassica napus]
Length=832

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/420 (64%), Positives = 333/420 (79%), Gaps = 10/420 (2%)
 Frame = -3

Query  1244  PTCIVETS----SKQFWKAGD-FEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLG  1080
             P  IVE      S+QFWKAGD  E  P   + S+      VRVHP+FLH+NATSHKW LG
Sbjct  76    PLAIVEADTPRLSRQFWKAGDDNEDEPVPRYCSNDAA---VRVHPQFLHANATSHKWALG  132

Query  1079  AFAELLDNSLDEVINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSA  903
             A AELLDNSLDEV NGATYV+++   + KDG S +L++EDNGGGMDP + R+C+SLGYS 
Sbjct  133   ALAELLDNSLDEVCNGATYVHVNSATNEKDGKSSILIVEDNGGGMDPGRFRECLSLGYSR  192

Query  902   KSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDI  723
             K  +A+ +GQYGNGFKTSTMRLGAD IVFSRC G NG   TQSIG+LSYTFL  T   + 
Sbjct  193   KRNMANKVGQYGNGFKTSTMRLGADAIVFSRCRGTNGNKTTQSIGMLSYTFLYETRKCEA  252

Query  722   VVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVI  543
             +VP +D+E  +  W +I  +S ++W  N+ETIV+WSP+S++  L  QF+ +++ GTRIVI
Sbjct  253   IVPTVDFELVDNTWKEITYNSTDEWFDNLETIVKWSPYSTQDQLFEQFDHLEEQGTRIVI  312

Query  542   YNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASIL  363
             YNLW+DD+G LELDFD DP DIQ+RGVNRD+K+I+MAK YPNSRHFLTYRHSLRSY SIL
Sbjct  313   YNLWDDDEGKLELDFDTDPHDIQLRGVNRDEKNIEMAKTYPNSRHFLTYRHSLRSYVSIL  372

Query  362   YLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKD  183
             YLR+PP+F+IILRGK+VEHH++++DMMMT++ TYRP   A+    +  MVA + +GFVKD
Sbjct  373   YLRLPPNFKIILRGKEVEHHSLLDDMMMTEDKTYRPVRSAE-CSSNEEMVADLKLGFVKD  431

Query  182   AKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             A  HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIG++EANF++PAH+KQGFERT VL
Sbjct  432   AHHHIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGLVEANFIQPAHNKQGFERTAVL  491



>ref|XP_002871548.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47807.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=710

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/422 (66%), Positives = 335/422 (79%), Gaps = 12/422 (3%)
 Frame = -3

Query  1244  PTCIVETS----SKQFWKAGDF-EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLG  1080
             P  IVE      S+QFWKAGD  E AP   + S+      VRVHP+FLH+NATSHKW LG
Sbjct  66    PLAIVEPETPKLSRQFWKAGDDDEAAPVPLYCSNDAA---VRVHPQFLHANATSHKWALG  122

Query  1079  AFAELLDNSLDEVINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSA  903
             A AELLDNSLDEV NGATYV++D   +++DG S +L++EDNGGGM+P   R+ +SLGYS 
Sbjct  123   ALAELLDNSLDEVSNGATYVHVDSTTNKRDGKSSILIVEDNGGGMNPSTFREFLSLGYSR  182

Query  902   KSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDI  723
             K  + + +GQYGNGFKTSTMRLGAD IVFSRC G NG +PTQSIG+LSYTFL  T   + 
Sbjct  183   KRNLVNRVGQYGNGFKTSTMRLGADAIVFSRCRGINGNNPTQSIGMLSYTFLYETRKCEA  242

Query  722   VVP--MLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRI  549
             +VP   +D+E  + +W +I+ +S E+W  N+ETIVRWSP+ S+ DLL QFN +++ GTRI
Sbjct  243   IVPTVQIDFELVDNKWKEIVYNSTEEWVDNLETIVRWSPYLSQQDLLDQFNHLEEQGTRI  302

Query  548   VIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYAS  369
             VIYNLWEDD+G LELDFD DP DIQ+RGVNRD+K+I+MAK YPNSRHFLTYRHSLRSYAS
Sbjct  303   VIYNLWEDDEGKLELDFDTDPHDIQLRGVNRDEKNIEMAKTYPNSRHFLTYRHSLRSYAS  362

Query  368   ILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFV  189
             ILYL+ P +FRIILRGKDVE+H+I++DMMMT E TY+P T +   P    MVA + +GFV
Sbjct  363   ILYLKHPDNFRIILRGKDVEYHSILDDMMMTDEKTYKP-TRSPEWPDQDEMVASLKLGFV  421

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTT  9
             KDA  HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIG+LEANF++PAH+KQGFERT 
Sbjct  422   KDAHHHIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGILEANFIQPAHNKQGFERTV  481

Query  8     VL  3
             VL
Sbjct  482   VL  483



>ref|XP_010492059.1| PREDICTED: uncharacterized protein LOC104769529 isoform X2 [Camelina 
sativa]
Length=752

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 327/408 (80%), Gaps = 6/408 (1%)
 Frame = -3

Query  1220  SKQFWKAG-DFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S+QFWKAG D E  P   + S+      VRVHP+FLH+NATSHKW LGA AELLDNSLDE
Sbjct  103   SRQFWKAGEDDESVPIPRYCSNDAA---VRVHPQFLHANATSHKWALGALAELLDNSLDE  159

Query  1043  VINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             V NGATYV+++   + +DG S +L++EDNGGGM+P   R+C+SLGYS K  +A+ +GQYG
Sbjct  160   VNNGATYVHVNTATNERDGKSNILIVEDNGGGMNPSTFRECLSLGYSRKRNMANRVGQYG  219

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGAD IVFSRC G NG +PTQSIG+LSYTFL  T   + +VP +DYE    
Sbjct  220   NGFKTSTMRLGADAIVFSRCRGTNGNNPTQSIGMLSYTFLYETRKCEAIVPTVDYELVNN  279

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             EW +I+ +S +DW+ N+ETI++WSP+ SE DLL QF+ +++ GTRIVIYNLWEDD+G LE
Sbjct  280   EWKEIVYNSRDDWSDNLETIMKWSPYLSEQDLLDQFDHLEEQGTRIVIYNLWEDDEGKLE  339

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQ+RGVNRD+K+I+MAK  PNSRHFLTYRHSLRSYASILYL  P +FRIIL
Sbjct  340   LDFDTDPHDIQLRGVNRDEKNIEMAKANPNSRHFLTYRHSLRSYASILYLERPSNFRIIL  399

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGKDV+HH+I++DMMM +E TY+P    +    D  M A + +GFVKDA+ HID+QGFNV
Sbjct  400   RGKDVQHHSILDDMMMMEEKTYKPMRSPEW-SSDQEMFATIKLGFVKDARHHIDIQGFNV  458

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+W  AGSDGRGVIG+LEANF++PAH+KQGFERT VL
Sbjct  459   YHKNRLIKPFWRVWTAAGSDGRGVIGILEANFIQPAHNKQGFERTAVL  506



>gb|EEC77006.1| hypothetical protein OsI_15335 [Oryza sativa Indica Group]
Length=764

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/411 (68%), Positives = 327/411 (80%), Gaps = 30/411 (7%)
 Frame = -3

Query  1229  ETSSKQFWKAGDFEGAPRGDWV--SSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
             ++++KQFWKAGD++G P GD    SS  G+DHVRVHPKFLHSNATSHKW LGA AELLDN
Sbjct  93    KSATKQFWKAGDYDGKPLGDGAPQSSVSGLDHVRVHPKFLHSNATSHKWALGALAELLDN  152

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             SLDE                     M+++E         K  QCMSLGYSAKSK+A TIG
Sbjct  153   SLDE---------------------MMVVE-----WTQTKCWQCMSLGYSAKSKVASTIG  186

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGADV+VFSR  G  GK  TQS+G+LSYTFLRST  EDIVVPM+DYEN
Sbjct  187   QYGNGFKTSTMRLGADVLVFSRSGGKGGKRLTQSVGMLSYTFLRSTNKEDIVVPMIDYEN  246

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
              ++ W +  R++  DWN +++TI+ WSP+S+EA+LL QF+ +K+ GTRI+IYNLWEDD+G
Sbjct  247   -QQGWKRKPRTTFADWNTSLQTIITWSPYSTEAELLEQFSSIKEQGTRIIIYNLWEDDEG  305

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
              LELDFD D  DIQ+RG NRD+K+I MAKQ+PNS+HFLTYRHSLRSYASILYLRVP  F+
Sbjct  306   HLELDFDEDIHDIQLRGGNRDEKNILMAKQFPNSKHFLTYRHSLRSYASILYLRVPSFFQ  365

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             +ILRGK++EHHNIV DMM+ +EV Y+P    +GVPKDSNMVA VTIGFVKDAK H+DVQG
Sbjct  366   MILRGKEIEHHNIVTDMMLKKEVKYKP-VAPNGVPKDSNMVADVTIGFVKDAKHHVDVQG  424

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYHKNRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  425   FNVYHKNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  475



>ref|XP_001756757.1| predicted protein [Physcomitrella patens]
 gb|EDQ78354.1| predicted protein [Physcomitrella patens]
Length=416

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/406 (65%), Positives = 326/406 (80%), Gaps = 5/406 (1%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWKAGD+EG P       SGG+DHVRVHPKFLHSNATSHKW LGA AE+LDNS+DEV
Sbjct  1     CRQFWKAGDYEGVPTIT-THQSGGIDHVRVHPKFLHSNATSHKWALGAIAEILDNSMDEV  59

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+VN+DM+++ +DGS ML IEDNGGGM P+++R+CMSLG+S KSK  +TIGQYGNG
Sbjct  60    KNGATFVNVDMIRNPRDGSPMLYIEDNGGGMTPERMRECMSLGFSTKSKSGNTIGQYGNG  119

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR   + G+    SIG+LS+TFLRSTG +DIVVPM+DYE  +   
Sbjct  120   FKTSTMRLGADVIVFSRSPADAGRR--HSIGVLSFTFLRSTGHDDIVVPMVDYELKDGMI  177

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               +IRS+ +DW  N+ TI +WSP+ +E DL  QF  M + GT+++IYNLWED+ G +ELD
Sbjct  178   CPLIRSTAKDWAHNLRTIQQWSPYCTEHDLFTQFFGMTEKGTKVIIYNLWEDEHGRVELD  237

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             F++D  DIQ+R  + D++ I MA++Y  SRH+LTY+HSLRSYASILY R PP FRIILRG
Sbjct  238   FESDRHDIQVRSEDLDERKIAMAQRYTYSRHYLTYQHSLRSYASILYYRHPPGFRIILRG  297

Query  320   KDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             +DV HHN+ +D+M TQE++Y+PQ       +D  MVA V +GF+KDAK H+DVQGF+VYH
Sbjct  298   QDVPHHNLADDLMYTQELSYKPQGFESS--RDVKMVATVVMGFIKDAKEHVDVQGFSVYH  355

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WN AGSDGRG++GVLEANFVEPAHDKQ FERT VL
Sbjct  356   KNRLIKPFWRVWNTAGSDGRGIVGVLEANFVEPAHDKQSFERTAVL  401



>ref|XP_009121795.1| PREDICTED: uncharacterized protein LOC103846600 [Brassica rapa]
Length=833

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/420 (64%), Positives = 332/420 (79%), Gaps = 10/420 (2%)
 Frame = -3

Query  1244  PTCIVETS----SKQFWKAGD-FEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLG  1080
             P  IVE      S+QFWKAGD  E  P   + S+      VRVHP+F H+NATSHKW LG
Sbjct  76    PLAIVEADTPRLSRQFWKAGDDNEDEPVPRYCSNDAA---VRVHPQFFHANATSHKWALG  132

Query  1079  AFAELLDNSLDEVINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSA  903
             A AELLDNSLDEV NGATYV+++   + KDG S +L++EDNGGGMDP + R+C+SLGYS 
Sbjct  133   ALAELLDNSLDEVCNGATYVHVNSATNEKDGKSSILIVEDNGGGMDPGRFRECLSLGYSR  192

Query  902   KSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDI  723
             K  +A+ +GQYGNGFKTSTMRLGAD IVFSRC G NG   TQSIG+LSYTFL  T   + 
Sbjct  193   KRNMANKVGQYGNGFKTSTMRLGADAIVFSRCRGTNGNKTTQSIGMLSYTFLYETRKCEA  252

Query  722   VVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVI  543
             +VP +D+E  +  W +I  +S ++W  N+ETIV+WSP+S++  L  QF+ +++ GTRIVI
Sbjct  253   IVPTVDFELVDNTWKEITYNSTDEWFDNLETIVKWSPYSTQDQLFEQFDHLEEQGTRIVI  312

Query  542   YNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASIL  363
             YNLW+DD+G LELDFD DP DIQ+RGVNRD+K+I+MAK YPNSRHFLTYRHSLRSY SIL
Sbjct  313   YNLWDDDEGKLELDFDTDPHDIQLRGVNRDEKNIEMAKTYPNSRHFLTYRHSLRSYVSIL  372

Query  362   YLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKD  183
             YLR+PP+F+IILRGK+VEHH++++DMMMT++ TYRP   A+    +  MVA + +GFVKD
Sbjct  373   YLRLPPNFKIILRGKEVEHHSLLDDMMMTEDKTYRPVRSAE-CSSNEEMVADLKLGFVKD  431

Query  182   AKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             A  HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIG++EANF++PAH+KQGFERT VL
Sbjct  432   AHHHIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGLVEANFIQPAHNKQGFERTAVL  491



>emb|CDX97228.1| BnaC09g43970D [Brassica napus]
Length=830

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/420 (64%), Positives = 333/420 (79%), Gaps = 10/420 (2%)
 Frame = -3

Query  1244  PTCIVETS----SKQFWKAGD-FEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLG  1080
             P  IVE      S+QFWKAGD  E  P   + S+      VRVHP+FLH+NATSHKW LG
Sbjct  76    PLAIVEADTPRLSRQFWKAGDDNEDEPVPRYCSNDAA---VRVHPQFLHANATSHKWALG  132

Query  1079  AFAELLDNSLDEVINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSA  903
             A AELLDNSLDEV NGATYV+++   + KDG S +L++EDNGGGMDP + R+C+SLGYS 
Sbjct  133   ALAELLDNSLDEVCNGATYVHVNSATNEKDGKSSILIVEDNGGGMDPGRFRECLSLGYSR  192

Query  902   KSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDI  723
             K  +A+ +GQYGNGFKTSTMRLGAD IVFSRC G NG   TQSIG+LSYTFL  T   + 
Sbjct  193   KRNMANKVGQYGNGFKTSTMRLGADAIVFSRCRGANGNKTTQSIGMLSYTFLYETRKCEA  252

Query  722   VVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVI  543
             +VP +D+E  +  W +I  +S ++W  N+ETIV+WSP+S++  L  QF+ +++ GTRIVI
Sbjct  253   IVPTVDFELVDNSWKEITYNSTDEWFDNLETIVKWSPYSTQDQLFDQFDHLEEQGTRIVI  312

Query  542   YNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASIL  363
             YNLW+DD+G LELDFD DP DIQ+RGVNRD+K+I+MAK YPNSRHFLTYRHSLRSY SIL
Sbjct  313   YNLWDDDEGKLELDFDTDPHDIQLRGVNRDEKNIEMAKTYPNSRHFLTYRHSLRSYVSIL  372

Query  362   YLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKD  183
             YLR+PP+F+IILRGK+VEHH++++DMMMT++ TYRP   A+    +  MVA + +GFVKD
Sbjct  373   YLRLPPNFKIILRGKEVEHHSLLDDMMMTEDKTYRPVRSAE-CSSNEEMVADLKLGFVKD  431

Query  182   AKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             A  HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIG++EANF++PAH+KQGFERT VL
Sbjct  432   AHHHIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGLVEANFIQPAHNKQGFERTAVL  491



>ref|XP_010492058.1| PREDICTED: MORC family CW-type zinc finger protein 4-like isoform 
X1 [Camelina sativa]
Length=753

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 327/408 (80%), Gaps = 5/408 (1%)
 Frame = -3

Query  1220  SKQFWKAG-DFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S+QFWKAG D E  P   +  S+     VRVHP+FLH+NATSHKW LGA AELLDNSLDE
Sbjct  103   SRQFWKAGEDDESVPIPRYSGSNDAA--VRVHPQFLHANATSHKWALGALAELLDNSLDE  160

Query  1043  VINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             V NGATYV+++   + +DG S +L++EDNGGGM+P   R+C+SLGYS K  +A+ +GQYG
Sbjct  161   VNNGATYVHVNTATNERDGKSNILIVEDNGGGMNPSTFRECLSLGYSRKRNMANRVGQYG  220

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGAD IVFSRC G NG +PTQSIG+LSYTFL  T   + +VP +DYE    
Sbjct  221   NGFKTSTMRLGADAIVFSRCRGTNGNNPTQSIGMLSYTFLYETRKCEAIVPTVDYELVNN  280

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             EW +I+ +S +DW+ N+ETI++WSP+ SE DLL QF+ +++ GTRIVIYNLWEDD+G LE
Sbjct  281   EWKEIVYNSRDDWSDNLETIMKWSPYLSEQDLLDQFDHLEEQGTRIVIYNLWEDDEGKLE  340

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQ+RGVNRD+K+I+MAK  PNSRHFLTYRHSLRSYASILYL  P +FRIIL
Sbjct  341   LDFDTDPHDIQLRGVNRDEKNIEMAKANPNSRHFLTYRHSLRSYASILYLERPSNFRIIL  400

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGKDV+HH+I++DMMM +E TY+P    +    D  M A + +GFVKDA+ HID+QGFNV
Sbjct  401   RGKDVQHHSILDDMMMMEEKTYKPMRSPEW-SSDQEMFATIKLGFVKDARHHIDIQGFNV  459

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+W  AGSDGRGVIG+LEANF++PAH+KQGFERT VL
Sbjct  460   YHKNRLIKPFWRVWTAAGSDGRGVIGILEANFIQPAHNKQGFERTAVL  507



>ref|XP_010424073.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Camelina 
sativa]
Length=713

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 327/408 (80%), Gaps = 5/408 (1%)
 Frame = -3

Query  1220  SKQFWKAG-DFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S+QFWKAG D E  P   + S+      VRVHP+FLH+NATSHKW LGA AELLDNSLDE
Sbjct  103   SRQFWKAGEDDESVPLPRYCSNDAA---VRVHPQFLHANATSHKWALGALAELLDNSLDE  159

Query  1043  VINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             V NGATYV+++   + +DG S +L++EDNGGGM+P   R+C+SLGYS K  +A+ +GQYG
Sbjct  160   VNNGATYVHVNTATNERDGKSNILIVEDNGGGMNPSTFRECLSLGYSRKRNMANRVGQYG  219

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGAD IVFSRC G NG +PTQSIG+LSYTFL  T   + +VP +DYE    
Sbjct  220   NGFKTSTMRLGADAIVFSRCRGTNGNNPTQSIGMLSYTFLYETRKCEAIVPTVDYELVNN  279

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             EW +I+ +S ++W+ N+ETI++WSP+ SE DLL QF+ +++ GTRIVIYNLWEDD+G LE
Sbjct  280   EWKEIVYNSRDEWSDNLETIMKWSPYLSEQDLLDQFDHLEEQGTRIVIYNLWEDDEGKLE  339

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQ+RGVNRD+K+I+MAK  PNSRHFL+YRHSLRSYASILYL+ P +FRIIL
Sbjct  340   LDFDTDPHDIQLRGVNRDEKNIEMAKANPNSRHFLSYRHSLRSYASILYLKRPSNFRIIL  399

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGKDV+HH+I++DMMM +E TY+P    +       M A + +GFVKDA+ HID+QGFNV
Sbjct  400   RGKDVQHHSILDDMMMMEEKTYKPMRSPEWSSDQDEMRATIKLGFVKDARHHIDIQGFNV  459

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+W  AGSDGRGVIG++EANF++PAH+KQGFERT VL
Sbjct  460   YHKNRLIKPFWRVWTAAGSDGRGVIGIIEANFIQPAHNKQGFERTAVL  507



>emb|CAC05441.1| putative protein [Arabidopsis thaliana]
Length=706

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 328/408 (80%), Gaps = 6/408 (1%)
 Frame = -3

Query  1220  SKQFWKAGDF-EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S+QFWKAGD  E AP   + S+      VRVHP+FLH+NATSHKW LGA AELLDNSLDE
Sbjct  75    SRQFWKAGDDDEAAPVPLYCSNDAA---VRVHPQFLHANATSHKWALGALAELLDNSLDE  131

Query  1043  VINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             V NGATYV++D   +++DG S +L++EDNGGGM+P   R+C+SLGYS K  +A+ +GQYG
Sbjct  132   VSNGATYVHVDSTINKRDGKSSILIVEDNGGGMNPSTFRECLSLGYSRKRNMANRVGQYG  191

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGAD IVFSR  G NG +PTQSIG+LSYTFL  T   + +VP +DYE  + 
Sbjct  192   NGFKTSTMRLGADAIVFSRSRGINGNNPTQSIGMLSYTFLYETRKCEAIVPTVDYELVDN  251

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             +W +I+ +S  +W  N+ETI+RWSP+ S+ DLL QFN +++ GTRIVIYNLWEDD+G +E
Sbjct  252   KWKEIVYNSTNEWLDNLETILRWSPYLSQQDLLDQFNHLEEQGTRIVIYNLWEDDEGKME  311

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQ+RGVNRD+K+I MAK YPNSRHFLTYRHSLRSYASILYL+ P +FRIIL
Sbjct  312   LDFDTDPHDIQLRGVNRDEKNIDMAKTYPNSRHFLTYRHSLRSYASILYLKRPDNFRIIL  371

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG+DVEHH++++DMM  +E TY+P    +  P    MVA + +GFVKDA  HID+QGFNV
Sbjct  372   RGEDVEHHSVLDDMMKIEEKTYKPMRSPEW-PDQEEMVASLKLGFVKDAHHHIDIQGFNV  430

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+WN AGSDGRGVIG+LEANF++PAH+KQGFERT VL
Sbjct  431   YHKNRLIKPFWRVWNAAGSDGRGVIGILEANFIQPAHNKQGFERTVVL  478



>ref|NP_196817.2| histidine kinase-like ATPase domain-containing protein [Arabidopsis 
thaliana]
 gb|AED91854.1| histidine kinase-like ATPase domain-containing protein [Arabidopsis 
thaliana]
Length=708

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 328/408 (80%), Gaps = 6/408 (1%)
 Frame = -3

Query  1220  SKQFWKAGDF-EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S+QFWKAGD  E AP   + S+      VRVHP+FLH+NATSHKW LGA AELLDNSLDE
Sbjct  75    SRQFWKAGDDDEAAPVPLYCSNDAA---VRVHPQFLHANATSHKWALGALAELLDNSLDE  131

Query  1043  VINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             V NGATYV++D   +++DG S +L++EDNGGGM+P   R+C+SLGYS K  +A+ +GQYG
Sbjct  132   VSNGATYVHVDSTINKRDGKSSILIVEDNGGGMNPSTFRECLSLGYSRKRNMANRVGQYG  191

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGAD IVFSR  G NG +PTQSIG+LSYTFL  T   + +VP +DYE  + 
Sbjct  192   NGFKTSTMRLGADAIVFSRSRGINGNNPTQSIGMLSYTFLYETRKCEAIVPTVDYELVDN  251

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             +W +I+ +S  +W  N+ETI+RWSP+ S+ DLL QFN +++ GTRIVIYNLWEDD+G +E
Sbjct  252   KWKEIVYNSTNEWLDNLETILRWSPYLSQQDLLDQFNHLEEQGTRIVIYNLWEDDEGKME  311

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQ+RGVNRD+K+I MAK YPNSRHFLTYRHSLRSYASILYL+ P +FRIIL
Sbjct  312   LDFDTDPHDIQLRGVNRDEKNIDMAKTYPNSRHFLTYRHSLRSYASILYLKRPDNFRIIL  371

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG+DVEHH++++DMM  +E TY+P    +  P    MVA + +GFVKDA  HID+QGFNV
Sbjct  372   RGEDVEHHSVLDDMMKIEEKTYKPMRSPEW-PDQEEMVASLKLGFVKDAHHHIDIQGFNV  430

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLIKPFWR+WN AGSDGRGVIG+LEANF++PAH+KQGFERT VL
Sbjct  431   YHKNRLIKPFWRVWNAAGSDGRGVIGILEANFIQPAHNKQGFERTVVL  478



>ref|XP_001768049.1| predicted protein [Physcomitrella patens]
 gb|EDQ67121.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/415 (64%), Positives = 329/415 (79%), Gaps = 11/415 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDW-----VSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
              +QFWKAGD+EG P         +  SGG+DHVRVHPKFLHSNATSHKW LGA AE+LDN
Sbjct  1     CRQFWKAGDYEGVPANTPQPPVPLLCSGGIDHVRVHPKFLHSNATSHKWALGAVAEILDN  60

Query  1055  SLDEVI-NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTI  879
             S+DEV+ NGAT+VN+DMV++ +DGS ML IEDNGGGM P+++R+CMSLG+S KSK  +TI
Sbjct  61    SMDEVVKNGATFVNVDMVRNPRDGSPMLYIEDNGGGMTPERMRECMSLGFSTKSKSGNTI  120

