BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79291_g1_i1 len=1834 path=[1:0-1833]

Length=1834
                                                                      Score     E

ref|XP_006363182.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    422   3e-138   
ref|XP_006363209.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    418   1e-136   
ref|XP_009757903.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    412   2e-134   
ref|XP_004232635.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    412   4e-134   
gb|AAV66308.1|  acyltransferase                                         411   4e-134   Capsicum frutescens [bird pepper]
ref|XP_004232633.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    411   4e-134   
ref|XP_004232634.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    411   4e-134   
gb|AAV66309.1|  acyltransferase                                         410   2e-133   Capsicum chinense [bonnet pepper]
gb|AAV66311.1|  acyltransferase                                         409   4e-133   Capsicum annuum
gb|AAV66310.1|  acyltransferase                                         408   7e-133   Capsicum annuum
gb|ADB28437.1|  acyltransferase                                         408   8e-133   Capsicum annuum
ref|XP_009604796.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    397   2e-128   
ref|XP_009603396.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    391   6e-126   
ref|XP_004233767.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    383   3e-123   
ref|XP_006363183.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    383   4e-123   
dbj|BAD99417.1|  acyl-transferase                                       382   5e-123   Capsicum annuum
gb|ACO48262.1|  acyltransferase                                         381   1e-122   Capsicum chacoense
gb|ACO48255.1|  acyltransferase                                         380   2e-122   Solanum pennellii
gb|ACO48253.1|  acyltransferase                                         380   4e-122   Solanum lycopersicum
gb|ACZ28491.1|  BAHD acyltransferase                                    380   4e-122   
ref|XP_006363207.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    380   6e-122   
gb|ACO48258.1|  acyltransferase                                         378   2e-121   Lycianthes dejecta
gb|ACO48254.1|  acyltransferase                                         377   3e-121   Datura stramonium [common thornapple]
gb|ACO48256.1|  acyltransferase                                         375   2e-120   Petunia axillaris subsp. parodii
gb|ACO48257.1|  acyltransferase                                         373   2e-119   Solanum melongena [aubergine]
ref|XP_006363208.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    368   2e-117   
ref|XP_006351056.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    360   3e-114   
ref|XP_009588779.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    357   2e-113   
ref|XP_004244824.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    357   6e-113   
ref|XP_004240174.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    349   6e-110   
ref|XP_006344158.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    348   1e-109   
ref|XP_006362683.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    347   3e-109   
dbj|BAD93694.1|  acyltransferase-like protein                           346   1e-108   Nicotiana tabacum [American tobacco]
ref|XP_009631587.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    345   2e-108   
ref|XP_006345867.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    342   4e-107   
ref|XP_009769095.1|  PREDICTED: vinorine synthase-like                  342   5e-107   
ref|XP_009765990.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    341   9e-107   
dbj|BAD93693.1|  acyltransferase-like protein                           339   5e-106   Nicotiana tabacum [American tobacco]
ref|XP_009770804.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    338   1e-105   
ref|XP_009790683.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    331   5e-103   
ref|XP_009630197.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    330   2e-102   
ref|XP_009612347.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    331   5e-102   
ref|XP_009616124.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    325   6e-101   
ref|XP_009590647.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    314   2e-96    
ref|XP_009796801.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    306   6e-94    
dbj|BAD99418.1|  acyl-transferase                                       301   8e-93    Capsicum annuum
ref|XP_004243890.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    300   3e-91    
ref|XP_006351214.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    298   4e-90    
ref|XP_006357899.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    294   6e-89    
ref|XP_004251404.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    295   1e-88    
ref|XP_004243889.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    292   3e-88    
ref|XP_009783683.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    292   4e-88    
ref|XP_004251378.2|  PREDICTED: deacetylvindoline O-acetyltransfe...    288   7e-87    
ref|XP_006351057.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    286   9e-87    
ref|XP_004246214.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    283   1e-84    
ref|XP_009359304.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    282   3e-84    
ref|XP_004237145.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    279   2e-83    
ref|XP_009793426.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    276   1e-82    
ref|XP_010321585.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    270   2e-80    
ref|XP_002515007.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    272   2e-80    Ricinus communis
ref|XP_002514985.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    271   3e-80    Ricinus communis
ref|XP_004251382.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    271   4e-80    
gb|KDP26743.1|  hypothetical protein JCGZ_17901                         270   8e-80    
ref|XP_008340165.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    269   2e-79    
ref|XP_009588593.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    266   3e-78    
ref|XP_006340447.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    261   2e-76    
ref|XP_009618364.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    260   3e-76    
ref|XP_008226170.1|  PREDICTED: vinorine synthase-like                  261   5e-76    
ref|XP_008222036.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    259   2e-75    
emb|CDP12986.1|  unnamed protein product                                258   2e-75    
ref|XP_006357897.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    258   3e-75    
ref|XP_004252044.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    257   5e-75    
ref|XP_011041560.1|  PREDICTED: BAHD acyltransferase At5g47980-like     256   1e-74    
ref|XP_004310187.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    256   1e-74    
ref|XP_009783370.1|  PREDICTED: vinorine synthase-like                  254   3e-74    
ref|XP_010313351.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    255   3e-74    
ref|XP_004243893.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    254   9e-74    
ref|XP_006378283.1|  hypothetical protein POPTR_0010s06650g             254   1e-73    
ref|XP_003532711.2|  PREDICTED: vinorine synthase-like                  254   2e-73    
ref|XP_011041559.1|  PREDICTED: BAHD acyltransferase At5g47980-like     253   6e-73    
ref|XP_011041557.1|  PREDICTED: BAHD acyltransferase At5g47980-like     252   8e-73    
emb|CDP19225.1|  unnamed protein product                                249   1e-71    
emb|CAN63243.1|  hypothetical protein VITISV_028808                     249   1e-71    Vitis vinifera
gb|KDP26744.1|  hypothetical protein JCGZ_17902                         248   3e-71    
ref|XP_002267080.1|  PREDICTED: vinorine synthase-like                  246   8e-71    Vitis vinifera
ref|XP_008383040.1|  PREDICTED: BAHD acyltransferase At5g47980-like     246   2e-70    
emb|CAN69388.1|  hypothetical protein VITISV_027664                     245   3e-70    Vitis vinifera
ref|XP_006346791.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    243   5e-70    
ref|XP_008226167.1|  PREDICTED: vinorine synthase-like                  244   7e-70    
ref|XP_002314550.2|  hypothetical protein POPTR_0010s06640g             243   1e-69    Populus trichocarpa [western balsam poplar]
ref|XP_004294207.1|  PREDICTED: vinorine synthase-like                  243   1e-69    
ref|XP_004295709.1|  PREDICTED: BAHD acyltransferase At5g47980-like     243   2e-69    
ref|XP_004294209.1|  PREDICTED: BAHD acyltransferase At5g47980-like     243   3e-69    
ref|XP_008383117.1|  PREDICTED: vinorine synthase-like                  243   3e-69    
gb|KDP26742.1|  hypothetical protein JCGZ_17900                         241   8e-69    
ref|XP_009371382.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    241   2e-68    
ref|XP_008390113.1|  PREDICTED: BAHD acyltransferase At5g47980          240   2e-68    
ref|XP_002514982.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    240   2e-68    Ricinus communis
gb|KHN12420.1|  Vinorine synthase                                       241   2e-68    
ref|XP_008459937.1|  PREDICTED: BAHD acyltransferase At5g47980-like     240   3e-68    
ref|XP_008222021.1|  PREDICTED: BAHD acyltransferase At5g47980-like     240   3e-68    
ref|XP_010100292.1|  Vinorine synthase                                  239   7e-68    
ref|XP_010100286.1|  Deacetylvindoline O-acetyltransferase              238   9e-68    
ref|XP_004298111.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    238   1e-67    
ref|XP_004140566.1|  PREDICTED: BAHD acyltransferase At5g47980-like     238   1e-67    
ref|XP_009604797.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    231   1e-67    
ref|XP_002311734.1|  hypothetical protein POPTR_0008s18070g             238   1e-67    Populus trichocarpa [western balsam poplar]
emb|CAN73739.1|  hypothetical protein VITISV_023236                     237   1e-67    Vitis vinifera
ref|XP_009361768.1|  PREDICTED: BAHD acyltransferase At5g47980-like     238   1e-67    
ref|XP_004165031.1|  PREDICTED: BAHD acyltransferase At5g47980-like     238   1e-67    
ref|XP_008226094.1|  PREDICTED: BAHD acyltransferase At5g47980-like     238   1e-67    
gb|KEH20541.1|  3'-N-debenzoyl-2'-deoxytaxol benzoyltransferase         238   2e-67    
ref|XP_004152528.1|  PREDICTED: BAHD acyltransferase At5g47980-like     238   2e-67    
ref|XP_009371381.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    239   2e-67    
ref|XP_008226087.1|  PREDICTED: BAHD acyltransferase At5g47980-like     237   5e-67    
ref|XP_010506970.1|  PREDICTED: vinorine synthase-like                  237   6e-67    
gb|KDP38750.1|  hypothetical protein JCGZ_04103                         236   8e-67    
ref|XP_011021361.1|  PREDICTED: BAHD acyltransferase At5g47980-like     236   1e-66    
ref|XP_006471031.1|  PREDICTED: BAHD acyltransferase At5g47980-like     235   1e-66    
ref|XP_008372859.1|  PREDICTED: BAHD acyltransferase At5g47980-like     235   2e-66    
ref|XP_006469323.1|  PREDICTED: BAHD acyltransferase At5g47980-like     236   2e-66    
ref|XP_006431838.1|  hypothetical protein CICLE_v10001160mg             235   2e-66    
ref|XP_002314561.1|  transferase family protein                         235   3e-66    Populus trichocarpa [western balsam poplar]
sp|Q9ZTK5.1|DAT_CATRO  RecName: Full=Deacetylvindoline O-acetyltr...    234   3e-66    Catharanthus roseus [chatas]
ref|XP_010682887.1|  PREDICTED: vinorine synthase-like                  234   3e-66    
ref|XP_006448149.1|  hypothetical protein CICLE_v10015171mg             235   4e-66    
ref|XP_008383041.1|  PREDICTED: BAHD acyltransferase At5g47980-like     234   5e-66    
gb|KDO60771.1|  hypothetical protein CISIN_1g012483mg                   234   5e-66    
ref|XP_007044970.1|  HXXXD-type acyl-transferase family protein, ...    233   7e-66    
ref|XP_004143047.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    234   7e-66    
ref|XP_010514234.1|  PREDICTED: vinorine synthase-like                  234   8e-66    
ref|NP_189233.1|  HXXXD-type acyl-transferase-like protein              233   8e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222084.1|  PREDICTED: BAHD acyltransferase At5g47980-like     233   8e-66    
ref|XP_006292162.1|  hypothetical protein CARUB_v10018368mg             233   9e-66    
ref|XP_002875299.1|  transferase family protein                         233   1e-65    
dbj|BAB01067.1|  acetyltranferase-like protein                          233   1e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006493520.1|  PREDICTED: BAHD acyltransferase At5g47980-like     233   1e-65    
ref|XP_008444410.1|  PREDICTED: vinorine synthase                       233   2e-65    
ref|XP_006493519.1|  PREDICTED: BAHD acyltransferase At5g47980-like     232   2e-65    
ref|XP_002511244.1|  Anthranilate N-benzoyltransferase protein, p...    232   2e-65    Ricinus communis
emb|CBI27537.3|  unnamed protein product                                231   3e-65    
ref|XP_009359423.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    231   3e-65    
ref|XP_006431933.1|  hypothetical protein CICLE_v10001089mg             232   4e-65    
ref|XP_002510627.1|  Anthranilate N-benzoyltransferase protein, p...    231   7e-65    Ricinus communis
ref|XP_004295691.1|  PREDICTED: BAHD acyltransferase At5g47980-like     231   1e-64    
ref|XP_006395599.1|  hypothetical protein EUTSA_v10005565mg             230   2e-64    
ref|XP_008226088.1|  PREDICTED: BAHD acyltransferase At5g47980-like     230   2e-64    
ref|XP_004301957.1|  PREDICTED: BAHD acyltransferase At5g47980-like     229   4e-64    
ref|XP_010682956.1|  PREDICTED: BAHD acyltransferase At5g47980          229   6e-64    
ref|XP_008437382.1|  PREDICTED: BAHD acyltransferase At5g47980-like     228   7e-64    
ref|XP_009361769.1|  PREDICTED: BAHD acyltransferase At5g47980-like     228   7e-64    
gb|AAO13736.1|AF253415_1  minovincinine 19-hydroxy-O-acetyltransf...    228   8e-64    Catharanthus roseus [chatas]
ref|XP_008372178.1|  PREDICTED: BAHD acyltransferase At5g47980-like     228   1e-63    
ref|XP_008222020.1|  PREDICTED: BAHD acyltransferase At5g47980-like     227   1e-63    
ref|XP_006422064.1|  hypothetical protein CICLE_v10006464mg             227   1e-63    
ref|XP_002514983.1|  Anthranilate N-benzoyltransferase protein, p...    228   1e-63    Ricinus communis
ref|XP_008372855.1|  PREDICTED: BAHD acyltransferase At5g47980-like     228   1e-63    
ref|XP_006422067.1|  hypothetical protein CICLE_v10004997mg             227   2e-63    
ref|XP_006431929.1|  hypothetical protein CICLE_v10003910mg             227   2e-63    
ref|XP_008372831.1|  PREDICTED: BAHD acyltransferase At5g47980-like     227   2e-63    
ref|XP_007018004.1|  Anthranilate N-benzoyltransferase protein, p...    226   3e-63    
ref|XP_004159582.1|  PREDICTED: vinorine synthase-like                  226   4e-63    
ref|XP_006484024.1|  PREDICTED: BAHD acyltransferase At5g47980-like     226   4e-63    
ref|XP_007018014.1|  HXXXD-type acyl-transferase family protein, ...    231   4e-63    
ref|XP_008222013.1|  PREDICTED: vinorine synthase-like                  226   4e-63    
ref|XP_010092011.1|  BAHD acyltransferase                               226   4e-63    
ref|XP_010100291.1|  Salutaridinol 7-O-acetyltransferase                226   5e-63    
gb|KDO82048.1|  hypothetical protein CISIN_1g012688mg                   226   5e-63    
ref|XP_009780612.1|  PREDICTED: vinorine synthase-like                  225   5e-63    
ref|XP_006438135.1|  hypothetical protein CICLE_v10031490mg             226   6e-63    
emb|CDP07885.1|  unnamed protein product                                226   8e-63    
ref|XP_006470642.1|  PREDICTED: BAHD acyltransferase At5g47980-like     226   1e-62    
ref|XP_006446155.1|  hypothetical protein CICLE_v10015146mg             226   1e-62    
ref|XP_004504492.1|  PREDICTED: vinorine synthase-like                  225   1e-62    
gb|KEH20540.1|  HXXXD-type acyl-transferase family protein              225   1e-62    
ref|XP_009773462.1|  PREDICTED: vinorine synthase-like                  224   1e-62    
ref|XP_006491900.1|  PREDICTED: BAHD acyltransferase At5g47980-like     225   1e-62    
ref|XP_008226093.1|  PREDICTED: BAHD acyltransferase At5g47980-like     225   1e-62    
ref|XP_011029622.1|  PREDICTED: BAHD acyltransferase At5g47980          224   1e-62    
ref|XP_004295693.1|  PREDICTED: BAHD acyltransferase At5g47980-like     224   2e-62    
emb|CDY39174.1|  BnaC09g21700D                                          225   2e-62    
ref|XP_009371383.1|  PREDICTED: BAHD acyltransferase At5g47980-like     224   2e-62    
ref|XP_009371390.1|  PREDICTED: vinorine synthase-like                  224   2e-62    
ref|XP_004295692.1|  PREDICTED: BAHD acyltransferase At5g47980-like     224   3e-62    
ref|XP_009361854.1|  PREDICTED: BAHD acyltransferase At5g47980-like     223   4e-62    
ref|XP_009355133.1|  PREDICTED: BAHD acyltransferase At5g47980-like     223   4e-62    
ref|XP_009359305.1|  PREDICTED: vinorine synthase                       223   5e-62    
ref|XP_008372858.1|  PREDICTED: BAHD acyltransferase At5g47980-like     223   6e-62    
ref|XP_009361770.1|  PREDICTED: vinorine synthase-like                  223   8e-62    
ref|XP_009602470.1|  PREDICTED: vinorine synthase-like                  221   1e-61    
ref|XP_009352970.1|  PREDICTED: vinorine synthase-like                  221   2e-61    
ref|XP_009114100.1|  PREDICTED: vinorine synthase                       222   2e-61    
emb|CDY04190.1|  BnaA09g19680D                                          221   3e-61    
ref|XP_008358908.1|  PREDICTED: vinorine synthase-like                  221   4e-61    
ref|XP_008241213.1|  PREDICTED: BAHD acyltransferase At5g47980-like     221   4e-61    
ref|XP_008226171.1|  PREDICTED: BAHD acyltransferase At5g47980-like     221   4e-61    
ref|XP_006431841.1|  hypothetical protein CICLE_v10001101mg             221   5e-61    
ref|XP_008226064.1|  PREDICTED: BAHD acyltransferase At5g47980-like     220   5e-61    
ref|XP_008226065.1|  PREDICTED: BAHD acyltransferase At5g47980-like     219   1e-60    
ref|XP_009371380.1|  PREDICTED: BAHD acyltransferase At5g47980-like     219   1e-60    
ref|XP_008222012.1|  PREDICTED: vinorine synthase-like                  219   1e-60    
ref|XP_003616845.1|  Vinorine synthase                                  219   2e-60    
ref|XP_008392421.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    219   2e-60    
ref|XP_008226172.1|  PREDICTED: BAHD acyltransferase At5g47980-like     218   2e-60    
ref|XP_008386397.1|  PREDICTED: BAHD acyltransferase At5g47980-like     219   2e-60    
gb|KDP36802.1|  hypothetical protein JCGZ_08093                         219   2e-60    
ref|XP_008346587.1|  PREDICTED: BAHD acyltransferase At5g47980-like     218   4e-60    
ref|XP_006435345.1|  hypothetical protein CICLE_v10001106mg             218   4e-60    
gb|KEH20539.1|  HXXXD-type acyl-transferase family protein              218   6e-60    
ref|XP_006471129.1|  PREDICTED: BAHD acyltransferase At5g47980-like     218   6e-60    
ref|XP_007158727.1|  hypothetical protein PHAVU_002G177000g             218   7e-60    
ref|XP_004485524.1|  PREDICTED: vinorine synthase-like                  217   1e-59    
ref|XP_006491901.1|  PREDICTED: BAHD acyltransferase At5g47980-like     216   1e-59    
ref|XP_009358370.1|  PREDICTED: BAHD acyltransferase At5g47980-like     217   1e-59    
ref|XP_007039558.1|  Anthranilate N-benzoyltransferase protein, p...    216   1e-59    
ref|XP_011013913.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    216   2e-59    
gb|KDP36822.1|  hypothetical protein JCGZ_08113                         221   2e-59    
emb|CDP08574.1|  unnamed protein product                                215   3e-59    
ref|XP_004310025.1|  PREDICTED: vinorine synthase-like                  215   4e-59    
ref|XP_002267341.1|  PREDICTED: vinorine synthase                       215   4e-59    Vitis vinifera
ref|XP_004298096.1|  PREDICTED: vinorine synthase-like                  215   4e-59    
ref|XP_010554168.1|  PREDICTED: vinorine synthase                       215   7e-59    
ref|XP_008389785.1|  PREDICTED: vinorine synthase-like                  214   7e-59    
ref|XP_010090836.1|  Vinorine synthase                                  215   7e-59    
ref|XP_011041291.1|  PREDICTED: vinorine synthase-like                  215   8e-59    
ref|XP_002300646.2|  hypothetical protein POPTR_0002s01180g             214   8e-59    Populus trichocarpa [western balsam poplar]
ref|XP_006431936.1|  hypothetical protein CICLE_v10001158mg             214   1e-58    
ref|XP_008353036.1|  PREDICTED: vinorine synthase-like                  213   2e-58    
ref|XP_008340164.1|  PREDICTED: vinorine synthase-like                  213   3e-58    
ref|XP_008368264.1|  PREDICTED: vinorine synthase-like                  213   3e-58    
ref|XP_011034885.1|  PREDICTED: vinorine synthase-like                  213   4e-58    
ref|XP_007037901.1|  Anthranilate N-benzoyltransferase protein, p...    212   4e-58    
ref|XP_007018005.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    213   5e-58    
ref|XP_011101100.1|  PREDICTED: vinorine synthase-like                  213   5e-58    
ref|XP_008454499.1|  PREDICTED: BAHD acyltransferase At5g47980-like     212   6e-58    
ref|XP_003616843.1|  Salutaridinol 7-O-acetyltransferase                211   9e-58    
gb|KDP30966.1|  hypothetical protein JCGZ_11342                         212   1e-57    
gb|ADD71922.1|  BAHD-type acyltransferase                               211   1e-57    Actaea racemosa
ref|XP_011042323.1|  PREDICTED: vinorine synthase-like                  211   1e-57    
gb|KDO61210.1|  hypothetical protein CISIN_1g015205mg                   210   2e-57    
ref|XP_008390114.1|  PREDICTED: vinorine synthase-like                  211   2e-57    
ref|XP_008360182.1|  PREDICTED: vinorine synthase-like                  211   2e-57    
ref|XP_002271612.1|  PREDICTED: vinorine synthase-like                  210   3e-57    Vitis vinifera
ref|XP_008385235.1|  PREDICTED: uncharacterized protein LOC103447811    218   3e-57    