Query  878   GQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQ---SIGLLSYTFLRSTGMEDIVVPML  708
             GQYGNGFKTSTMRLGADVIVFSR   + G+   Q   SIGLLS+TFLRSTG +DIVVPM+
Sbjct  121   GQYGNGFKTSTMRLGADVIVFSRSPADVGRRHVQNFSSIGLLSFTFLRSTGHDDIVVPMV  180

Query  707   DYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWE  528
             DYE  +     +IRS+  DW  N++TI +WSP+ +E DL  QF  M + GT+++IYNLWE
Sbjct  181   DYELKDGMICPLIRSTANDWVHNLQTIQQWSPYCTEHDLFTQFFGMTEKGTKVIIYNLWE  240

Query  527   DDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVP  348
             D+ G +ELDF++D  DIQ+R  + D++ I MA++Y +SRH+LTY+HSLRSYASILY R P
Sbjct  241   DEHGRVELDFESDSHDIQVRNEDLDERKIAMAQRYTHSRHYLTYQHSLRSYASILYYRYP  300

Query  347   PSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHI  168
             P FRIILRG+DV HH++  D+M TQE++Y+PQ       +D  MVA V +GFVKDAK H+
Sbjct  301   PGFRIILRGQDVRHHDLAEDLMYTQELSYKPQGFESS--RDVKMVARVVMGFVKDAKEHV  358

Query  167   DVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             DVQGF+VYHKNRLIKPFWR+WN AGSDGRG++GVLEANFVEPAHDKQ FERT VL
Sbjct  359   DVQGFSVYHKNRLIKPFWRVWNTAGSDGRGIVGVLEANFVEPAHDKQSFERTAVL  413



>emb|CDY52039.1| BnaA08g31520D [Brassica napus]
Length=687

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/410 (64%), Positives = 327/410 (80%), Gaps = 10/410 (2%)
 Frame = -3

Query  1220  SKQFWKAGDF---EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSL  1050
             S+QFWKAGD    E  PR     + G    +RVHP+FLH+NATSHKW LGAFAELLDNSL
Sbjct  67    SRQFWKAGDDKEDERPPR-----NCGNDAAIRVHPQFLHANATSHKWALGAFAELLDNSL  121

Query  1049  DEVINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQ  873
             DE  NGATYV++D   ++KDG S ML+++DNGGGMDP++ R+C+SLGYS K  +A+T+GQ
Sbjct  122   DEACNGATYVHVDSTTNQKDGKSSMLIVQDNGGGMDPNRFRECLSLGYSRKRNVANTVGQ  181

Query  872   YGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN  693
             YGNGFKTSTMRLGAD IVF+R  G NG + TQS+G+LSYT+L  T   + VVP +D+E  
Sbjct  182   YGNGFKTSTMRLGADAIVFTRSRGANGGNTTQSVGMLSYTYLYETRKSEAVVPTVDFELV  241

Query  692   EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGL  513
             +  W  +     + W  N+ETIV+WSP+ S+  +  QF+ +++ GT+IVIYNLW+DD+G 
Sbjct  242   DNNWVALTHDDRDKWFDNLETIVKWSPYVSQQAMFDQFDLLEEQGTQIVIYNLWDDDEGK  301

Query  512   LELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRI  333
             LELDFD D  DIQ+RGVNRD+K I+MAK YPNSRHFLTYRHSLRSYASILYLR+PP+FRI
Sbjct  302   LELDFDTDGHDIQLRGVNRDEKKIEMAKAYPNSRHFLTYRHSLRSYASILYLRLPPNFRI  361

Query  332   ILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGF  153
             ILRGK+VEHH+++ DMMMT+++TY+P   +  +  D +MVA + IGFVKDA  HID+QGF
Sbjct  362   ILRGKEVEHHSLLEDMMMTEDITYKP-VASPELSLDEDMVAALKIGFVKDAHHHIDIQGF  420

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLIKPFWR+WN AGSDGRGVIG+LEANF++PAH+KQGFERT +L
Sbjct  421   NVYHKNRLIKPFWRVWNAAGSDGRGVIGLLEANFIQPAHNKQGFERTALL  470



>ref|XP_009110531.1| PREDICTED: uncharacterized protein LOC103836064 [Brassica rapa]
Length=819

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/410 (63%), Positives = 327/410 (80%), Gaps = 10/410 (2%)
 Frame = -3

Query  1220  SKQFWKAGDF---EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSL  1050
             S+QFWKAGD    E  PR     + G    +RVHP+FLH+NATSHKW LGAFAELLDNSL
Sbjct  67    SRQFWKAGDDKEDERPPR-----NCGNDAAIRVHPQFLHANATSHKWALGAFAELLDNSL  121

Query  1049  DEVINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQ  873
             DE  NGATYV++D   ++KDG S ML+++DNGGGMDP++ R+C+SLGYS K  +A+T+GQ
Sbjct  122   DEACNGATYVHVDSTTNQKDGKSSMLIVQDNGGGMDPNRFRECLSLGYSRKRNVANTVGQ  181

Query  872   YGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN  693
             YGNGFKTSTMRLGAD I+F+R  G NG + TQS+G+LSYT+L  T   + VVP +D+E  
Sbjct  182   YGNGFKTSTMRLGADAIIFTRSRGANGGNTTQSVGMLSYTYLYETRKSEAVVPTVDFELV  241

Query  692   EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGL  513
             +  W  +     + W  N+ETIV+WSP+ S+  +  QF+ +++ GT+IVIYNLW+DD+G 
Sbjct  242   DNNWVALTHDDRDKWFDNLETIVKWSPYVSQQAMFDQFDLLEEQGTQIVIYNLWDDDEGK  301

Query  512   LELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRI  333
             LELDFD D RDIQ+RGVNRD+K I+MAK YPNSRHFLTYRHSLR YASILYLR+PP+FRI
Sbjct  302   LELDFDTDGRDIQLRGVNRDEKKIEMAKAYPNSRHFLTYRHSLRRYASILYLRLPPNFRI  361

Query  332   ILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGF  153
             ILRGK+VEHH+++ DMMMT+++TY+P   +  +  D +MVA + IGFVKDA  HID+QGF
Sbjct  362   ILRGKEVEHHSLLEDMMMTEDITYKP-VASPELSLDEDMVAALKIGFVKDAHHHIDIQGF  420

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLIKPFWR+WN AGSDGRGVIG+LEANF++PAH+KQGFERT +L
Sbjct  421   NVYHKNRLIKPFWRVWNAAGSDGRGVIGLLEANFIQPAHNKQGFERTALL  470



>emb|CDX84021.1| BnaC08g16240D [Brassica napus]
Length=690

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/410 (63%), Positives = 326/410 (80%), Gaps = 10/410 (2%)
 Frame = -3

Query  1220  SKQFWKAGDF---EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSL  1050
             S+QFWKAGD    E  PR     + G    ++VHP+FLH+NATSHKW LGAFAELLDNSL
Sbjct  70    SRQFWKAGDDKEDERPPR-----NCGNDAAIKVHPQFLHANATSHKWALGAFAELLDNSL  124

Query  1049  DEVINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQ  873
             DE  NGATYV++D   ++KDG S ML+++DNGGGMDP++ R+C+SLGYS K  +A+T+GQ
Sbjct  125   DEACNGATYVHVDSTTNQKDGKSSMLIVQDNGGGMDPNRFRECLSLGYSRKRNVANTVGQ  184

Query  872   YGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN  693
             YGNGFKTSTMRLGAD IVF+R  G N  + TQS+G+LSYT+L  T   + VVP +D+E  
Sbjct  185   YGNGFKTSTMRLGADAIVFTRSRGANSGNTTQSVGMLSYTYLYETRKSEAVVPTVDFELV  244

Query  692   EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGL  513
             +  W  +     + W  N+ETIV+WSP+ S+  +  QF+ +++ GT+IVIYNLW+DD+G 
Sbjct  245   DNNWVALTHGDRDKWFDNLETIVKWSPYVSQQAMFDQFDLLEEQGTQIVIYNLWDDDEGK  304

Query  512   LELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRI  333
             LELDFD D  DIQ+RGVNRD+K I+MAK YPNSRHFLTYRHSLRSYASILYLR+PP+FRI
Sbjct  305   LELDFDTDGHDIQLRGVNRDEKKIEMAKAYPNSRHFLTYRHSLRSYASILYLRLPPNFRI  364

Query  332   ILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGF  153
             ILRGK+VEHH+++ +MMMT+++TYRP   +  +  D +MVA + IGFVKDA  HID+QGF
Sbjct  365   ILRGKEVEHHSLLENMMMTEDITYRP-VASPELSSDEDMVAALKIGFVKDAHHHIDIQGF  423

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLIKPFWR+WN AGSDGRGVIG+LEANF++PAH+KQGFERT +L
Sbjct  424   NVYHKNRLIKPFWRVWNAAGSDGRGVIGLLEANFIQPAHNKQGFERTALL  473



>gb|KHG07152.1| MORC family CW-type zinc finger protein 4 [Gossypium arboreum]
Length=764

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/371 (71%), Positives = 310/371 (84%), Gaps = 10/371 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGD-WVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
              KQFWKAGD+EG    D  +SS+ GMDHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE
Sbjct  135   CKQFWKAGDYEGGNACDSAMSSTVGMDHVRVHPKFLHSNATSHKWALGAFAELLDNALDE  194

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
               NGATYV+IDM++++KDGS+ML++EDNGGGM PDK+RQCMSLGYS+K+         GN
Sbjct  195   ACNGATYVSIDMLQNKKDGSKMLVVEDNGGGMSPDKMRQCMSLGYSSKN---------GN  245

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFS+  G +GKSPT+SIG+LSYTFL  TG EDIVVP++D+E   ++
Sbjct  246   GFKTSTMRLGADVIVFSQSLGTDGKSPTRSIGVLSYTFLTETGKEDIVVPIIDFEQKGRD  305

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W ++ R   +DWNRN+ETI+ WSP++SEA LL QFN +KDHGTRI+IYNLWEDD+G LEL
Sbjct  306   WTKMTRCFEDDWNRNLETIIHWSPYTSEAHLLDQFNFLKDHGTRIIIYNLWEDDEGKLEL  365

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFD D  DIQIRGVNRD+K+I+MAK + NSRHFLTYRHSLRSYASILYLR+P +F +ILR
Sbjct  366   DFDTDLHDIQIRGVNRDEKNIEMAKTFHNSRHFLTYRHSLRSYASILYLRLPTNFTMILR  425

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GKD+EHHNIVNDMM+T  +TYRPQ  +   P  S+MVA VTIGF KDA+ HID+QGFNVY
Sbjct  426   GKDIEHHNIVNDMMLTTRITYRPQIVSGKAPISSDMVATVTIGFAKDAQHHIDIQGFNVY  485

Query  143   HKNRLIKPFWR  111
             HKNRLIK  WR
Sbjct  486   HKNRLIKVCWR  496



>ref|NP_001190300.1| histidine kinase-like ATPase domain-containing protein [Arabidopsis 
thaliana]
 gb|AED91855.1| histidine kinase-like ATPase domain-containing protein [Arabidopsis 
thaliana]
Length=696

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/436 (61%), Positives = 328/436 (75%), Gaps = 33/436 (8%)
 Frame = -3

Query  1220  SKQFWKAGDF-EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             S+QFWKAGD  E AP   + S+      VRVHP+FLH+NATSHKW LGA AELLDNSLDE
Sbjct  75    SRQFWKAGDDDEAAPVPLYCSNDAA---VRVHPQFLHANATSHKWALGALAELLDNSLDE  131

Query  1043  VINGATYVNIDMVKSRKDG-SRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYG  867
             V NGATYV++D   +++DG S +L++EDNGGGM+P   R+C+SLGYS K  +A+ +GQYG
Sbjct  132   VSNGATYVHVDSTINKRDGKSSILIVEDNGGGMNPSTFRECLSLGYSRKRNMANRVGQYG  191

Query  866   NGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             NGFKTSTMRLGAD IVFSR  G NG +PTQSIG+LSYTFL  T   + +VP +DYE  + 
Sbjct  192   NGFKTSTMRLGADAIVFSRSRGINGNNPTQSIGMLSYTFLYETRKCEAIVPTVDYELVDN  251

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             +W +I+ +S  +W  N+ETI+RWSP+ S+ DLL QFN +++ GTRIVIYNLWEDD+G +E
Sbjct  252   KWKEIVYNSTNEWLDNLETILRWSPYLSQQDLLDQFNHLEEQGTRIVIYNLWEDDEGKME  311

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD DP DIQ+RGVNRD+K+I MAK YPNSRHFLTYRHSLRSYASILYL+ P +FRIIL
Sbjct  312   LDFDTDPHDIQLRGVNRDEKNIDMAKTYPNSRHFLTYRHSLRSYASILYLKRPDNFRIIL  371

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGAD----------------------------GVP  231
             RG+DVEHH++++DMM  +E TY+P    +                               
Sbjct  372   RGEDVEHHSVLDDMMKIEEKTYKPMRSPEWPDQEEVLPYLTLVSLFIILKHSQKFLLCFQ  431

Query  230   KDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANF  51
             K   MVA + +GFVKDA  HID+QGFNVYHKNRLIKPFWR+WN AGSDGRGVIG+LEANF
Sbjct  432   KILQMVASLKLGFVKDAHHHIDIQGFNVYHKNRLIKPFWRVWNAAGSDGRGVIGILEANF  491

Query  50    VEPAHDKQGFERTTVL  3
             ++PAH+KQGFERT VL
Sbjct  492   IQPAHNKQGFERTVVL  507



>ref|XP_002964030.1| hypothetical protein SELMODRAFT_61608, partial [Selaginella moellendorffii]
 ref|XP_002967894.1| hypothetical protein SELMODRAFT_61606, partial [Selaginella moellendorffii]
 gb|EFJ31241.1| hypothetical protein SELMODRAFT_61606, partial [Selaginella moellendorffii]
 gb|EFJ34363.1| hypothetical protein SELMODRAFT_61608, partial [Selaginella moellendorffii]
Length=417

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/406 (62%), Positives = 318/406 (78%), Gaps = 6/406 (1%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             +QFWKAGD++G+       S+  MDHVR+HPKFLHSNATSHKW LGA AELLDN+LDE  
Sbjct  2     RQFWKAGDYDGSGAQTMPGSNSSMDHVRMHPKFLHSNATSHKWALGAIAELLDNALDEAQ  61

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGAT+VNI+++K+  DGS ML+ EDNGGGM  +++R+CMS GYSAK K A+ IGQYGNGF
Sbjct  62    NGATFVNINVLKNPVDGSPMLLFEDNGGGMTQERLRECMSFGYSAKDKAANMIGQYGNGF  121

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFS+ +   G  PT+S+G LSY+FLR T  +DI+VP LDYE +  E  
Sbjct  122   KTSTMRLGADVIVFSKSNAKRGGRPTRSVGFLSYSFLRDTMQQDIIVPTLDYEEHGGELK  181

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
             ++ R + +DW   ++ I +WSP+ SE  +  QF ++K  GTRI+IYNLWED+Q  LELDF
Sbjct  182   EVQRGTHQDWKYRMDAITKWSPYQSEESIRSQFKKIKGQGTRIIIYNLWEDEQQRLELDF  241

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGK  318
             ++DP+DIQIRG  RDD    MA++YP+++HF  Y++SLR YASILYL +P +F+I LR +
Sbjct  242   ESDPQDIQIRG-GRDDSQRDMAEKYPSAKHFFLYQNSLRIYASILYLHLPKNFKITLRNQ  300

Query  317   DVEHHNIVNDMMMTQEVTYRPQT-GADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             +++HHNI++D+M  +E+ Y+PQ  G +GV    NM A V +GF+KDA+ HIDVQGFNVYH
Sbjct  301   EIKHHNILSDVMHIEELVYKPQKDGQNGV----NMSAKVHLGFLKDAREHIDVQGFNVYH  356

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             KNRLIKPFWR+WN + S GRGVIGVLEANFVEPAHDKQGFERT VL
Sbjct  357   KNRLIKPFWRIWNSSSSQGRGVIGVLEANFVEPAHDKQGFERTPVL  402



>emb|CAE03980.3| OSJNBa0033H08.4 [Oryza sativa Japonica Group]
Length=799

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/418 (63%), Positives = 323/418 (77%), Gaps = 34/418 (8%)
 Frame = -3

Query  1229  ETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLD---  1059
             ++++KQFWKAGD++G P GD    S  +  +     F    A    W++  F  +L+   
Sbjct  91    KSATKQFWKAGDYDGKPLGDGAPQSSDLITL-----FRKIAANYPDWIM--FVYILNFCT  143

Query  1058  ------NSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKS  897
                   + L  VINGATYVNIDM+++ KD +RML++ED+GGGMDPDK+RQCMSLGYSAKS
Sbjct  144   QMQQATSGLWGVINGATYVNIDMLENNKDKTRMLLVEDDGGGMDPDKMRQCMSLGYSAKS  203

Query  896   KIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVV  717
             K+A TIGQYGNGFKTSTMRLGADV+VFSR  G  GK  TQS+G+LSYTFLRST  EDIVV
Sbjct  204   KVASTIGQYGNGFKTSTMRLGADVLVFSRSGGKGGKRLTQSVGMLSYTFLRSTNKEDIVV  263

Query  716   PMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYN  537
             PM+DYEN ++ W +  R++  DWN +++TI+ WSP+S+EA+LL QF+ +K+ GTRI+IYN
Sbjct  264   PMIDYEN-QQGWKRKPRTTFADWNTSLQTIITWSPYSTEAELLEQFSSIKEQGTRIIIYN  322

Query  536   LWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYL  357
             LWEDD+G LELDFD D  DIQ+RG NRD+K+I MAKQ+PNS+HFLTYRHSLRSYASILYL
Sbjct  323   LWEDDEGHLELDFDEDIHDIQLRGGNRDEKNILMAKQFPNSKHFLTYRHSLRSYASILYL  382

Query  356   RVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAK  177
             RVP  F++ILRGK++EHHNIV DMM+ +E                 MVA VTIGFVKDAK
Sbjct  383   RVPSFFQMILRGKEIEHHNIVTDMMLKKE-----------------MVADVTIGFVKDAK  425

Query  176   AHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
              H+DVQGFNVYHKNRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  426   HHVDVQGFNVYHKNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  483



>gb|EMT20981.1| hypothetical protein F775_52718 [Aegilops tauschii]
Length=586

 Score =   528 bits (1361),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 245/347 (71%), Positives = 292/347 (84%), Gaps = 17/347 (5%)
 Frame = -3

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             V NGAT+VNIDM+++ KD +RML++EDNGGGMDPDK+RQCMSLGYSAKS++A+TIGQYGN
Sbjct  108   VRNGATFVNIDMLENSKDKTRMLLVEDNGGGMDPDKMRQCMSLGYSAKSQVANTIGQYGN  167

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADV+VFSR  G  GK PTQSIG+LSYTFLRSTG EDIVVPM+DYE N   
Sbjct  168   GFKTSTMRLGADVLVFSRSRGKEGKRPTQSIGMLSYTFLRSTGKEDIVVPMIDYEKNGLN  227

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W + +RS+  DWN +++TI+ WSP+ +EA+LL QF+ +K+ GTR++IYNLWEDDQG LEL
Sbjct  228   WTRKLRSTFADWNTSLQTIITWSPYGTEAELLEQFSSIKEQGTRVIIYNLWEDDQGDLEL  287

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFDAD  DIQ+RG NRD+K+I+MAK++PNS+HFLTYRHSLRSYASILYLR+  +F+I LR
Sbjct  288   DFDADVNDIQLRGGNRDEKNIEMAKRFPNSKHFLTYRHSLRSYASILYLRLSDAFQIFLR  347

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GK++EHHNIV DMM+ +E                 MVA VTIGFVKDAK HIDVQGFNVY
Sbjct  348   GKEIEHHNIVTDMMLKKE-----------------MVADVTIGFVKDAKFHIDVQGFNVY  390

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             H+NRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  391   HRNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  437



>emb|CAB36739.1| putative protein [Arabidopsis thaliana]
 emb|CAB79406.1| putative protein [Arabidopsis thaliana]
Length=618

 Score =   487 bits (1253),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 256/430 (60%), Positives = 293/430 (68%), Gaps = 80/430 (19%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE-  1044
              KQFWKAGD+EGA   +W  SSGG DHVRVHPKFLHSNATSHKW LGAFAELLDN+LDE 
Sbjct  135   CKQFWKAGDYEGAAGDNWDLSSGGFDHVRVHPKFLHSNATSHKWALGAFAELLDNALDED  194

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
              +  A       +++  D   +L + D             +   ++ +  I   +   GN
Sbjct  195   TLQKAN------LQTPLDNVIILCLSD-------------LYRKFAGRCLIYLLLID-GN  234

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC G +GKS TQSIGLLSYTFLRSTG EDIVVPMLDYE  + E
Sbjct  235   GFKTSTMRLGADVIVFSRCPGKDGKSSTQSIGLLSYTFLRSTGKEDIVVPMLDYERRDPE  294

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
             W +IIRSS  DW++N+ETI++WSPFSSE DLL QF+ MKD GTRI+IYNLWEDDQG+LEL
Sbjct  295   WSKIIRSSTRDWDKNVETIIQWSPFSSEEDLLHQFDLMKDRGTRIIIYNLWEDDQGMLEL  354

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILR  324
             DFDADP                                   SY SILYLR+PP FRIILR
Sbjct  355   DFDADP----------------------------------YSYVSILYLRIPPGFRIILR  380

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             G DVEHH++VNDMM T+++TYRPQ+ + GV   +NM A+V IGFVKDAK H+DVQGFNVY
Sbjct  381   GIDVEHHSVVNDMMQTEQITYRPQSESYGVV--TNMSAIVIIGFVKDAKHHVDVQGFNVY  438

Query  143   HKNRLIK-----------------------PFWRLWNPAGSDGRGVIGVLEANFVEPAHD  33
             HKNRLIK                       PFWR+WN  GSDGRGVIGVLEANFVEPAHD
Sbjct  439   HKNRLIKAFDFQDKQRISYSCVFLINLCYQPFWRIWNATGSDGRGVIGVLEANFVEPAHD  498

Query  32    KQGFERTTVL  3
             KQGFERTTVL
Sbjct  499   KQGFERTTVL  508



>ref|XP_010235429.1| PREDICTED: uncharacterized protein LOC100841444 isoform X4 [Brachypodium 
distachyon]
Length=746

 Score =   488 bits (1257),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 239/411 (58%), Positives = 295/411 (72%), Gaps = 60/411 (15%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPR----GDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNS  1053
             +KQFWKAG++ G  +         S  GM+HVRVHP+FLHSNATSHKW LGAFAELLDNS
Sbjct  88    TKQFWKAGEYGGNRQLLGSDPAQHSDSGMEHVRVHPRFLHSNATSHKWSLGAFAELLDNS  147

Query  1052  LDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQ  873
             LDEV NGAT+VNIDM++++KDGSRML+ +D+GGGM P+KIR CMSLGYSAKSK+ + IGQ
Sbjct  148   LDEVSNGATFVNIDMLENKKDGSRMLLFQDDGGGMSPEKIRHCMSLGYSAKSKVKNAIGQ  207

Query  872   YGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN  693
             YGNGFKTSTMRLGADV+VFSR   N  +S TQSIG+LSYTFL+STG +DI+VPM+DYE  
Sbjct  208   YGNGFKTSTMRLGADVLVFSRSCSNEERSLTQSIGMLSYTFLKSTGKDDIIVPMIDYEKR  267

Query  692   EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGL  513
             +  W + +R+++ DW  +++TI++WSP+S+EA+LL++F+ + + GTRIVIYNLWED+QG 
Sbjct  268   QA-WNRKVRTTLGDWYTSLQTIIQWSPYSNEAELLQEFSAINEQGTRIVIYNLWEDEQGQ  326

Query  512   LELDFDAD-PRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
             LELDFDAD  +DIQIRGVNRD+KS  MAKQ+PNS+HF TYRHSLR  A++    V     
Sbjct  327   LELDFDADVNQDIQIRGVNRDEKSSLMAKQFPNSKHFFTYRHSLRMVANVTVGFV-----  381

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
                  KD +H                                            H+ +QG
Sbjct  382   -----KDAKH--------------------------------------------HVPIQG  392

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             FNVYH+NRLIKPFWR+W   GS GRG+IGVLE NFVEPAHDKQ FERT  L
Sbjct  393   FNVYHRNRLIKPFWRVWTLPGSQGRGIIGVLEVNFVEPAHDKQDFERTNSL  443



>gb|EMS56220.1| MORC family CW-type zinc finger protein 4 [Triticum urartu]
Length=536

 Score =   464 bits (1193),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 228/359 (64%), Positives = 269/359 (75%), Gaps = 54/359 (15%)
 Frame = -3

Query  1079  AFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAK  900
             A AELLDNSLDEV NGAT+VNIDM+++ KD +RML++EDNGGGMDPDK+RQCMSLGYSAK
Sbjct  69    ALAELLDNSLDEVRNGATFVNIDMLENSKDKTRMLLVEDNGGGMDPDKMRQCMSLGYSAK  128

Query  899   SKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIV  720
             S++A+TIGQYGNGFKTSTMRLGADV+VFSR  G  GK PTQSIG+LSYTFLRSTG EDIV
Sbjct  129   SQVANTIGQYGNGFKTSTMRLGADVLVFSRSRGKEGKRPTQSIGMLSYTFLRSTGKEDIV  188

Query  719   VPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIY  540
             VPM+DYE N   W + +RS+  DWN +++TI+ WSP+ +EA+LL QF+ +K+ GTR++IY
Sbjct  189   VPMIDYEKNGLNWTRKLRSTFADWNTSLQTIITWSPYGTEAELLEQFSSIKEQGTRVIIY  248

Query  539   NLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILY  360
             NLWEDDQG LELDFDAD  DIQ+RG NRD+K+I+MAK++PNS+HFLT             
Sbjct  249   NLWEDDQGDLELDFDADVNDIQLRGGNRDEKNIEMAKRFPNSKHFLT-------------  295

Query  359   LRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDA  180
                   +R  LR                                   MVA VTIGFVKDA
Sbjct  296   ------YRHSLR-----------------------------------MVADVTIGFVKDA  314

Query  179   KAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             K HIDVQGFNVYH+NRLIKPFWR+W  AGS GRGVIGVLEANF+EPAHDKQ FERTT+L
Sbjct  315   KFHIDVQGFNVYHRNRLIKPFWRVWTAAGSGGRGVIGVLEANFIEPAHDKQDFERTTLL  373



>ref|XP_008806549.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Phoenix 
dactylifera]
Length=410

 Score =   455 bits (1170),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 226/338 (67%), Positives = 264/338 (78%), Gaps = 6/338 (2%)
 Frame = -3

Query  1391  GRPRKKQKSAETSSVALPLGFLDplhepveqplllpppapaETSSGRAVPTCIVETSSKQ  1212
             G P KK ++    S ALPLGF     +P+   +    P P   +  R +P        KQ
Sbjct  68    GGPFKKLRAEGGLSAALPLGF----LDPLPPDIPPLLPRPVPLAVARPLPPATGFQGCKQ  123

Query  1211  FWKAGDFEGAPRGDWVSS-SGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVIN  1035
             FWKAGD+E +P  D     + GMD VRVHPKFLHSNATSHKW LGA AELLDNSLDEV N
Sbjct  124   FWKAGDYEESPIADSTPYYASGMDRVRVHPKFLHSNATSHKWALGALAELLDNSLDEVCN  183

Query  1034  GATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFK  855
             GATYVNIDM++++KDG+RML++EDNGGGMDPDK+RQCMSLGYSAKSK+A TIGQYGNGFK
Sbjct  184   GATYVNIDMLENKKDGTRMLLVEDNGGGMDPDKMRQCMSLGYSAKSKVASTIGQYGNGFK  243

Query  854   TSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQ  675
             TSTMRLGADVIVFS      G+ PTQSIG+LSYTFLRST  EDIVVPML YE  +  W +
Sbjct  244   TSTMRLGADVIVFSCSRAKGGRRPTQSIGMLSYTFLRSTAKEDIVVPMLYYEKGQT-WNK  302

Query  674   IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFD  495
             +++SS+ DW+ N+ETI++WSP+SSEADLL+QF+ MKD GTRI+IYNLWEDDQG LELDFD
Sbjct  303   MVQSSLADWSTNLETILQWSPYSSEADLLQQFSSMKDQGTRIIIYNLWEDDQGQLELDFD  362

Query  494   ADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLR  381
              D  DIQ+ GVNRD+K IQMAKQ+PNSRHFLTYRHSLR
Sbjct  363   VDKYDIQVGGVNRDEKKIQMAKQFPNSRHFLTYRHSLR  400



>ref|XP_001762322.1| predicted protein [Physcomitrella patens]
 gb|EDQ72789.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   451 bits (1161),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 225/388 (58%), Positives = 288/388 (74%), Gaps = 10/388 (3%)
 Frame = -3

Query  1157  SGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRM  978
             +G +DHVRVHPKFLHSNATSHKW LGA AELLDN++DEV NGATYV +D +K+ ++GS  
Sbjct  2     AGALDHVRVHPKFLHSNATSHKWALGAIAELLDNAIDEVSNGATYVRLDKIKNAREGSPA  61

Query  977   LMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGN  798
             L+++DNGGGM PD IRQCMSLGYS K++   TIGQYGNGFKTSTMRLGADVIVF+R    
Sbjct  62    LLVQDNGGGMSPDNIRQCMSLGYSLKNQ-KTTIGQYGNGFKTSTMRLGADVIVFTRNRNL  120

Query  797   NGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK--EWGQIIRSSVEDWNRNIETIV  624
                  TQSIGLLSYTFLR TG ED VVPMLDYE +    +   ++R++++DW  N+ TI+
Sbjct  121   KTGKSTQSIGLLSYTFLRKTGHEDTVVPMLDYELDAHLVKPSVLLRTTMDDWLSNLNTII  180

Query  623   RWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRD-DK  447
             +WSP+SSE  LL QFN +  HGT+++IYNLW +D G+LELDFD+D  DIQ+R  +++  K
Sbjct  181   KWSPYSSEQQLLSQFNDIGWHGTKVIIYNLWLNDDGILELDFDSDEHDIQLRVASKELPK  240

Query  446   SIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEV  267
             +  +     N      Y+ SLR+YASILYL++P  F+IILRG+ VEH++I  D+   + +
Sbjct  241   NHTLPSLLSNEHISNRYQLSLRAYASILYLKLPEHFKIILRGQPVEHYDIAEDLKFKEYI  300

Query  266   TYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSD  87
              YRPQ G     K++++    TIGF K+A   I+V GF VYH+NRLI PFW+++    S 
Sbjct  301   IYRPQIGPS---KEASVTT--TIGFSKEAPM-INVHGFCVYHRNRLIMPFWKVFQENSSR  354

Query  86    GRGVIGVLEANFVEPAHDKQGFERTTVL  3
             GRGVIGVLEANF+EPAHDKQ FERT+V 
Sbjct  355   GRGVIGVLEANFMEPAHDKQDFERTSVF  382



>ref|XP_006841042.1| hypothetical protein AMTR_s00085p00139780, partial [Amborella 
trichopoda]
 gb|ERN02717.1| hypothetical protein AMTR_s00085p00139780, partial [Amborella 
trichopoda]
Length=721

 Score =   461 bits (1186),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 236/425 (56%), Positives = 310/425 (73%), Gaps = 24/425 (6%)
 Frame = -3

Query  1262  SSGRAVPTCIVETSSKQFWKAGDF-EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             +SG +   C      +QFWKAGD+ EG P  + V  S  MDH+RVHPKFLHSNATSHKW 
Sbjct  94    ASGSSQSIC------RQFWKAGDYPEGPPTKEVVRES--MDHLRVHPKFLHSNATSHKWA  145

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
             LGA AELLDN++DE+ NGAT+VNID V + +DG+  L+I+D+GGGM P+ +RQCMSLGYS
Sbjct  146   LGAIAELLDNAVDEINNGATFVNIDKVVNPRDGAAALLIQDDGGGMGPECMRQCMSLGYS  205

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K   + TIGQYGNGFKTSTMRLGADVIVFSR +  N +  T+SIGLLSYTFL+ T  +D
Sbjct  206   QKQSTS-TIGQYGNGFKTSTMRLGADVIVFSRWT--NKRFKTESIGLLSYTFLKETCQDD  262

Query  725   IVVPMLDYE--NNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTR  552
             IVVPM+DYE   +  E  +++RS  EDW+ N+ TI++WSP+S+E DLL+Q + +  HGT+
Sbjct  263   IVVPMVDYEILPSTGERRKLLRSRQEDWSFNLSTILKWSPYSTEEDLLKQLDDVGPHGTK  322

Query  551   IVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLT-YRHSLRSY  375
             IV+YNLW +D G LELDFD+D  DI+I G ++  +S  +  +   + H    +R+SLR Y
Sbjct  323   IVVYNLWLNDVGELELDFDSDKEDIRIHGASKVAESGTLPDK--QTEHVANRFRYSLRVY  380

Query  374   ASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIG  195
             +SILY  +P SF I+LRG+ VE H IV+D+   Q + Y+PQ+G      +  +  + TIG
Sbjct  381   SSILYQHLPNSFTILLRGRAVEQHRIVDDLKFPQYILYKPQSGG-----NREVSVITTIG  435

Query  194   FVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNP-AGSDGRGVIGVLEANFVEPAHDKQGFE  18
             F++DA   +++ GFNVYHKNRLI PFWR+ N   G+ GRGV+GVLEANF++PAHDKQ FE
Sbjct  436   FMRDA-PKVNIHGFNVYHKNRLILPFWRVVNEHGGNKGRGVVGVLEANFIKPAHDKQDFE  494

Query  17    RTTVL  3
             RT+VL
Sbjct  495   RTSVL  499



>ref|XP_002990610.1| hypothetical protein SELMODRAFT_131980, partial [Selaginella 
moellendorffii]
 gb|EFJ08242.1| hypothetical protein SELMODRAFT_131980, partial [Selaginella 
moellendorffii]
Length=394

 Score =   444 bits (1142),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 228/393 (58%), Positives = 286/393 (73%), Gaps = 24/393 (6%)
 Frame = -3

Query  1157  SGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRM  978
             SGGMDHVRVHPKFLHSNATSHKW LGA AELLDN++DE  NGAT++ ID V + +DGS  
Sbjct  3     SGGMDHVRVHPKFLHSNATSHKWALGAIAELLDNAIDEANNGATFIKIDKVTNFRDGSPG  62

Query  977   LMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGN  798
             L+  DNGGGM P+KIRQCMS GYS   K A+ IGQYGNGFKTSTMRLGADVIV +RC  +
Sbjct  63    LLFLDNGGGMSPEKIRQCMSFGYS--QKCANAIGQYGNGFKTSTMRLGADVIVLTRCVRD  120

Query  797   NGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG---QIIRSSVEDWNRNIETI  627
             +    TQS+GLLSYTFLR TG  DI+VPM+DYE      G   ++IRS+ ED+  N+ TI
Sbjct  121   S--VTTQSVGLLSYTFLRKTGRGDILVPMVDYERVSGSPGHVSRVIRSTTEDFEMNLNTI  178

Query  626   VRWSPFSSEADLLRQFNQMKD-HGTRIVIYNLWEDDQGLLELDFDADPRDIQIR--GVNR  456
             ++WSPFS+EA +L QF  M+  HGT+++IYNLW +D G+LELDFD DP DI++R  G   
Sbjct  179   LQWSPFSTEAQVLAQFEDMESPHGTKVIIYNLWLNDDGVLELDFDTDPHDIKLRENGAKS  238

Query  455   DDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMM  282
             D ++ ++ K++      L+Y  R+SLR+YASILYLR+P  FRI LRGK V HH I +D+ 
Sbjct  239   DARAKELHKKH------LSYQLRYSLRAYASILYLRLPSGFRITLRGKLVVHHKIDDDLK  292

Query  281   MTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWN  102
               + + Y+PQ   DG+        V  IGF K+A   ++V GF VYHKNRLI PFW +++
Sbjct  293   FPEYIMYKPQ--VDGITSGE---VVTCIGFTKEAPL-LNVHGFCVYHKNRLIMPFWNVFH  346

Query  101   PAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
                S GRGVIG+LEANF+EPAHDKQ FE+T +L
Sbjct  347   DNSSRGRGVIGILEANFIEPAHDKQDFEKTCLL  379



>ref|XP_002968723.1| hypothetical protein SELMODRAFT_91078, partial [Selaginella moellendorffii]
 gb|EFJ29839.1| hypothetical protein SELMODRAFT_91078, partial [Selaginella moellendorffii]
Length=391

 Score =   443 bits (1139),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 227/392 (58%), Positives = 285/392 (73%), Gaps = 24/392 (6%)
 Frame = -3

Query  1154  GGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRML  975
             GGMDHVRVHPKFLHSNATSHKW LGA AELLDN++DE  NGAT++ ID V + +DGS  L
Sbjct  1     GGMDHVRVHPKFLHSNATSHKWALGAIAELLDNAIDEANNGATFIKIDKVTNFRDGSPGL  60

Query  974   MIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNN  795
             +  DNGGGM P+KIRQCMS GYS   K A+ IGQYGNGFKTSTMRLGADVIV +RC  ++
Sbjct  61    LFLDNGGGMSPEKIRQCMSFGYS--QKCANAIGQYGNGFKTSTMRLGADVIVLTRCVRDS  118

Query  794   GKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG---QIIRSSVEDWNRNIETIV  624
                 TQS+GLLSYTFLR TG  DI+VPM+DYE      G   ++IRS+ ED+  N+ TI+
Sbjct  119   --VTTQSVGLLSYTFLRKTGRGDILVPMVDYERVSGSPGHVSRVIRSTTEDFEMNLNTIL  176

Query  623   RWSPFSSEADLLRQFNQMKD-HGTRIVIYNLWEDDQGLLELDFDADPRDIQIR--GVNRD  453
             +WSPFS+EA +L QF  M+  HGT+++IYNLW +D G+LELDFD DP DI++R  G   D
Sbjct  177   QWSPFSTEAQVLAQFEHMESPHGTKVIIYNLWLNDDGVLELDFDTDPHDIKLRENGAKSD  236

Query  452   DKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMM  279
              ++ ++ K++      L+Y  R+SLR+YASILYLR+P  FRI LRGK V HH I +D+  
Sbjct  237   ARAKELHKKH------LSYQLRYSLRAYASILYLRLPSGFRITLRGKLVVHHKIDDDLKF  290

Query  278   TQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNP  99
              + + Y+PQ   DG+        V  IGF K+A   ++V GF VYHKNRLI PFW +++ 
Sbjct  291   PEYIMYKPQ--VDGITSGE---VVTCIGFTKEAPL-LNVHGFCVYHKNRLIMPFWNVFHD  344

Query  98    AGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
               S GRGVIG+LEANF+EPAHDKQ FE+T +L
Sbjct  345   NSSRGRGVIGILEANFIEPAHDKQDFEKTCLL  376



>emb|CBI17427.3| unnamed protein product [Vitis vinifera]
Length=641

 Score =   443 bits (1140),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 223/409 (55%), Positives = 300/409 (73%), Gaps = 13/409 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAG ++  P      +   ++H RVHPKFLHSNATSHKW  GA AELLDN++DE+
Sbjct  46    SRSFWKAGAYDNTP-SKLTPAPDQLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEI  104

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D + +RKD S  L+ +D+GGGMDP+ IR+CMSLGYS+K K   TIGQYGNG
Sbjct  105   CNGATFVKLDRIDNRKDNSPALLFQDDGGGMDPESIRKCMSLGYSSK-KSNTTIGQYGNG  163

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR S  +    TQSIGLLSYTFLR TG +D++VPM+D++ ++   
Sbjct  164   FKTSTMRLGADVIVFSRASRTS--RATQSIGLLSYTFLRRTGQDDVIVPMVDFDISDHWA  221

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               II SS EDW+ N++TI+ WSPF+S+ +L++QF  +  HGT+I+IYNLW +D+G+ EL+
Sbjct  222   EPIIYSSKEDWSTNLKTILEWSPFASKEELMQQFEDIGPHGTKIIIYNLWLNDEGIFELN  281

Query  500   FDADPRDIQIRG-VNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRII  330
             FD D  DI++R   NR   S ++ K+    +  ++Y  R+SLR+YASILYLR   +F+II
Sbjct  282   FDDDDEDIRLRDEANRGSLS-KVPKKVAELQSHISYCIRYSLRAYASILYLRKFTNFQII  340

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             LRGK V+  NI +++   + V YRPQ   +   K+++M    TIGF+K+A A + V GFN
Sbjct  341   LRGKPVQQFNIADELKYPKVVIYRPQ--HNTALKEASM--ETTIGFIKEAPA-LGVSGFN  395

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLI+PFW++ +   S G GV+GVLEANF+EPAHDKQ FER+++ 
Sbjct  396   VYHKNRLIRPFWKVTSDGSSKGNGVVGVLEANFIEPAHDKQDFERSSLF  444



>ref|XP_002267687.2| PREDICTED: MORC family CW-type zinc finger protein 3 [Vitis vinifera]
Length=653

 Score =   443 bits (1139),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 223/409 (55%), Positives = 300/409 (73%), Gaps = 13/409 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAG ++  P      +   ++H RVHPKFLHSNATSHKW  GA AELLDN++DE+
Sbjct  58    SRSFWKAGAYDNTP-SKLTPAPDQLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEI  116

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D + +RKD S  L+ +D+GGGMDP+ IR+CMSLGYS+K K   TIGQYGNG
Sbjct  117   CNGATFVKLDRIDNRKDNSPALLFQDDGGGMDPESIRKCMSLGYSSK-KSNTTIGQYGNG  175

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR S  +    TQSIGLLSYTFLR TG +D++VPM+D++ ++   
Sbjct  176   FKTSTMRLGADVIVFSRASRTS--RATQSIGLLSYTFLRRTGQDDVIVPMVDFDISDHWA  233

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               II SS EDW+ N++TI+ WSPF+S+ +L++QF  +  HGT+I+IYNLW +D+G+ EL+
Sbjct  234   EPIIYSSKEDWSTNLKTILEWSPFASKEELMQQFEDIGPHGTKIIIYNLWLNDEGIFELN  293

Query  500   FDADPRDIQIRG-VNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRII  330
             FD D  DI++R   NR   S ++ K+    +  ++Y  R+SLR+YASILYLR   +F+II
Sbjct  294   FDDDDEDIRLRDEANRGSLS-KVPKKVAELQSHISYCIRYSLRAYASILYLRKFTNFQII  352

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             LRGK V+  NI +++   + V YRPQ   +   K+++M    TIGF+K+A A + V GFN
Sbjct  353   LRGKPVQQFNIADELKYPKVVIYRPQ--HNTALKEASM--ETTIGFIKEAPA-LGVSGFN  407

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLI+PFW++ +   S G GV+GVLEANF+EPAHDKQ FER+++ 
Sbjct  408   VYHKNRLIRPFWKVTSDGSSKGNGVVGVLEANFIEPAHDKQDFERSSLF  456



>ref|XP_004968953.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Setaria 
italica]
Length=675

 Score =   442 bits (1136),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 222/411 (54%), Positives = 304/411 (74%), Gaps = 19/411 (5%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+GD+  A R    ++ GG + +R++PKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  92    CRQFWKSGDYVVACRNPDANAPGGRNRLRINPKFLHSNATSHKWAFGAIAELLDNAIDEV  151

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGATYV I+   + +DGS  L+++D+GGGMDP+ +R+CMS G+S K   A  IGQYGNG
Sbjct  152   NNGATYVRINKFTNPRDGSPSLLVQDDGGGMDPEALRRCMSFGFSDKQSDA-FIGQYGNG  210

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIVF++    N  +PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  211   FKTSTMRLGADVIVFTQ--NQNNWTPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDLTTA  268

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R   + ++ N+  +++WSPF+SEA+LL+QF+ M +HGT+I+++NLW +D G +E
Sbjct  269   SYIQMLRHDQKLFSSNLGILLKWSPFASEAELLKQFDDMGEHGTKIIVFNLWFNDDGDME  328

Query  506   LDFDADPRDIQIRGVNRD---DKSIQMAKQ-YPNSRHFLTYRHSLRSYASILYLRVPPSF  339
             LDF++D +DI I G ++    +K+ ++AKQ Y +SR     R+SLR+YASILYL VP +F
Sbjct  329   LDFNSDEKDILITGAHKKLKTNKAEKIAKQNYVSSR----LRYSLRAYASILYLHVPDNF  384

Query  338   RIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQ  159
             RIILRG DVE HNIVND+M  + V Y+PQ    G+ + S    + TIGFVK A   IDVQ
Sbjct  385   RIILRGCDVEPHNIVNDLMYRECVLYKPQIA--GLTESS---VITTIGFVKGA-PDIDVQ  438

Query  158   GFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             GFNVYHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++ +
Sbjct  439   GFNVYHKNRLISPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKSVL  489



>ref|XP_006340682.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Solanum 
tuberosum]
Length=644

 Score =   439 bits (1128),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 215/408 (53%), Positives = 303/408 (74%), Gaps = 12/408 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAG+FE   R    +  G ++H RVHPKFLHSNATSHKW  GA AELLDN++DE+
Sbjct  66    SRSFWKAGNFE-VGRIKSTAIHGELEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEI  124

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              +GAT+V +D + + +D S  L+ +D+GGGMDPD++R+CMSLGYS+K+  + TIGQYGNG
Sbjct  125   SSGATFVKVDRISNPRDNSPALLFQDDGGGMDPDRLRKCMSLGYSSKTSNS-TIGQYGNG  183

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR S  +G++ TQS+GLLSYTFLR TG +D++VPM+DY+ ++   
Sbjct  184   FKTSTMRLGADVIVFSR-SSRSGRA-TQSVGLLSYTFLRRTGQDDVIVPMIDYDISDHWA  241

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               I+  S +DW+ N++TI+ WSPF+++ DLL+QF+ +K HGT+I+++NLW +D+G+ EL+
Sbjct  242   EAIVYGSQDDWSTNLKTILEWSPFATKMDLLQQFDDIKSHGTKIIVFNLWLNDEGIYELN  301

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIIL  327
             FD D  DI +R       + +  K+    +  ++Y  R+SLR+YASILYL+   +F IIL
Sbjct  302   FDDDDEDITLRDEANLGNTSKTNKRGRELQSHISYRLRYSLRAYASILYLKKFTNFSIIL  361

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGK VE +NI++++ +++ +TYRPQ    G  K+  ++   ++GFVKD  +   V GFNV
Sbjct  362   RGKPVEQYNILDELKLSKVITYRPQLA--GTSKE--ILVETSLGFVKDTPS--SVCGFNV  415

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLI+PFW++     S G GV+GVLEANF+EPAHDKQ FER+++ 
Sbjct  416   YHKNRLIRPFWKVTADGSSKGNGVVGVLEANFIEPAHDKQDFERSSLF  463



>ref|XP_008675510.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X3 [Zea mays]
 tpg|DAA59011.1| TPA: hypothetical protein ZEAMMB73_651339 [Zea mays]
Length=677

 Score =   439 bits (1129),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 216/407 (53%), Positives = 297/407 (73%), Gaps = 11/407 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+GD+  A R   V+  GG + +R++PKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  91    CRQFWKSGDYVVARRNPDVAGPGGRNRLRINPKFLHSNATSHKWAFGAIAELLDNAIDEV  150

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ++  K+ +DG+  L+++D+GGGMDP+ +R+CMS G+S K   A  IGQYGNG
Sbjct  151   NNGATFVRVNKFKNPRDGNPSLLVQDDGGGMDPEALRRCMSFGFSDKQSDA-FIGQYGNG  209

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIVF++    N   PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  210   FKTSTMRLGADVIVFTQ--NQNNWVPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDLTTT  267

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R   + ++ N+  +++WSPFS+EA+LL+QF+ M DHGT+I+++NLW +D G +E
Sbjct  268   SYVQMLRHDQKLFSSNLAILLKWSPFSTEAELLKQFDDMGDHGTKIIVFNLWFNDDGDME  327

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDF++D +DI I G ++  K+  + K    +      R+SLR+YASILYL VP +FRIIL
Sbjct  328   LDFNSDKKDILITGAHKKVKTNSLDKIAAQNYVSTRLRYSLRAYASILYLHVPDTFRIIL  387

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG DVE HN+VND+M  + V Y+PQ    G+ + S    + TIGFVK A   IDVQGFNV
Sbjct  388   RGCDVEPHNVVNDLMYRECVLYKPQIA--GLTESS---VITTIGFVKGA-PDIDVQGFNV  441

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             YHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++ +
Sbjct  442   YHKNRLILPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKSVL  488



>ref|XP_008675511.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X4 [Zea mays]
 tpg|DAA59012.1| TPA: hypothetical protein ZEAMMB73_651339 [Zea mays]
Length=676

 Score =   439 bits (1128),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/407 (53%), Positives = 297/407 (73%), Gaps = 11/407 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+GD+  A R   V+  GG + +R++PKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  91    CRQFWKSGDYVVARRNPDVAGPGGRNRLRINPKFLHSNATSHKWAFGAIAELLDNAIDEV  150

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ++  K+ +DG+  L+++D+GGGMDP+ +R+CMS G+S K   A  IGQYGNG
Sbjct  151   NNGATFVRVNKFKNPRDGNPSLLVQDDGGGMDPEALRRCMSFGFSDKQSDA-FIGQYGNG  209

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIVF++    N   PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  210   FKTSTMRLGADVIVFTQ--NQNNWVPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDLTTT  267

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R   + ++ N+  +++WSPFS+EA+LL+QF+ M DHGT+I+++NLW +D G +E
Sbjct  268   SYVQMLRHDQKLFSSNLAILLKWSPFSTEAELLKQFDDMGDHGTKIIVFNLWFNDDGDME  327