ref|XP_004301806.1|  PREDICTED: vinorine synthase-like                  209   4e-57    
ref|XP_009359286.1|  PREDICTED: vinorine synthase-like                  209   4e-57    
ref|XP_009361771.1|  PREDICTED: BAHD acyltransferase At5g47980-like     210   5e-57    
ref|XP_003538872.1|  PREDICTED: vinorine synthase-like                  209   5e-57    
ref|XP_007028226.1|  HXXXD-type acyl-transferase family protein, ...    209   7e-57    
ref|XP_002284817.2|  PREDICTED: vinorine synthase-like                  209   7e-57    Vitis vinifera
ref|XP_006341810.1|  PREDICTED: vinorine synthase-like                  209   8e-57    
ref|XP_007044963.1|  HXXXD-type acyl-transferase family protein, ...    208   9e-57    
gb|AFK47265.1|  unknown                                                 209   1e-56    
gb|KGN52789.1|  hypothetical protein Csa_4G001560                       208   1e-56    
ref|XP_008389833.1|  PREDICTED: vinorine synthase-like                  208   1e-56    
ref|XP_008383043.1|  PREDICTED: BAHD acyltransferase At5g47980-like     207   1e-56    
ref|XP_009342764.1|  PREDICTED: vinorine synthase-like                  208   2e-56    
ref|XP_009606783.1|  PREDICTED: vinorine synthase-like                  207   2e-56    
ref|XP_008226591.1|  PREDICTED: BAHD acyltransferase At5g47980-like     209   2e-56    
ref|XP_006348577.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    208   2e-56    
emb|CDP08578.1|  unnamed protein product                                207   2e-56    
gb|AFK42496.1|  unknown                                                 208   2e-56    
ref|XP_010027285.1|  PREDICTED: BAHD acyltransferase At5g47980-like     207   2e-56    
ref|XP_008382277.1|  PREDICTED: BAHD acyltransferase At5g47980-like     208   2e-56    
ref|XP_006582966.1|  PREDICTED: vinorine synthase-like                  207   3e-56    
ref|XP_011091918.1|  PREDICTED: vinorine synthase-like                  207   4e-56    
ref|XP_011091913.1|  PREDICTED: vinorine synthase-like                  206   7e-56    
ref|XP_006387936.1|  hypothetical protein POPTR_0468s00200g             204   7e-56    
ref|XP_004310028.1|  PREDICTED: vinorine synthase-like                  206   8e-56    
ref|XP_004138261.1|  PREDICTED: vinorine synthase-like                  205   1e-55    
ref|XP_002893451.1|  transferase family protein                         205   1e-55    
ref|XP_007044964.1|  HXXXD-type acyl-transferase family protein, ...    205   1e-55    
ref|XP_010531415.1|  PREDICTED: BAHD acyltransferase At5g47980-like     205   1e-55    
ref|XP_008226086.1|  PREDICTED: BAHD acyltransferase At5g47980-like     206   2e-55    
ref|XP_003547065.2|  PREDICTED: vinorine synthase-like                  205   2e-55    
ref|XP_009353048.1|  PREDICTED: BAHD acyltransferase At5g47980-like     205   2e-55    
ref|XP_002315639.2|  transferase family protein                         205   2e-55    Populus trichocarpa [western balsam poplar]
ref|XP_008392330.1|  PREDICTED: BAHD acyltransferase At5g47980-like     205   2e-55    
ref|XP_009342768.1|  PREDICTED: vinorine synthase-like                  205   2e-55    
ref|XP_004310026.1|  PREDICTED: vinorine synthase-like                  204   3e-55    
ref|XP_004511244.1|  PREDICTED: vinorine synthase-like                  204   3e-55    
ref|XP_008222018.1|  PREDICTED: vinorine synthase-like                  204   3e-55    
emb|CDY22927.1|  BnaA01g18650D                                          204   5e-55    
ref|XP_010529016.1|  PREDICTED: BAHD acyltransferase At5g47980-like     204   5e-55    
ref|XP_002315640.2|  hypothetical protein POPTR_0010s06380g             202   6e-55    
ref|XP_004239499.1|  PREDICTED: vinorine synthase                       203   7e-55    
ref|XP_008226063.1|  PREDICTED: BAHD acyltransferase At5g47980-like     204   8e-55    
ref|XP_009359355.1|  PREDICTED: vinorine synthase-like                  204   8e-55    
ref|XP_002321827.2|  hypothetical protein POPTR_0015s14850g             203   9e-55    
ref|XP_006487765.1|  PREDICTED: vinorine synthase-like                  202   1e-54    
gb|AGT56097.1|  cocaine synthase                                        203   1e-54    
ref|XP_004301963.1|  PREDICTED: BAHD acyltransferase At5g47980-like     202   1e-54    
ref|XP_011000149.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    202   1e-54    
ref|XP_002514981.1|  Salutaridinol 7-O-acetyltransferase, putative      202   2e-54    
ref|XP_009147434.1|  PREDICTED: BAHD acyltransferase At5g47980-like     202   2e-54    
ref|XP_008389789.1|  PREDICTED: vinorine synthase-like                  201   4e-54    
emb|CDP15031.1|  unnamed protein product                                202   4e-54    
ref|XP_011000222.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    202   4e-54    
ref|XP_006414522.1|  hypothetical protein EUTSA_v10025210mg             201   4e-54    
gb|KCW86592.1|  hypothetical protein EUGRSUZ_B03224                     201   5e-54    
gb|KDO41287.1|  hypothetical protein CISIN_1g044243mg                   201   5e-54    
ref|XP_006423966.1|  hypothetical protein CICLE_v10028504mg             201   5e-54    
ref|XP_008346326.1|  PREDICTED: BAHD acyltransferase At5g47980-like     201   7e-54    
ref|XP_010044503.1|  PREDICTED: vinorine synthase-like                  201   7e-54    
ref|XP_010466664.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    201   7e-54    
gb|AES72092.2|  anthranilate N-benzoyltransferase                       200   8e-54    
gb|AFK43775.1|  unknown                                                 200   9e-54    
ref|XP_008375497.1|  PREDICTED: BAHD acyltransferase At5g47980-like     201   9e-54    
ref|XP_010044504.1|  PREDICTED: vinorine synthase-like                  200   1e-53    
ref|XP_002514980.1|  Anthranilate N-benzoyltransferase protein, p...    200   2e-53    
ref|XP_006307565.1|  hypothetical protein CARUB_v10009188mg             199   2e-53    
ref|XP_010046626.1|  PREDICTED: vinorine synthase-like                  199   2e-53    
gb|KDO52550.1|  hypothetical protein CISIN_1g042238mg                   200   2e-53    
ref|XP_010514678.1|  PREDICTED: BAHD acyltransferase At5g47980-like     199   3e-53    
gb|EYU26834.1|  hypothetical protein MIMGU_mgv1a020307mg                199   3e-53    
ref|XP_003601841.1|  Vinorine synthase                                  200   4e-53    
gb|KCW86595.1|  hypothetical protein EUGRSUZ_B03227                     199   4e-53    
ref|XP_002875533.1|  transferase family protein                         199   5e-53    
ref|XP_010044505.1|  PREDICTED: vinorine synthase-like                  199   5e-53    
ref|XP_011101142.1|  PREDICTED: vinorine synthase-like                  198   6e-53    
ref|XP_008226155.1|  PREDICTED: BAHD acyltransferase At5g47980-like     198   7e-53    
ref|XP_006493396.1|  PREDICTED: vinorine synthase-like                  197   7e-53    
ref|XP_006292868.1|  hypothetical protein CARUB_v10019128mg             198   1e-52    
ref|XP_010499178.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    197   1e-52    
ref|XP_010025365.1|  PREDICTED: vinorine synthase-like                  197   1e-52    
ref|XP_008382276.1|  PREDICTED: BAHD acyltransferase At5g47980-like     199   1e-52    
ref|XP_007030131.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    197   1e-52    
ref|XP_010460461.1|  PREDICTED: BAHD acyltransferase At5g47980-like     197   1e-52    
ref|XP_002533732.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    197   1e-52    
ref|XP_006420178.1|  hypothetical protein CICLE_v10006986mg             197   2e-52    
ref|XP_010088399.1|  Salutaridinol 7-O-acetyltransferase                197   2e-52    
ref|XP_010025363.1|  PREDICTED: BAHD acyltransferase At5g47980-like     197   2e-52    
gb|KDP20131.1|  hypothetical protein JCGZ_05900                         197   2e-52    
ref|XP_002307785.2|  hypothetical protein POPTR_0005s27190g             197   2e-52    
ref|XP_008240535.1|  PREDICTED: vinorine synthase-like                  197   2e-52    
ref|XP_006421556.1|  hypothetical protein CICLE_v10006823mg             197   2e-52    
ref|XP_009588476.1|  PREDICTED: vinorine synthase-like                  197   2e-52    
emb|CDY68964.1|  BnaC01g42060D                                          196   2e-52    
ref|XP_009375404.1|  PREDICTED: BAHD acyltransferase At5g47980-like     197   2e-52    
dbj|BAF02069.1|  HSR201 like protein                                    197   2e-52    
gb|KCW62003.1|  hypothetical protein EUGRSUZ_H04681                     196   3e-52    
ref|XP_010534787.1|  PREDICTED: BAHD acyltransferase At5g47980-like     196   3e-52    
ref|XP_010502921.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    196   3e-52    
ref|XP_004514780.1|  PREDICTED: vinorine synthase-like                  196   3e-52    
gb|AFB74620.1|  acetyltransferase 1                                     197   3e-52    
ref|XP_010094574.1|  Salutaridinol 7-O-acetyltransferase                197   3e-52    
ref|XP_009365957.1|  PREDICTED: BAHD acyltransferase At5g47980-like     197   4e-52    
ref|XP_004135508.1|  PREDICTED: vinorine synthase-like                  196   4e-52    
ref|XP_007227141.1|  hypothetical protein PRUPE_ppa026262mg             196   4e-52    
ref|XP_002517535.1|  Anthranilate N-benzoyltransferase protein, p...    196   5e-52    
ref|XP_010528792.1|  PREDICTED: BAHD acyltransferase At5g47980-like     196   5e-52    
ref|XP_010100290.1|  Salutaridinol 7-O-acetyltransferase                196   6e-52    
ref|XP_002511237.1|  Anthranilate N-benzoyltransferase protein, p...    196   6e-52    
ref|XP_006379530.1|  hypothetical protein POPTR_0008s03350g             196   6e-52    
ref|XP_010051001.1|  PREDICTED: vinorine synthase-like                  196   6e-52    
ref|XP_010502922.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    196   7e-52    
gb|KGN64382.1|  hypothetical protein Csa_1G050210                       195   7e-52    
ref|XP_008240680.1|  PREDICTED: vinorine synthase-like                  196   8e-52    
ref|NP_193274.1|  HXXXD-type acyl-transferase family protein            195   8e-52    
ref|XP_011071306.1|  PREDICTED: vinorine synthase-like                  195   9e-52    
ref|XP_008389788.1|  PREDICTED: vinorine synthase-like                  195   1e-51    
gb|ACI45390.1|  salutaridinol 7-O-acetyltransferase                     195   1e-51    
ref|XP_011069600.1|  PREDICTED: vinorine synthase-like                  194   1e-51    
ref|XP_010502924.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    194   2e-51    
gb|KDP40899.1|  hypothetical protein JCGZ_24898                         194   2e-51    
ref|XP_011091857.1|  PREDICTED: vinorine synthase-like                  194   2e-51    
ref|XP_006342247.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    194   2e-51    
emb|CDP13291.1|  unnamed protein product                                194   2e-51    
ref|XP_006351852.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    194   2e-51    
ref|XP_002322397.2|  hypothetical protein POPTR_0015s14800g             194   2e-51    
ref|XP_010502923.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    194   2e-51    
ref|XP_009117330.1|  PREDICTED: BAHD acyltransferase At5g47980-like     194   2e-51    
ref|XP_008385196.1|  PREDICTED: BAHD acyltransferase At5g47980-like     194   3e-51    
ref|XP_008222015.1|  PREDICTED: vinorine synthase-like                  194   3e-51    
gb|ACI45392.1|  salutaridinol 7-O-acetyltransferase                     194   3e-51    
ref|XP_009375401.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    194   4e-51    
ref|XP_010550538.1|  PREDICTED: BAHD acyltransferase At5g47980          192   4e-51    
ref|XP_008222087.1|  PREDICTED: vinorine synthase-like                  193   4e-51    
ref|XP_006438136.1|  hypothetical protein CICLE_v10033777mg             193   4e-51    
ref|XP_008377211.1|  PREDICTED: vinorine synthase-like                  194   4e-51    
ref|XP_006370899.1|  hypothetical protein POPTR_0019s01540g             193   5e-51    
ref|XP_009361992.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    193   6e-51    
gb|KDO85081.1|  hypothetical protein CISIN_1g015400mg                   192   6e-51    
ref|XP_006291172.1|  hypothetical protein CARUB_v10017289mg             192   6e-51    
ref|XP_010556179.1|  PREDICTED: BAHD acyltransferase At5g47980          192   6e-51    
ref|XP_008222017.1|  PREDICTED: vinorine synthase-like                  192   7e-51    
ref|XP_008222079.1|  PREDICTED: vinorine synthase-like                  192   7e-51    
ref|XP_006464646.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    193   7e-51    
ref|XP_002514976.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    192   7e-51    
ref|XP_004301008.1|  PREDICTED: vinorine synthase-like                  192   8e-51    
ref|XP_010044501.1|  PREDICTED: vinorine synthase-like                  192   8e-51    
gb|KDP35375.1|  hypothetical protein JCGZ_10359                         192   9e-51    
ref|XP_004242673.1|  PREDICTED: vinorine synthase-like                  192   9e-51    
sp|Q70PR7.2|VINSY_RAUSE  RecName: Full=Vinorine synthase                192   9e-51    
ref|XP_010425699.1|  PREDICTED: BAHD acyltransferase At5g47980-like     192   1e-50    
ref|XP_004251383.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    189   1e-50    
ref|XP_004238629.1|  PREDICTED: vinorine synthase-like                  192   1e-50    
ref|XP_006484023.1|  PREDICTED: vinorine synthase-like                  193   1e-50    
sp|Q94FT4.1|SALAT_PAPSO  RecName: Full=Salutaridinol 7-O-acetyltr...    192   2e-50    
ref|XP_009780317.1|  PREDICTED: vinorine synthase-like                  191   2e-50    
gb|KDO36951.1|  hypothetical protein CISIN_1g045540mg                   191   2e-50    
ref|XP_008365512.1|  PREDICTED: BAHD acyltransferase At5g47980-like     192   2e-50    
ref|XP_003593106.1|  Deacetylvindoline O-acetyltransferase              191   2e-50    
ref|XP_004310024.1|  PREDICTED: vinorine synthase-like                  191   2e-50    
ref|XP_010050993.1|  PREDICTED: vinorine synthase-like                  191   2e-50    
ref|XP_008379851.1|  PREDICTED: BAHD acyltransferase At5g47980-like     192   2e-50    
ref|XP_011031655.1|  PREDICTED: vinorine synthase-like                  191   2e-50    
emb|CDP15027.1|  unnamed protein product                                191   3e-50    
ref|XP_007135112.1|  hypothetical protein PHAVU_010G102000g             191   4e-50    
ref|XP_004310027.1|  PREDICTED: vinorine synthase-like                  190   4e-50    
ref|XP_006282607.1|  hypothetical protein CARUB_v10004825mg             190   5e-50    
ref|NP_173851.1|  HXXXD-type acyl-transferase-like protein              190   5e-50    
ref|XP_010097635.1|  Salutaridinol 7-O-acetyltransferase                190   6e-50    
ref|XP_010514622.1|  PREDICTED: BAHD acyltransferase At5g47980-like     190   6e-50    
ref|XP_008446094.1|  PREDICTED: vinorine synthase-like                  190   7e-50    
ref|XP_011071181.1|  PREDICTED: vinorine synthase-like isoform X1       189   7e-50    
gb|AET80686.1|  spermidine hydroxycinnamoyl transferase                 190   7e-50    
ref|XP_008240679.1|  PREDICTED: vinorine synthase-like                  190   7e-50    
emb|CDY52590.1|  BnaC08g49150D                                          189   8e-50    
ref|XP_010040717.1|  PREDICTED: vinorine synthase-like                  189   1e-49    
ref|XP_006432232.1|  hypothetical protein CICLE_v10001086mg             189   1e-49    
ref|XP_006414524.1|  hypothetical protein EUTSA_v10027507mg             189   1e-49    
gb|KDO85073.1|  hypothetical protein CISIN_1g044625mg                   189   2e-49    
ref|XP_009113794.1|  PREDICTED: BAHD acyltransferase At5g47980          188   2e-49    
ref|XP_010556026.1|  PREDICTED: BAHD acyltransferase At5g47980-like     188   2e-49    
ref|XP_002868208.1|  hypothetical protein ARALYDRAFT_915274             188   2e-49    
ref|XP_006427936.1|  hypothetical protein CICLE_v10027290mg             188   2e-49    
ref|XP_011008627.1|  PREDICTED: vinorine synthase-like                  188   3e-49    
ref|XP_006473916.1|  PREDICTED: vinorine synthase-like                  189   3e-49    
ref|XP_011070326.1|  PREDICTED: vinorine synthase-like                  188   3e-49    
ref|NP_189647.1|  HXXXD-type acyl-transferase-like protein              188   3e-49    
ref|XP_010100294.1|  Vinorine synthase                                  188   3e-49    
gb|KDO58317.1|  hypothetical protein CISIN_1g037128mg                   188   4e-49    
ref|XP_006414545.1|  hypothetical protein EUTSA_v10025191mg             188   4e-49    
ref|XP_004295939.1|  PREDICTED: BAHD acyltransferase At5g47980-like     187   4e-49    
ref|XP_007042887.1|  HXXXD-type acyl-transferase family protein, ...    189   4e-49    
ref|XP_009775563.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    180   5e-49    
ref|XP_010050979.1|  PREDICTED: vinorine synthase-like                  187   5e-49    
gb|KDP26741.1|  hypothetical protein JCGZ_17899                         187   5e-49    
ref|XP_009759141.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    187   5e-49    
ref|XP_008226085.1|  PREDICTED: BAHD acyltransferase At5g47980-like     188   5e-49    
ref|XP_008383113.1|  PREDICTED: vinorine synthase-like                  189   5e-49    
ref|XP_008377073.1|  PREDICTED: vinorine synthase-like                  189   6e-49    
gb|KCW80998.1|  hypothetical protein EUGRSUZ_C02374                     187   6e-49    
ref|XP_006415800.1|  hypothetical protein EUTSA_v10007667mg             187   7e-49    
ref|XP_004243011.1|  PREDICTED: vinorine synthase-like                  187   8e-49    
ref|XP_008446095.1|  PREDICTED: vinorine synthase-like                  187   8e-49    
gb|KCW44979.1|  hypothetical protein EUGRSUZ_L01434                     186   9e-49    
gb|KFK33809.1|  hypothetical protein AALP_AA5G062900                    187   9e-49    
ref|XP_010647391.1|  PREDICTED: vinorine synthase-like                  186   1e-48    
ref|XP_010097637.1|  Salutaridinol 7-O-acetyltransferase                186   1e-48    
ref|XP_007212426.1|  hypothetical protein PRUPE_ppa016640mg             187   1e-48    
emb|CDY27594.1|  BnaA09g28130D                                          186   1e-48    
gb|KCW81023.1|  hypothetical protein EUGRSUZ_C02397                     186   1e-48    
ref|XP_009606831.1|  PREDICTED: vinorine synthase-like                  186   1e-48    
ref|XP_010025364.1|  PREDICTED: BAHD acyltransferase At5g47980-like     186   1e-48    
gb|KDP36821.1|  hypothetical protein JCGZ_08112                         186   1e-48    
ref|XP_010425703.1|  PREDICTED: BAHD acyltransferase At5g47980-like     186   1e-48    
gb|KCW86594.1|  hypothetical protein EUGRSUZ_B03226                     186   1e-48    
gb|KDO56836.1|  hypothetical protein CISIN_1g037338mg                   184   1e-48    
ref|XP_007134039.1|  hypothetical protein PHAVU_010G014300g             186   1e-48    
ref|XP_010088398.1|  Salutaridinol 7-O-acetyltransferase                186   2e-48    
ref|XP_006432227.1|  hypothetical protein CICLE_v10001125mg             186   2e-48    
ref|XP_011071304.1|  PREDICTED: vinorine synthase-like                  186   2e-48    
ref|XP_010425269.1|  PREDICTED: BAHD acyltransferase At5g47980-like     185   2e-48    
ref|XP_002308780.1|  hypothetical protein POPTR_0006s01190g             185   3e-48    
ref|XP_010545914.1|  PREDICTED: BAHD acyltransferase At5g47980-like     185   3e-48    
ref|XP_004310183.1|  PREDICTED: vinorine synthase-like                  185   4e-48    
ref|XP_007134037.1|  hypothetical protein PHAVU_010G014100g             184   4e-48    
ref|XP_006432226.1|  hypothetical protein CICLE_v10001111mg             185   5e-48    
gb|KCW44307.1|  hypothetical protein EUGRSUZ_L02250                     183   6e-48    
emb|CDP10332.1|  unnamed protein product                                184   6e-48    
ref|XP_009782260.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    184   8e-48    
ref|XP_006441394.1|  hypothetical protein CICLE_v10023627mg             183   8e-48    
ref|XP_007037899.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    184   8e-48    
gb|KDP36818.1|  hypothetical protein JCGZ_08109                         184   8e-48    
ref|XP_010064606.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   9e-48    
ref|XP_010514628.1|  PREDICTED: BAHD acyltransferase At5g47980-like     184   1e-47    
ref|XP_010050974.1|  PREDICTED: vinorine synthase-like                  183   1e-47    
ref|XP_006465504.1|  PREDICTED: vinorine synthase-like                  184   1e-47    
ref|XP_002529587.1|  Anthranilate N-benzoyltransferase protein, p...    183   1e-47    
emb|CDX84944.1|  BnaC05g21110D                                          183   1e-47    
ref|XP_006464983.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    184   1e-47    
emb|CBI18889.3|  unnamed protein product                                187   2e-47    
ref|XP_007148464.1|  hypothetical protein PHAVU_006G211000g             183   2e-47    
emb|CDP15032.1|  unnamed protein product                                183   2e-47    
ref|XP_008446186.1|  PREDICTED: vinorine synthase-like                  182   2e-47    
emb|CDP13085.1|  unnamed protein product                                182   3e-47    
ref|XP_010529584.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   3e-47    
gb|KDO58318.1|  hypothetical protein CISIN_1g037986mg                   183   3e-47    
gb|ACI45393.1|  salutaridinol 7-O-acetyltransferase                     183   3e-47    
emb|CBI37948.3|  unnamed protein product                                190   3e-47    
ref|XP_010478802.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   3e-47    
ref|XP_010100295.1|  Vinorine synthase                                  182   3e-47    
ref|XP_010050981.1|  PREDICTED: vinorine synthase-like                  182   4e-47    
ref|XP_008360555.1|  PREDICTED: BAHD acyltransferase At5g47980-like     181   4e-47    
ref|XP_006370897.1|  hypothetical protein POPTR_0019s01520g             182   5e-47    
ref|XP_010648156.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    181   5e-47    
ref|XP_003521961.1|  PREDICTED: vinorine synthase-like                  182   5e-47    
ref|XP_010100296.1|  Vinorine synthase                                  182   5e-47    