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDF++D +DI I G ++  K+  + K    +      R+SLR+YASILYL VP +FRIIL
Sbjct  328   LDFNSDKKDILITGAHKKVKTNSLDKIAAQNYVSTRLRYSLRAYASILYLHVPDTFRIIL  387

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG DVE HN+VND+M  + V Y+PQ    G+ + S    + TIGFVK A   IDVQGFNV
Sbjct  388   RGCDVEPHNVVNDLMYRECVLYKPQIA--GLTESS---VITTIGFVKGA-PDIDVQGFNV  441

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             YHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++ +
Sbjct  442   YHKNRLILPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKSVL  488



>ref|XP_004232448.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Solanum 
lycopersicum]
Length=644

 Score =   437 bits (1125),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 218/409 (53%), Positives = 301/409 (74%), Gaps = 14/409 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FW+AG+FE   R    +  G ++H RVHPKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  66    SRSFWRAGNFEVG-RIKSSAIHGELEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEV  124

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              +GAT+V ID + + +D S  L+ +D+GGGMDPD++R+CMSLGYS+K+  + TIGQYGNG
Sbjct  125   SSGATFVKIDRISNPRDNSPALLFQDDGGGMDPDRLRKCMSLGYSSKTSNS-TIGQYGNG  183

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR S  +G++ TQS+GLLSYTFLR TG +D++VPM+DY+     W
Sbjct  184   FKTSTMRLGADVIVFSR-SSRSGRA-TQSVGLLSYTFLRRTGQDDVIVPMIDYDIT-GHW  240

Query  680   GQ-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
              + I+  S +DW+ N+ TI+ WSPF+++ DLL+QF+ +K HGTRI+++NLW +D+G+ EL
Sbjct  241   AEPIVYGSQDDWSTNLNTILEWSPFATKLDLLQQFDDIKSHGTRIIVFNLWLNDEGIYEL  300

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRII  330
             +FD D  DI +R       + +  K+    +  ++Y  R+SLR+Y SILYL+   +F II
Sbjct  301   NFDDDDEDITLRDEANHGNTSKTNKRGRELQSHISYRLRYSLRAYTSILYLKKFTNFSII  360

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             LRGK VE +NI++++ +T+ +TYRPQ    G  K+  ++   ++GFVKD  +   V GFN
Sbjct  361   LRGKPVEQYNILDELKLTKVITYRPQLA--GTSKE--ILVETSLGFVKDTPS--SVCGFN  414

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLI+PFW++     S G GV+GVLEANF+EPAHDKQ FER+++ 
Sbjct  415   VYHKNRLIRPFWKVTADGSSKGNGVVGVLEANFIEPAHDKQDFERSSLF  463



>gb|KDP32669.1| hypothetical protein JCGZ_13667 [Jatropha curcas]
Length=635

 Score =   437 bits (1123),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 296/413 (72%), Gaps = 22/413 (5%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             + FWKA  ++          +G ++H RVHPKFLHSNATSHKW  GA AELLDN++DE+ 
Sbjct  80    RSFWKAQAYDVVLTARTSLPTGELEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEIQ  139

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGAT+V +D +   KD S  L+ +D+GGGMDP+ IR+CMSLGYS+K K   TIGQYGNGF
Sbjct  140   NGATFVMVDKIDILKDNSPALLFQDDGGGMDPESIRKCMSLGYSSK-KSNKTIGQYGNGF  198

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIVFSR S  +    TQS+GLLSYTFLR TG +D++VPM+D++ +   W 
Sbjct  199   KTSTMRLGADVIVFSRAS--HASKATQSVGLLSYTFLRKTGQDDVIVPMVDFDIS-GHWA  255

Query  677   Q-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
             + II SS +DW+ N++TI+ WSPFSS+ +LL+QF  +  HGT+I+IYNLW +D+G+ EL 
Sbjct  256   EPIIYSSQDDWSANLKTILEWSPFSSKDELLQQFEDIGRHGTKIIIYNLWLNDEGIYELS  315

Query  500   FDADPRDIQIRGVNRDDKSI---QMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFR  336
             FD D  DI++    RD+ S    ++ K+    +  ++Y  R+SLR+YASILYLR   +F 
Sbjct  316   FDDDDEDIRL----RDEASCAGQKLNKKVVELQSHISYRIRYSLRAYASILYLRKFTNFS  371

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVV--TIGFVKDAKAHIDV  162
             IILRGK VE  NI +D+  ++ VTY+PQ G       S  VA V  +IGF+K+A A + +
Sbjct  372   IILRGKPVEQFNIADDLKYSKLVTYKPQLGM-----ASKEVAAVETSIGFIKEAPA-LCI  425

Query  161   QGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
              GFNVYHKNRLI+PFW++ +   S G GV+GVLEANF+EPAHDKQ FER++V 
Sbjct  426   SGFNVYHKNRLIRPFWKVTSDGSSKGNGVVGVLEANFIEPAHDKQDFERSSVF  478



>ref|XP_008241762.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Prunus 
mume]
Length=607

 Score =   436 bits (1120),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 218/415 (53%), Positives = 290/415 (70%), Gaps = 11/415 (3%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAE  1068
              P C     S+ FWKAGD+   P      + G ++H RVHPKFLHSNATSHKW  GA AE
Sbjct  53    APNCQT-LDSRSFWKAGDYAVGPTARPYIAQGQLEHARVHPKFLHSNATSHKWAFGAIAE  111

Query  1067  LLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIA  888
             LLDN++DEV NGAT+V +D +   KD S  L+ +D+GGGMDP+ +R+CMSLGYS K K  
Sbjct  112   LLDNAVDEVQNGATFVRVDKIDVVKDNSPALLFQDDGGGMDPEGMRKCMSLGYSTK-KAN  170

Query  887   DTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPML  708
              TIGQYGNGFKTSTMRLGADVIVFSR    +GK+ TQS+GLLSYTFLR TG +D++VPM+
Sbjct  171   TTIGQYGNGFKTSTMRLGADVIVFSRAI-RSGKA-TQSVGLLSYTFLRRTGQDDVIVPMI  228

Query  707   DYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWE  528
             D++ +      I   S +DW  N++TI+ WSPF+S+ DL+ QF ++  HGTRIVIYNLW 
Sbjct  229   DFDISGNWVEPITYGSQDDWTSNLKTILEWSPFASKEDLMLQFEEIGAHGTRIVIYNLWL  288

Query  527   DDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVP  348
             +D+G+ EL FD D  DI++R      KS ++ +Q   S      R+SLR+YASILYLR  
Sbjct  289   NDEGIYELSFDDDDEDIRLRDEAAGGKSTKI-QQKIQSHISYRMRYSLRAYASILYLRTF  347

Query  347   PSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHI  168
              +F+I+LRGK ++ ++I +D+   +  TYRPQ     +   + ++   TIGF+K+A   +
Sbjct  348   TNFKIVLRGKPIQQYHIKDDLKYLEVKTYRPQ-----ITTLNEVIVETTIGFIKEA-PDL  401

Query  167   DVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
              V GFN+YHKNRLI+PFW++     S G GV+G+LEANF+EPAHDKQ FER+++ 
Sbjct  402   GVTGFNLYHKNRLIRPFWKVTADGSSKGNGVVGILEANFIEPAHDKQDFERSSLF  456



>gb|KGN63461.1| hypothetical protein Csa_1G001330 [Cucumis sativus]
Length=527

 Score =   432 bits (1112),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 221/240 (92%), Gaps = 3/240 (1%)
 Frame = -3

Query  713  MLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNL  534
            MLDYE    EW +I+RSS+ DWN+N++T+V+WSPF++EA+LLRQF  MKDHGTRI+IYNL
Sbjct  1    MLDYERKGGEWVKIVRSSLNDWNKNVDTVVQWSPFANEAELLRQFYMMKDHGTRIIIYNL  60

Query  533  WEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLR  354
            WEDDQG LELDFD DP DIQIRGVNRD+KSIQMAK++PNSRHFLTYRHSLRSYASILYLR
Sbjct  61   WEDDQGQLELDFDTDPHDIQIRGVNRDEKSIQMAKKFPNSRHFLTYRHSLRSYASILYLR  120

Query  353  VPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADG---VPKDSNMVAVVTIGFVKD  183
            +PP FRIILRG+DVEHHNIVNDMM++QEVTYRPQ GADG   V KD+NMVAVVTIGFVKD
Sbjct  121  LPPCFRIILRGRDVEHHNIVNDMMISQEVTYRPQPGADGAGTVGKDTNMVAVVTIGFVKD  180

Query  182  AKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
            AK HIDVQGFNVYHKNRLIKPFWRLWN +GSDGRGVIGVLEANFVEPAHDKQGFERTTVL
Sbjct  181  AKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  240



>ref|XP_008675507.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X1 [Zea mays]
 ref|XP_008675508.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X1 [Zea mays]
Length=684

 Score =   437 bits (1124),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 216/407 (53%), Positives = 297/407 (73%), Gaps = 11/407 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+GD+  A R   V+  GG + +R++PKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  91    CRQFWKSGDYVVARRNPDVAGPGGRNRLRINPKFLHSNATSHKWAFGAIAELLDNAIDEV  150

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ++  K+ +DG+  L+++D+GGGMDP+ +R+CMS G+S K   A  IGQYGNG
Sbjct  151   NNGATFVRVNKFKNPRDGNPSLLVQDDGGGMDPEALRRCMSFGFSDKQSDA-FIGQYGNG  209

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIVF++    N   PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  210   FKTSTMRLGADVIVFTQ--NQNNWVPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDLTTT  267

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R   + ++ N+  +++WSPFS+EA+LL+QF+ M DHGT+I+++NLW +D G +E
Sbjct  268   SYVQMLRHDQKLFSSNLAILLKWSPFSTEAELLKQFDDMGDHGTKIIVFNLWFNDDGDME  327

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDF++D +DI I G ++  K+  + K    +      R+SLR+YASILYL VP +FRIIL
Sbjct  328   LDFNSDKKDILITGAHKKVKTNSLDKIAAQNYVSTRLRYSLRAYASILYLHVPDTFRIIL  387

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG DVE HN+VND+M  + V Y+PQ    G+ + S    + TIGFVK A   IDVQGFNV
Sbjct  388   RGCDVEPHNVVNDLMYRECVLYKPQIA--GLTESS---VITTIGFVKGA-PDIDVQGFNV  441

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             YHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++ +
Sbjct  442   YHKNRLILPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKSVL  488



>ref|XP_008675509.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X2 [Zea mays]
Length=683

 Score =   437 bits (1124),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/407 (53%), Positives = 297/407 (73%), Gaps = 11/407 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+GD+  A R   V+  GG + +R++PKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  91    CRQFWKSGDYVVARRNPDVAGPGGRNRLRINPKFLHSNATSHKWAFGAIAELLDNAIDEV  150

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ++  K+ +DG+  L+++D+GGGMDP+ +R+CMS G+S K   A  IGQYGNG
Sbjct  151   NNGATFVRVNKFKNPRDGNPSLLVQDDGGGMDPEALRRCMSFGFSDKQSDA-FIGQYGNG  209

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIVF++    N   PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  210   FKTSTMRLGADVIVFTQ--NQNNWVPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDLTTT  267

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R   + ++ N+  +++WSPFS+EA+LL+QF+ M DHGT+I+++NLW +D G +E
Sbjct  268   SYVQMLRHDQKLFSSNLAILLKWSPFSTEAELLKQFDDMGDHGTKIIVFNLWFNDDGDME  327

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDF++D +DI I G ++  K+  + K    +      R+SLR+YASILYL VP +FRIIL
Sbjct  328   LDFNSDKKDILITGAHKKVKTNSLDKIAAQNYVSTRLRYSLRAYASILYLHVPDTFRIIL  387

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG DVE HN+VND+M  + V Y+PQ    G+ + S    + TIGFVK A   IDVQGFNV
Sbjct  388   RGCDVEPHNVVNDLMYRECVLYKPQIA--GLTESS---VITTIGFVKGA-PDIDVQGFNV  441

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             YHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++ +
Sbjct  442   YHKNRLILPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKSVL  488



>ref|XP_002455787.1| hypothetical protein SORBIDRAFT_03g025250 [Sorghum bicolor]
 gb|EES00907.1| hypothetical protein SORBIDRAFT_03g025250 [Sorghum bicolor]
Length=676

 Score =   436 bits (1122),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/411 (53%), Positives = 299/411 (73%), Gaps = 19/411 (5%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+GD+  A R       GG + +R++PKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  92    CRQFWKSGDYVVARRNPDADVPGGRNRLRINPKFLHSNATSHKWAFGAIAELLDNAIDEV  151

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ++  K+ +DG+  L+++D+GGGMDP+ +R+CMS G+S K   A  IGQYGNG
Sbjct  152   NNGATFVRVNKFKNPRDGNPSLLVQDDGGGMDPEALRRCMSFGFSDKQSDA-FIGQYGNG  210

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIVF++    N   PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  211   FKTSTMRLGADVIVFTQ--NQNNWVPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDPTTT  268

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R   + ++ N+  +++WSPF+SEA+LL+QF+ M DHGT+I+++NLW +D G +E
Sbjct  269   SYVQMLRHDQKLFSSNLAILLKWSPFASEAELLKQFDDMGDHGTKIIVFNLWFNDDGDME  328

Query  506   LDFDADPRDIQIRGVNRDDKSIQ----MAKQYPNSRHFLTYRHSLRSYASILYLRVPPSF  339
             LDF++D +DI I G ++  K+       A++Y ++R     R SLR+YASILYL VP +F
Sbjct  329   LDFNSDKKDILITGAHKMVKTNNPEKIAAQKYVSTR----LRFSLRAYASILYLHVPDTF  384

Query  338   RIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQ  159
             RIILRG+DVE HNIVND+M  + V Y+PQ    G+ + S    + TIGFVK A   IDVQ
Sbjct  385   RIILRGRDVEPHNIVNDLMYRECVLYKPQLA--GLTESS---VITTIGFVKGA-PDIDVQ  438

Query  158   GFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             GFNVYHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++ +
Sbjct  439   GFNVYHKNRLISPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKSVL  489



>ref|XP_008337977.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Malus 
domestica]
Length=626

 Score =   435 bits (1118),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 219/408 (54%), Positives = 290/408 (71%), Gaps = 11/408 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FW+AGD+   P      + G ++H RVHPKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  56    SRSFWRAGDYAVGPTSRASIAQGQLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEV  115

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V++D +   KD S  L+ +D+GGGMDP+ +R+CMSLGYS K K   TIGQYGNG
Sbjct  116   QNGATFVSVDKIDIVKDNSPALLFQDDGGGMDPEGMRKCMSLGYSTK-KANTTIGQYGNG  174

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR     GK+ TQS+GLLSYTFLR TG +D++VPM+DY+ +    
Sbjct  175   FKTSTMRLGADVIVFSRAI-RAGKA-TQSVGLLSYTFLRRTGQDDVIVPMVDYDISGNWV  232

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               II  S +DW  N++TI+ WSPF+S+ DL+RQF ++  HGTRI+IYNLW +D+G+ EL 
Sbjct  233   EPIIYGSQDDWTSNLKTILEWSPFASKDDLMRQFEEIGSHGTRILIYNLWLNDEGIYELS  292

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIIL  327
             FD D  DI++R       S+   ++  + +  ++Y  R SLR+YASILYLR    F+IIL
Sbjct  293   FDDDDEDIRLREEATRVTSVVAQRKINDLQSHISYRIRFSLRAYASILYLRRFTDFKIIL  352

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGK V+ ++I +D+     V Y+PQ     + K+  +    TIGF+K+A A + V GFNV
Sbjct  353   RGKPVQQYDIKDDLKYVDIVPYKPQL---AILKE--VTVETTIGFIKEAPA-LPVSGFNV  406

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLI+PFW++     S G GV+G+LEANF+EPAHDKQ FER+++ 
Sbjct  407   YHKNRLIRPFWKVTADGSSKGNGVVGILEANFIEPAHDKQDFERSSLF  454



>ref|XP_010679818.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=621

 Score =   434 bits (1117),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/407 (52%), Positives = 294/407 (72%), Gaps = 11/407 (3%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             + FWKAG +E  P   +V + G ++H RVHPKFLHSNATSHKW  GA AELLDN++DE+ 
Sbjct  55    RSFWKAGSYEIGP-SSFVPAHGELEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEIH  113

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGAT+V +D + + KD S  L+ +D+GGGMDP+ IR+CMSLGYS+K K   TIGQYGNGF
Sbjct  114   NGATFVKVDKIVNVKDHSPALLFQDDGGGMDPEGIRKCMSLGYSSK-KSNTTIGQYGNGF  172

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGADVIV SR S ++G++ TQS+GLLSYTFLR TG +D++VPM+D++ +     
Sbjct  173   KTSTMRLGADVIVLSR-STHSGRA-TQSVGLLSYTFLRLTGQDDVIVPMVDFDISNHWAE  230

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
              II SS +DW  N+  I+ WSPF+++ DL+ QF  +  HGT++++YNLW +D+G+ EL F
Sbjct  231   PIIYSSKDDWTANLNNILEWSPFATKEDLMMQFEDIGPHGTKVIVYNLWLNDEGIYELSF  290

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIILR  324
             D D  DI++R        +++ K+  + +  ++Y  R+SLR+Y+S+LYLR   +F+I+LR
Sbjct  291   DDDDEDIKLRDEASRVSGLKVNKRTLDLQSHISYRLRYSLRAYSSVLYLRKFKNFKILLR  350

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             GK VE  NI +++   Q VTY+PQ  A        ++   TIGF+K+A   ++V GFNVY
Sbjct  351   GKPVEQFNIADELQYKQVVTYKPQLAASS----KEVLVKTTIGFIKEA-PDLNVSGFNVY  405

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLI+PFW++     S G GV+GVLEANF+EPAHDKQ FER+++ 
Sbjct  406   HKNRLIRPFWKVSRDGSSVGNGVVGVLEANFIEPAHDKQDFERSSLF  452



>dbj|BAJ95604.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score =   436 bits (1120),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 217/418 (52%), Positives = 299/418 (72%), Gaps = 14/418 (3%)
 Frame = -3

Query  1253  RAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAF  1074
             RA+P   +    +QFWK+G++  A R     + GG + +R++PKFLHSNATSHKW  GA 
Sbjct  81    RALPAPRL---CRQFWKSGEYVVARRNPDADAPGGRNRLRINPKFLHSNATSHKWAFGAI  137

Query  1073  AELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSK  894
             AELLDN++DEV NGAT+V ++   + +DGS  L+++D+GGGMDPD +R CMS G+S K  
Sbjct  138   AELLDNAIDEVNNGATFVRVNKFTNPRDGSPSLLVQDDGGGMDPDALRCCMSFGFSDKQS  197

Query  893   IADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVP  714
              A  IGQYGNGFKTSTMRLGADVIVF++   N   +PT+SIGLLSYTFL  TG +D++VP
Sbjct  198   DA-FIGQYGNGFKTSTMRLGADVIVFTQNQKN--WTPTRSIGLLSYTFLMETGCDDVLVP  254

Query  713   MLDYENN--EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIY  540
              +DY  +     + Q++R + + ++ N+  +++WSPF SEA+LL+QF+ M +HGT+I+++
Sbjct  255   TVDYHYDLTTSSYTQLLRHNQKLFSSNLAILLKWSPFGSEAELLKQFDDMGEHGTKIIVF  314

Query  539   NLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILY  360
             NLW +D G +ELDF++D +DI I G  +  K+ +  K           RHSLR+YASILY
Sbjct  315   NLWFNDDGDMELDFNSDKKDILITGAQKKVKTNKHEKHVTQDYIANRLRHSLRAYASILY  374

Query  359   LRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDA  180
             LRVP SFRIILRG+DVE HN+VND+M  + V Y+PQ    G+P+   +  V TIGFVK A
Sbjct  375   LRVPDSFRIILRGQDVEPHNVVNDLMYRECVLYKPQIA--GLPE---LSIVTTIGFVKGA  429

Query  179   KAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
                 DVQGFNVYHKNRLI PFW++ + +   GRGV+G+L+A+F++P HDKQ FE++ +
Sbjct  430   -PDTDVQGFNVYHKNRLIMPFWKVASNSYGKGRGVVGILDASFIKPTHDKQDFEKSVL  486



>emb|CDF77348.1| CRT1-like GHKL ATPase [Hordeum vulgare]
Length=649

 Score =   435 bits (1119),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 217/418 (52%), Positives = 299/418 (72%), Gaps = 14/418 (3%)
 Frame = -3

Query  1253  RAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAF  1074
             RA+P   +    +QFWK+G++  A R     + GG + +R++PKFLHSNATSHKW  GA 
Sbjct  81    RALPAPRL---CRQFWKSGEYVVARRNPDADAPGGRNRLRINPKFLHSNATSHKWAFGAI  137

Query  1073  AELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSK  894
             AELLDN++DEV NGAT+V ++   + +DGS  L+++D+GGGMDPD +R CMS G+S K  
Sbjct  138   AELLDNAIDEVNNGATFVRVNKFTNPRDGSPSLLVQDDGGGMDPDALRCCMSFGFSDKQS  197

Query  893   IADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVP  714
              A  IGQYGNGFKTSTMRLGADVIVF++   N   +PT+SIGLLSYTFL  TG +D++VP
Sbjct  198   DA-FIGQYGNGFKTSTMRLGADVIVFTQNQKN--WTPTRSIGLLSYTFLMETGCDDVLVP  254

Query  713   MLDYENN--EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIY  540
              +DY  +     + Q++R + + ++ N+  +++WSPF SEA+LL+QF+ M +HGT+I+++
Sbjct  255   TVDYHYDLTTSSYTQLLRHNQKLFSSNLAILLKWSPFGSEAELLKQFDDMGEHGTKIIVF  314

Query  539   NLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILY  360
             NLW +D G +ELDF++D +DI I G  +  K+ +  K           RHSLR+YASILY
Sbjct  315   NLWFNDDGDMELDFNSDKKDILITGAQKKVKTNKHEKHVTQDYIANRLRHSLRAYASILY  374

Query  359   LRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDA  180
             LRVP SFRIILRG+DVE HN+VND+M  + V Y+PQ    G+P+   +  V TIGFVK A
Sbjct  375   LRVPDSFRIILRGQDVEPHNVVNDLMYRECVLYKPQIA--GLPE---LSIVTTIGFVKGA  429

Query  179   KAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
                 DVQGFNVYHKNRLI PFW++ + +   GRGV+G+L+A+F++P HDKQ FE++ +
Sbjct  430   -PDTDVQGFNVYHKNRLIMPFWKVASNSYGKGRGVVGILDASFIKPTHDKQDFEKSVL  486



>ref|XP_010268615.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Nelumbo 
nucifera]
 ref|XP_010268616.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Nelumbo 
nucifera]
 ref|XP_010268617.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Nelumbo 
nucifera]
 ref|XP_010268618.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Nelumbo 
nucifera]
Length=649

 Score =   434 bits (1117),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 216/406 (53%), Positives = 284/406 (70%), Gaps = 8/406 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAGD++  P        G ++H R+HPKFLHSNATSHKW  GA AELLDN++DE+
Sbjct  61    SRSFWKAGDYDVGPTKS-TPGPGQLEHARIHPKFLHSNATSHKWAFGAIAELLDNAVDEI  119

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              +GATY+ +D + + KD S  L+ +DNGGGMDP+ +R+CMSLGYS+K K  +TIGQYGNG
Sbjct  120   CHGATYLKVDKINNVKDNSPALLFQDNGGGMDPESMRKCMSLGYSSK-KSKETIGQYGNG  178

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR +  NG   TQS+GLLSYTFLR TG +D++VPM+D+E +E   
Sbjct  179   FKTSTMRLGADVIVFSRAT--NGSHATQSVGLLSYTFLRRTGQDDVIVPMVDFELSEHCA  236

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               II SS +DW  N++ I+ WSPF S+ +L+ QF+ +  HGT+I+I+NLW +D GLLELD
Sbjct  237   EPIIFSSQDDWAANLKIILGWSPFGSKEELMLQFDDIGPHGTKIIIFNLWLNDDGLLELD  296

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIILRG  321
             FD D  DI++R      +  +   +   S      R+SLR+Y SILYLR   +F I LRG
Sbjct  297   FDNDDEDIRLRDETDHGRPSRSRNKLIESHISYRIRYSLRAYISILYLRKFTNFHISLRG  356

Query  320   KDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVYH  141
             K VE   I +++   + VTYRPQ    G+     +    TIGFVK+A   + V GFN+YH
Sbjct  357   KPVEQITIADELKFRKVVTYRPQL---GMTSKETVSVETTIGFVKEA-PFLPVSGFNIYH  412

Query  140   KNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             K RLI+PFW++ +   S G GV+GVLEANF+EPAHDKQ FER+++ 
Sbjct  413   KCRLIRPFWKVVDEYSSRGNGVVGVLEANFIEPAHDKQDFERSSLF  458



>emb|CDP01951.1| unnamed protein product [Coffea canephora]
Length=621

 Score =   433 bits (1113),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 223/410 (54%), Positives = 297/410 (72%), Gaps = 15/410 (4%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAP-RGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             ++ FWKAG +E  P +  ++   G ++H RVHPKFLHSNATSHKW  GA AELLDN++DE
Sbjct  70    TRSFWKAGAYEIGPSKCSYIQ--GDLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDE  127