>ref|XP_006363182.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=446

 Score =   422 bits (1085),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 220/443 (50%), Positives = 302/443 (68%), Gaps = 29/443 (7%)
 Frame = +2

Query  179   AIIASPPL-SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-NNRTDPT  352
             A+++SP L S  ++  IKPSS TPP+LR+HKLS +DQ  ++MYIPL FFYP    R + T
Sbjct  4     ALLSSPSLVSACDKTFIKPSSLTPPTLRYHKLSYIDQFYSNMYIPLAFFYPKVQQREEST  63

Query  353   R--------VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDII  508
             +        ++ +LQ +LS+TL S+YPYAG+L DNA VDCND GAEF  VR+NC + +I+
Sbjct  64    KYSHNELSHIAHLLQTSLSQTLVSYYPYAGKLRDNAIVDCNDMGAEFSSVRINCHMSEIL  123

Query  509   NHPDA-DAQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNF  682
             +HPDA  A+++ FP  LPWAN ++GG L V QLS+FDCGGIA+S  + HK+GDG +V NF
Sbjct  124   DHPDASQAESIVFPKDLPWANNYEGGNLLVAQLSKFDCGGIAISVCLSHKIGDGTSVLNF  183

Query  683   MGHWVAATRHPKLN--LSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKL  856
             +  W   T H ++   L+P FV DSVF +    P+  P + S +  +CVQKR +F   KL
Sbjct  184   VNDWSRMT-HSRMTTTLAPKFVGDSVFSSNNYSPIIAPQMLSNV-SECVQKRIIFPTTKL  241

Query  857   DLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAAS-------RRPSILVHYADMRPPLG  1015
             D L+  V+EESGV+NPTRAE+VSALL+KC VKAA+S       RRPS  VH  ++R  + 
Sbjct  242   DALRAKVAEESGVENPTRAEVVSALLFKCAVKAASSTTTSMLTRRPSKFVHLLNVRSMMK  301

Query  1016  --LPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSL  1177
               LP ++ GN+LS+FST+     +++L  LV  LR+G E   ++D    NEL+ E+V S+
Sbjct  302   SRLPQSAIGNLLSSFSTTATNEQDIELPTLVRNLRKGVEVAYTKDHVEQNELILEVVESM  361

Query  1178  RTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGF  1357
             R G+KP+++   ++Y CS+L ++P Y  DFGWG P +VS+P GP KN+FFL D + GGG 
Sbjct  362   RKGKKPFDDEYENVYSCSNLCRFPLYKVDFGWGKPERVSLPNGPFKNLFFLKDYKIGGGV  421

Query  1358  EALVMLKKTDMSGFERDEELLRF  1426
             +A VML+K  MS FERDEELL  
Sbjct  422   DARVMLQKQHMSEFERDEELLEL  444



>ref|XP_006363209.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=443

 Score =   418 bits (1075),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 215/437 (49%), Positives = 293/437 (67%), Gaps = 21/437 (5%)
 Frame = +2

Query  176   MAIIASPPL-SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP-------N  331
              A+++SP L SI ++  IKPSS TPP+LR HKLS +DQ+ ++MYIP  FFYP       +
Sbjct  3     FALLSSPSLVSIYDKTFIKPSSLTPPTLRLHKLSFVDQSFSNMYIPFAFFYPKVEEREES  62

Query  332   NNRTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIIN  511
             NN  + + ++ +LQ +LS+TL S+YPYAG+L DNA +DCND GAEF  VR+ C + +I++
Sbjct  63    NNSHELSHIAHLLQTSLSQTLVSYYPYAGKLRDNAIIDCNDMGAEFSTVRIKCHMSEILD  122

Query  512   HPDAD-AQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFM  685
             HPDA  A+++ FP  LPWAN ++GG L + Q+S+FDCGGIA+S  +  K+GDG +V NF+
Sbjct  123   HPDASHAESIVFPKDLPWANNYEGGNLLIAQVSKFDCGGIAISVCLSRKIGDGCSVINFL  182

Query  686   GHWVAATR--HPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLD  859
               W   TR  +    L+P FV DS+F T   GPL  P+I S +  +CVQ+R +F   KLD
Sbjct  183   NDWSGITRGHNTTTTLTPRFVGDSIFSTEKFGPLIAPLIESNV-SECVQQRLIFPTAKLD  241

Query  860   LLKDVVSEESGVKNPTRAEIVSALLYKCCVKAA-ASRRPSILVHYADMRPPLG--LPCNS  1030
               +  V+ ESGV+NPTRAE+VSALL+KC  KAA +S   S LVHY D+R  +   LP ++
Sbjct  242   AFRAKVAAESGVENPTRAEVVSALLFKCATKAALSSTTTSKLVHYLDVRTMMKPRLPRSA  301

Query  1031  AGNILSTFSTSPAAAGEMDLARLVAELRE-----GKERLQSRDNELVQEIVTSLRTGEKP  1195
              GNILS  ST+     ++++  LV  LR+       ++ Q   NELV EIV S+R G+  
Sbjct  302   IGNILSVLSTTATNEQDIEIPTLVRNLRKELFEVAYKKDQVEQNELVLEIVESIRKGKIA  361

Query  1196  YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVML  1375
             +++ +  +YFCS+L KYP Y  DFGWG P +VS+P GP KN+FF +D Q+G G EA VML
Sbjct  362   FDDENCSMYFCSNLCKYPYYNVDFGWGKPERVSIPNGPFKNVFFFMDYQNGQGLEARVML  421

Query  1376  KKTDMSGFERDEELLRF  1426
             KK  MS FERDEELL  
Sbjct  422   KKHHMSKFERDEELLEL  438



>ref|XP_009757903.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
sylvestris]
Length=442

 Score =   412 bits (1060),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 219/431 (51%), Positives = 298/431 (69%), Gaps = 26/431 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-----NNRTDPTRVSD  364
             +SI ++  IKPS+ TP +LRFHKLS +DQA+++MYIP+ FFYP      +N +  + ++D
Sbjct  13    VSIRDKSFIKPSTLTPSTLRFHKLSFVDQAVSNMYIPVAFFYPKPQREESNNSQLSHIAD  72

Query  365   ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-DAQNVA  541
             +LQ +LS+TL S+YPYAG L DNATV+CND GAEF  V++NC + +I+NHP A DA+++ 
Sbjct  73    LLQRSLSQTLVSYYPYAGILRDNATVECNDMGAEFLSVKINCPMSEILNHPHATDAESIV  132

Query  542   FPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK  718
             FP  LPW N ++GG L V QLS+FDCGGIA+SA + HK+GDG +V NF+  W   TR  +
Sbjct  133   FPKDLPWKNNYEGGNLLVAQLSKFDCGGIAISACLSHKIGDGSSVNNFLNDWANVTRDRR  192

Query  719   LNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVK  898
             L  SP FV DS+F +L +GPL  P I S +  +CVQKR +F   KLD L+  ++ ESGV+
Sbjct  193   LVPSPRFVGDSIFSSL-NGPLIAPQIMSNV-SECVQKRLIFPAAKLDALRSKIAVESGVE  250

Query  899   NPTRAEIVSALLYKCCVKAAASR-----RPSILVHYADMRPPLG--LPCNSAGNILSTFS  1057
             NPTRAE+VSALLYKC  KAAA+      +PS LVHY ++R  +   L  ++ GN++STFS
Sbjct  251   NPTRAEVVSALLYKCATKAAAASSSANIQPSKLVHYLNVRTMIKPRLRRSAIGNLVSTFS  310

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPDLD---  1216
             T  AA  +++L RLV  LR+  E    +D    NELV EIV S++ G+ P+E  D +   
Sbjct  311   T--AAMQDIELPRLVHNLRKEVEVAYKKDQVDENELVLEIVDSMKKGKLPFEEEDENSTA  368

Query  1217  -IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
              +YFCS++ ++P Y+ DFGWG P +V +  GP KN FFL D ++G G EA VML+K  MS
Sbjct  369   TMYFCSNVCQFPLYSVDFGWGKPERVCLANGPCKNYFFLKDYKTGRGVEARVMLQKQHMS  428

Query  1394  GFERDEELLRF  1426
              FE DEELL+F
Sbjct  429   AFECDEELLQF  439



>ref|XP_004232635.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=437

 Score =   412 bits (1058),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 213/431 (49%), Positives = 291/431 (68%), Gaps = 18/431 (4%)
 Frame = +2

Query  179   AIIASPPL-SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTR  355
             A+++SP L S+ ++  IKP S TPP+LR+HKLS +DQ  +++YIPL FFYP   + +   
Sbjct  4     ALLSSPSLVSVCDKTFIKPFSLTPPTLRYHKLSYIDQFYSNLYIPLAFFYPKVQQREENE  63

Query  356   VSDI---LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-  523
             +S I   LQ +LS+TL S+YPYAG+L DNAT+DCND GAEF  VR+NCT+ +I++HPDA 
Sbjct  64    LSHIAHLLQTSLSKTLVSYYPYAGKLRDNATIDCNDMGAEFLSVRINCTMSEILDHPDAS  123

Query  524   DAQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA  700
              A+++ FP  LPWAN ++GG L V Q+S+FDCGGIA+S  + HK+GDG ++ NF+  W  
Sbjct  124   QAESIVFPKALPWANNYEGGNLLVAQVSKFDCGGIAISLCLAHKIGDGTSMLNFVNDWSR  183

Query  701   ATRHP-KLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVV  877
              T  P    L+P FV DSVF +    P+  P + S +  +CVQKR +F   KLD L+  V
Sbjct  184   MTHSPMTTTLAPKFVGDSVFSSNNYSPIITPQMLSDV-SECVQKRIIFPTAKLDALRAKV  242

Query  878   SEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCNSAGN  1039
             + ESGV+NPTRAE+VSALL+KC +KAA+S     RPS  VH  ++R  L   LP ++ GN
Sbjct  243   AAESGVENPTRAEVVSALLFKCAIKAASSTTTSMRPSKFVHLLNVRSMLKSRLPQSTIGN  302

Query  1040  ILSTFSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENP  1207
             ILS+FST+     +++L  LV  LR+  E    +D    NE + E+V S+R G+KPY++ 
Sbjct  303   ILSSFSTTATKEEDIELPALVRSLRKEVEEAYKKDHVEQNEFMLEVVESMRKGKKPYDDE  362

Query  1208  DLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTD  1387
               ++Y CS+L ++P Y  DFG G P +VS+P GP KN FFL D + G G +A VML K  
Sbjct  363   YENVYSCSNLCRFPLYKVDFGLGKPERVSLPNGPFKNFFFLKDYKIGKGVDARVMLDKQH  422

Query  1388  MSGFERDEELL  1420
             MS FERDEELL
Sbjct  423   MSKFERDEELL  433



>gb|AAV66308.1| acyltransferase [Capsicum frutescens]
Length=440

 Score =   411 bits (1057),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 217/430 (50%), Positives = 287/430 (67%), Gaps = 22/430 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +SI ++  IKPSS TP +LRFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSICDKSFIKPSSLTPSTLRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             ++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + TR
Sbjct  130   SIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVTR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S + ++CVQKR +F  +KLD L+  V+
Sbjct  190   DHTTTTLVPSPRFVGDSVFSTKKYGSLITPQILSDL-NECVQKRLIFPTDKLDALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYEN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             +Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G EA VML K  MS 
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQGVEARVMLHKQQMSE  428

Query  1397  FERDEELLRF  1426
             FER+EELL F
Sbjct  429   FERNEELLEF  438



>ref|XP_004232633.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=438

 Score =   411 bits (1057),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 210/434 (48%), Positives = 291/434 (67%), Gaps = 19/434 (4%)
 Frame = +2

Query  179   AIIASPPL-SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-NNRTDPT  352
             A+++SP L S+ ++  IKPSS TPP+LR+HKLS +DQ  ++MYIPL FFYP    R + T
Sbjct  4     ALLSSPSLVSVCDKTFIKPSSLTPPTLRYHKLSYIDQFHSNMYIPLAFFYPKVQQREEST  63

Query  353   -----RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHP  517
                   +  +LQ +LS+TL S+YPYAG+L DNA VDCND GAEF  VR+NCT+ +I++HP
Sbjct  64    DNELSHIVHLLQTSLSKTLVSYYPYAGKLRDNAIVDCNDMGAEFLSVRINCTMSEILDHP  123

Query  518   DA-DAQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGH  691
             DA  A+++ FP  LPWAN ++GG L V Q+S+FDCGGIA+S  + HK+GDG +V NF+  
Sbjct  124   DASQAESIVFPKDLPWANNYEGGNLLVAQVSKFDCGGIAISVCLSHKIGDGTSVLNFVND  183

Query  692   WVAATRHP-KLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLK  868
             W   T  P    L+P FV DSVF      P+  P + S +  +CVQKR +F   KLD L+
Sbjct  184   WSRMTYSPMTTTLAPKFVGDSVFSANNYSPIIAPQMLSNV-SECVQKRIIFHKIKLDALR  242

Query  869   DVVSEESGVKNPTRAEIVSALLYKCCVKAAASRR----PSILVHYADMRPPLGLPCNSAG  1036
               V+ ESGV+NPTRAE+VSA+L++C +KAA+S      PS  VH+ ++R  +    ++ G
Sbjct  243   AKVAAESGVENPTRAEVVSAILFRCAIKAASSTTSSMVPSKFVHFLNVRSMMKCRPSAIG  302

Query  1037  NILSTFSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYEN  1204
             NILS FST+     +++L  LV  LR+G E+   +D    NEL+ E+V S+R G+KP++ 
Sbjct  303   NILSIFSTTATKEEDIELPTLVHNLRKGVEKSYKKDQVEQNELILEVVESMRKGKKPFDE  362

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
                ++Y CS++ ++P Y  DFGWG P +V +P GP KN+FFL D + G G +A VML+K 
Sbjct  363   EYENVYSCSNVCRFPFYNVDFGWGKPERVGLPNGPFKNLFFLKDLKIGQGVDARVMLQKQ  422

Query  1385  DMSGFERDEELLRF  1426
              MS FERDEELL  
Sbjct  423   HMSEFERDEELLEL  436



>ref|XP_004232634.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=440

 Score =   411 bits (1057),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 209/422 (50%), Positives = 284/422 (67%), Gaps = 20/422 (5%)
 Frame = +2

Query  212   ERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-NNRTDPT-----RVSDILQ  373
             ++  IKPSS TPP+L++HKLS +DQ  ++MYIPL FFYP    R + T     +++ +LQ
Sbjct  16    DKTFIKPSSLTPPTLKYHKLSYIDQFYSNMYIPLAFFYPKVQQREESTDNELSQIAHLLQ  75

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-DAQNVAFPA  550
              +LS+TL  +YPYAG+L DNAT+DCND GAEF  VR+NCT+ +I+NHPDA  A+++ FP 
Sbjct  76    TSLSKTLVFYYPYAGKLRDNATIDCNDMGAEFLSVRINCTMFEILNHPDASQAESIVFPK  135

Query  551   GLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP-KLN  724
              LPWAN ++GG L V Q+S+FDCGGIA+S  + HK+GDG +  NF+  W   T  P    
Sbjct  136   DLPWANNYEGGNLLVAQVSKFDCGGIAISVCLAHKIGDGTSALNFVNDWSRMTLSPMTTT  195

Query  725   LSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNP  904
             LSP FV DS+F +    P+  P + S + + CVQKR +F   KLD L+  V+ ESGV+NP
Sbjct  196   LSPKFVGDSIFSSNKYSPIITPQMLSDVSE-CVQKRIIFPTTKLDALRAKVAAESGVENP  254

Query  905   TRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCNSAGNILSTFSTSP  1066
             TRAE+VSALL+KC +KA +S     RPS  VH  ++R  L   LP ++ GNILS+F+T+ 
Sbjct  255   TRAEVVSALLFKCAIKATSSTTTSMRPSKFVHLLNVRSMLKSRLPQSTIGNILSSFTTTA  314

Query  1067  AAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
                 +++L  LV  LR+G E    +D    NE++ E+V S+R G+KPY++   ++Y C +
Sbjct  315   TKEEDIELPTLVRSLRKGVEEAHKKDHVEQNEMMLEVVESMRKGKKPYDDDYENVYSCCN  374

Query  1235  LGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
             L K+P Y  DFGWG P +VS+P GP KN FFL D + G G +A VML K  MS FERDEE
Sbjct  375   LCKFPLYKVDFGWGKPERVSLPNGPFKNFFFLNDYKIGEGVDARVMLDKQHMSEFERDEE  434

Query  1415  LL  1420
             LL
Sbjct  435   LL  436



>gb|AAV66309.1| acyltransferase [Capsicum chinense]
 gb|ADN97116.1| acyltransferase [Capsicum frutescens]
Length=440

 Score =   410 bits (1053),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/430 (50%), Positives = 286/430 (67%), Gaps = 22/430 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +S+ ++  IKPSS TP  LRFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSVCDKSFIKPSSLTPSKLRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             ++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + TR
Sbjct  130   SIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVTR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S + ++CVQKR +F  +KLD L+  V+
Sbjct  190   DHTTTALVPSPRFVGDSVFSTKKYGSLITPQILSDL-NECVQKRLIFPTDKLDALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYEN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             +Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G EA VML K  MS 
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQGVEARVMLHKQQMSE  428

Query  1397  FERDEELLRF  1426
             FER+EELL F
Sbjct  429   FERNEELLEF  438



>gb|AAV66311.1| acyltransferase [Capsicum annuum]
Length=440

 Score =   409 bits (1051),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 215/430 (50%), Positives = 285/430 (66%), Gaps = 22/430 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +S+  +  IKPSS TP +LRFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSVCNKSFIKPSSLTPSTLRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             ++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + TR
Sbjct  130   SIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVTR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S + + CVQKR +F  +KLD L+  V+
Sbjct  190   DHTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDL-NQCVQKRLIFPTDKLDALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYKN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             +Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G EA VML K  MS 
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQGVEARVMLHKQQMSE  428

Query  1397  FERDEELLRF  1426
             FER+EEL+ F
Sbjct  429   FERNEELVEF  438



>gb|AAV66310.1| acyltransferase [Capsicum annuum]
Length=440

 Score =   408 bits (1049),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 216/433 (50%), Positives = 285/433 (66%), Gaps = 22/433 (5%)
 Frame = +2

Query  191   SPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTD  346
             S  +S+  +  IKPSS TP +LRFHKLS +DQ+L++MYIP  FFYP        + N  +
Sbjct  7     SSLVSVCNKSFIKPSSLTPSTLRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDE  66

Query  347   PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
              + ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A 
Sbjct  67    LSHIAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHAS  126

Query  527   -AQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA  700
              A+++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W +
Sbjct  127   LAESIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSS  186

Query  701   ATR-HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKD  871
              TR H    L  SP FV DSVF T   G L  P I S + + CVQKR +F  +KLD L+ 
Sbjct  187   VTRDHTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDL-NQCVQKRLIFPTDKLDALRA  245

Query  872   VVSEESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNIL  1045
              V+EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ 
Sbjct  246   KVAEESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLS  305

Query  1046  STFSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD-  1210
             S FS       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D 
Sbjct  306   SIFSIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDG  365

Query  1211  -LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTD  1387
               ++Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G EA VML K  
Sbjct  366   YKNVYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQGVEARVMLHKQQ  425

Query  1388  MSGFERDEELLRF  1426
             MS FER+EEL  F
Sbjct  426   MSEFERNEELFEF  438



>gb|ADB28437.1| acyltransferase [Capsicum annuum]
Length=440

 Score =   408 bits (1049),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 216/433 (50%), Positives = 285/433 (66%), Gaps = 22/433 (5%)
 Frame = +2

Query  191   SPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTD  346
             S  +S+  +  IKPSS TP +LRFHKLS +DQ+L++MYIP  FFYP        + N  +
Sbjct  7     SSLVSVCNKSFIKPSSLTPSTLRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDE  66

Query  347   PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
              + ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A 
Sbjct  67    LSHIAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHAS  126

Query  527   -AQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA  700
              A+++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W +
Sbjct  127   LAESIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSS  186

Query  701   ATRH---PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKD  871
              TR      L  SP FV DSVF T   G L  P I S + + CVQKR +F  +KLD L+ 
Sbjct  187   VTRDRTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDL-NQCVQKRLIFPTDKLDALRA  245

Query  872   VVSEESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNIL  1045
              V+EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ 
Sbjct  246   KVAEESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLS  305

Query  1046  STFSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD-  1210
             S FS       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D 
Sbjct  306   SIFSIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDG  365

Query  1211  -LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTD  1387
               ++Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G EA VML K  
Sbjct  366   YKNVYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQGVEARVMLHKQQ  425

Query  1388  MSGFERDEELLRF  1426
             MS FER+EELL F
Sbjct  426   MSEFERNEELLEF  438



>ref|XP_009604796.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=446

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 218/433 (50%), Positives = 294/433 (68%), Gaps = 27/433 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-----NNRTDPTRVSD  364
             +SI ++  +KPS  TPP +R+HKLS +DQ+L++MYIP  FFYP      +N +  + ++D
Sbjct  11    VSICDKSFVKPSCLTPPMVRYHKLSFVDQSLSNMYIPFAFFYPKQQKEESNNSQLSHLAD  70

Query  365   ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-DAQNVA  541
             +LQ +LS+TL S+YPYAG L DNATV+CND GAEF  V++NC + +I+NHP A DA+++ 
Sbjct  71    LLQRSLSQTLVSYYPYAGILRDNATVECNDMGAEFLSVKINCPMSEILNHPHATDAESIV  130

Query  542   FPAGLPWANIHDG-GLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK  718
             FP  LPW N ++G  L V QLS+FDCGGIA+SA + HK+GDG +V NF+ HW   TR  +
Sbjct  131   FPKDLPWKNNYEGDNLLVVQLSKFDCGGIAISACLSHKIGDGCSVINFLNHWANVTRDRR  190

Query  719   LNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
               + SP FV DS+FP+  +GPL  P   S +  +CVQKR +F   KLD L+  ++ ESG 
Sbjct  191   FVVPSPRFVGDSIFPS-QNGPLIAPQTMSNV-SECVQKRLIFPTAKLDALRAKIAIESGA  248

Query  896   KNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCNSAGNILSTFS  1057
             +NPTRAE+VSALLYK   KAAAS     +PS LVH+ ++R  +   LP ++ GN+LS FS
Sbjct  249   ENPTRAEVVSALLYKSATKAAASSSANIQPSKLVHHLNVRTMIKPRLPRSAIGNLLSMFS  308

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPDLD---  1216
             T  AA  +++L RLV  LR+  E    +D    NELV EIV S++ G+ P+E  D +   
Sbjct  309   T--AATQDIELPRLVHNLRKEVEVAYKKDQVDENELVLEIVDSMKKGKLPFEEKDENCTT  366

Query  1217  --IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
               +YFCS+L K+P Y+ DFGWG P +V +  GP KN FFL D Q+G G EA VML+K  M
Sbjct  367   TTMYFCSNLCKFPFYSVDFGWGKPERVCLGTGPFKNFFFLKDYQTGRGVEARVMLQKQHM  426

Query  1391  SGFERDEELLRFA  1429
             S FE DEELL+FA
Sbjct  427   SAFECDEELLQFA  439



>ref|XP_009603396.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=448

 Score =   391 bits (1004),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 300/441 (68%), Gaps = 28/441 (6%)
 Frame = +2

Query  179   AIIASPPL-SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-----NNR  340
              +++SP L SI ++  IKPS+ TP +LR HKLS +DQ++++MYIP+ FFYP      +N 
Sbjct  5     GLLSSPSLVSICDKSFIKPSTLTPSTLRLHKLSFVDQSVSNMYIPVAFFYPKPQREESNN  64

Query  341   TDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPD  520
             +  + ++D+LQ +LS+TL S+YPYAG L DNATV+CND GAEF  V++NC + +I+NHP 
Sbjct  65    SHLSHIADLLQTSLSQTLVSYYPYAGILRDNATVECNDMGAEFLSVKINCPMSEILNHPH  124

Query  521   A-DAQNVAFPAGLPWANIHDG-GLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHW  694
             A DA+++ FP  LPW N ++G  L V QLS+FDCGGIA+SA + HK+GDG +V NF+ HW
Sbjct  125   ATDAESIVFPKDLPWKNNYEGDNLLVVQLSKFDCGGIAISACLSHKIGDGCSVINFLNHW  184

Query  695   VAATRHPKLNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKD  871
                TR  +  + SP FV DS+  +L +GPL  P I S +  +CVQKR +F   KLD L+ 
Sbjct  185   ANVTRDRRFVVPSPRFVGDSILSSL-NGPLVAPQIMSNV-GECVQKRLIFPAAKLDALRA  242

Query  872   VVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCNSA  1033
              ++ ESGV+NPTRAE+VSALLYK   KAAA+     +PS LVHY ++R  +   L  ++ 
Sbjct  243   KIAVESGVENPTRAEVVSALLYKSATKAAAASSANIQPSKLVHYLNVRTMIKPRLRRSAI  302

Query  1034  GNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYE  1201
             GN++STFST  AA  +++L RL+  LR+  E    +D    NELV EI+ S++ G+ P+E
Sbjct  303   GNLVSTFST--AAMQDIELPRLIHNLRKEVEVAYKKDQVDENELVLEIIDSMKKGKLPFE  360