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             + NGAT+V +D + ++KD S  L+ +D+GGGM+P+ IR+CMSLGYS+K+    TIGQYGN
Sbjct  128   IENGATFVKVDRIYNKKDNSPALLFQDDGGGMNPESIRKCMSLGYSSKTS-NTTIGQYGN  186

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSR S  +G++ TQSIGLLSYTFLR TG +D+VVPM+D++ ++  
Sbjct  187   GFKTSTMRLGADVIVFSRAS-RSGRA-TQSIGLLSYTFLRRTGHDDVVVPMIDFDISDHW  244

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
                II SS  DW+ N++TI+ WSPFSS+ DL+ QF  +  HGT+I+IYNLW +D+G+ EL
Sbjct  245   AEPIIYSSHNDWSANLKTILDWSPFSSKDDLMLQFEDIGSHGTKIIIYNLWLNDEGIYEL  304

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRII  330
             +FD D  DI++R        ++  KQ    +  ++Y  R+SLR+YASILYLR    F+I+
Sbjct  305   NFDEDDEDIRLRDEANRGSLLKPTKQVIELQSHISYRIRYSLRAYASILYLRKFMKFKIL  364

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTI-GFVKDAKAHIDVQGF  153
             LRGK VE  +I  D+   + + YRPQ    G  K+   V+V TI GF K+A + I V GF
Sbjct  365   LRGKAVEQFDIAADLKHPETIFYRPQLA--GATKE---VSVSTILGFNKEAPS-IAVSGF  418

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLI+PFW++     S G GV+GVLEANF+EPAHDKQ FER+++ 
Sbjct  419   NVYHKNRLIRPFWKVTADGSSKGNGVVGVLEANFIEPAHDKQDFERSSLF  468



>ref|XP_004289106.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Fragaria 
vesca subsp. vesca]
Length=589

 Score =   432 bits (1110),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 213/409 (52%), Positives = 290/409 (71%), Gaps = 12/409 (3%)
 Frame = -3

Query  1223  SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             + + FWKAGD+   P+  +++    ++H RVHPKFLHSNATSHKW  GA AELLDN +DE
Sbjct  48    ACRSFWKAGDYV-VPKQQFLAQDQ-LEHARVHPKFLHSNATSHKWAFGAIAELLDNGVDE  105

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             + NGAT+V++D V+ +KD S  L+  D+G GM+P+ +R+CMSLGYS K K   TIGQYGN
Sbjct  106   IQNGATFVSVDKVELKKDNSPALLFRDDGAGMNPEGLRKCMSLGYSTK-KSNTTIGQYGN  164

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGAD IVFSR +   G   TQSIGLLSYTFLR TG +D++VPM+D++ +   
Sbjct  165   GFKTSTMRLGADAIVFSRAT--RGSKATQSIGLLSYTFLRRTGQDDVIVPMIDFDISGNW  222

Query  683   WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
                II SS++DW+ N++TI++WSPF S+ DLL+QF  +  HGT+I+IYNLW +D+G+ EL
Sbjct  223   VEPIIYSSLDDWSSNLKTILKWSPFGSKEDLLQQFEDIGAHGTKIIIYNLWLNDEGIYEL  282

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRII  330
              FD D  DI++R         +  K+     + ++Y  R+SLR+YASILYLR   +F++I
Sbjct  283   SFDDDDEDIRLRDETNHGSLTKSKKKTAGLLNHVSYRLRYSLRAYASILYLRKFTNFQVI  342

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             +RGK V+ +NI +D++  + +TYRPQ           ++   TIGF K+A   + V GFN
Sbjct  343   IRGKPVQQYNIQDDLIHAKVITYRPQLAT----MSKEVLVETTIGFAKEA-PDLPVSGFN  397

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLI+PFW++     S G GVIG+LEANF+EPAHDKQ FER+++ 
Sbjct  398   VYHKNRLIRPFWKVTADGSSKGNGVIGILEANFIEPAHDKQDFERSSLF  446



>ref|XP_007204594.1| hypothetical protein PRUPE_ppa003060mg [Prunus persica]
 gb|EMJ05793.1| hypothetical protein PRUPE_ppa003060mg [Prunus persica]
Length=607

 Score =   432 bits (1111),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 215/408 (53%), Positives = 290/408 (71%), Gaps = 14/408 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAGD+   P      S G ++H RVHPKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  61    SRSFWKAGDYAVGPTARPYISQGQLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEV  120

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D +   KD S  L+ +D+GGGMDP+ +R+CMSLGYS K K   TIGQYGNG
Sbjct  121   QNGATFVRVDKIDVVKDNSPALLFQDDGGGMDPEGMRKCMSLGYSTK-KANTTIGQYGNG  179

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR     GK+ TQS+GLLSYTFLR TG +D++VPM+D++ +    
Sbjct  180   FKTSTMRLGADVIVFSRAI-RAGKA-TQSVGLLSYTFLRRTGQDDVIVPMIDFDISGNWV  237

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               I   S +DW  N++TI+ WSPF+S+ DL+ QF ++  HGTRIVIYNLW +D+G+ EL 
Sbjct  238   EPITYGSQDDWTSNLKTILEWSPFASKEDLMLQFEEIGAHGTRIVIYNLWLNDEGIYELS  297

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIIL  327
             FD D  DI++R      KS ++ ++    +  ++Y  R+SLR+YASILYLR   +F+I+L
Sbjct  298   FDDDDEDIRLRDEAAGGKSTKVQQKI---QFHISYRMRYSLRAYASILYLRTFTNFKIVL  354

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGK ++ ++I +D+   +  TY+PQ     +   + ++   TIGF+K+A   + V GFN+
Sbjct  355   RGKPIQQYHIKDDLRYLEVKTYKPQ-----ITTLNEVIVETTIGFIKEA-PDLGVTGFNL  408

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLI+PFW++     S G GV+G+LEANF+EPAHDKQ FER+++ 
Sbjct  409   YHKNRLIRPFWKVTADGSSKGNGVVGILEANFIEPAHDKQDFERSSLF  456



>gb|EEE54777.1| hypothetical protein OsJ_02172 [Oryza sativa Japonica Group]
Length=682

 Score =   433 bits (1113),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 211/411 (51%), Positives = 300/411 (73%), Gaps = 19/411 (5%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+GD+  A R     + GG + +R++P+FLHSNATSHKW  GA AELLDN++DEV
Sbjct  112   CRQFWKSGDYVVAQRNPDADAPGGRNRLRINPRFLHSNATSHKWAFGAIAELLDNAIDEV  171

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
               GAT+V ++   + +DGS  L+I+D+GGGMDP+ +R+CMS G+S K   A  IGQYGNG
Sbjct  172   NTGATFVRVNEFTNPRDGSSSLLIQDDGGGMDPEALRRCMSFGFSDKQSDA-LIGQYGNG  230

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIVF++    N   PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  231   FKTSTMRLGADVIVFTQ--NQNNWVPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDISTA  288

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R   + ++ N+  +++WSPF+SEA+LL+QF+ + +HGT+I+++NLW +D G +E
Sbjct  289   SYTQMLRHDQKLFSSNLAILLKWSPFASEAELLKQFDDIGEHGTKIIVFNLWFNDDGDME  348

Query  506   LDFDADPRDIQIRGVNRD---DKSIQMAKQ-YPNSRHFLTYRHSLRSYASILYLRVPPSF  339
             LDF++D +DI I G +R    +K+ ++A Q Y ++R     R+SLR+Y S+LYL +P +F
Sbjct  349   LDFNSDKKDILITGAHRKVNTNKADKVATQNYVSTR----LRYSLRAYTSVLYLHIPDNF  404

Query  338   RIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQ  159
             RI+LRG DVE HN++ND+M  + V Y+PQ    G+   + + A+ TIGFVK A   IDVQ
Sbjct  405   RIVLRGHDVESHNVINDLMYPECVLYKPQIA--GL---AELSAITTIGFVKGA-PEIDVQ  458

Query  158   GFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             GFNVYHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++ +
Sbjct  459   GFNVYHKNRLIAPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKSVL  509



>ref|XP_010660881.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X2 [Vitis vinifera]
Length=634

 Score =   431 bits (1107),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 226/423 (53%), Positives = 292/423 (69%), Gaps = 27/423 (6%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGM-DHVRVHPKFLHSNATSHKWVLGAFA  1071
              P C      +QFWKAG+++        S S  + +H+ VHP FLHSNATSHKW  GA A
Sbjct  23    APVC------RQFWKAGNYDIGHGSKATSQSIDVKNHLCVHPMFLHSNATSHKWAFGAIA  76

Query  1070  ELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKI  891
             ELLDN+ DE+ NGAT+V ID + + +DG+  L+I+D+GGGMDP+ IR CMS G+SAK K 
Sbjct  77    ELLDNAFDEIQNGATFVVIDKIPNPRDGNPALLIQDDGGGMDPEAIRHCMSFGFSAK-KS  135

Query  890   ADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPM  711
               +IGQYGNGFKTSTMRLGADVIVFSR      +SPTQSIGLLSYTFLR TG   IVVP+
Sbjct  136   KTSIGQYGNGFKTSTMRLGADVIVFSRHLKE--RSPTQSIGLLSYTFLRQTGCNKIVVPV  193

Query  710   LDYENNEK--EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYN  537
             +DYE N    ++G I+    + ++ N+  +++WSP+S+E +LL QF+ +  HGT+IVIYN
Sbjct  194   VDYEFNASTGKYGPILPHGKKHFSLNLSMLLQWSPYSTEDELLLQFDDIGQHGTKIVIYN  253

Query  536   LWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYP--NSRHFLT-YRHSLRSYASI  366
             LW +D+G +ELDFD+D  DI I   NR  K  Q  K       +H    Y +SLR Y+SI
Sbjct  254   LWLNDEGHMELDFDSDVEDICI---NRGPKLFQKGKHVNPIYDQHMANLYHYSLRIYSSI  310

Query  365   LYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGAD-GVPKDSNMVAVVTIGFV  189
             LYLR+P  FRIILRG+ VEHHNI ND+   + + YRP  G +  VP       + TIGF+
Sbjct  311   LYLRIPQCFRIILRGRVVEHHNIANDLKFWEIILYRPHIGGNVEVP------VLTTIGFL  364

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLW-NPAGSDGRGVIGVLEANFVEPAHDKQGFERT  12
             KDA  H+++ GFNVYH+NRLI PFWR+  N   S+ RGV+GVLEANF+EP H+KQ FE+T
Sbjct  365   KDA-PHVNIHGFNVYHRNRLILPFWRVVKNTTNSNARGVVGVLEANFIEPTHNKQDFEKT  423

Query  11    TVL  3
             ++ 
Sbjct  424   SLF  426



>ref|XP_010432184.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Camelina 
sativa]
Length=631

 Score =   431 bits (1107),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 219/420 (52%), Positives = 287/420 (68%), Gaps = 12/420 (3%)
 Frame = -3

Query  1259  SGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLG  1080
             +  A P   +E  S  FWKAG+    P G   ++ G ++H RVHPKFLHSNATSHKW  G
Sbjct  43    AATAAPRETLECRS--FWKAGENYVIPTGVTPTAPGMLEHARVHPKFLHSNATSHKWAFG  100

Query  1079  AFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAK  900
             A AELLDN++DE  NGAT+V ID +   KD +  L+ +D+GGGMDP+ IR+CMSLGYS+K
Sbjct  101   AIAELLDNAVDETQNGATFVKIDKINIVKDNTPALVFQDDGGGMDPNGIRKCMSLGYSSK  160

Query  899   SKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIV  720
              K   TIGQYGNGFKTSTMRLGAD IVFSR S + GKS TQSIGLLSYTFLR TG +D++
Sbjct  161   -KSNTTIGQYGNGFKTSTMRLGADAIVFSR-STHGGKS-TQSIGLLSYTFLRRTGQDDVI  217

Query  719   VPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIY  540
             VPM+D++ +E +   II  S  DW+ N+  +++WSPFS+  +LL+QF  +  HGT++VIY
Sbjct  218   VPMIDFDISEDQPQPIIYGSPGDWSTNLNILLKWSPFSTVDELLQQFEDIGTHGTKVVIY  277

Query  539   NLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHF-LTYRHSLRSYASIL  363
             NLW +D+G+ EL FD D  DIQ+R  N  D     AK      H    YRHSLR+Y S+L
Sbjct  278   NLWLNDEGIYELSFDDDDEDIQLRDENAQDGKRLHAKTLELRSHISYRYRHSLRAYISML  337

Query  362   YLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKD  183
             YL+   +F+I+LRG  V+  NI ++    + V Y+PQ  A          + + IGF+K+
Sbjct  338   YLKKFKNFKIVLRGIPVQQFNIADEFRYPETVMYKPQAAA-----TEYAASEIKIGFIKE  392

Query  182   AKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             A   + + GFNVYHKNRLI+PFW++     + G GV+GVLEANF+EPAHDKQ FER+++ 
Sbjct  393   A-PKLPINGFNVYHKNRLIRPFWKVLLEGSTRGNGVVGVLEANFIEPAHDKQDFERSSLF  451



>ref|XP_008375822.1| PREDICTED: MORC family CW-type zinc finger protein 3 [Malus domestica]
 ref|XP_008375823.1| PREDICTED: MORC family CW-type zinc finger protein 3 [Malus domestica]
Length=683

 Score =   432 bits (1111),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 219/422 (52%), Positives = 289/422 (68%), Gaps = 20/422 (5%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             TS+    P C      +QFWKAG +  A  G  V+   G +++ VHP FLHSNATSHKW 
Sbjct  96    TSTFSPAPLC------RQFWKAGSYNDAV-GSKVAFQNGKNYLHVHPMFLHSNATSHKWA  148

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN++DE+ NGAT+V +D + + +DGS  L+I+D+G GMDP+ +R+CMS G+S
Sbjct  149   FGAIAELLDNAVDEIQNGATFVIVDKILNPRDGSPALLIQDDGSGMDPEAMRRCMSFGFS  208

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K K    IGQYGNGFKTSTMRLGADVIVFSR    + ++ TQSIGLLSYTFL  TG + 
Sbjct  209   DK-KSKSAIGQYGNGFKTSTMRLGADVIVFSRH--QDTRTLTQSIGLLSYTFLARTGHDR  265

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPM+DYE N       +    E +  N+  +++WSP+S+EADLL+QFN +  HGT+++
Sbjct  266   IVVPMVDYEFNTLTNKLEVMHGKEHFMSNLSMLLQWSPYSTEADLLKQFNDIGAHGTKVI  325

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLT-YRHSLRSYAS  369
             +YNLW  D G LELDFD DP DI+I G   D K +    +  N  H    +R SLR Y S
Sbjct  326   VYNLWFSDDGNLELDFDTDPEDIRISG---DTKKVDTKFKTVNEEHIANRFRFSLRVYLS  382

Query  368   ILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFV  189
             ILYLR+P +F+I+LRG+ VEHHNI ND+   + + Y+PQ+G     +      + TIGF+
Sbjct  383   ILYLRIPQTFQIVLRGRVVEHHNIANDLKFPEFILYKPQSGGSVEGQ-----VITTIGFL  437

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTT  9
             K+A  H+   GFNVYHKNRLI P+W++ + + S GRGV+GVLEANFVEP+H+KQ FE+T 
Sbjct  438   KEA-PHVSFHGFNVYHKNRLILPYWQVVSYSDSRGRGVVGVLEANFVEPSHNKQDFEKTN  496

Query  8     VL  3
             + 
Sbjct  497   LF  498



>ref|XP_006645988.1| PREDICTED: uncharacterized protein LOC102721607 [Oryza brachyantha]
Length=772

 Score =   434 bits (1115),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 213/422 (50%), Positives = 298/422 (71%), Gaps = 11/422 (3%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
              SS   VP        +QFWK+GD+  A R     + GG + +R++PKFLHSNATSHKW 
Sbjct  187   ASSSPGVPALPPPRLCRQFWKSGDYVVAQRNPDTDALGGRNRLRINPKFLHSNATSHKWA  246

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN++DEV  GAT+V +D   + +DG+  L+I+D+GGGMDP+ +R+CMS G+S
Sbjct  247   FGAIAELLDNAIDEVNTGATFVRVDEFTNPRDGNPSLLIQDDGGGMDPEGLRRCMSFGFS  306

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K   A  IGQYGNGFKTSTMRLGADVIVF++    N   PT+SIGLLSYTFL  TG +D
Sbjct  307   DKQSDA-FIGQYGNGFKTSTMRLGADVIVFTQ--NQNNWVPTRSIGLLSYTFLMETGCDD  363

Query  725   IVVPMLDYENN--EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTR  552
             ++VP +DY+ +     + Q++R   + ++ N+  +++WSPF+SEA+LL+QF+ + +HGT+
Sbjct  364   VLVPTVDYQYDPTTASYTQMLRHDQKLFSSNLAILLKWSPFASEAELLKQFDDIGEHGTK  423

Query  551   IVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYA  372
             I+++NLW +D G +ELDF++D +DI I G ++  K+ +  K    S      R+SLR+Y 
Sbjct  424   IIVFNLWFNDDGDMELDFNSDEKDILITGSHKKVKTNKAEKIATQSYVSTRLRYSLRAYT  483

Query  371   SILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGF  192
             S+LYL +P +FRI+LRG DVE HN++ND+M  + V Y+PQ    G+   + + A+ TIGF
Sbjct  484   SVLYLHIPDNFRIVLRGHDVESHNVINDLMYPECVLYKPQIA--GL---AELSAITTIGF  538

Query  191   VKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERT  12
             VK A   IDVQGFNVYHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++
Sbjct  539   VKGA-PDIDVQGFNVYHKNRLIAPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKS  597

Query  11    TV  6
              +
Sbjct  598   VL  599



>emb|CDM83165.1| unnamed protein product [Triticum aestivum]
Length=649

 Score =   430 bits (1105),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/407 (52%), Positives = 295/407 (72%), Gaps = 11/407 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+G++  A R     + GG + +R++PKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  89    CRQFWKSGEYVVARRNPDADAPGGRNRLRINPKFLHSNATSHKWAFGAIAELLDNAIDEV  148

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ++   + +DGS  L+++D+GGGMDPD +R CMS G+S K   A  IGQYGNG
Sbjct  149   NNGATFVRVNKFTNPRDGSPSLLVQDDGGGMDPDALRCCMSFGFSDKQSDA-FIGQYGNG  207

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIVF++   N   +PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  208   FKTSTMRLGADVIVFTQNQKN--WTPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDLTTA  265

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R + + ++ N+  + +WSPF+SEA+LL+QF+ + +HGT+I+++NLW +D G +E
Sbjct  266   SYTQLLRHNQKLFSSNLAILSKWSPFASEAELLKQFDDIGEHGTKIIVFNLWFNDDGDME  325

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDF++D +DI I G  +  K+ +  K           R+SLR+YASILYLRVP SFRIIL
Sbjct  326   LDFNSDKKDILITGAQKKVKTNKHEKLVTQDYIANRLRYSLRAYASILYLRVPDSFRIIL  385

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG+DVE HN+VND++  + V Y+PQ    G+P+   +  V TIGFVK A    DVQGFNV
Sbjct  386   RGQDVEPHNVVNDLLYRECVLYKPQIA--GLPE---LSIVTTIGFVKGA-PDTDVQGFNV  439

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             YHKNRLI PFW++ + +   GRGV+G+L+A+F++P HDKQ FE++ +
Sbjct  440   YHKNRLITPFWKVASNSYGKGRGVVGILDASFIKPTHDKQDFEKSVL  486



>ref|XP_007156096.1| hypothetical protein PHAVU_003G258200g [Phaseolus vulgaris]
 gb|ESW28090.1| hypothetical protein PHAVU_003G258200g [Phaseolus vulgaris]
Length=631

 Score =   429 bits (1103),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 219/424 (52%), Positives = 296/424 (70%), Gaps = 14/424 (3%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             +SS  +VP    +   + FWKAGDF   P        G ++H RVHPKFLHSNATSHKW 
Sbjct  54    SSSALSVP----DGRFRSFWKAGDFVVGPSSKPAPFQGHLEHARVHPKFLHSNATSHKWA  109

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AEL+DN++DE+ NGAT+V ID    +KD S  L   D+GGGMDP+ IR+CMSLGYS
Sbjct  110   FGAIAELVDNAVDEIQNGATFVKIDKFDVKKDNSPALCFLDDGGGMDPNSIRKCMSLGYS  169

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
             +K K   TIGQYGNGFKTSTMRLGAD IVFSR   ++G++ TQS+GLLSYTFLR TG +D
Sbjct  170   SK-KSKTTIGQYGNGFKTSTMRLGADAIVFSRAR-HSGRA-TQSVGLLSYTFLRRTGQDD  226

Query  725   IVVPMLDYENNEKEWGQ-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRI  549
             +VVPM+D++ +   W + II SS ++W+ N++TI+ WSPF+S+ +L+ QF+ +  HGT++
Sbjct  227   VVVPMIDFDIS-GHWAEPIIYSSQDEWSANLKTILDWSPFTSKEELMLQFDDIGSHGTKV  285

Query  548   VIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSY  375
             +IYNLW +D+G+ EL FD D  DI +R         ++ K+    +  ++Y  R+SLR+Y
Sbjct  286   LIYNLWLNDEGIYELSFDDDVEDIMLRDEANHGAEKKLNKKTVQLQSHISYRIRYSLRAY  345

Query  374   ASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIG  195
              S+LYLR   +F+I+LRGK V+  NIV+D++ ++ + YRPQ        ++      TIG
Sbjct  346   VSMLYLRKFSNFKIMLRGKLVDQFNIVDDLIHSKVIPYRPQLAI--ASNEAIAETKTTIG  403

Query  194   FVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFER  15
             F+K+A A I V GFNVYHKNRLIKPFW++ +   S G  V+GVLEANF+EPAHDKQ FER
Sbjct  404   FIKEA-ASIKVTGFNVYHKNRLIKPFWKVVSDGSSKGSCVVGVLEANFIEPAHDKQDFER  462

Query  14    TTVL  3
             + + 
Sbjct  463   SVLF  466



>ref|XP_010231898.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X2 [Brachypodium distachyon]
Length=655

 Score =   430 bits (1105),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 208/407 (51%), Positives = 295/407 (72%), Gaps = 11/407 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+G++  A R     + GG + +R++PKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  97    CRQFWKSGEYTVARRNPDADAPGGRNRLRINPKFLHSNATSHKWAFGAIAELLDNAIDEV  156

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ++   + +DGS  L+I+D+GGGMDP+ +R CMS G+S K   A  IGQYGNG
Sbjct  157   NNGATFVRVNKFTNPRDGSPSLLIQDDGGGMDPEALRCCMSFGFSDKQSDA-FIGQYGNG  215

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIV ++   N   +PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  216   FKTSTMRLGADVIVLTQNQKN--WTPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDLTTA  273

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R + + ++ N+  +++WSPF++EA+L++QF+ + DHGT+I+++NLW +D G +E
Sbjct  274   SYTQLLRHNQKLFSSNLAILLKWSPFATEAELIKQFDDIGDHGTKIIVFNLWFNDDGDME  333

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDF++D +D+ I G  +  K+ +  K    +      R+SLR+YASILYLRVP +FRIIL
Sbjct  334   LDFNSDKKDVLITGAQKKVKASKREKAEMQNYVANRLRYSLRAYASILYLRVPDNFRIIL  393

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG+DV+ HN+VND+M  + V Y+PQ    G+   + +  + TIGFVK A    DVQGFNV
Sbjct  394   RGRDVDSHNVVNDLMYRECVLYKPQIA--GL---TELSIITTIGFVKGA-PDTDVQGFNV  447

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             YHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++ +
Sbjct  448   YHKNRLITPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKSVL  494



>gb|KHN27040.1| MORC family CW-type zinc finger protein 4 [Glycine soja]
Length=630

 Score =   429 bits (1102),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 216/409 (53%), Positives = 288/409 (70%), Gaps = 10/409 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAGD+   P        G ++H RVHPKFLHSNATSHKW  GA AEL+DN++DE+
Sbjct  65    SRSFWKAGDYVVGPSSKPTPFQGHLEHARVHPKFLHSNATSHKWAFGAIAELVDNAVDEI  124

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ID    +KD S  L   D+GGGM+P+ IR+CMSLGYS+K K   TIGQYGNG
Sbjct  125   QNGATFVKIDKFDVKKDNSPALCFLDDGGGMNPNAIRKCMSLGYSSK-KSKTTIGQYGNG  183

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR + ++G++ TQS+GLLSYTFLR TG +D+VVPM+D++ +   W
Sbjct  184   FKTSTMRLGADVIVFSR-AMHSGRA-TQSVGLLSYTFLRRTGQDDVVVPMIDFDIS-GHW  240

Query  680   GQ-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
              + II SS ++W+ N++TI+ WSPF+S+ +L+ QF+ +  HGT++VIYNLW +D+G+ EL
Sbjct  241   AEPIIYSSQDEWSANLKTILDWSPFTSKEELMLQFDDIGSHGTKVVIYNLWLNDEGIYEL  300