Query  1202  NPDLD-----IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEAL  1366
               D +     +YFCS++ K+P Y+ DFG G P +V +  GP KN FFL D ++G G EA 
Sbjct  361   EKDENSTTTTMYFCSNVCKFPLYSVDFGLGKPERVCLANGPSKNYFFLKDYKTGRGVEAR  420

Query  1367  VMLKKTDMSGFERDEELLRFA  1429
             VML+K  MS FE DEELL+FA
Sbjct  421   VMLQKQHMSAFECDEELLQFA  441



>ref|XP_004233767.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=431

 Score =   383 bits (984),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 200/430 (47%), Positives = 279/430 (65%), Gaps = 17/430 (4%)
 Frame = +2

Query  176   MAIIASPPLS-ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT  352
             MAI  S  +S ++E++++KPS PTP  L++HKLS +DQ+L+ +YIPLVFFY    +    
Sbjct  1     MAIAPSQLVSPVTEKIIVKPSLPTPSPLKYHKLSFIDQSLSHLYIPLVFFYSKQQQEFDQ  60

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
              V++ LQN+L+ TL+++YPYAGR+ D+AT++CND G EF  VR++C + +++N+P   A+
Sbjct  61    LVANKLQNSLATTLSAYYPYAGRMRDSATIECNDRGIEFLNVRISCPMSEMMNNPHDYAE  120

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
                F   LPW N  DG L V QLS FDCGGIA+S  + HKVGDGG+V +F+  W   TR+
Sbjct  121   GNIFTKDLPWKNSFDGSLLVAQLSHFDCGGIAISTCLSHKVGDGGSVASFIYDWAKITRN  180

Query  713   PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
             P     P F+SD+ FPT P+GPL  P+I SK+ D CV K+F FS  KL  L+  ++ E+G
Sbjct  181   PNQIARPKFISDTFFPT-PNGPLIAPLIDSKL-DKCVHKKFHFSASKLQGLRAKIAAEAG  238

Query  893   VKNPTRAEIVSALLYKCCVKAAA-----SRRPSILVHYADMRPPLGLPC--NSAGNILST  1051
             +KNPTRAE+VSALL+    KAA+     S RPS L++Y D+RP    P   N  GN+L+ 
Sbjct  239   IKNPTRAEVVSALLFISATKAASKINNTSFRPSKLINYVDIRPMTTPPLSRNVIGNLLTV  298

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPDLDI  1219
              ST+ +   EM+L RLV E R+  E++  +D    N LV ++   L   E PY   + D 
Sbjct  299   TSTTASHDEEMELPRLVREFRKEFEQVYKKDPVQHNSLVLKL---LEIMESPYAIDEFDT  355

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             Y+CS++ K+  Y+ DFGWG P +V  P GP KN F L  +Q+  G EA+V L++  M  F
Sbjct  356   YYCSNMCKFSGYSIDFGWGKPERVCAPMGPFKNFFILSADQNMDGVEAMVTLEEQHMLAF  415

Query  1400  ERDEELLRFA  1429
             E DEELL FA
Sbjct  416   ECDEELLEFA  425



>ref|XP_006363183.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=441

 Score =   383 bits (984),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 210/446 (47%), Positives = 287/446 (64%), Gaps = 38/446 (9%)
 Frame = +2

Query  176   MAIIASPPL-SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP-------N  331
              A+++SP L SI ++  IKPSS TP + RFHKLSL+DQ+ +++YIP+ FFYP       +
Sbjct  3     FALLSSPSLVSICDKSFIKPSSLTPSTNRFHKLSLVDQSFSNLYIPIAFFYPKVEEREES  62

Query  332   NNRTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIIN  511
             NN  + + ++ +LQ +LS+TL S+YPYAG+  DNAT+DCND GAEF   R+ C + +I++
Sbjct  63    NNSHELSHIAHLLQTSLSQTLVSYYPYAGKSKDNATIDCNDMGAEFLSARIKCHMSEILD  122

Query  512   HPDADAQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMG  688
             +P+A++  + FP  LPW N ++GG L V Q+S+FDCGGIAVS  + HK+GDG +V NF  
Sbjct  123   YPNAES--IVFPKDLPWTNNYEGGNLLVVQVSKFDCGGIAVSVCLSHKIGDGCSVLNFFN  180

Query  689   HWVAATRHPK----LNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKL  856
              W + TR       +N SP FV DS+F     GPL      S + ++CVQKR VF   KL
Sbjct  181   DWASLTRDRATTTLINPSPRFVGDSIFSAQNYGPLVDQRFVSDL-NECVQKRLVFPTAKL  239

Query  857   DLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--L  1018
             + L+  V+ ESGV+NPTRAE+VSALL+KC  KAA+S     R S LV++ D+R  +   L
Sbjct  240   NALRAKVAVESGVENPTRAEVVSALLFKCATKAASSTTTLMRTSKLVNFFDVRTMMKPRL  299

Query  1019  PCNSAGNILSTFSTSPAAAG---EMDLARLVAELREGKE----RLQSRDNELVQEIVTSL  1177
             P  + GN+LS FSTS        EM L +LV  LR+G E    + Q + NEL+      +
Sbjct  300   PRRAIGNVLSLFSTSAIDTNNEQEMKLPKLVHSLRKGVEVAYKKEQVQQNELI------M  353

Query  1178  RTGEKPYENPD---LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSG  1348
             + G+   EN D    ++Y CS+L +YP Y  DFGWG P +VS+  GP KN FFL+D ++G
Sbjct  354   KKGKMLLENKDENCSNVYLCSNLCRYPFYNVDFGWGKPERVSLANGPFKNSFFLMDYKTG  413

Query  1349  GGFEALVMLKKTDMSGFERDEELLRF  1426
              G EA VML K  MS FERD+ELL F
Sbjct  414   QGVEARVMLHKQHMSAFERDKELLEF  439



>dbj|BAD99417.1| acyl-transferase [Capsicum annuum]
Length=405

 Score =   382 bits (980),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 201/404 (50%), Positives = 266/404 (66%), Gaps = 22/404 (5%)
 Frame = +2

Query  278   LDQALTSMYIPLVFFYP--------NNNRTDPTRVSDILQNALSRTLTSFYPYAGRLLDN  433
             LDQ+L++MYIP  FFYP        + N  + +R++ +LQ +LS+TL S+YPYAG+L DN
Sbjct  1     LDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSRIAHLLQTSLSQTLVSYYPYAGKLKDN  60

Query  434   ATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQNVAFPAGLPWANIHDGG-LAVFQLSE  607
             ATVDCND GAEF  VR+ C++ +I++HP A  A+++A P  LPWAN  +GG L V Q+S+
Sbjct  61    ATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAESIALPKDLPWANNCEGGNLLVVQVSK  120

Query  608   FDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL---SPNFVSDSVFPTLPSGP  778
             FDCG IA+S    HK+GDG ++ NF+  W + TR P       SP FV DSVF T   G 
Sbjct  121   FDCGRIAISVCFSHKIGDGCSLLNFLNDWSSVTRDPTTTTLVPSPRFVGDSVFSTQKYGS  180

Query  779   LDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAA  958
             L  P I S + + CVQKR +F  +KLD L+  V+EESGVKNPTRAE+VSALL+KC  KA+
Sbjct  181   LITPQILSDL-NQCVQKRLIFPTDKLDALRAKVAEESGVKNPTRAEVVSALLFKCATKAS  239

Query  959   ASRRPSILVHYADMRPPLG--LPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERL  1132
             +S  PS LVH+ ++R  +   LP N+ GN+ S FS       +M+L  LV  LR+  E  
Sbjct  240   SSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIFSIEATNMQDMELPTLVRNLRKEVEVA  299

Query  1133  QSRD----NELVQEIVTSLRTGEKPYENPD--LDIYFCSSLGKYPAYTADFGWGWPCKVS  1294
               +D    NEL+ E+V S+R G+ P+EN D   ++Y CS+L KYP YT DFGWG P +V 
Sbjct  300   YKKDQVEQNELILEVVESMREGKLPFENMDGYKNVYTCSNLCKYPYYTVDFGWGRPERVC  359

Query  1295  MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRF  1426
             +  GP KN FFL D ++G G EA VML K  MS FER+EEL+ F
Sbjct  360   LGNGPSKNAFFLKDYKAGQGVEARVMLHKQQMSEFERNEELVEF  403



>gb|ACO48262.1| acyltransferase [Capsicum chacoense]
Length=415

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 201/406 (50%), Positives = 271/406 (67%), Gaps = 22/406 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +S+ ++  IKPSS TP +LRFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSVCDKSFIKPSSLTPSTLRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+NC++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRINCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             +V  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + TR
Sbjct  130   SVVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSITR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S + ++CVQKR +F  +KL+ L+  V+
Sbjct  190   DHTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDL-NECVQKRLIFPTDKLNALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYEN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGG  1354
             +Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQG  414



>gb|ACO48255.1| acyltransferase [Solanum pennellii]
Length=415

 Score =   380 bits (977),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 201/406 (50%), Positives = 269/406 (66%), Gaps = 22/406 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +SI ++  IKPSS TP +LRFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSICDKSFIKPSSLTPSTLRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             ++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + TR
Sbjct  130   SIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVTR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S + + CVQKR +F  +KLD L+  V+
Sbjct  190   DHTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDL-NQCVQKRLIFPTDKLDALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYEN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGG  1354
             +Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQG  414



>gb|ACO48253.1| acyltransferase [Solanum lycopersicum]
Length=415

 Score =   380 bits (975),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 200/406 (49%), Positives = 269/406 (66%), Gaps = 22/406 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +S+ ++  IKPSS TP +LRFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSVCDKSFIKPSSLTPSTLRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             ++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + TR
Sbjct  130   SIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVTR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S + + CVQKR +F  +KLD L+  V+
Sbjct  190   DHTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDL-NQCVQKRLIFPTDKLDALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYEN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGG  1354
             +Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQG  414



>gb|ACZ28491.1| BAHD acyltransferase [Capsicum chacoense]
Length=415

 Score =   380 bits (975),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 201/406 (50%), Positives = 270/406 (67%), Gaps = 22/406 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +S+ ++  IKPSS TP +LRFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSVCDKSFIKPSSLTPSTLRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+NC++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRINCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             +V  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + TR
Sbjct  130   SVVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVTR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S I ++CVQKR +F  +KL+ L+  V+
Sbjct  190   DHTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDI-NECVQKRLIFPTDKLNALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYEN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGG  1354
             +Y CS+L KYP YT DFGWG P +V +  GP KN  FL D ++G G
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNASFLKDYKAGQG  414



>ref|XP_006363207.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=430

 Score =   380 bits (975),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 200/430 (47%), Positives = 279/430 (65%), Gaps = 18/430 (4%)
 Frame = +2

Query  176   MAIIASPPLS-ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT  352
             MAI  S  +S ++E++++KPS PTP  L++HKLS +DQ+L+ +YIPLVFFY +  + +  
Sbjct  1     MAIAPSQLVSPVTEKIIVKPSLPTPSPLKYHKLSFIDQSLSHLYIPLVFFY-SKQQQEFD  59

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
             +V++ LQN+L+ TL+++YPYAGR+ D+AT++CND G EF  VR+NC + +++N+P   A+
Sbjct  60    QVANKLQNSLATTLSAYYPYAGRMRDSATIECNDRGIEFLNVRINCPMSEMLNNPHDYAE  119

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
                F   LPW N  DG L V QLS FDCGGIA+S  + HKVGDGG+V +F+  W   TR+
Sbjct  120   GNIFMKDLPWKNSFDGSLLVAQLSHFDCGGIAISTCLSHKVGDGGSVASFIYDWAKITRN  179

Query  713   PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
             P     P F+ D+ FPT P+GPL  P+I SK+E  CV K+F FS  KL  L+  ++ E+G
Sbjct  180   PNQIARPQFIGDTFFPT-PNGPLIAPLIDSKLE-KCVHKKFHFSASKLQGLRAKIAAEAG  237

Query  893   VKNPTRAEIVSALLYKCCVKAAA-----SRRPSILVHYADMRPPLGLPC--NSAGNILST  1051
             +KNPTRAE+ SALL+    KAA+     S RPS L++Y D+RP    P   N  GN+L+ 
Sbjct  238   IKNPTRAEVTSALLFISATKAASKMNNTSFRPSKLINYVDIRPMTTPPLSRNIIGNLLTV  297

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPDLDI  1219
              ST+ +   EM L RLV E R+  E++  +D    N LV ++   L   E PY   + D 
Sbjct  298   TSTTASHDEEMKLPRLVREFRKEFEQVYKKDPVQHNSLVLKL---LEIMESPYAIDEFDT  354

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             Y+CS++ K+  Y+ DFGWG P +V  P GP KN F L  +QS  G EA+V L++  M  F
Sbjct  355   YYCSNMCKFSGYSIDFGWGKPERVCAPMGPFKNFFILSADQSMDGVEAMVTLEEQHMLAF  414

Query  1400  ERDEELLRFA  1429
             E DEELL FA
Sbjct  415   ECDEELLEFA  424



>gb|ACO48258.1| acyltransferase [Lycianthes dejecta]
 gb|ACO48259.1| acyltransferase [Capsicum annuum]
 gb|ACO48260.1| acyltransferase [Capsicum frutescens]
 gb|ACO48261.1| acyltransferase [Capsicum frutescens]
Length=415

 Score =   378 bits (970),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/406 (49%), Positives = 269/406 (66%), Gaps = 22/406 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +S+ ++  IKPSS TP + RFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSVCDKSFIKPSSLTPSTHRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             ++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + TR
Sbjct  130   SIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVTR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S + ++CVQKR +F  +KLD L+  V+
Sbjct  190   DHTTTTLVPSPRFVGDSVFSTKKYGSLITPQILSDL-NECVQKRLIFPTDKLDALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYEN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGG  1354
             +Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQG  414



>gb|ACO48254.1| acyltransferase [Datura stramonium]
Length=415

 Score =   377 bits (969),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 199/406 (49%), Positives = 268/406 (66%), Gaps = 22/406 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +S+ ++  IKPSS TP + RFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSVCDKSFIKPSSLTPSTHRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             ++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + TR
Sbjct  130   SIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVTR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S + + CVQKR +F  +KLD L+  V+
Sbjct  190   DHTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDL-NQCVQKRLIFPTDKLDALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYEN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGG  1354
             +Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQG  414



>gb|ACO48256.1| acyltransferase [Petunia axillaris subsp. parodii]
Length=415

 Score =   375 bits (964),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 199/406 (49%), Positives = 267/406 (66%), Gaps = 22/406 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP--------NNNRTDPTR  355
             +S+ ++  IKPSS TP + RFHKLS +DQ+L++MYIP  FFYP        + N  + + 
Sbjct  10    VSVCDKSFIKPSSLTPSTHRFHKLSFIDQSLSNMYIPCAFFYPKVQQRLEDSKNSDELSH  69

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-AQ  532
             ++ +LQ +LS+TL S+YPYAG+L DNATVDCND GAEF  VR+ C++ +I++HP A  A+
Sbjct  70    IAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAE  129

Query  533   NVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             ++  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF   W + TR
Sbjct  130   SIVLPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFPNDWSSVTR  189

Query  710   -HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
              H    L  SP FV DSVF T   G L  P I S + + CVQKR +F  +KLD L+  V+
Sbjct  190   DHTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDL-NQCVQKRLIFPTDKLDALRAKVA  248

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
             EESGVKNPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S F
Sbjct  249   EESGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF  308

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--LD  1216
             S       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   +
Sbjct  309   SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYXN  368

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGG  1354
             +Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G
Sbjct  369   VYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQG  414



>gb|ACO48257.1| acyltransferase [Solanum melongena]
Length=416

 Score =   373 bits (957),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/407 (49%), Positives = 265/407 (65%), Gaps = 23/407 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN---------NNRTDPT  352
             +S+ ++  IKPSS TP +LRFHKLS +DQ+L++MYIP  FFYP          N+  + +
Sbjct  10    VSVCDKSFIKPSSLTPSALRFHKLSFIDQSLSNMYIPCAFFYPKVQQILEDSKNSHDELS  69

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD-A  529
              V+ +LQ +LS+TL S+YPYAG+L DNATVDCND G EF   R+ C++ +I++HP A  A
Sbjct  70    HVAHLLQTSLSQTLVSYYPYAGKLKDNATVDCNDMGPEFLSARIKCSMSEILDHPHASLA  129

Query  530   QNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAAT  706
             + +  P  LPWAN  +GG L V Q+S+FDCGGIA+S    HK+GDG ++ NF+  W + T
Sbjct  130   EGIVXPKDLPWANNXEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVT  189

Query  707   R-HPKLNL--SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVV  877
             R H    L  SP FV DSVF T   G L  P I S + + CVQKR +F  +KLD L+  V
Sbjct  190   RDHTTTTLVPSPRFVGDSVFSTQKYGSLITPQILSDL-NQCVQKRLIFPTDKLDALRAKV  248

Query  878   SEESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILST  1051
             +EESGV NPTRAE+VSALL+KC  KA++S  PS LVH+ ++R  +   LP N+ GN+ S 
Sbjct  249   AEESGVXNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSI  308

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPD--L  1213
             FS       +M+L  LV  LR+  E    +D    NEL+ E+V S+R G+ P+EN D   
Sbjct  309   FSIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVESMREGKLPFENMDGYE  368

Query  1214  DIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGG  1354
             ++Y CS+L KYP YT DFGWG P +V +  GP KN FFL D ++G G
Sbjct  369   NVYTCSNLCKYPYYTVDFGWGRPERVCLGNGPSKNAFFLKDYKAGQG  415