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRII  330
              FD D  DI +R          + K+    +  ++Y  R SLR+Y S+LYLR   +F II
Sbjct  301   SFDDDAEDIMLRDEANHGAEKNLRKKTVQLQSHISYRLRFSLRAYVSMLYLRKFSNFSII  360

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             LRGK V+  NI +D++ ++ + Y+PQ        ++      TIGF+K+A A I V GFN
Sbjct  361   LRGKLVDQFNIADDLIYSKVIPYKPQLAM--ATNEAIAETKTTIGFIKEA-AEIKVTGFN  417

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLIKPFW++     S GR V+GVLEANF+EPAHDKQ FER+ + 
Sbjct  418   VYHKNRLIKPFWKVVADGSSKGRCVVGVLEANFIEPAHDKQDFERSVLF  466



>ref|XP_003569179.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X1 [Brachypodium distachyon]
Length=657

 Score =   429 bits (1104),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/407 (51%), Positives = 295/407 (72%), Gaps = 11/407 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              +QFWK+G++  A R     + GG + +R++PKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  97    CRQFWKSGEYTVARRNPDADAPGGRNRLRINPKFLHSNATSHKWAFGAIAELLDNAIDEV  156

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ++   + +DGS  L+I+D+GGGMDP+ +R CMS G+S K   A  IGQYGNG
Sbjct  157   NNGATFVRVNKFTNPRDGSPSLLIQDDGGGMDPEALRCCMSFGFSDKQSDA-FIGQYGNG  215

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENN--EK  687
             FKTSTMRLGADVIV ++   N   +PT+SIGLLSYTFL  TG +D++VP +DY+ +    
Sbjct  216   FKTSTMRLGADVIVLTQNQKN--WTPTRSIGLLSYTFLMETGCDDVLVPTVDYQYDLTTA  273

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
              + Q++R + + ++ N+  +++WSPF++EA+L++QF+ + DHGT+I+++NLW +D G +E
Sbjct  274   SYTQLLRHNQKLFSSNLAILLKWSPFATEAELIKQFDDIGDHGTKIIVFNLWFNDDGDME  333

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDF++D +D+ I G  +  K+ +  K    +      R+SLR+YASILYLRVP +FRIIL
Sbjct  334   LDFNSDKKDVLITGAQKKVKASKREKAEMQNYVANRLRYSLRAYASILYLRVPDNFRIIL  393

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RG+DV+ HN+VND+M  + V Y+PQ    G+   + +  + TIGFVK A    DVQGFNV
Sbjct  394   RGRDVDSHNVVNDLMYRECVLYKPQIA--GL---TELSIITTIGFVKGA-PDTDVQGFNV  447

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             YHKNRLI PFW++ N +   GRGV+G+LEANF++P HDKQ FE++ +
Sbjct  448   YHKNRLITPFWKVANNSYGKGRGVVGILEANFIKPTHDKQDFEKSVL  494



>ref|XP_007206462.1| hypothetical protein PRUPE_ppa018433mg, partial [Prunus persica]
 gb|EMJ07661.1| hypothetical protein PRUPE_ppa018433mg, partial [Prunus persica]
Length=572

 Score =   426 bits (1095),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 219/424 (52%), Positives = 287/424 (68%), Gaps = 22/424 (5%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             TS     P C      +QFWKAG++     G  V+   G +++ VHP FLHSNATSHKW 
Sbjct  93    TSPLSPAPLC------RQFWKAGNYNDGI-GSKVTIQNGKNYLHVHPMFLHSNATSHKWA  145

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN++DE+ NGAT+V +D   + +DGS  L+I+DNG GMDP+ +R+CMS G+S
Sbjct  146   FGAIAELLDNAVDEIQNGATFVIVDKTSNPRDGSPALLIQDNGSGMDPEAMRRCMSFGFS  205

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K K    IGQYGNGFKTSTMRLGADVIVFSR    + +  TQSIGLLSYTFL  TG + 
Sbjct  206   DK-KSKSAIGQYGNGFKTSTMRLGADVIVFSR--HQDKRVLTQSIGLLSYTFLARTGHDR  262

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPM+DYE N       I    E +  N+  +++WSP+S+EADLL+QFN +  HGT+++
Sbjct  263   IVVPMVDYEFNTSTETLEIMHGTEHFMSNLSMLLQWSPYSTEADLLKQFNDIGAHGTKVI  322

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYP--NSRHFLT-YRHSLRSY  375
             IYNLW +D   +ELDFD DP DI+I G   D K +  + ++   N  H    + +SLR Y
Sbjct  323   IYNLWFNDDRNVELDFDTDPEDIRISG---DTKKVNASSKWKTVNEEHIANRFHYSLRVY  379

Query  374   ASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIG  195
              SILYLR+P +F+I+LRG+ VEHHNI ND+   + + Y+PQ G     +      + TIG
Sbjct  380   LSILYLRIPETFQIVLRGRVVEHHNIANDLKFPEFILYKPQMGGSVEGQ-----VITTIG  434

Query  194   FVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFER  15
             F+K+A  H+   GFNVYHKNRLI PFW++ +   S GRGV+GVLEANFVEP+H+KQ FE+
Sbjct  435   FLKEA-PHVSFHGFNVYHKNRLILPFWQVVSYLDSRGRGVVGVLEANFVEPSHNKQDFEK  493

Query  14    TTVL  3
             T++ 
Sbjct  494   TSLF  497



>emb|CBI34886.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   427 bits (1099),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 293/423 (69%), Gaps = 30/423 (7%)
 Frame = -3

Query  1247  VPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAE  1068
              P C      +QFWKAG+++    G    ++   +H+ VHP FLHSNATSHKW  GA AE
Sbjct  23    APVC------RQFWKAGNYD---IGHGSKATNVKNHLCVHPMFLHSNATSHKWAFGAIAE  73

Query  1067  LLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIA  888
             LLDN+ DE+ NGAT+V ID + + +DG+  L+I+D+GGGMDP+ IR CMS G+SAK K  
Sbjct  74    LLDNAFDEIQNGATFVVIDKIPNPRDGNPALLIQDDGGGMDPEAIRHCMSFGFSAK-KSK  132

Query  887   DTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPML  708
              +IGQYGNGFKTSTMRLGADVIVFSR      +SPTQSIGLLSYTFLR TG   IVVP++
Sbjct  133   TSIGQYGNGFKTSTMRLGADVIVFSRHLKE--RSPTQSIGLLSYTFLRQTGCNKIVVPVV  190

Query  707   DYENNEK--EWGQIIRSSVEDWNRNIETIVRWSPFSSEAD-LLRQFNQMKDHGTRIVIYN  537
             DYE N    ++G I+    + ++ N+  +++WSP+S+E + LL+QF+ +  HGT+IVIYN
Sbjct  191   DYEFNASTGKYGPILPHGKKHFSLNLSMLLQWSPYSTEDELLLQQFDDIGQHGTKIVIYN  250

Query  536   LWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYP--NSRHFLT-YRHSLRSYASI  366
             LW +D+G +ELDFD+D  DI I   NR  K  Q  K       +H    Y +SLR Y+SI
Sbjct  251   LWLNDEGHMELDFDSDVEDICI---NRGPKLFQKGKHVNPIYDQHMANLYHYSLRIYSSI  307

Query  365   LYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGAD-GVPKDSNMVAVVTIGFV  189
             LYLR+P  FRIILRG+ VEHHNI ND+   + + YRP  G +  VP       + TIGF+
Sbjct  308   LYLRIPQCFRIILRGRVVEHHNIANDLKFWEIILYRPHIGGNVEVP------VLTTIGFL  361

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLW-NPAGSDGRGVIGVLEANFVEPAHDKQGFERT  12
             KDA  H+++ GFNVYH+NRLI PFWR+  N   S+ RGV+GVLEANF+EP H+KQ FE+T
Sbjct  362   KDA-PHVNIHGFNVYHRNRLILPFWRVVKNTTNSNARGVVGVLEANFIEPTHNKQDFEKT  420

Query  11    TVL  3
             ++ 
Sbjct  421   SLF  423



>ref|XP_006828823.1| hypothetical protein AMTR_s00001p00138970 [Amborella trichopoda]
 gb|ERM96239.1| hypothetical protein AMTR_s00001p00138970 [Amborella trichopoda]
Length=777

 Score =   432 bits (1111),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 216/405 (53%), Positives = 285/405 (70%), Gaps = 13/405 (3%)
 Frame = -3

Query  1211  FWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVING  1032
             FWKAGD++        S  G MDHVRVHPKFLHSNATSHKW  GA AELLDN++DE+ NG
Sbjct  193   FWKAGDYDNFV-SRRSSGQGQMDHVRVHPKFLHSNATSHKWAFGAIAELLDNAVDEIPNG  251

Query  1031  ATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGFKT  852
             AT+V +D V + +DGS +L+ +D+GGGMDP+++R CMSLGYS+K K   TIGQYGNGFKT
Sbjct  252   ATFVKVDSVYNARDGSPVLLFQDDGGGMDPERMRHCMSLGYSSK-KNNTTIGQYGNGFKT  310

Query  851   STMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWGQI  672
             STMRLGADVIVFS      G   TQS+GLLSYTFLR TG++D++VPM+D+E    +   +
Sbjct  311   STMRLGADVIVFS--GSKQGSCATQSVGLLSYTFLRKTGLDDVIVPMIDFELCGDDVKPL  368

Query  671   IRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDFDA  492
             IR S +DW  N+  I+ WSP+ SE +L+RQF  +  HGT+I+IYNLW +D GL ELDF  
Sbjct  369   IRRSQDDWTDNMNAILEWSPYLSEEELMRQFEDIGPHGTKIIIYNLWLNDDGLSELDF-T  427

Query  491   DPRDIQIRGVNRDDKSIQMAKQYPNSRHFL-TYRHSLRSYASILYLRVPPSFRIILRGKD  315
             D  DI++ G  + + ++ +++Q     H     R+SLR+YASILYLR   +F IILRG  
Sbjct  428   DDEDIKLNGEAKYE-TLSISQQRHRENHISHRLRYSLRAYASILYLRKFTNFEIILRGTP  486

Query  314   VEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAK-AHIDVQGFNVYHK  138
             V+     +++  ++ +TY+P      +      V ++ +GF+K+A    IDV GFNVYHK
Sbjct  487   VQQLIFADELKFSEVITYKP-----CLRDTKEAVVLIAVGFIKEAAIVGIDVHGFNVYHK  541

Query  137   NRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NRLI PFWR++    ++GRGV+GVLEANF+EPAHDKQ FE+T V 
Sbjct  542   NRLIMPFWRVYQDVSNNGRGVVGVLEANFIEPAHDKQDFEKTAVF  586



>gb|KDO71063.1| hypothetical protein CISIN_1g006503mg [Citrus sinensis]
 gb|KDO71064.1| hypothetical protein CISIN_1g006503mg [Citrus sinensis]
Length=572

 Score =   425 bits (1093),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 215/408 (53%), Positives = 287/408 (70%), Gaps = 10/408 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAG +            G ++H RVHPKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  65    SRSFWKAGTYAANITIKSTPVQGSLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEV  124

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D V   KD S  L+  D+GGGMDP+ +R+CMSLGYS K K   TIGQYGNG
Sbjct  125   QNGATFVKVDRVNIMKDNSPALVFIDDGGGMDPESLRKCMSLGYSTK-KANKTIGQYGNG  183

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR + +  KS TQSIGLLSYT+LR TG +D++VPM+D++ +    
Sbjct  184   FKTSTMRLGADVIVFSRAT-HESKS-TQSIGLLSYTYLRKTGQDDVIVPMIDFDISGHWA  241

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               II SS +DW+ N++TI+ WSPF+S+++LL+QF  +  HGT+++IYNLW +D+G+ EL 
Sbjct  242   EPIIYSSQDDWSFNLKTILEWSPFASKSELLQQFEDIGPHGTKVIIYNLWMNDEGVYELS  301

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIIL  327
             FD D  DI +R         ++ K+    +  ++Y  R+SLR+YAS+LYL    +F+IIL
Sbjct  302   FDDDEEDICLRDEANSGSLKKLPKKVLERQSHISYRIRYSLRAYASMLYLGKFDNFKIIL  361

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGK ++  +I +++   + ++YRPQ  A    KD+   A  TIGF+K+A A + V GFNV
Sbjct  362   RGKPIQQFHIADELKFPKVISYRPQVSAP--LKDA--TAETTIGFIKEAPA-LSVSGFNV  416

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLI+PFW++       G GV+GVLEANF+EP HDKQ FER+T+ 
Sbjct  417   YHKNRLIRPFWKVTGDGSLKGNGVVGVLEANFIEPTHDKQDFERSTLF  464



>ref|XP_010251156.1| PREDICTED: MORC family CW-type zinc finger protein 4 isoform 
X2 [Nelumbo nucifera]
 ref|XP_010251157.1| PREDICTED: MORC family CW-type zinc finger protein 4 isoform 
X2 [Nelumbo nucifera]
 ref|XP_010251158.1| PREDICTED: MORC family CW-type zinc finger protein 4 isoform 
X2 [Nelumbo nucifera]
Length=712

 Score =   430 bits (1105),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 225/427 (53%), Positives = 304/427 (71%), Gaps = 25/427 (6%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             T  G + P C      +QFWKAG+++   +   V    G +HV VHPKFLHSNATSHKW 
Sbjct  93    TPPGCSAPLC------RQFWKAGEYD-VRQASRVLLQDGKNHVHVHPKFLHSNATSHKWS  145

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN++DE+ +GAT+V ID   + +DGS  L+I+D+GGGMDPD +R+CMS G+S
Sbjct  146   FGAIAELLDNAVDEIQSGATFVIIDKTSNPRDGSPALLIQDDGGGMDPDAMRRCMSFGFS  205

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K K    IGQYGNGFKTSTMRLGADVIVFSR  G   ++ TQS+GLLSY+FLR TG + 
Sbjct  206   DK-KSKSAIGQYGNGFKTSTMRLGADVIVFSRHMGK--RTLTQSVGLLSYSFLRQTGHDR  262

Query  725   IVVPMLDYENN--EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTR  552
             IVVPM+DYE N     +G  +R S E +  N+  +++WSP+++E+DLL+QF+ +  HGT+
Sbjct  263   IVVPMVDYEFNISTGTFGTFLRYSKEHFLSNLSMLLKWSPYATESDLLKQFDDIGHHGTK  322

Query  551   IVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLT-YRHSLRSY  375
             +++YNLW ++ G +ELDF+++  DI I G ++  K+   +K  P+ +H    +RHSLR+Y
Sbjct  323   VIVYNLWLNNDGEMELDFESNNEDILIIGADQIVKTGHHSK-IPSEQHIANRFRHSLRAY  381

Query  374   ASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVV--T  201
             +SILYLR+P  FRI+LRG+ VEHHNI ND+   + + Y+PQTG        NM A+V  T
Sbjct  382   SSILYLRIPQHFRIVLRGRVVEHHNIANDLKFPEYIMYKPQTGG-------NMEAIVVTT  434

Query  200   IGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLW-NPAGSDGRGVIGVLEANFVEPAHDKQG  24
             IGF+K+A   +++ GFN+YHKNRLI PFWR+     GS GRGV+G+LEANF+EP HDKQ 
Sbjct  435   IGFLKEA-PQVNIHGFNIYHKNRLILPFWRVVRQTGGSRGRGVVGILEANFIEPTHDKQD  493

Query  23    FERTTVL  3
             FE+TT+ 
Sbjct  494   FEKTTLF  500



>ref|XP_010918978.1| PREDICTED: MORC family CW-type zinc finger protein 4-like isoform 
X1 [Elaeis guineensis]
Length=651

 Score =   427 bits (1099),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 220/408 (54%), Positives = 279/408 (68%), Gaps = 14/408 (3%)
 Frame = -3

Query  1211  FWKAGDFEGAPRGDWVS----SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
             FWKAG +E   R    S     S   D  RVHPKFLH+NATSHKW  GA AELLDN++DE
Sbjct  56    FWKAGSYEVPSRPSQTSHGLLESSDFDRARVHPKFLHTNATSHKWAFGAIAELLDNAVDE  115

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             + NGAT+V +D + + KD S ML+ +D+GGGMDP+ IRQCMSLG+S+K K   TIGQYGN
Sbjct  116   ICNGATFVKVDKINNLKDNSPMLLFQDDGGGMDPEGIRQCMSLGFSSK-KSKTTIGQYGN  174

Query  863   GFKTSTMRLGADVIVFSR-CSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEK  687
             GFKTSTMRLGAD IVFSR C G++    T SIGLLSYTFLR T  +DI+VPMLD++  + 
Sbjct  175   GFKTSTMRLGADAIVFSRACRGSH---VTMSIGLLSYTFLRRTMKDDIIVPMLDFQIIKD  231

Query  686   EWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLE  507
             +   +I SS +DW  +++ I+ WSPFSS+ +LL QF  +  +GT++ IYNLW +D GLLE
Sbjct  232   QIVPVIYSSQDDWENSLKIILDWSPFSSKEELLLQFEDLGSNGTKVFIYNLWMNDDGLLE  291

Query  506   LDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRIIL  327
             LDFD +  DI +R         +  K+   S    T R+SLR+YASILYLR   +F+IIL
Sbjct  292   LDFDDNDEDILLRDQATSGGFSKFHKEIVQSHISYTLRYSLRAYASILYLRKFSNFQIIL  351

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGK VE  NIV+++   + VTY+PQ  AD      ++V    IGF K+A   + + G NV
Sbjct  352   RGKPVEQLNIVDELKFKKTVTYKPQVAADS----PDVVVRTIIGFAKEAPV-LGIFGLNV  406

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLI PFW++     S GR V+GVLEANF+EPAHDKQ FERT + 
Sbjct  407   YHKNRLIMPFWKVVQEGSSRGRSVVGVLEANFIEPAHDKQDFERTPLF  454



>gb|KDO71059.1| hypothetical protein CISIN_1g006503mg [Citrus sinensis]
Length=623

 Score =   427 bits (1097),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 216/409 (53%), Positives = 289/409 (71%), Gaps = 12/409 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAG +            G ++H RVHPKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  65    SRSFWKAGTYAANITIKSTPVQGSLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEV  124

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D V   KD S  L+  D+GGGMDP+ +R+CMSLGYS K K   TIGQYGNG
Sbjct  125   QNGATFVKVDRVNIMKDNSPALVFIDDGGGMDPESLRKCMSLGYSTK-KANKTIGQYGNG  183

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR + +  KS TQSIGLLSYT+LR TG +D++VPM+D++ +   W
Sbjct  184   FKTSTMRLGADVIVFSRAT-HESKS-TQSIGLLSYTYLRKTGQDDVIVPMIDFDIS-GHW  240

Query  680   GQ-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
              + II SS +DW+ N++TI+ WSPF+S+++LL+QF  +  HGT+++IYNLW +D+G+ EL
Sbjct  241   AEPIIYSSQDDWSFNLKTILEWSPFASKSELLQQFEDIGPHGTKVIIYNLWMNDEGVYEL  300

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRII  330
              FD D  DI +R         ++ K+    +  ++Y  R+SLR+YAS+LYL    +F+II
Sbjct  301   SFDDDEEDICLRDEANSGSLKKLPKKVLERQSHISYRIRYSLRAYASMLYLGKFDNFKII  360

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             LRGK ++  +I +++   + ++YRPQ  A    KD+   A  TIGF+K+A A + V GFN
Sbjct  361   LRGKPIQQFHIADELKFPKVISYRPQVSAP--LKDA--TAETTIGFIKEAPA-LSVSGFN  415

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLI+PFW++       G GV+GVLEANF+EP HDKQ FER+T+ 
Sbjct  416   VYHKNRLIRPFWKVTGDGSLKGNGVVGVLEANFIEPTHDKQDFERSTLF  464



>ref|XP_010251155.1| PREDICTED: MORC family CW-type zinc finger protein 4 isoform 
X1 [Nelumbo nucifera]
Length=721

 Score =   430 bits (1105),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 225/427 (53%), Positives = 304/427 (71%), Gaps = 25/427 (6%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             T  G + P C      +QFWKAG+++   +   V    G +HV VHPKFLHSNATSHKW 
Sbjct  102   TPPGCSAPLC------RQFWKAGEYD-VRQASRVLLQDGKNHVHVHPKFLHSNATSHKWS  154

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN++DE+ +GAT+V ID   + +DGS  L+I+D+GGGMDPD +R+CMS G+S
Sbjct  155   FGAIAELLDNAVDEIQSGATFVIIDKTSNPRDGSPALLIQDDGGGMDPDAMRRCMSFGFS  214

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K K    IGQYGNGFKTSTMRLGADVIVFSR  G   ++ TQS+GLLSY+FLR TG + 
Sbjct  215   DK-KSKSAIGQYGNGFKTSTMRLGADVIVFSRHMGK--RTLTQSVGLLSYSFLRQTGHDR  271

Query  725   IVVPMLDYENN--EKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTR  552
             IVVPM+DYE N     +G  +R S E +  N+  +++WSP+++E+DLL+QF+ +  HGT+
Sbjct  272   IVVPMVDYEFNISTGTFGTFLRYSKEHFLSNLSMLLKWSPYATESDLLKQFDDIGHHGTK  331

Query  551   IVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLT-YRHSLRSY  375
             +++YNLW ++ G +ELDF+++  DI I G ++  K+   +K  P+ +H    +RHSLR+Y
Sbjct  332   VIVYNLWLNNDGEMELDFESNNEDILIIGADQIVKTGHHSK-IPSEQHIANRFRHSLRAY  390

Query  374   ASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVV--T  201
             +SILYLR+P  FRI+LRG+ VEHHNI ND+   + + Y+PQTG        NM A+V  T
Sbjct  391   SSILYLRIPQHFRIVLRGRVVEHHNIANDLKFPEYIMYKPQTGG-------NMEAIVVTT  443

Query  200   IGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLW-NPAGSDGRGVIGVLEANFVEPAHDKQG  24
             IGF+K+A   +++ GFN+YHKNRLI PFWR+     GS GRGV+G+LEANF+EP HDKQ 
Sbjct  444   IGFLKEA-PQVNIHGFNIYHKNRLILPFWRVVRQTGGSRGRGVVGILEANFIEPTHDKQD  502

Query  23    FERTTVL  3
             FE+TT+ 
Sbjct  503   FEKTTLF  509



>gb|KDO71058.1| hypothetical protein CISIN_1g006503mg [Citrus sinensis]
Length=643

 Score =   427 bits (1097),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 216/409 (53%), Positives = 289/409 (71%), Gaps = 12/409 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAG +            G ++H RVHPKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  65    SRSFWKAGTYAANITIKSTPVQGSLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEV  124

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D V   KD S  L+  D+GGGMDP+ +R+CMSLGYS K K   TIGQYGNG
Sbjct  125   QNGATFVKVDRVNIMKDNSPALVFIDDGGGMDPESLRKCMSLGYSTK-KANKTIGQYGNG  183

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR + +  KS TQSIGLLSYT+LR TG +D++VPM+D++ +   W
Sbjct  184   FKTSTMRLGADVIVFSRAT-HESKS-TQSIGLLSYTYLRKTGQDDVIVPMIDFDIS-GHW  240

Query  680   GQ-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
              + II SS +DW+ N++TI+ WSPF+S+++LL+QF  +  HGT+++IYNLW +D+G+ EL
Sbjct  241   AEPIIYSSQDDWSFNLKTILEWSPFASKSELLQQFEDIGPHGTKVIIYNLWMNDEGVYEL  300

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRII  330
              FD D  DI +R         ++ K+    +  ++Y  R+SLR+YAS+LYL    +F+II
Sbjct  301   SFDDDEEDICLRDEANSGSLKKLPKKVLERQSHISYRIRYSLRAYASMLYLGKFDNFKII  360

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             LRGK ++  +I +++   + ++YRPQ  A    KD+   A  TIGF+K+A A + V GFN
Sbjct  361   LRGKPIQQFHIADELKFPKVISYRPQVSAP--LKDA--TAETTIGFIKEAPA-LSVSGFN  415

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLI+PFW++       G GV+GVLEANF+EP HDKQ FER+T+ 
Sbjct  416   VYHKNRLIRPFWKVTGDGSLKGNGVVGVLEANFIEPTHDKQDFERSTLF  464



>ref|XP_004509325.1| PREDICTED: MORC family CW-type zinc finger protein 4-like [Cicer 
arietinum]
Length=617

 Score =   426 bits (1094),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 215/410 (52%), Positives = 296/410 (72%), Gaps = 15/410 (4%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S  FWKAGD+   P        G +DH RVHPKFLHSNATSHKW  GA AEL+DN++DE+
Sbjct  59    SHSFWKAGDYVVGPSSKPSPVQGHLDHARVHPKFLHSNATSHKWAFGAIAELVDNAVDEI  118

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D +++ KD S +L  +D+GGGMDP+ IR+CMSLGYS+K K   TIGQYGNG
Sbjct  119   QNGATFVKVDKLENTKDNSPVLCFQDDGGGMDPNSIRKCMSLGYSSK-KSKTTIGQYGNG  177

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGAD IVFSR S ++G++ TQS+GLLSYTFLR TG +D+++PM+D++ +   W
Sbjct  178   FKTSTMRLGADAIVFSR-STSSGRA-TQSVGLLSYTFLRRTGQDDVIIPMIDFDIS-GHW  234

Query  680   GQ-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
              + II  S +DW+ N++TI+ WSPF+++ +L+ QF+ +  HGT+I+IYNLW +D+G+ EL
Sbjct  235   AEPIIYGSQDDWSSNLKTILDWSPFTTKEELMLQFDDIGSHGTKILIYNLWLNDEGIYEL  294

Query  503   DFDADPRDIQIRG-VNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRI  333
              FD D  DI +R   NR D   ++ K+    +  ++Y  R+SLR+Y S+LYLR   +F+I
Sbjct  295   SFDDDAEDIMLRDEANRGDGK-KLNKKTVQLQSHISYRIRYSLRAYVSMLYLRKFSNFKI  353

Query  332   ILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGF  153
             ILRGK V+  +I ++++ +  V Y+PQ G       + MV   TIGF+K+  + ++V GF
Sbjct  354   ILRGKPVDQFDITDELIHSAVVRYKPQIGT----TQAAMVE-TTIGFIKEFIS-LNVTGF  407

Query  152   NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             NVYHKNRLIKPFW++     S G GV+G+LEANF+EPAHDKQ FER+ + 
Sbjct  408   NVYHKNRLIKPFWKVTGDGSSKGNGVVGILEANFIEPAHDKQDFERSVLF  457



>gb|KDO71060.1| hypothetical protein CISIN_1g006503mg [Citrus sinensis]
 gb|KDO71061.1| hypothetical protein CISIN_1g006503mg [Citrus sinensis]
 gb|KDO71062.1| hypothetical protein CISIN_1g006503mg [Citrus sinensis]
Length=621

 Score =   426 bits (1094),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 215/408 (53%), Positives = 287/408 (70%), Gaps = 10/408 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAG +            G ++H RVHPKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  65    SRSFWKAGTYAANITIKSTPVQGSLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEV  124

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D V   KD S  L+  D+GGGMDP+ +R+CMSLGYS K K   TIGQYGNG
Sbjct  125   QNGATFVKVDRVNIMKDNSPALVFIDDGGGMDPESLRKCMSLGYSTK-KANKTIGQYGNG  183

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR + +  KS TQSIGLLSYT+LR TG +D++VPM+D++ +    
Sbjct  184   FKTSTMRLGADVIVFSRAT-HESKS-TQSIGLLSYTYLRKTGQDDVIVPMIDFDISGHWA  241

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               II SS +DW+ N++TI+ WSPF+S+++LL+QF  +  HGT+++IYNLW +D+G+ EL 
Sbjct  242   EPIIYSSQDDWSFNLKTILEWSPFASKSELLQQFEDIGPHGTKVIIYNLWMNDEGVYELS  301

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIIL  327
             FD D  DI +R         ++ K+    +  ++Y  R+SLR+YAS+LYL    +F+IIL
Sbjct  302   FDDDEEDICLRDEANSGSLKKLPKKVLERQSHISYRIRYSLRAYASMLYLGKFDNFKIIL  361

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGK ++  +I +++   + ++YRPQ  A    KD+   A  TIGF+K+A A + V GFNV
Sbjct  362   RGKPIQQFHIADELKFPKVISYRPQVSAP--LKDA--TAETTIGFIKEAPA-LSVSGFNV  416

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLI+PFW++       G GV+GVLEANF+EP HDKQ FER+T+ 
Sbjct  417   YHKNRLIRPFWKVTGDGSLKGNGVVGVLEANFIEPTHDKQDFERSTLF  464



>gb|EYU30360.1| hypothetical protein MIMGU_mgv1a0262021mg, partial [Erythranthe 
guttata]
Length=373

 Score =   416 bits (1070),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 199/290 (69%), Positives = 237/290 (82%), Gaps = 3/290 (1%)
 Frame = -3

Query  869  GNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNE  690
            GNGFKTS+MRLGADVIVFSR  G  G S TQSIGLLS+TFL++TG EDI+VP++DYE   
Sbjct  1    GNGFKTSSMRLGADVIVFSRFRGKYGLSTTQSIGLLSFTFLQNTGKEDIIVPIVDYEKTG  60

Query  689  KEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLL  510
            + W + ++SS E W RN+ET+V+WSP+ SE +L+ QFN ++D GTRIVIYNLWEDD+GLL
Sbjct  61   ETWNKRLKSSDECWQRNLETVVQWSPYDSEEELVGQFNFLEDQGTRIVIYNLWEDDEGLL  120

Query  509  ELDFDADPRDIQIRGVNRDDKSIQ-MAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFRI  333
            ELDF+AD  DIQ R  NRDDK +  +A  +P+SR FLTYRHSLRSYASILY R+PP F I
Sbjct  121  ELDFEADQNDIQTRAGNRDDKKLMTIANDHPSSRRFLTYRHSLRSYASILYRRIPPGFSI  180

Query  332  ILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGF  153
            ILRGK+VE+H+IV+D++  Q+  Y+P   A    KD NM A VT+GF+KDA  HIDVQGF
Sbjct  181  ILRGKEVEYHDIVDDLIHPQKHVYKPVACASS--KDPNMSAAVTLGFIKDAGHHIDVQGF  238

Query  152  NVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
            NVYHKNRLI+PFWRLWN +GSDGRGVIGVLEANFVEPAHDKQGFERTT L
Sbjct  239  NVYHKNRLIRPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTAL  288



>ref|XP_002533659.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF28730.1| zinc finger protein, putative [Ricinus communis]
Length=561

 Score =   423 bits (1088),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/409 (52%), Positives = 286/409 (70%), Gaps = 12/409 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              + FWKAG ++        ++ G ++H RVHPKFLHSNATSHKW  GA AELLDN++DE+
Sbjct  61    CRSFWKAGAYDVGSTPRMATTQGQLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEI  120

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT++ +D +   KD S  L+ +D+GGGMDPD IR+CMSLGYS+K K   TIGQYGNG
Sbjct  121   HNGATFLKVDKIDIMKDNSPALLFQDDGGGMDPDSIRKCMSLGYSSK-KSNKTIGQYGNG  179

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR S   G   TQSIGLLSYT L  TG +D++VPM+D++ +    
Sbjct  180   FKTSTMRLGADVIVFSRAS--RGSKATQSIGLLSYTLLLKTGQDDVIVPMVDFDVSGHWA  237

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               II SS +DW+ N+  I+ WSPF+S+  L++QF  +  HGT+++IYNLW +D+G+ EL 
Sbjct  238   EPIIYSSQDDWSSNLNMILEWSPFTSKDMLMQQFEDIGPHGTKVIIYNLWLNDEGIYELS  297

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIIL  327
             FD D  DI++R        I++ ++    +  ++Y  R+SLR+YASILYLR   +F IIL
Sbjct  298   FDDDEEDIRLRDEANRGGQIKLNQKTVELQSHISYRIRYSLRAYASILYLRKFTNFSIIL  357

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAV-VTIGFVKDAKAHIDVQGFN  150
             RGK ++ + I +D+  +++  YRPQ G       S  VAV  TIGF+K+A  ++ V GFN
Sbjct  358   RGKPIQQYIIADDLKHSKKAIYRPQLGV-----TSKEVAVETTIGFIKEA-PNLGVSGFN  411

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLI+PFW++     + G  V+GVLEANF+EPAHDKQ FER+++ 
Sbjct  412   VYHKNRLIRPFWKVTGEGATKGNYVVGVLEANFIEPAHDKQDFERSSLF  460



>ref|XP_009370695.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Pyrus 
x bretschneideri]
 ref|XP_009370696.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Pyrus 
x bretschneideri]
Length=694

 Score =   427 bits (1099),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 218/422 (52%), Positives = 286/422 (68%), Gaps = 20/422 (5%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             TS+    P C      +QFWKAG +  A  G  V+   G +++ VHP FLHSNATSHKW 
Sbjct  96    TSTFSPAPLC------RQFWKAGSYNDAV-GSKVAFQNGKNYLHVHPMFLHSNATSHKWA  148

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN +DE+ NGAT+V +D + + +DGS  L+I+D+G GMDP+ +R+CMS G+S
Sbjct  149   FGAIAELLDNVVDEIQNGATFVIVDKILNPRDGSPALLIQDDGSGMDPEAMRRCMSFGFS  208

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K K    IGQYGNGFKTSTMRLGADVIVFSR    + ++ TQSIGLLSYTFL  TG + 
Sbjct  209   DK-KSKSAIGQYGNGFKTSTMRLGADVIVFSR--HQDTRTLTQSIGLLSYTFLARTGHDR  265

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPM+DYE N       +    E +  N+  +++WSP+S+EADLL+QFN +   GT+++
Sbjct  266   IVVPMVDYEFNTLTNKLEVMHGREHFMSNLSMLLQWSPYSTEADLLKQFNDIGARGTKVI  325

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLT-YRHSLRSYAS  369
             +YNLW  D G LELDFD DP DI+I G   D K +    +  N  H    +R SLR Y S
Sbjct  326   VYNLWFSDDGNLELDFDTDPEDIRISG---DTKKVDTKFKTVNEEHIANRFRFSLRVYLS  382

Query  368   ILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFV  189
             ILYLR+P +F I+LRG+ VEHHNI ND+   + + Y+PQ+G     +      + TIGF+
Sbjct  383   ILYLRIPQTFHIVLRGRVVEHHNIANDLKFPEFILYKPQSGGSVEGQ-----VITTIGFL  437

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTT  9
             K+A  H+   GFNVYHKNRLI P+W++ + + S GRGV+GVLEANFVEP+H+KQ FE+T 
Sbjct  438   KEA-PHVSFHGFNVYHKNRLILPYWQVVSYSDSRGRGVVGVLEANFVEPSHNKQDFEKTN  496

Query  8     VL  3
             + 
Sbjct  497   LF  498



>ref|XP_006466881.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X1 [Citrus sinensis]
Length=643

 Score =   426 bits (1094),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 214/409 (52%), Positives = 287/409 (70%), Gaps = 12/409 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             S+ FWKAG +            G ++H RVHPKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  65    SRSFWKAGTYAANITIKSTPVQGSLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEV  124

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D V   KD S  L+  D+GGGMDP+ +R+CMSLGYS K K   TIGQYGNG
Sbjct  125   QNGATFVKVDRVNIMKDNSPALVFLDDGGGMDPESLRKCMSLGYSTK-KANKTIGQYGNG  183

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR +  +    TQSIGLLSYT+LR TG +D++VPM+D++ +   W
Sbjct  184   FKTSTMRLGADVIVFSRATHES--KATQSIGLLSYTYLRKTGQDDVIVPMIDFDIS-GHW  240

Query  680   GQ-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLEL  504
              + II SS +DW+ N++TI+ WSPF+S+++LL+QF  +  HGT+++IYNLW +D+G+ EL
Sbjct  241   AEPIIYSSQDDWSFNLKTILEWSPFASKSELLQQFEDIGPHGTKVIIYNLWMNDEGVYEL  300

Query  503   DFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRII  330
              FD D  DI +R         ++ K+    +  ++Y  R+SLR+YAS+LYL    +F+II
Sbjct  301   SFDDDEEDICLRDEANPGSLKKLPKKVLERQSHISYRIRYSLRAYASMLYLGKFDNFKII  360

Query  329   LRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFN  150
             LRGK ++  +I +++   + ++YRPQ  A    KD+   A  TIGF+K+A A + V GFN
Sbjct  361   LRGKPIQQFHIADELKFPKVISYRPQVSAP--LKDA--TAETTIGFIKEAPA-LSVSGFN  415

Query  149   VYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             VYHKNRLI+PFW++       G GV+GVLEANF+EP HDKQ FER+T+ 
Sbjct  416   VYHKNRLIRPFWKVTGDGSLKGNGVVGVLEANFIEPTHDKQDFERSTLF  464



>ref|XP_011083160.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X1 [Sesamum indicum]
Length=619

 Score =   424 bits (1091),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/408 (52%), Positives = 291/408 (71%), Gaps = 11/408 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
             ++ FW+AG +E  P    +   G ++H RVHPKFLHSNATSHKW  GA AELLDN++DE+
Sbjct  76    NRSFWRAGAYEIGPTVSTIIQ-GDLEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEI  134

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V +D + + KD S  L+ +D+GGGMDP+ +R+CMSLGYS+K+    TIGQYGNG
Sbjct  135   CNGATFVKVDRIYNSKDNSPALLFQDDGGGMDPESMRKCMSLGYSSKTS-NTTIGQYGNG  193

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGADVIVFSR +   G++ TQS+GLLSYTFLR T  +D++VPM+D++ ++   
Sbjct  194   FKTSTMRLGADVIVFSRAT-QPGRA-TQSVGLLSYTFLRRTRQDDVIVPMIDFDISDHWA  251

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               I+ SS ++W+ N++TI+ WSPF S+ DL+ QF+ +  HGT+I+I+NLW +D+G+ EL+
Sbjct  252   EPIVHSSKDNWSCNLKTILEWSPFVSKDDLMLQFDDIGPHGTKIIIFNLWMNDEGVYELN  311

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIIL  327
             FD D  DI++R       + +  K+    +  L+Y  R+SLR+Y+SILYLR   +FRIIL
Sbjct  312   FDDDDEDIRLRDEVNHGNASRTYKRVLEMQSHLSYRIRYSLRAYSSILYLRKFTNFRIIL  371

Query  326   RGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNV  147
             RGK VE  +IV+D+  ++ VTY PQ G    P    +     IGF+K+A   + V GFNV
Sbjct  372   RGKPVEQFSIVDDLKHSKVVTYSPQVG----PAPKEITVETKIGFIKEAPG-LGVCGFNV  426

Query  146   YHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             YHKNRLI+P+W++     S G GV+GVLEANF+EP HDKQ FER+ + 
Sbjct  427   YHKNRLIRPYWKVTADGNSRGLGVVGVLEANFIEPTHDKQDFERSILF  474



>ref|XP_009339592.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Pyrus 
x bretschneideri]
 ref|XP_009339593.1| PREDICTED: MORC family CW-type zinc finger protein 3-like [Pyrus 
x bretschneideri]
Length=694

 Score =   427 bits (1097),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 218/422 (52%), Positives = 286/422 (68%), Gaps = 20/422 (5%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             TS+    P C      +QFWKAG +  A  G  V+   G +++ VHP FLHSNATSHKW 
Sbjct  96    TSTFSPAPLC------RQFWKAGSYNDAV-GSKVAFQNGKNYLHVHPMFLHSNATSHKWA  148

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN +DE+ NGAT+V +D + + +DGS  L+I+D+G GMDP+ +R+CMS G+S
Sbjct  149   FGAIAELLDNVVDEIQNGATFVIVDKILNPRDGSPALLIQDDGSGMDPEAMRRCMSFGFS  208

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K K    IGQYGNGFKTSTMRLGADVIVFSR    + ++ TQSIGLLSYTFL  TG + 
Sbjct  209   DK-KSKSAIGQYGNGFKTSTMRLGADVIVFSR--HQDTRTLTQSIGLLSYTFLARTGHDR  265

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPM+DYE N       +    E +  N+  +++WSP+S+EADLL+QFN +   GT+++
Sbjct  266   IVVPMVDYEFNTLTNKLEVMHGREHFMSNLSMLLQWSPYSTEADLLKQFNDIGARGTKVI  325

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLT-YRHSLRSYAS  369
             +YNLW  D G LELDFD DP DI+I G   D K +    +  N  H    +R SLR Y S
Sbjct  326   VYNLWFSDDGNLELDFDTDPEDIRISG---DTKKVDTKFKTVNEEHIANRFRFSLRVYLS  382

Query  368   ILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFV  189
             ILYLR+P +F I+LRG+ VEHHNI ND+   + + Y+PQ+G     +      + TIGF+
Sbjct  383   ILYLRIPQTFHIVLRGRVVEHHNIANDLKFPEFILYKPQSGGSVEGQ-----VITTIGFL  437

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTT  9
             K+A  H+   GFNVYHKNRLI P+W++ + + S GRGV+GVLEANFVEP+H+KQ FE+T 
Sbjct  438   KEA-PHVSFHGFNVYHKNRLILPYWQVVSYSDSRGRGVVGVLEANFVEPSHNKQDFEKTN  496

Query  8     VL  3
             + 
Sbjct  497   LF  498



>ref|XP_007036272.1| MORC family CW-type zinc finger protein 3 isoform 2 [Theobroma 
cacao]
 gb|EOY20773.1| MORC family CW-type zinc finger protein 3 isoform 2 [Theobroma 
cacao]
Length=531

 Score =   421 bits (1081),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 220/424 (52%), Positives = 290/424 (68%), Gaps = 22/424 (5%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             TS+    P C      +QFWKAG +EG   G  V+     +++ VHP FLHSNATSHKW 
Sbjct  95    TSAVSPAPVC------RQFWKAGSYEGG-LGSKVTLQNSKNYLHVHPLFLHSNATSHKWA  147

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN++DE+ NGAT+V +D   + +DGS  L+I+D+GGGMDP+ +R+CMS G+S
Sbjct  148   FGAIAELLDNAIDEIQNGATFVIVDKTSNPRDGSPALLIQDDGGGMDPEAMRRCMSFGFS  207

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K K    IGQYGNGFKTS+MRLG DVIVFSR   N  +S TQSIGLLSYTFL  TG + 
Sbjct  208   DK-KSKSAIGQYGNGFKTSSMRLGGDVIVFSRHLDN--RSLTQSIGLLSYTFLTRTGHDR  264

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             IVVPM+DYE N       +    E +  N+  +++WSP+S+EA+LL+QF+ +  HGT+I+
Sbjct  265   IVVPMVDYELNVSTGMLDVLHGREHFVSNLSILLQWSPYSTEAELLKQFDDIGSHGTKII  324

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRH-SLRSYAS  369
             IYNLW ++    ELDFD+DP+DI+I G  +   +I   K   N +H  +  H SLR Y S
Sbjct  325   IYNLWLNNDRDSELDFDSDPKDIRISGDTKKVNTIPAWKAV-NEQHIASRYHISLRVYLS  383

Query  368   ILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQT--GADGVPKDSNMVAVVTIG  195
             ILYLR+P +FRIILRG+ VEHHNI +D+   + + YRPQ+    +G         V TIG
Sbjct  384   ILYLRIPDTFRIILRGEIVEHHNIADDLKFIEYILYRPQSFGSVEG-------TVVCTIG  436

Query  194   FVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFER  15
             F+K+A   +++ GF VYHKNRLI PFW++ + + S GRGV+GVLEANFVEP H+KQ FER
Sbjct  437   FLKEA-PQVNIHGFCVYHKNRLILPFWQVVSYSDSRGRGVVGVLEANFVEPTHNKQDFER  495

Query  14    TTVL  3
             T++ 
Sbjct  496   TSLF  499



>ref|XP_008810876.1| PREDICTED: MORC family CW-type zinc finger protein 4-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008810877.1| PREDICTED: MORC family CW-type zinc finger protein 4-like isoform 
X2 [Phoenix dactylifera]
Length=649

 Score =   424 bits (1091),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 215/411 (52%), Positives = 278/411 (68%), Gaps = 14/411 (3%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSG-----GMDHVRVHPKFLHSNATSHKWVLGAFAELLDN  1056
              ++FWKAG +E  P G   +  G       D  RVHPKFLH+NATSHKW  GA AELLDN
Sbjct  53    CRRFWKAGSYE-VPSGPAQTCHGLEELSDFDRARVHPKFLHTNATSHKWAFGAIAELLDN  111

Query  1055  SLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIG  876
             ++DE+ NGAT+V +D + + KD S ML+ +D+GGGMDP+ +R+CMSLG+S+K K   TIG
Sbjct  112   AVDEICNGATFVKVDKINNLKDNSPMLLFQDDGGGMDPEGVRRCMSLGFSSK-KSKTTIG  170

Query  875   QYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYEN  696
             QYGNGFKTSTMRLGAD IVFSR     G   T SIGLLSYTFLR T  +DI+VPMLD++ 
Sbjct  171   QYGNGFKTSTMRLGADAIVFSRAC--RGSHVTMSIGLLSYTFLRRTMKDDIIVPMLDFQI  228

Query  695   NEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQG  516
              + +   +I SS++DW  +++ I+ WSPFSS+ +LL QF  +  HGT+++IYNLW +D G
Sbjct  229   IKDQIVPVIYSSLDDWENSLKIILDWSPFSSKEELLLQFEDLGSHGTKVLIYNLWMNDDG  288

Query  515   LLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPSFR  336
             LLELDFD +  DI +R            K+   S    T R+SLR+YASILYLR   +F+
Sbjct  289   LLELDFDDNDEDILLRDQATSGGFSNFHKEIVQSHISYTLRYSLRAYASILYLRKFSNFQ  348

Query  335   IILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQG  156
             I+LRGK VE  NI +++   + VTY+PQ          ++V   TIGF K+A   + + G
Sbjct  349   IVLRGKPVEQLNIADELKFKKTVTYKPQVAV----YSPDVVVRTTIGFAKEAPV-LGIFG  403

Query  155   FNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
              NVYHKNRLI PFW++     S GR V+GVLEANF+EPAHDKQ FERT + 
Sbjct  404   LNVYHKNRLIMPFWKVVQEGSSRGRSVVGVLEANFIEPAHDKQDFERTPLF  454



>gb|KFK30262.1| hypothetical protein AALP_AA7G238400 [Arabis alpina]
Length=635

 Score =   424 bits (1089),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 214/406 (53%), Positives = 283/406 (70%), Gaps = 12/406 (3%)
 Frame = -3

Query  1217  KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEVI  1038
             + FWKAGD     +    ++ G ++H R+HPKFLHSNATSHKW  GA AELLDN++DE+ 
Sbjct  58    RSFWKAGDNFVNAKAITPAAPGLLEHARIHPKFLHSNATSHKWAFGAIAELLDNAVDEIH  117

Query  1037  NGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNGF  858
             NGAT+V ID +   KD S  L+ +D+GGGMDP+ IR+CMSLGYS+K K   TIGQYGNGF
Sbjct  118   NGATFVKIDKIDIVKDNSPALVFQDDGGGMDPNGIRKCMSLGYSSK-KSNTTIGQYGNGF  176

Query  857   KTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEWG  678
             KTSTMRLGAD IVFSR S   GKS TQS+GLLSYTFLR TG +D++VPM+D +       
Sbjct  177   KTSTMRLGADAIVFSR-STRGGKS-TQSVGLLSYTFLRKTGQDDVIVPMIDLDLTHGRPE  234

Query  677   QIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELDF  498
              II  S EDW+ ++  +++WSPFS+E +L +QF  +  HGT+++IYNLW +D+G+ EL F
Sbjct  235   PIIYGSPEDWSSSLNILLKWSPFSTEDELFQQFEGIGTHGTKVIIYNLWLNDEGIYELSF  294

Query  497   DADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRSYASILYLRVPPSFRIILR  324
             D D  DI++R  N  D    +AK      H ++Y  RHSLR+YAS+LYL+   +F+IILR
Sbjct  295   DDDDEDIRLRDENAQDGKRVIAKTLELRSH-ISYRLRHSLRAYASMLYLKKFKNFKIILR  353

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             G  VE  NI +++   + + Y+PQT              + +GF+K+A   + + GFNVY
Sbjct  354   GIPVEQFNIADELRHPESIMYKPQTAM-----MEQAATEIKVGFIKEA-PKLPIIGFNVY  407

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             HKNRLIKPFW +   + S G GV+GVLEANF+EPAHDKQGFER+++
Sbjct  408   HKNRLIKPFWEVLVESSSRGNGVVGVLEANFIEPAHDKQGFERSSL  453



>ref|XP_006283315.1| hypothetical protein CARUB_v10004354mg [Capsella rubella]
 gb|EOA16213.1| hypothetical protein CARUB_v10004354mg [Capsella rubella]
Length=635

 Score =   424 bits (1089),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 215/422 (51%), Positives = 285/422 (68%), Gaps = 12/422 (3%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             T +    P   +E  S  FWKAG+    P G   ++ G ++H RVHPKFLHSNATSHKW 
Sbjct  45    TDAAAVAPRETLECRS--FWKAGENYVIPTGVTPTAPGMLEHARVHPKFLHSNATSHKWA  102

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN++DE  NGAT+V ID +   KD +  L+ +D+GGGMDP+ IR+CMSLGYS
Sbjct  103   FGAIAELLDNAVDETQNGATFVKIDKINIVKDNTPALVFQDDGGGMDPNGIRKCMSLGYS  162

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
             +K K   TIGQYGNGFKTSTMRLGAD +VFSR S   GKS TQSIGLLSYTFLR TG +D
Sbjct  163   SK-KSNTTIGQYGNGFKTSTMRLGADALVFSR-STRGGKS-TQSIGLLSYTFLRRTGQDD  219

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIV  546
             ++VPM+D++ +  +   II  S  DW+ N+  +++WSPFS+  +LL+QF  +  HGT+++
Sbjct  220   VIVPMIDFDISNDQPQPIIYGSSGDWSTNLNILLKWSPFSTVDELLQQFEDIGTHGTKVI  279