>ref|XP_006363208.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=416

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 197/439 (45%), Positives = 279/439 (64%), Gaps = 55/439 (13%)
 Frame = +2

Query  179   AIIASPPL-SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP---------  328
             A+++SP L S+ ++ LIKPSS T P+LR+HKLS +DQ  ++MYIPL  FYP         
Sbjct  4     ALLSSPSLASVCDKTLIKPSSLTSPTLRYHKLSYIDQFHSNMYIPLALFYPKVQQREEST  63

Query  329   NNNRTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDII  508
             N +  + + ++ +LQ +LS+TL S+YPYAG+L DNA VDCND GAEF  VR+NC + +I+
Sbjct  64    NYSHNELSHIAHLLQTSLSKTLVSYYPYAGKLRDNAIVDCNDMGAEFSSVRINCHMSEIL  123

Query  509   NHPDAD-AQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNF  682
             +HP+A  A+++ FP  LPWAN + GG L V Q+S+FDCGGIA+S                
Sbjct  124   DHPNASHAESIVFPKDLPWANNYVGGNLLVAQVSKFDCGGIAIST---------------  168

Query  683   MGHWVAATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDL  862
                           L+P F+ DSVF +    P+  P + S +  +CVQKR +F   KLD 
Sbjct  169   --------------LAPKFIGDSVFSSNNYSPIIAPQMLSNV-SECVQKRIIFPTTKLDA  213

Query  863   LKDVVSEESGVKNPTRAEIVSALLYKCCVKAAA-------SRRPSILVHYADMRPPLG--  1015
             L+  V+ ESGV+NPTRAE+VSALL+KC +KA +       +RRPS  VH+ ++R  +   
Sbjct  214   LRSKVAAESGVENPTRAEVVSALLFKCAIKATSSTTTSMLTRRPSKFVHFLNVRNMMKSR  273

Query  1016  LPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKE----RLQSRDNELVQEIVTSLRT  1183
             LP ++ GN+LS FS +     +++L  LV  LR+G E    + Q  +NEL+ E+V S+R 
Sbjct  274   LPQSAIGNLLSVFSITATNEQDIELPTLVRNLRKGVEVAYKKDQVEENELILEVVESMRK  333

Query  1184  GEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEA  1363
             G+KP+++   ++Y CS++ +YP Y  DFGWG P +V +P GP KN+FFL D + G G +A
Sbjct  334   GKKPFDDDYENVYSCSNVCRYPFYNVDFGWGKPERVGLPNGPFKNLFFLKDYKIGRGVDA  393

Query  1364  LVMLKKTDMSGFERDEELL  1420
              VML+K  MS FERDEELL
Sbjct  394   RVMLQKQHMSEFERDEELL  412



>ref|XP_006351056.1| PREDICTED: deacetylvindoline O-acetyltransferase-like isoform 
X1 [Solanum tuberosum]
Length=434

 Score =   360 bits (924),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 189/425 (44%), Positives = 263/425 (62%), Gaps = 19/425 (4%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNR----TDPTRVSDI  367
             LS + + LIKP SPTP + + HK SL++QA T  Y+P  FFY NN        P ++S +
Sbjct  7     LSRASKKLIKPLSPTPLTQKLHKFSLIEQAQTHTYVPFGFFYSNNQLGALCNQPAQISKL  66

Query  368   LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP  547
             L+N+LS+ L S+YPYAG + DNA +DCND G EF  V ++  +  ++N  D + +++ FP
Sbjct  67    LENSLSKNLVSYYPYAGHMKDNAEIDCNDKGVEFLNVHIDAPMSQVLNDQDCNVKDLIFP  126

Query  548   AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL  727
              G+ W N  D GLAV QL+ FDCGGIAVS  + HK+GD      F   W   TR     +
Sbjct  127   HGVAWENDSDYGLAVIQLTHFDCGGIAVSTCLSHKIGDACNGLQFSIDWATLTRDSNAKI  186

Query  728   S-PNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNP  904
             + P ++SD++FP+ PSGPLD P++PS I D C QKR++FS  K+  L+  V+ ES VKNP
Sbjct  187   TPPYYISDTIFPSPPSGPLDSPVVPS-ILDGCTQKRYIFSSSKVSELRSSVASESHVKNP  245

Query  905   TRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLG--LPCNSAGNILSTFSTSP  1066
             T  E++SALL+KC  KA    + S  PS L+ YAD+R  +   LP NS GN+LS FST  
Sbjct  246   TPTEVLSALLFKCVAKAVTANSGSFVPSKLIQYADLRGMISPKLPPNSIGNVLSHFSTHI  305

Query  1067  AAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGE----KPYENPDLDIYFCSS  1234
             +   +M+L ++V+ +RE K+  ++RDN  ++E   +L   +     P +  + D Y CSS
Sbjct  306   SNETDMNLPQIVSLMREEKQLFRTRDN--IKENAWALEILQLAKGLPPKKKEFDEYTCSS  363

Query  1235  LGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
             + K+P Y  DFGWG P   ++  GP K +F L+ N    G EA VML + DMS FERDEE
Sbjct  364   VCKFPFYDVDFGWGKPMAATIATGPYKKLFNLM-NYKDDGIEAFVMLDEQDMSVFERDEE  422

Query  1415  LLRFA  1429
              L FA
Sbjct  423   FLEFA  427



>ref|XP_009588779.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=402

 Score =   357 bits (916),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 263/389 (68%), Gaps = 27/389 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-----NNRTDPTRVSD  364
             +SI ++  +KPS  TP +LR HKLS +DQ+L++MYIP+ FFYP      +N +  +R++D
Sbjct  11    VSICDKSFVKPSCLTPSTLRLHKLSFVDQSLSNMYIPVAFFYPKPQREESNNSQLSRIAD  70

Query  365   ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-DAQNVA  541
             +LQ +LS+TL S+YPYAG L DNATV+CND GAEF  V++NC + +I+NHP A DA+++ 
Sbjct  71    LLQTSLSQTLVSYYPYAGILRDNATVECNDMGAEFLSVKINCPMSEILNHPHATDAESIV  130

Query  542   FPAGLPWANIHDG-GLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK  718
             FP  LPW N ++G  L V QLS+FDCGGIA+SA + HK+GDG +V NF+ HW   TR  +
Sbjct  131   FPKDLPWKNNYEGDNLLVVQLSKFDCGGIAISACLSHKIGDGCSVINFLNHWANVTRDRR  190

Query  719   LNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
               + SP FV DS+F +L +GPL  P I S +  +CVQKR +F   KLD L+  ++ ESGV
Sbjct  191   FVVPSPRFVGDSIFSSL-NGPLIAPQIMSNV-SECVQKRLIFPTAKLDALRAKIAVESGV  248

Query  896   KNPTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMRPPLG--LPCNSAGNILSTFS  1057
             +N TRAE+VSAL+YK   KAAAS     +PS LVHY ++R  +   LP  + GN+LS FS
Sbjct  249   ENLTRAEVVSALIYKSATKAAASCSANIQPSKLVHYLNVRTMIKPRLPRRAIGNLLSVFS  308

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPDLD---  1216
             T  AA  +++L RLV  LR+  E    +D    NELV EIV S++ G+ P+E  D +   
Sbjct  309   T--AATQDIELPRLVHNLRKEVEVAYKKDQVDENELVLEIVDSMKKGKLPFEEKDENCTT  366

Query  1217  --IYFCSSLGKYPAYTADFGWGWPCKVSM  1297
               +YFCS+L K+P Y  DFGWG P +V +
Sbjct  367   TTMYFCSNLCKFPFYNVDFGWGKPERVYL  395



>ref|XP_004244824.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=436

 Score =   357 bits (915),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 190/433 (44%), Positives = 266/433 (61%), Gaps = 22/433 (5%)
 Frame = +2

Query  185   IASPPLSISERL---LIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN----RT  343
             +ASP L I  R    LIKPSSPTP + ++HK SL++QA T  Y+P  FFY NN       
Sbjct  1     MASPALKILSRASKKLIKPSSPTPLTQKWHKFSLIEQAQTHTYVPFGFFYSNNQLGALSN  60

Query  344   DPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA  523
              P++ S +L+N+LS+ L S+YPYAG + DNA +DCND G EF  V ++  +  ++N  D 
Sbjct  61    QPSQTSKLLENSLSKNLVSYYPYAGHMKDNAVIDCNDKGVEFLNVHIDAPMSQVLNDKDC  120

Query  524   DAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAA  703
               +++ FP G+ W N  + GLAV QL+ FDCGGIAVS  + HK+GD      F+  W   
Sbjct  121   HVKDLIFPHGVAWENDSEYGLAVIQLTHFDCGGIAVSTCLSHKIGDACNGLQFLIDWAKL  180

Query  704   TRHPKLNLS-PNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
             TR P   ++ P ++SD++FP+ P+GPLD P++PS I D C QKR+VFS  K+  L+  ++
Sbjct  181   TRDPNAKITPPYYISDTIFPSPPTGPLDSPVVPS-ILDGCTQKRYVFSSSKVSELRSSIA  239

Query  881   EESGVKNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLG--LPCNSAGNI  1042
               S VK+PT  E++SALL+KC  KA    + S  PS L+ YAD+R  +   LP NS GN+
Sbjct  240   SVSQVKDPTPTEVLSALLFKCVAKAVTANSGSFVPSKLIQYADLRGMISPKLPPNSIGNV  299

Query  1043  LSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGE----KPYENPD  1210
             LS FST  +   +M+L ++V+ +RE K   ++RDN  ++E   +L   E     P +  +
Sbjct  300   LSHFSTHISNEADMNLPQIVSLMREEKLLFRTRDN--IKENAWALEILELAKGLPPKKKE  357

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
              D Y CSS+ K+P Y  DFGWG P   ++  GP   +F L+ N    G EA V+L + DM
Sbjct  358   FDEYTCSSVCKFPFYDVDFGWGKPMAATIATGPYNKLFNLM-NYKDDGVEAFVVLDEQDM  416

Query  1391  SGFERDEELLRFA  1429
             S FERDEE L FA
Sbjct  417   SVFERDEEFLEFA  429



>ref|XP_004240174.1| PREDICTED: deacetylvindoline O-acetyltransferase-like isoform 
X1 [Solanum lycopersicum]
Length=434

 Score =   349 bits (895),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 184/430 (43%), Positives = 268/430 (62%), Gaps = 14/430 (3%)
 Frame = +2

Query  176   MAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNR-TDPT  352
             M  +A P +SI    LIKPSSPT P+ R+HKLSL+DQA ++ YIP   FY  +N  ++ +
Sbjct  1     MESVAHPLVSIISEKLIKPSSPTCPTKRWHKLSLIDQAFSNSYIPFSLFYTKDNAISNTS  60

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
             ++S +L+ +LS+ L+++YPYAGRL DN TVDCNDAGAEF +V+++C + + +N  +   +
Sbjct  61    QISQLLEESLSKILSTYYPYAGRLKDNTTVDCNDAGAEFIQVQIDCLISETLNWHNTAIE  120

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
             ++ FP GLPW+N    GL V QL+ F+CGGIA+S  + HK+GDG +  N    W   T H
Sbjct  121   DLLFPQGLPWSNCASRGLVVVQLTYFNCGGIAISMCISHKIGDGCSGYNLFRDWSHITSH  180

Query  713   PKLNLSP--NFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEE  886
             P     P  ++V  SVFP   SGP   P+  S  + DCVQ+R++FS +KL  LK+ V+ E
Sbjct  181   PNNFSIPSLHYVEQSVFPPPSSGPFLSPLFMSN-KHDCVQRRYIFSNQKLLNLKNTVASE  239

Query  887   SGVKNPTRAEIVSALLYKCCVKAAASRR----PSILVHYADMRPPLGLPCNSAGNILSTF  1054
             S V+NPTR E+VSAL++KC V+AA +      PS +V   D+R  +GLP N+ GN+L+  
Sbjct  240   SEVQNPTRTEVVSALIFKCAVRAAKANSGIFLPSSMVQAVDLRAQVGLPPNAIGNLLTIC  299

Query  1055  STSPAAAGE--MDLARLVAELREGKERLQSRDN---ELVQEIVTSLRTGEKPYENPDLDI  1219
              TS     E  M +++LV+E+R+ KE +  RDN    +   ++  L   ++ Y +   + 
Sbjct  300   PTSIITNNEESMTISKLVSEMRKSKELVYKRDNVNDNMFVALLLELAKSKREYHDNGPNA  359

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             Y  +SL K+  +  DFGWG P KVS+  G    +  L+ NQ+ GG +A V L + DMS  
Sbjct  360   YQITSLVKFALHEIDFGWGKPTKVSIANGLNNKLAILMGNQT-GGIDAFVTLTEQDMSVL  418

Query  1400  ERDEELLRFA  1429
             + D ELL FA
Sbjct  419   QYDTELLEFA  428



>ref|XP_006344158.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=430

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/428 (44%), Positives = 265/428 (62%), Gaps = 14/428 (3%)
 Frame = +2

Query  176   MAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTR  355
             M  IA P +SI    LIKPSSPT P+ R+HKLSL+DQA ++ YIP   FY  +  +    
Sbjct  1     MESIAHPLVSIISEKLIKPSSPTCPTKRWHKLSLIDQAFSNSYIPFSLFYTKDAISKNN-  59

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQN  535
              + +L+ +LS+ L+ +YPYAGRL DN TVDCNDAGAEF +VR++C + + +N  +   ++
Sbjct  60    -TQLLEESLSKILSIYYPYAGRLKDNTTVDCNDAGAEFVQVRIDCLISETLNWHNTAIED  118

Query  536   VAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP  715
             + FP GLPW+N   GGL V QL+ F+CGGIA+S  + HK+GDG +  N    W   T  P
Sbjct  119   LLFPQGLPWSNCTTGGLVVVQLTYFNCGGIAISMCISHKIGDGCSGYNLFRDWSEITSDP  178

Query  716   KLNLSP--NFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEES  889
                  P  ++V  SVFP   SGP   P+  S  + DCVQ+R++FS EKL  LK+ V+ ES
Sbjct  179   NNFSIPSLHYVEQSVFPPPSSGPFLSPLFMSN-KHDCVQRRYIFSNEKLLNLKNTVAAES  237

Query  890   GVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPCNSAGNILSTFS  1057
              V+NPTR E+VSAL++KC V+AA ++    +PS +V   D+R  +GLP N+ GN+L+   
Sbjct  238   EVQNPTRTEVVSALIFKCAVRAAKAKSGIFQPSSIVQAVDLRALVGLPPNAIGNLLTICP  297

Query  1058  TSPAAAGE-MDLARLVAELREGKERLQSRDN---ELVQEIVTSLRTGEKPYENPDLDIYF  1225
             TS     E M +++LV E+R+ KE +  RDN    +   ++  L   ++ Y +   + Y 
Sbjct  298   TSITNNEESMTISKLVTEMRKSKELVYKRDNINDNMFVALLLKLAKSKQEYHDNGPNAYQ  357

Query  1226  CSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
              +SL K+  +  DFGWG P KVS+  G    +  L+ NQS GG +A V L + DMS FER
Sbjct  358   ITSLVKFALHEIDFGWGKPTKVSIANGLNNKLAILMGNQS-GGLDAFVTLTEHDMSVFER  416

Query  1406  DEELLRFA  1429
             D ELL FA
Sbjct  417   DTELLEFA  424



>ref|XP_006362683.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=440

 Score =   347 bits (891),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 192/436 (44%), Positives = 271/436 (62%), Gaps = 20/436 (5%)
 Frame = +2

Query  176   MAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRT-DPT  352
             M  IA P +SI    LIKPSSPT P+ R+HKLSL+DQA ++ YIP   FY  +  + + T
Sbjct  1     MESIAHPLVSIISEKLIKPSSPTCPTKRWHKLSLIDQAFSNSYIPFSLFYTKDAISKNNT  60

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
             ++S +L+ +LS+ L+ +YPYAGRL DN TVDCNDAGAEF +VR++C + + +N  +   +
Sbjct  61    QISQLLEESLSKILSIYYPYAGRLKDNTTVDCNDAGAEFVQVRIDCLISETLNWHNTAIE  120

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
             ++ FP GLPW+N   GGL V QL+ F+CGGIA+S  + HK+GDG +  N    W   T  
Sbjct  121   DLLFPQGLPWSNCTTGGLVVVQLTYFNCGGIAISMCISHKIGDGCSGYNLFRDWSEITSD  180

Query  713   PKLNLSP--NFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEK-LDL------L  865
             P     P  ++V  SVFP   SGP   P+  S  + DCVQ+R++FS EK L+L      L
Sbjct  181   PNNFSIPSLHYVEQSVFPPPSSGPFLSPLFMSN-KHDCVQRRYIFSNEKLLNLLEKILNL  239

Query  866   KDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPCNSA  1033
             K+ V+ ES V+NPTR E+VSAL++KC V+AA ++    +PS +V   D+R  +GLP N+ 
Sbjct  240   KNTVAAESEVQNPTRTEVVSALIFKCAVRAAKAKSGIFQPSSIVQAVDLRALVGLPPNAI  299

Query  1034  GNILSTFSTSPAAAGE-MDLARLVAELREGKERLQSRDN---ELVQEIVTSLRTGEKPYE  1201
             GN+L+   TS     E M +++LV E+R+ KE +  RDN    +   ++  L   ++ Y 
Sbjct  300   GNLLTICPTSITNNEESMTISKLVTEMRKSKELVYKRDNINDNMFVALLLELAKSKQEYH  359