Query  545   IYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHF-LTYRHSLRSYAS  369
             IYNLW +D+G+ EL FD D  DIQ+R  N  D     A+      H    YRHSLR+Y S
Sbjct  280   IYNLWLNDEGIYELSFDDDDEDIQLRDENAQDGKRLYARTLELRSHISYRYRHSLRAYIS  339

Query  368   ILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFV  189
             +LYL+   +F+IILRG  VE +NI ++    + + Y+PQ  A          + + IGF+
Sbjct  340   MLYLKKFKNFKIILRGIPVEQYNIADEFRHPETIMYKPQATA-----VEYAASEIKIGFI  394

Query  188   KDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTT  9
             K+A   + + GFNVYHKNRLI+PFW++     +   GV+GVLEANF+EPAHDKQ FER++
Sbjct  395   KEA-PKLPICGFNVYHKNRLIRPFWKVIQEGSTRCNGVVGVLEANFIEPAHDKQDFERSS  453

Query  8     VL  3
             + 
Sbjct  454   LF  455



>ref|XP_008452124.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X3 [Cucumis melo]
Length=553

 Score =   421 bits (1082),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 217/425 (51%), Positives = 288/425 (68%), Gaps = 18/425 (4%)
 Frame = -3

Query  1253  RAVPTCIVETSS------KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHK  1092
             R   T IV +S       + FWKAG+F+    G+ +   G ++H RVHPKFLHSNATSHK
Sbjct  43    RGSSTPIVSSSDNKALDWRSFWKAGNFDFGLTGNPLPDDGDLEHARVHPKFLHSNATSHK  102

Query  1091  WVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLG  912
             W  GA AELLDN++DE+ NGAT+V +D V   KD S  L+  D+GGGMDP  IR+CMSLG
Sbjct  103   WAFGAIAELLDNAVDEIHNGATFVKVDKVDIMKDNSPALLFHDDGGGMDPAGIRKCMSLG  162

Query  911   YSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGM  732
             YS+K K   TIGQYGNGFKTSTMRLGAD IVF+R     G   TQS+GLLSYTFLR T  
Sbjct  163   YSSK-KSNTTIGQYGNGFKTSTMRLGADAIVFTRAV--RGGIATQSVGLLSYTFLRMTSQ  219

Query  731   EDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTR  552
             +D++VPM+D++ +      I+  S +DW+ N++TI+ WSPFSS+ DLL QF  +  HGT+
Sbjct  220   DDVIVPMIDFDISGHWAEPIVNGSQDDWSSNLKTILEWSPFSSKEDLLIQFEDIGRHGTK  279

Query  551   IVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRS  378
             ++I+NLW +D+G+ EL+FD D  DI++R         ++ K     +  ++Y  R+SLR+
Sbjct  280   VIIFNLWLNDEGIYELNFDDDDEDIRLRDEANQGGLRKLRKSVAELQAHISYRIRYSLRA  339

Query  377   YASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTI  198
             Y S+LYL+   +F IILRGK VE H+I +++  ++ V Y+PQ  A     D+      TI
Sbjct  340   YISMLYLKRFTNFNIILRGKPVEQHSIADNLKYSKVVKYKPQLHAVQASVDT------TI  393

Query  197   GFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFE  18
             GF+K+A A + V GFNVYHKNRLI PFW++     S G GV+GVLEANF+EP HDKQGFE
Sbjct  394   GFIKEAPA-LGVCGFNVYHKNRLILPFWKVTGDGSSKGLGVVGVLEANFLEPVHDKQGFE  452

Query  17    RTTVL  3
             R++  
Sbjct  453   RSSAF  457



>ref|XP_007046788.1| Compromised recognition of TCV 1 protein, partial [Theobroma 
cacao]
 gb|EOX90945.1| Compromised recognition of TCV 1 protein, partial [Theobroma 
cacao]
Length=629

 Score =   423 bits (1088),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 221/429 (52%), Positives = 303/429 (71%), Gaps = 25/429 (6%)
 Frame = -3

Query  1262  SSGRAVPTCIV--ET-SSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHK  1092
             SSG   P+ +   ET  S+ FWKAG++   P    +  S  ++H RVHPKFLHSNATSHK
Sbjct  42    SSGAIEPSVLPSDETLESRSFWKAGNYAVGPTSKPLVQSS-LEHARVHPKFLHSNATSHK  100

Query  1091  WVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLG  912
             W  GA AEL+DN++DE+  GAT+V +D +   KD S  L+ +D+GGGMDP+ IR+CMSLG
Sbjct  101   WAFGAIAELMDNAVDEIHRGATFVKVDKIDVMKDNSPALLFQDDGGGMDPELIRKCMSLG  160

Query  911   YSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGM  732
             YS+K K   TIGQYGNGFKTSTMRLGADV+VFSR         TQS+GLLSYTFLR TG+
Sbjct  161   YSSK-KSNTTIGQYGNGFKTSTMRLGADVVVFSRSI--RASKATQSVGLLSYTFLRRTGL  217

Query  731   EDIVVPMLDYENNEKEWGQ-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGT  555
             +D++VPM+D++ +   W + II SS +DW+ N++TI+ WSPF+S+ +LL QF+ +  HGT
Sbjct  218   DDVIVPMIDFDIS-GHWAEPIIYSSQDDWSSNLKTILEWSPFTSKEELLLQFDDIGPHGT  276

Query  554   RIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSI----QMAKQYPNSRHFLTYR--  393
             +IVIYNLW +D+G+ EL FD D  DI++R     D+++    ++ K+    +  ++YR  
Sbjct  277   KIVIYNLWLNDEGIYELAFDDDDEDIRLR-----DEALRGATKLHKKIAELQSHISYRIL  331

Query  392   HSLRSYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMV  213
             +SLR+YAS+LYLR   +F+IILRGK V+  NI +++   + VTY+PQ  A G+       
Sbjct  332   YSLRAYASMLYLRKFKNFQIILRGKPVQQFNIADELRYPKVVTYKPQV-ATGL---KECA  387

Query  212   AVVTIGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHD  33
                TIGF+K+A + + V GFNVYHKNRLI+PFW++     S G GV+GVLEA+F+EPAHD
Sbjct  388   VETTIGFIKEAPS-LGVSGFNVYHKNRLIRPFWKVTGDGSSKGNGVVGVLEADFIEPAHD  446

Query  32    KQGFERTTV  6
             KQ FER+++
Sbjct  447   KQDFERSSL  455



>gb|KGN63568.1| hypothetical protein Csa_1G004350 [Cucumis sativus]
Length=678

 Score =   424 bits (1091),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 217/416 (52%), Positives = 283/416 (68%), Gaps = 18/416 (4%)
 Frame = -3

Query  1244  PTCIVETSSKQFWKAGDF-EGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAE  1068
             P C      +QFWKAG++ +G      V SS G  H+ VHP FLHSNATSHKW  GA AE
Sbjct  99    PVC------RQFWKAGNYNDGVASTVTVQSSKG--HLHVHPMFLHSNATSHKWAFGAVAE  150

Query  1067  LLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIA  888
             LLDN++DE+ NGAT+VN+D + + +DGS  L+I+D+GGGMDP  +R+CMS G+S K K  
Sbjct  151   LLDNAVDEIPNGATFVNVDKILNARDGSPALLIQDDGGGMDPKAMRRCMSFGFSDK-KSK  209

Query  887   DTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPML  708
               IGQYGNGFKTSTMRLGADVIVFSR   N  +  TQSIGLLSYTFL  +G   IVVPM+
Sbjct  210   SAIGQYGNGFKTSTMRLGADVIVFSRHVNNRSRVSTQSIGLLSYTFLTRSGYNRIVVPMV  269

Query  707   DYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWE  528
             DY+ N       I    E +  N+  +++WSP+SSE++LL+QFN +  HGT+++IYNLW 
Sbjct  270   DYQYNTSSGKMEILHGRERFTSNLSILLQWSPYSSESELLKQFNDIGSHGTKVIIYNLWY  329

Query  527   DDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLT-YRHSLRSYASILYLRV  351
             +  G LELDFD D  DI I G  +   ++  +K   N +H     ++SLR Y SILYLR 
Sbjct  330   NGDGRLELDFDTDQEDICIDGDVKKMAALPASKAI-NEQHIANRLQYSLREYLSILYLRT  388

Query  350   PPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAH  171
               +F+I+LRG+ V HHN+ +D+   Q + Y+P +G          V V TIGF+K+A   
Sbjct  389   SENFKIVLRGRVVLHHNLADDLKYIQYILYKPHSGG-----HVEGVVVTTIGFLKEA-PD  442

Query  170   IDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             +++ GFNVYHKNRLI PFWR+ + + S GRGV+G+LEANF+EP H+KQ FERT VL
Sbjct  443   VNIHGFNVYHKNRLILPFWRVVSYSESRGRGVVGILEANFIEPTHNKQDFERTPVL  498



>ref|XP_002511370.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF51972.1| zinc finger protein, putative [Ricinus communis]
Length=717

 Score =   426 bits (1094),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 223/426 (52%), Positives = 293/426 (69%), Gaps = 22/426 (5%)
 Frame = -3

Query  1265  TSSGRAVPTCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWV  1086
             TS+    P C      +QFWKAG++E    G  +S   G +++ VHP FLHSNATSHKW 
Sbjct  74    TSTICPAPLC------RQFWKAGNYEDG-LGSKISLQNGKNYLHVHPMFLHSNATSHKWA  126

Query  1085  LGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYS  906
              GA AELLDN++DE+ NGAT+V +D   + +DGS  L+I+D+GGGMD + +R+CMS G+S
Sbjct  127   FGAIAELLDNAVDEIQNGATFVIVDKTSNPRDGSPALLIQDDGGGMDLEAMRRCMSFGFS  186

Query  905   AKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMED  726
              K K    IGQYGNGFKTSTMRLGADVIVFSR    + +  TQSIGLLSYTFL  TG + 
Sbjct  187   DK-KSKSAIGQYGNGFKTSTMRLGADVIVFSR--HLHDRVLTQSIGLLSYTFLTRTGYDR  243

Query  725   IVVPMLDYENNEKEWGQIIRSSVEDWN--RNIETIVRWSPFSSEADLLRQFNQMKDHGTR  552
             IVVPM+DYE N       I       N   N+  +++WSP+S+EA+LL+QF+ +  HGT+
Sbjct  244   IVVPMVDYEINSSTGSLEISHCCGKANFMSNLSLLLQWSPYSTEAELLKQFDDIGSHGTK  303

Query  551   IVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRH-SLRSY  375
             ++IYNLW +D G++ELDFD DP+DI+I G  +   +I   ++  N  H     H SLR Y
Sbjct  304   VIIYNLWFNDDGVVELDFDTDPQDIRIGGDIKKVDTIPAWRKI-NEEHIANRLHYSLRVY  362

Query  374   ASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIG  195
              SILYLR+P +FRIILRG+ VEHHN+ ND+   + + Y+PQ+G  GV +      + TIG
Sbjct  363   LSILYLRMPETFRIILRGRVVEHHNLANDLKFQEFILYKPQSG--GVVEGQ---VITTIG  417

Query  194   FVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAG--SDGRGVIGVLEANFVEPAHDKQGF  21
             F+K+A  H++V GFNVYHKNRLI PFW + +  G  S GRGV+G+LEANF+EP HDKQ F
Sbjct  418   FLKEA-PHVNVHGFNVYHKNRLILPFWAVVSSFGYNSKGRGVVGILEANFIEPTHDKQDF  476

Query  20    ERTTVL  3
             ERT++ 
Sbjct  477   ERTSLF  482



>ref|XP_002867022.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43281.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=631

 Score =   422 bits (1086),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 213/407 (52%), Positives = 279/407 (69%), Gaps = 10/407 (2%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDEV  1041
              + FWKAG+    P G   ++ G ++H RVHPKFLHSNATSHKW  GA AELLDN++DEV
Sbjct  55    CRSFWKAGENFVIPSGVTPTAPGMVEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEV  114

Query  1040  INGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGNG  861
              NGAT+V ID +   KD +  L+ +DNGGGMDP+ IR+CMSLGYS+K K   TIGQYGNG
Sbjct  115   QNGATFVKIDKINIVKDNTPALVFQDNGGGMDPNGIRKCMSLGYSSK-KSNTTIGQYGNG  173

Query  860   FKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKEW  681
             FKTSTMRLGAD IVFSR S   GKS TQSIGLLSYTFLR TG +D++VPM+D++ +    
Sbjct  174   FKTSTMRLGADAIVFSR-STRGGKS-TQSIGLLSYTFLRKTGQDDVIVPMIDFDISSVRP  231

Query  680   GQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLLELD  501
               II  S  DW+ N+  +++WSPFS+  ++L+QF  +  HGT+++IYNLW +D+G+ EL 
Sbjct  232   QPIIYGSPGDWSTNLNILLKWSPFSTMDEILQQFEDIGTHGTKVIIYNLWLNDEGIYELS  291

Query  500   FDADPRDIQIRGVNRDDKSIQMAKQYPNSRHF-LTYRHSLRSYASILYLRVPPSFRIILR  324
             FD D  DI++R  N  D     AK      H    YRHSLR+Y S+LYL+   +F+IILR
Sbjct  292   FDDDDEDIRLRDENAQDGKRLYAKTLELRSHISYRYRHSLRAYISMLYLKKFKNFKIILR  351

Query  323   GKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDVQGFNVY  144
             G  VE  NI ++    + + Y+PQ  A            + +GF+K+A   + + GFNVY
Sbjct  352   GIPVEQFNIADEFRHPETIMYKPQAAAMEYAATG-----IKVGFIKEA-PKLPICGFNVY  405

Query  143   HKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTVL  3
             HKNRLI+PFW++     + G GV+GVLEANF+EPAHDKQ FER+++ 
Sbjct  406   HKNRLIRPFWKVVLEGSTRGNGVVGVLEANFIEPAHDKQDFERSSLF  452



>ref|XP_008452122.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X1 [Cucumis melo]
Length=596

 Score =   421 bits (1083),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 218/426 (51%), Positives = 290/426 (68%), Gaps = 20/426 (5%)
 Frame = -3

Query  1253  RAVPTCIVETSS------KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHK  1092
             R   T IV +S       + FWKAG+F+    G+ +   G ++H RVHPKFLHSNATSHK
Sbjct  43    RGSSTPIVSSSDNKALDWRSFWKAGNFDFGLTGNPLPDDGDLEHARVHPKFLHSNATSHK  102

Query  1091  WVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLG  912
             W  GA AELLDN++DE+ NGAT+V +D V   KD S  L+  D+GGGMDP  IR+CMSLG
Sbjct  103   WAFGAIAELLDNAVDEIHNGATFVKVDKVDIMKDNSPALLFHDDGGGMDPAGIRKCMSLG  162

Query  911   YSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGM  732
             YS+K K   TIGQYGNGFKTSTMRLGAD IVF+R     G   TQS+GLLSYTFLR T  
Sbjct  163   YSSK-KSNTTIGQYGNGFKTSTMRLGADAIVFTRAV--RGGIATQSVGLLSYTFLRMTSQ  219

Query  731   EDIVVPMLDYENNEKEWGQ-IIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGT  555
             +D++VPM+D++ +   W + I+  S +DW+ N++TI+ WSPFSS+ DLL QF  +  HGT
Sbjct  220   DDVIVPMIDFDIS-GHWAEPIVNGSQDDWSSNLKTILEWSPFSSKEDLLIQFEDIGRHGT  278

Query  554   RIVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLR  381
             +++I+NLW +D+G+ EL+FD D  DI++R         ++ K     +  ++Y  R+SLR
Sbjct  279   KVIIFNLWLNDEGIYELNFDDDDEDIRLRDEANQGGLRKLRKSVAELQAHISYRIRYSLR  338

Query  380   SYASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVT  201
             +Y S+LYL+   +F IILRGK VE H+I +++  ++ V Y+PQ  A     D+      T
Sbjct  339   AYISMLYLKRFTNFNIILRGKPVEQHSIADNLKYSKVVKYKPQLHAVQASVDT------T  392

Query  200   IGFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGF  21
             IGF+K+A A + V GFNVYHKNRLI PFW++     S G GV+GVLEANF+EP HDKQGF
Sbjct  393   IGFIKEAPA-LGVCGFNVYHKNRLILPFWKVTGDGSSKGLGVVGVLEANFLEPVHDKQGF  451

Query  20    ERTTVL  3
             ER++  
Sbjct  452   ERSSAF  457



>ref|XP_010936621.1| PREDICTED: uncharacterized protein LOC105056203 isoform X1 [Elaeis 
guineensis]
Length=727

 Score =   426 bits (1094),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 203/414 (49%), Positives = 289/414 (70%), Gaps = 12/414 (3%)
 Frame = -3

Query  1241  TCIVETSSKQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHKWVLGAFAELL  1062
             T I    S+QFW AGD+E   +   ++   G +H+ VHPKFLHSNATSHKW  GA AELL
Sbjct  109   TGISAQLSRQFWSAGDYE-VRQAHGLAYQDGQNHLSVHPKFLHSNATSHKWAFGAIAELL  167

Query  1061  DNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADT  882
             DN++DE+ NGAT+V ID + + ++G+  L+I+D+GGGMDP+ +R CMS G+SAK   + +
Sbjct  168   DNAVDEIQNGATFVIIDKIANPRNGNPALLIQDDGGGMDPESLRHCMSFGFSAKQPCS-S  226

Query  881   IGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDY  702
             IGQYGNGFKTSTMRLGADVIVF+RC   + +  TQS+GLLSYTFLR TG  DIVVP++DY
Sbjct  227   IGQYGNGFKTSTMRLGADVIVFTRC--KHERELTQSVGLLSYTFLRQTGCSDIVVPLVDY  284

Query  701   ENNEKE--WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWE  528
             + +     + ++ R   + ++ N+  ++RWSPF++E +LL+ FN M  HGT+I++YNLW 
Sbjct  285   KFDPSSGVFKRLFRHGQKQFSSNLFMLLRWSPFATEDELLKHFNDMGHHGTKIIVYNLWF  344

Query  527   DDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVP  348
             +D+G +ELDF++D  DI I G  +  ++  ++K    +      R SLR+Y+SILYL +P
Sbjct  345   NDEGKMELDFESDTGDIMISGAPKPVQTNSISKMLTQNHIANRLRFSLRAYSSILYLHLP  404

Query  347   PSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHI  168
               F+IILRG+ +EHH+I +D+   + + Y+PQ G       +    + TIGF+ +    +
Sbjct  405   EYFKIILRGQVIEHHHIASDLRYCECIKYKPQVGG-----RTEAEVITTIGFL-EGSPQV  458

Query  167   DVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
             +V GFN+YHKNRLI PF R+ N  GS G+G+ GVLEANF++P HDKQ FE++ +
Sbjct  459   NVHGFNIYHKNRLILPFCRVVNSTGSKGKGIAGVLEANFIKPTHDKQSFEKSIL  512



>ref|XP_008452123.1| PREDICTED: MORC family CW-type zinc finger protein 3-like isoform 
X2 [Cucumis melo]
Length=574

 Score =   421 bits (1081),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 217/425 (51%), Positives = 288/425 (68%), Gaps = 18/425 (4%)
 Frame = -3

Query  1253  RAVPTCIVETSS------KQFWKAGDFEGAPRGDWVSSSGGMDHVRVHPKFLHSNATSHK  1092
             R   T IV +S       + FWKAG+F+    G+ +   G ++H RVHPKFLHSNATSHK
Sbjct  43    RGSSTPIVSSSDNKALDWRSFWKAGNFDFGLTGNPLPDDGDLEHARVHPKFLHSNATSHK  102

Query  1091  WVLGAFAELLDNSLDEVINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLG  912
             W  GA AELLDN++DE+ NGAT+V +D V   KD S  L+  D+GGGMDP  IR+CMSLG
Sbjct  103   WAFGAIAELLDNAVDEIHNGATFVKVDKVDIMKDNSPALLFHDDGGGMDPAGIRKCMSLG  162

Query  911   YSAKSKIADTIGQYGNGFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGM  732
             YS+K K   TIGQYGNGFKTSTMRLGAD IVF+R     G   TQS+GLLSYTFLR T  
Sbjct  163   YSSK-KSNTTIGQYGNGFKTSTMRLGADAIVFTRAV--RGGIATQSVGLLSYTFLRMTSQ  219

Query  731   EDIVVPMLDYENNEKEWGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTR  552
             +D++VPM+D++ +      I+  S +DW+ N++TI+ WSPFSS+ DLL QF  +  HGT+
Sbjct  220   DDVIVPMIDFDISGHWAEPIVNGSQDDWSSNLKTILEWSPFSSKEDLLIQFEDIGRHGTK  279

Query  551   IVIYNLWEDDQGLLELDFDADPRDIQIRGVNRDDKSIQMAKQYPNSRHFLTY--RHSLRS  378
             ++I+NLW +D+G+ EL+FD D  DI++R         ++ K     +  ++Y  R+SLR+
Sbjct  280   VIIFNLWLNDEGIYELNFDDDDEDIRLRDEANQGGLRKLRKSVAELQAHISYRIRYSLRA  339

Query  377   YASILYLRVPPSFRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTI  198
             Y S+LYL+   +F IILRGK VE H+I +++  ++ V Y+PQ  A     D+      TI
Sbjct  340   YISMLYLKRFTNFNIILRGKPVEQHSIADNLKYSKVVKYKPQLHAVQASVDT------TI  393

Query  197   GFVKDAKAHIDVQGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFE  18
             GF+K+A A + V GFNVYHKNRLI PFW++     S G GV+GVLEANF+EP HDKQGFE
Sbjct  394   GFIKEAPA-LGVCGFNVYHKNRLILPFWKVTGDGSSKGLGVVGVLEANFLEPVHDKQGFE  452

Query  17    RTTVL  3
             R++  
Sbjct  453   RSSAF  457



>ref|XP_008791185.1| PREDICTED: MORC family CW-type zinc finger protein 3 isoform 
X2 [Phoenix dactylifera]
 ref|XP_008791186.1| PREDICTED: MORC family CW-type zinc finger protein 3 isoform 
X2 [Phoenix dactylifera]
Length=686

 Score =   424 bits (1090),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 215/412 (52%), Positives = 295/412 (72%), Gaps = 22/412 (5%)
 Frame = -3

Query  1220  SKQFWKAGDFEGAPRGDWVS-SSGGMDHVRVHPKFLHSNATSHKWVLGAFAELLDNSLDE  1044
              +QFWK+GD+E  PR  +   S  G D +R+HPKFLHSNATSHKW  GA AELLDN++DE
Sbjct  81    CRQFWKSGDYE--PRQAFAQVSQSGTDRLRIHPKFLHSNATSHKWAFGAIAELLDNAVDE  138

Query  1043  VINGATYVNIDMVKSRKDGSRMLMIEDNGGGMDPDKIRQCMSLGYSAKSKIADTIGQYGN  864
             + NGAT+V ID   + ++G+  L+I D+GGGMDP+ +R+CMS G+S K   + +IGQYGN
Sbjct  139   LQNGATFVVIDKFINPRNGNPALLIRDDGGGMDPESLRRCMSFGFSDKHSDS-SIGQYGN  197

Query  863   GFKTSTMRLGADVIVFSRCSGNNGKSPTQSIGLLSYTFLRSTGMEDIVVPMLDYENNEKE  684
             GFKTSTMRLGADVIVFSRC+    +  TQSIGLLSYTFLR TG +DIVVP +DYE +   
Sbjct  198   GFKTSTMRLGADVIVFSRCT--KKRILTQSIGLLSYTFLRQTGCDDIVVPAVDYEFDPHT  255

Query  683   --WGQIIRSSVEDWNRNIETIVRWSPFSSEADLLRQFNQMKDHGTRIVIYNLWEDDQGLL  510
               + ++ R + + ++ N+ T+++WSPFS+EA+LL+QF+++  HGT+I++YNLW +D G +
Sbjct  256   TLFERLYRHNTKQFSDNLLTLLKWSPFSTEAELLKQFDEVGPHGTKIIVYNLWFNDDGHM  315

Query  509   ELDFDADPRDIQI----RGVNRDDKSIQMAKQYPNSRHFLTYRHSLRSYASILYLRVPPS  342
             ELDF++DP+DI I    R V ++ K   + ++Y  +R      +SLR+Y SILYL  P  
Sbjct  316   ELDFESDPKDITICGAHRSVQKNGKGSVLTQKYIANR----LHYSLRAYISILYLHSPEH  371

Query  341   FRIILRGKDVEHHNIVNDMMMTQEVTYRPQTGADGVPKDSNMVAVVTIGFVKDAKAHIDV  162
             FRIILRG+ VE H+I ND++  + V Y+PQ G  GV +      + TIGF++ A   I+V
Sbjct  372   FRIILRGQVVEPHHIANDLIYRECVLYKPQVG--GVME---AAVITTIGFLEGA-PDINV  425

Query  161   QGFNVYHKNRLIKPFWRLWNPAGSDGRGVIGVLEANFVEPAHDKQGFERTTV  6
              GFN+YHKNRLI PF  + N +   GRGV+GVLEANF++P HDKQ FE++ +
Sbjct  426   HGFNIYHKNRLILPFKGVANNSYGKGRGVVGVLEANFIKPTHDKQDFEKSNL  477



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4637730747328