Query  1202  NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKK  1381
             +   + Y  +SL K+  +  DFGWG P KVS+  G    +  L+ NQS GG +A V L +
Sbjct  360   DNGPNEYQITSLVKFALHEIDFGWGKPTKVSIANGLNNKLAILMGNQS-GGLDAFVTLTE  418

Query  1382  TDMSGFERDEELLRFA  1429
              DMS FERD ELL FA
Sbjct  419   HDMSVFERDTELLEFA  434



>dbj|BAD93694.1| acyltransferase-like protein [Nicotiana tabacum]
Length=453

 Score =   346 bits (888),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 185/426 (43%), Positives = 262/426 (62%), Gaps = 14/426 (3%)
 Frame = +2

Query  185   IASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN------RTD  346
             I+ P +SI    LIKPSSPTP + R+H+LSL+DQA ++ YIP   FY            +
Sbjct  25    ISLPLVSIISEKLIKPSSPTPHTKRWHRLSLIDQAFSNSYIPFSLFYTKQQLDAISKNNN  84

Query  347   PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
             PT++S +L+ +LS+ L+++YPYAGRL DN  VDCND GAEF   +++C +   +N  ++ 
Sbjct  85    PTQISHLLEESLSKILSTYYPYAGRLKDNNVVDCNDTGAEFVEAQISCPISQTLNWHNSA  144

Query  527   AQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAAT  706
              +++ FP GLPW+N  D GL   QLS F+CGGIA+S  + HK+GDG +  N    W   T
Sbjct  145   TEDLLFPQGLPWSNSADRGLVAVQLSYFNCGGIAISMCISHKIGDGCSGYNLFRDWSEIT  204

Query  707   RHPKLNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSE  883
             R P  +  S ++V  SVFP   SGP   P+  S  + DCVQ+R++FS EKL  LK+ V+ 
Sbjct  205   RDPNFSKPSLHYVEQSVFPPPSSGPFLSPLFMSN-KHDCVQRRYIFSNEKLLHLKNRVAA  263

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPCNSAGNILST  1051
             ES V+NPTR E+VSAL++K  V AA +     +PS +V   D+R  +GLP N+ GN+L+ 
Sbjct  264   ESEVQNPTRTEVVSALIFKRAVAAAKANSGFFQPSSMVQAVDLRAQIGLPPNAIGNLLTI  323

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYENPDLDIYFCS  1231
               TS      M +++LV+E+R+ KE   +RDN  V  ++  L   ++ Y +   + Y  +
Sbjct  324   CPTSITNEQSMTISKLVSEMRKSKELAYNRDNIFV-ALLLELANSKQEYHDNGPNAYQIT  382

Query  1232  SLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             SL K+  +  DFGWG P KVS+  G    +  L+ NQS GG +A V L + DMS FERD 
Sbjct  383   SLVKFALHEIDFGWGKPTKVSIANGLNNKLAILMGNQS-GGLDAFVTLSEQDMSVFERDP  441

Query  1412  ELLRFA  1429
             ELL FA
Sbjct  442   ELLEFA  447



>ref|XP_009631587.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=453

 Score =   345 bits (886),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 184/426 (43%), Positives = 262/426 (62%), Gaps = 14/426 (3%)
 Frame = +2

Query  185   IASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN------RTD  346
             I+ P +SI    LIKPSSPTP + R+H+LSL+DQA ++ YIP   FY            +
Sbjct  25    ISLPLVSIISEKLIKPSSPTPHTKRWHRLSLIDQAFSNSYIPFSLFYTKQQLDAISKNNN  84

Query  347   PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
             PT++S +L+ +LS+ L+++YPYAGRL DN  VDCND GAEF   +++C +   +N  ++ 
Sbjct  85    PTQISHLLEESLSKILSTYYPYAGRLKDNNVVDCNDTGAEFVEAQISCPISQTLNWHNSA  144

Query  527   AQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAAT  706
              +++ FP GLPW+N  D GL   QLS F+CGGIA+S  + HK+GDG +  N    W   T
Sbjct  145   TEDLLFPQGLPWSNSADRGLVAVQLSYFNCGGIAISMCISHKIGDGCSGYNLFRDWSEIT  204

Query  707   RHPKLNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSE  883
             R P  +  S ++V  S+FP   SGP   P+  S  + DCVQ+R++FS EKL  LK+ V+ 
Sbjct  205   RDPNFSKPSLHYVEQSIFPPPSSGPFLSPLFMSN-KHDCVQRRYIFSNEKLLHLKNRVAA  263

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPCNSAGNILST  1051
             ES V+NPTR E+VSAL++K  V AA +     +PS +V   D+R  +GLP N+ GN+L+ 
Sbjct  264   ESEVQNPTRTEVVSALIFKRAVAAAKANSGFFQPSSMVQAVDLRAQIGLPPNAIGNLLTI  323

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYENPDLDIYFCS  1231
               TS      M +++LV+E+R+ KE   +RDN  V  ++  L   ++ Y +   + Y  +
Sbjct  324   CPTSITNEQSMTISKLVSEMRKSKELAYNRDNIFV-ALLLELANSKQEYHDNGPNAYQIT  382

Query  1232  SLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             SL K+  +  DFGWG P KVS+  G    +  L+ NQS GG +A V L + DMS FERD 
Sbjct  383   SLVKFALHEIDFGWGKPTKVSIANGLNNKLAILMGNQS-GGLDAFVTLSEQDMSVFERDP  441

Query  1412  ELLRFA  1429
             ELL FA
Sbjct  442   ELLEFA  447



>ref|XP_006345867.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   342 bits (876),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 186/431 (43%), Positives = 257/431 (60%), Gaps = 29/431 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP----NNNRTDPTRVSDI  367
             +S+  + +IKPS  TP  LR HKLS LDQ    M IP  FFYP    + +  +P+ +S +
Sbjct  7     VSLISKKIIKPSIQTPLPLRSHKLSFLDQVF-DMSIPFAFFYPKKGGDKSSDEPSHMSQL  65

Query  368   LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP  547
             L+++LS+ L+ +YPYAG++ D+  VDCND G E   VRV+C + +I+ HP  DA+NVAFP
Sbjct  66    LESSLSKALSYYYPYAGKIKDDCIVDCNDVGVEVSNVRVHCPMSEILKHPYTDAENVAFP  125

Query  548   AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL  727
               LPW +   G LAV Q+S FDCGGIAV   + HK+GD  T+ NF  +W   +R   +  
Sbjct  126   QRLPWNHPDQGNLAVAQVSYFDCGGIAVGGCLSHKIGDACTISNFFYNWGILSRDKSVMP  185

Query  728   SPNFVSDSVFPTLPSGPLDKPMIPSKIEDD----CVQKRFVFSGEKLDLLKDVVSEESGV  895
             SP FV +S++P       + P + S I+ +     + KRFVF   K++ LK   S +SGV
Sbjct  186   SPQFVGESIYPQ-----SNDPYVVSTIKPEEPTKYLGKRFVFPAAKVNALKAKFSFDSGV  240

Query  896   KNPTRAEIVSALLYKCCVKAA----ASRRPSILVHYADMR----PPLGLPCNSAGNILST  1051
             +NPTR E+VS L+YKC + A      S + S L   + MR    PPL    + +GNI+S 
Sbjct  241   QNPTRTEVVSTLIYKCALAARTRNFGSFKQSSLFQVSYMRERHNPPLSQ--DVSGNIVSG  298

Query  1052  FSTSPAAAGEMDLARLVAELREGKERL-----QSRDNELVQEIVTSLRTGEKPYENPDLD  1216
             FS       +++  RLV+ELR  KE+L     ++ +N  + E+V S+  G  P+ N   D
Sbjct  299   FSVETTNERDVNCPRLVSELRNEKEKLDQDKAKAIENAFISEVVDSIEKGRSPFNNDMFD  358

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
              YFC SL  +P Y  DFGWG P +VS+  GP    F L+DNQSGGG EA++ML + DM  
Sbjct  359   YYFCLSLNAFPLYKTDFGWGKPTRVSLATGPFNRWFHLMDNQSGGGIEAIIMLGELDMFV  418

Query  1397  FERDEELLRFA  1429
             FE D ELL FA
Sbjct  419   FETDPELLEFA  429



>ref|XP_009769095.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=456

 Score =   342 bits (877),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 183/438 (42%), Positives = 263/438 (60%), Gaps = 16/438 (4%)
 Frame = +2

Query  158   HTQETKMAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN  337
             +  ++    I+ P +SI    LIKPSSPTP + R+HKLSL+DQA ++ YIP   FY    
Sbjct  15    NVNKSSATTISLPLVSIISEKLIKPSSPTPHTKRWHKLSLIDQAFSNSYIPFSLFYTKQQ  74

Query  338   ------RTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLL  499
                     +PT++S +L+ +LS+ L+++YPYAGRL DN  VDCND GAEF   +++C + 
Sbjct  75    LDAISKNNNPTQISHLLEESLSKILSTYYPYAGRLKDNTLVDCNDTGAEFIEAQISCPIS  134

Query  500   DIINHPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRN  679
               +N  ++  +N+ FP GLPW+N  D GL V QLS F CGGIA+S  + HK+GDG +  N
Sbjct  135   QTLNWHNSAVENLLFPQGLPWSNSADRGLVVVQLSYFGCGGIAISMCISHKIGDGCSGYN  194

Query  680   FMGHWVAATRHPKLNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKL  856
                 W   TR P  +  S ++V  S+FP   SGP   P+  S    DCVQ+R++FS EKL
Sbjct  195   LFRDWSEITRDPNFSKPSLHYVEQSIFPPPSSGPFLSPLFMSNTH-DCVQRRYIFSNEKL  253

Query  857   DLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPC  1024
               LK+ V+ ES V+NPTR E+VSAL++K  V AA +     +PS +V   D+R  +GLP 
Sbjct  254   LNLKNKVAAESEVQNPTRTEVVSALIFKRAVAAANANSGFFQPSSMVQAVDLRTQIGLPP  313

Query  1025  NSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDN---ELVQEIVTSLRTGEKP  1195
             N+ GN+L+   TS      M +++LV+E+R+ KE   +RDN    +   ++  L   ++ 
Sbjct  314   NAIGNLLTICPTSITNEQSMTISKLVSEMRKSKELAYNRDNINDNIFVALLLELANSKQE  373

Query  1196  YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVML  1375
             Y +   + Y  +SL K+  +  DFGWG P KV++  G    +  L+ NQS GG +A V L
Sbjct  374   YHDNGPNAYQITSLVKFALHEIDFGWGKPTKVNIANGLNNKLAILMGNQS-GGLDAFVTL  432

Query  1376  KKTDMSGFERDEELLRFA  1429
              + DM  F+RD ELL FA
Sbjct  433   NERDMFVFQRDPELLEFA  450



>ref|XP_009765990.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
sylvestris]
Length=437

 Score =   341 bits (874),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 185/434 (43%), Positives = 266/434 (61%), Gaps = 22/434 (5%)
 Frame = +2

Query  185   IASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN------RTD  346
             +AS  LS   +  IKP SPTP + R HKL L  QA    +IPLVFFYP            
Sbjct  3     VASRLLSTVSKKTIKPFSPTPSTQRLHKLCLPGQAFPPNHIPLVFFYPKQQVDTIFPNGH  62

Query  347   PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
               R+S  L+ +LS+TLT +YP+AGRL DNATV+CND GAE+F V++N ++ ++++H D+ 
Sbjct  63    KQRLSKFLEISLSKTLTCYYPWAGRLKDNATVECNDVGAEYFEVQINSSMDEVLHHSDSR  122

Query  527   AQN-VAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAA  703
              ++ V FP G PW    D  LA+ QLS F+CGGIA+S  + HKVGD  +   F+  W + 
Sbjct  123   IKDLVTFPQGAPWGKCMDRALAIAQLSHFECGGIAISVCLSHKVGDACSCYCFLRDWASL  182

Query  704   TRHP--KLNLSPNFVSDSVFPT-LPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDV  874
             TR P  K+  SP FV DSV P+ LP GPL  P+  SK + +C++K F FS  K+  LK  
Sbjct  183   TRDPNTKIASSPYFVEDSVIPSPLPDGPLASPV--SKKKQECIEKTFDFSALKISPLKAF  240

Query  875   VSEESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILS  1048
             V  ESGV+NPTR E+V+AL+YKC   AA+  +   LV Y ++RP +   LP  S GN+L+
Sbjct  241   VEAESGVQNPTRNEVVNALVYKCAANAASIHQSHQLVQYTNIRPSVSPPLPPTSIGNLLT  300

Query  1049  TFST---SPAAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENP  1207
              FST   + +  G+ +L+++V ++R  K++L SRD    NE   EIV + +TG+  ++  
Sbjct  301   VFSTPIYNSSREGDFNLSKIVTDIRNSKQKLLSRDNIKENEWAWEIVNAYKTGKGTFQQR  360

Query  1208  DLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTD  1387
             + D+Y  +SL ++P +  DFGWG P +  +  G + + FF + +   GG +  V L +  
Sbjct  361   NCDVYVSTSLCQFPFHDLDFGWGKPSRARL-GGHLISKFFSLMSTHDGGIQVSVHLNEQQ  419

Query  1388  MSGFERDEELLRFA  1429
             MS FE D+ LL+FA
Sbjct  420   MSVFENDQHLLQFA  433



>dbj|BAD93693.1| acyltransferase-like protein [Nicotiana tabacum]
Length=457

 Score =   339 bits (870),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 181/429 (42%), Positives = 261/429 (61%), Gaps = 16/429 (4%)
 Frame = +2

Query  185   IASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN------RTD  346
             I+ P +SI    LIKPSSPTP + R+H+LSL+DQA ++ YIP   FY            +
Sbjct  25    ISLPLVSIISEKLIKPSSPTPHTKRWHRLSLIDQAFSNSYIPFSLFYTKQQLDAISKNNN  84

Query  347   PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
             PT++S +L+ +LS+ LT++YPYAGRL DN  VDCND GAEF   +++C +   +N  ++ 
Sbjct  85    PTQISHLLEESLSKILTTYYPYAGRLKDNNVVDCNDTGAEFVEAQISCPISQTLNWHNSA  144

Query  527   AQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAAT  706
              +++ FP GLPW+N  D GL   QLS F+CGGIA+S  + HK+GDG +  N    W   T
Sbjct  145   TEDLLFPQGLPWSNSADRGLVAVQLSYFNCGGIAISMCISHKIGDGCSGYNLFRDWSEIT  204

Query  707   RHPKLNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSE  883
             R P  +  S ++V  S+FP   SGP   P+  S  + DCVQ+R++FS EKL  LK+ V+ 
Sbjct  205   RDPNFSKPSLHYVEQSIFPPPSSGPFLSPLFMSS-KHDCVQRRYIFSNEKLLHLKNRVAA  263

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPCNSAGNILST  1051
             ES V+NPTR E+VSAL++K  V AA +     +PS +V   D+R  +GLP N+ GN+L+ 
Sbjct  264   ESEVQNPTRTEVVSALIFKRAVAAAKANSGFFQPSSMVQAVDLRTQIGLPPNAIGNLLTI  323

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSRDN---ELVQEIVTSLRTGEKPYENPDLDIY  1222
               TS      M +++LV+E+R+ KE   +RDN    +   ++  L   ++ Y +   + Y
Sbjct  324   CPTSITNEQSMTISKLVSEMRKSKELAYNRDNINDNIFVALLLELANSKQEYHDNGPNAY  383

Query  1223  FCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFE  1402
               +SL K+  +  DFGWG P KV++  G    +  L+ NQS GG +A V L + DM  F+
Sbjct  384   QITSLVKFALHEIDFGWGKPTKVNIANGLNNKLAILMGNQS-GGLDAFVTLNERDMFVFQ  442

Query  1403  RDEELLRFA  1429
             RD ELL FA
Sbjct  443   RDPELLEFA  451



>ref|XP_009770804.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
sylvestris]
Length=430

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 187/428 (44%), Positives = 256/428 (60%), Gaps = 17/428 (4%)
 Frame = +2

Query  185   IASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN----RTDPT  352
             +  P  +I  + LIKPSSPTP + ++HKLSLLDQA +++YIP  FFY           PT
Sbjct  1     MKKPSSTILSKKLIKPSSPTPSTQKWHKLSLLDQAFSNIYIPFAFFYTKKQLDSVSIHPT  60

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
             ++S +L+N+LSR L S+YPYAGRL DN  VDCND GA+F RV++N  +   +   +   +
Sbjct  61    QISHLLENSLSRLLVSYYPYAGRLKDNTVVDCNDVGADFLRVQINIPISQALEKHNNVIE  120

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
              + FP  LPW+N  + GL V QLS F CGGIA+S    HKVGDG +  NF   W   TR 
Sbjct  121   EMVFPQDLPWSNCTNRGLVVAQLSYFTCGGIAISLCTSHKVGDGHSSYNFFHDWAKLTRE  180

Query  713   ---PKLNLSPNFVSDSVFPTLPSG-PLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
                PK  L   +V +S+FP   +G P   P+  S  +DDC+Q++F+FS +KL+ LK +V+
Sbjct  181   ANGPKPVL--QYVQESIFPPPITGTPFLSPVCTSN-KDDCIQRKFIFSLQKLNKLKTLVA  237

Query  881   EESGVKNPTRAEIVSALLYKCCVKA--AASRRPSILVHYADMRPPLGLPCNSAGNILSTF  1054
               S V+ PTR E+VSAL++KC V A    S  P I+    D+R  + LP NS GNIL++ 
Sbjct  238   STSNVQTPTRNEVVSALIFKCIVAAVNGKSFEPWIMSQSFDLRHQIDLPPNSIGNILTST  297

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRDN---ELVQEIVTSLRTGEKPYENPDLDIYF  1225
               S A+   M LA +V E+R+ K+R+  RDN    L  +    L T EK Y     ++  
Sbjct  298   YISIASEKYMTLANIVTEMRKEKQRVSDRDNVEDNLFLKKFLELATEEKSYSKVQNNMCN  357

Query  1226  CSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
              SSL K+P +  DFGWG P K+++  G    + FL+ N S GG +A V L    MS FE+
Sbjct  358   FSSLVKFPVHEIDFGWGKPAKMNIANGLHNKVIFLVGNLS-GGVDAFVSLSAKVMSAFEK  416

Query  1406  DEELLRFA  1429
             D+ELL FA
Sbjct  417   DKELLEFA  424



>ref|XP_009790683.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
sylvestris]
Length=437

 Score =   331 bits (849),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 180/427 (42%), Positives = 259/427 (61%), Gaps = 20/427 (5%)
 Frame = +2

Query  203   SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN----RTDPTRVSDIL  370
             +I  + ++KP SPTP + R+HKLSLLDQ + + Y+ LV FYP +     + +P ++S +L
Sbjct  6     TIISKKIVKPLSPTPSTQRWHKLSLLDQGIGNFYMGLVLFYPKHQVDTFQIEPKQLSTLL  65

Query  371   QNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPA  550
             +N+LS+ LT +YP+AG L DNAT+DC+D GA+F  V VNC +  ++ H D+  +N+AFP 
Sbjct  66    ENSLSKALTYYYPWAGSLRDNATIDCDDTGAKFLDVEVNCPMDKVLYHQDSSIKNIAFPQ  125

Query  551   GLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL  727
             G+P  N  DG  L V QLS F+CGGIA+S  + HKVGD  +   F+  W A TR P   L
Sbjct  126   GVPLRNAADGACLIVSQLSHFECGGIAISVCLSHKVGDARSALFFVRDWAALTRDPNAEL  185

Query  728   S--PNFVSDSVFPTLPSGPLDKPMIPSKIEDDC-VQKRFVFSGEKLDLLKDVVSEESGVK  898
                P FV DS+ P+   GPL  P+I SK E+   ++KRF FS  K+  LKD+V+ ESGV+
Sbjct  186   VCPPYFVQDSLIPSPSDGPLAFPVIVSKPEERIELEKRFYFSASKIRALKDLVAAESGVE  245

Query  899   NPTRAEIVSALLYKCCVKA--AASRRPSILVHYADMRPPL--GLPCNSAGNILSTFSTSP  1066
             NPT  E+VSAL+YK    A   +S   S L+  +D+R  +   +   S GNIL+ FST P
Sbjct  246   NPTTTEVVSALVYKSAAIANLGSSHEQSRLILLSDIRKEISHSVSSTSIGNILTIFST-P  304

Query  1067  AAAGEMDL--ARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYENPDLDIYFC  1228
                 + DL  ++LVA++R+ K  L +RD    N+    ++ + +TG+  Y   + D+Y C
Sbjct  305   IYNNKEDLKVSKLVADIRKSKHELSNRDNFKENDWASAMLHAYKTGDGTYRQINCDVYRC  364

Query  1229  SSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERD  1408
             SS    P    DFGWG P + +MP  P   MF+++      G E ++ L +  MS FE D
Sbjct  365   SSASNIPFKDLDFGWGKPIRATMPSSPFSKMFYMMSTHD-KGIEVIINLNEQQMSAFEND  423

Query  1409  EELLRFA  1429
             ++LL FA
Sbjct  424   KDLLEFA  430



>ref|XP_009630197.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=437

 Score =   330 bits (845),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 261/435 (60%), Gaps = 22/435 (5%)
 Frame = +2

Query  176   MAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN----RT  343
             MA++++    I  + ++KP SPTP + R+HKLSLLDQ + + Y+ LV FYP +     + 
Sbjct  1     MAVLST----IISKKIVKPLSPTPSTQRWHKLSLLDQGIGNFYMGLVLFYPKHQVDIFQN  56

Query  344   DPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA  523
              P ++  +L+N+LS+ +T +YP+AG L DNAT+ C+D GAEF  V+VNC +  ++ H D+
Sbjct  57    GPKQLCILLENSLSKAITYYYPWAGSLRDNATIACDDTGAEFLEVQVNCPMDKVLYHQDS  116

Query  524   DAQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA  700
               +N+ FP G+P  N  DG  L V QLS F+CGGIA+S  + HKVGD  +   F+  W A
Sbjct  117   SIKNITFPQGVPLRNAADGACLIVSQLSHFECGGIAISVCLSHKVGDARSALFFVRDWAA  176

Query  701   ATRHPKLNLS--PNFVSDSVFPTLPSGPLDKPMIPSKIEDDC-VQKRFVFSGEKLDLLKD  871
              TR P   L   P FV DS+ P+   GPL  P+I SK E+   ++KRF FS  K+  LKD
Sbjct  177   LTREPNAELVCPPYFVQDSLIPSPSDGPLTFPIIVSKPEERIELEKRFYFSASKIRALKD  236

Query  872   VVSEESGVKNPTRAEIVSALLYKCCVKA--AASRRPSILVHYADMRPPL--GLPCNSAGN  1039
             +VS ESGV+NPT  E+VSAL+YK    A   +S   S L+  +D+R  +    P  S GN
Sbjct  237   LVSAESGVENPTTTEVVSALVYKSAAIANLGSSHEQSRLILLSDIRKEISHSAPPTSIGN  296

Query  1040  ILSTFSTSP-AAAGEMDLARLVAELREGKERLQSRD----NELVQEIVTSLRTGEKPYEN  1204
             IL+ FST      G++ +++LVA++R+ K  L +RD    NE    ++ + +TG+  Y  
Sbjct  297   ILTIFSTPIYNNKGDLRVSKLVADIRKSKHELSNRDNFKENEWASAMLHAYKTGDGTYRQ  356

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
              + D+Y CSS    P    DFGWG P + +MP  P   MF+++      G E ++ L + 
Sbjct  357   SNCDVYRCSSASNIPFQDLDFGWGKPIRATMPSSPFGKMFYMMSTHD-RGIEVIINLNEQ  415

Query  1385  DMSGFERDEELLRFA  1429
              MS FE D++LL FA
Sbjct  416   QMSAFENDKDLLEFA  430



>ref|XP_009612347.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=527

 Score =   331 bits (849),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 177/429 (41%), Positives = 266/429 (62%), Gaps = 26/429 (6%)
 Frame = +2

Query  188   ASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN------RTDP  349
             AS  +S+S+++ IKP SPTP S R +KLS +DQ  ++ Y PLVFFYP N         +P
Sbjct  3     ASALVSLSKKI-IKPFSPTPFSERIYKLSFIDQFNSTQYCPLVFFYPKNKGNVVTPSIEP  61

Query  350   TRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADA  529
             + +  +++N+LS+TL ++YP+AG L DN  V+CND GA+FF+ R +C + +I+  PD + 
Sbjct  62    SDMCKVIENSLSKTLAAYYPFAGTLRDNVHVECNDIGADFFKARFDCPMSEIVKSPDRNV  121

Query  530   QNVAFPAGLPWANI-HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAAT  706
             + + +P G+PW  +  +  L   Q ++FDCGGIA+S  + HK+GD  T+  F+  W A  
Sbjct  122   KEMVYPKGIPWNIVTSNRKLVTVQFNQFDCGGIALSTCVSHKIGDMCTMSKFLQDWAAIA  181

Query  707   RHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEE  886
             R P L L P F+  S+FP   + P+++P I       CV +RFVFS      LK ++SE 
Sbjct  182   RDPNLKLCPQFIGSSIFPPT-NEPVNEPPI-----QKCVTRRFVFSNHT---LKSLLSEP  232

Query  887   SGVKNPTRAEIVSALLYKCCVKA-AASRRPSILVHYADMRPPLGLPCNSAGNILSTFSTS  1063
             S VKNPTR E+++ALLYKC +KA ++S +PSIL    ++R  + LP N+AGN  S+F   
Sbjct  233   SQVKNPTRVELLTALLYKCGMKANSSSLKPSILFQTVNLRSFIPLPDNTAGNFSSSFFVP  292

Query  1064  PAAAGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYF  1225
               +  EM L+RLV++LR+ KE+L           +L+   +   +   K +++ D D+Y 
Sbjct  293   TYSEEEMKLSRLVSQLRKEKEQLVGNYKNCKGGEDLISTTMRPFQEIRKLFKDMDFDMYR  352

Query  1226  CSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVML-KKTDMSGFE  1402
             CSSL  YP Y  DFGWG P K+S+ +G  +N+F L DN++G   EA V L +++ MS F 
Sbjct  353   CSSLANYPLYDVDFGWGKPNKISIAEGVFRNVFLLYDNKTGDEVEASVCLDEESTMSAFL  412

Query  1403  RD-EELLRF  1426
             R+ E+ L+F
Sbjct  413   REMEQFLQF  421



>ref|XP_009616124.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=433

 Score =   325 bits (834),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 182/430 (42%), Positives = 254/430 (59%), Gaps = 24/430 (6%)
 Frame = +2

Query  194   PPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN----RTDPTRVS  361
             P  +I    LIKPSSPTP + R+HKLSLLDQA +++YIP  FFY          +PT++S
Sbjct  4     PSSTILSEKLIKPSSPTPSTQRWHKLSLLDQAFSNIYIPFAFFYTKKQLDSVSINPTQIS  63

Query  362   DILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA  541
              +L+N+LS+ L S+YPYAGRL DN  VDCND GA+F RV +N  +   +   +   + + 
Sbjct  64    HLLENSLSKLLVSYYPYAGRLKDNTIVDCNDVGADFLRVEINIPISQALQKHNNVIEEMV  123

Query  542   FPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKL  721
             FP  LPW+N  + GL V QLS F+CGGIA+S  + HKVGDG +  N    W   TR P  
Sbjct  124   FPRDLPWSNCTNRGLVVAQLSYFNCGGIAISLCISHKVGDGHSSYNLFHDWAKITREPN-  182

Query  722   NLSP----NFVSDSVFPTLPSG-PLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEE  886
                P     +V +S+FP   +G P   P+  S  ++DC+Q++F+F  +KL+ LK +++  
Sbjct  183   --GPKPVLQYVQESIFPPPITGTPFLSPVCTSN-KEDCIQRKFIFPIQKLNKLKALIAAT  239

Query  887   SGVKNPTRAEIVSALLYKCCVKA------AASRRPSILVHYADMRPPLGLPCNSAGNILS  1048
             S V+NPTR E+VSAL++KC V A        S +P I+    D+R  + LP NS GNIL+
Sbjct  240   SNVQNPTRNEVVSALIFKCIVAAVKVVNSGKSFQPWIMSQSFDLRHQIDLPPNSIGNILT  299

Query  1049  TFSTSPAAAGEMDLARLVAELREGKERLQSRDN---ELVQEIVTSLRTGEKPYENPDLDI  1219
             +   S AA   M LA +V E+R+ K+R+  RDN    L  +    L T EK +     ++
Sbjct  300   STYISIAAEKYMTLANIVTEMRKEKQRVCDRDNVEDNLFLKKFLELATEEKNFLKVQNNM  359

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
                SSL K+P +  DFGWG P KV++  G    + FL+ N S  G +A V L    MS F
Sbjct  360   CNFSSLVKFPVHEIDFGWGKPAKVNIANGLHNKVVFLVGNLS--GVDAFVSLSAKVMSVF  417

Query  1400  ERDEELLRFA  1429
             E+++ELL FA
Sbjct  418   EKEKELLEFA  427



>ref|XP_009590647.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=443

 Score =   314 bits (805),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 186/447 (42%), Positives = 268/447 (60%), Gaps = 40/447 (9%)
 Frame = +2

Query  182   IIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN------NNRT  343
             + +S  +S+SE++ IKP S TP  LR +KLSL+DQ +++MYIP+ FFY         N++
Sbjct  1     MTSSRLISVSEKI-IKPFSATPSPLRHYKLSLIDQLMSTMYIPIAFFYRRPLEHKIINKS  59

Query  344   DPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA  523
                 VS  L+ +LS+TL+S+YP+AG+L DN +++CND GA+F  V +NC++ +++N PD 
Sbjct  60    SKLEVSQTLEKSLSKTLSSYYPFAGKLKDNLSIECNDMGAKFLNVELNCSMSEVVNLPDT  119

Query  524   DAQNVAFPAGLPW--ANIHDGG--LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGH  691
               + +AFP  LPW   + ++G     V QLS F CGGIAVSA + HK+GDG T  NFM  
Sbjct  120   GPEYLAFPKNLPWNSTSYYEGTNYFVVAQLSHFRCGGIAVSACLSHKIGDGCTEINFMND  179

Query  692   WVAATR------HPKLNLS-PNFVSDSVFPTLPSGPLDKPMIPSKIEDD---CVQKRFVF  841
             W    R      +  + LS P ++  S+FP  P+   D     S+I  +   C+ KR+VF
Sbjct  180   WATIARSATSSNYAIIRLSTPQWIGASIFP--PTYD-DHSSAISRITPNTLPCITKRYVF  236

Query  842   SGEKLDLLKDVVSEES-GVKNPTRAEIVSALLYKCCVKAAASR--------RPSILVHYA  994
             S  KL  LK  ++ +S GV+NPTR E+V+ALLYK C   A SR        +PS L+   
Sbjct  237   SSSKLSALKKFMASDSGGVQNPTRNEVVTALLYK-CANMATSRSSSGSGLFKPSALIQVV  295

Query  995   DMRPPLG--LPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIV  1168
             ++RP L   LP NSAGN++S+         +M +AR+V +LR+ KE+L  + ++LV +  
Sbjct  296   NLRPRLNPPLPNNSAGNLISSILIKSTDEEQMKVARIVQDLRKEKEQLNMK-HDLVNQNG  354

Query  1169  TSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSG  1348
               L   E  Y N ++D+Y CSSL  Y  Y  DFGWG P +V +  G + N F L D+++G
Sbjct  355   VVLSALE--YLNDNMDVYCCSSLCNYQLYNVDFGWGKPERVVVTNGTI-NFFLLSDDKNG  411

Query  1349  GGFEALVMLKKTDMSGFERDEELLRFA  1429
              G E LV L K  MS F  ++ELL FA
Sbjct  412   DGIEVLVSLGKEVMSEFNNNKELLEFA  438



>ref|XP_009796801.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
sylvestris]
Length=416

 Score =   306 bits (785),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 167/419 (40%), Positives = 239/419 (57%), Gaps = 23/419 (5%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFY--PNNNRTDPTRVSDILQNA  379
             I  R +IKPSSPT  S   H LS +D   +S Y+P+  FY  P NN      +S IL+N+
Sbjct  6     ILSRKMIKPSSPTDISR--HNLSFIDHIASSAYVPVAAFYSKPENN------ISQILENS  57

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LSR L+S+YP+AG ++DN  VDCND GAEF  VR++C + +I++H   D  +V FP  LP
Sbjct  58    LSRVLSSYYPFAGIIMDNKYVDCNDTGAEFLNVRISCPMSEILDHAYNDVTDVVFPQYLP  117

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK-LNLSPN  736
             W++  +G L V QLS FDCGGIAVS  + HK+ DG ++  F+  W A  RH      S  
Sbjct  118   WSSYSNGSLLVVQLSHFDCGGIAVSVCLSHKIADGYSLCKFLNDWAATARHESDFKPSTQ  177

Query  737   FVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
             F + S FP +   P+ + ++  +    CV + + FS   L  LKD+VS  S V+NPTR E
Sbjct  178   FDAYSFFPLMDDPPVLRDIV--REPQRCVSRMYHFSSSSLGRLKDIVSTNSQVQNPTRVE  235

Query  917   IVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAAGEM  1084
             + +ALL+K     + +     +PSIL H    RPPL    N+ GN    F +  +   E+
Sbjct  236   VATALLHKFGAAVSMANFGMFQPSILSHLMSFRPPLSR--NTIGNACYFFGSIASTEDEI  293

Query  1085  DLARLVAELREGKERLQSRD---NELVQEIVTSLRT-GEKPYENPDLDIYFCSSLGKYPA  1252
             +L   VA+LR  K+ LQ +    N L   ++ +++    K  ++   D Y CSSL     
Sbjct  294   ELPHFVAQLRNAKQYLQDKSKDPNTLASHVLENVKERANKSEKSTKFDFYMCSSLCNLGV  353

Query  1253  YTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             Y  DFGWG P +V++ + PMKN F  +D+ +G G   L+ L++ DM  FE ++ELL FA
Sbjct  354   YKIDFGWGEPIRVTLARNPMKNNFIFLDSPNGDGINVLITLREADMLIFESNKELLEFA  412



>dbj|BAD99418.1| acyl-transferase [Capsicum annuum]
Length=336

 Score =   301 bits (771),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 215/332 (65%), Gaps = 16/332 (5%)
 Frame = +2

Query  476   VRVNCTLLDIINHPDA-DAQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCH  649
             VR+ C++ +I++HP A  A+ + FP  LPWAN ++GG L V Q+S+FDCGGIA+S    H
Sbjct  4     VRIKCSMSEILDHPRAAHAEGIVFPKDLPWANNYEGGNLLVVQVSKFDCGGIAISICFSH  63

Query  650   KVGDGGTVRNFMGHWVAATRH----PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDD  817
             K+GDG ++ NF+  W + TR       L  SP F+ DS+F T   GPL  P I S +  +
Sbjct  64    KIGDGCSLLNFLNDWSSVTRDHMTTTTLIPSPRFIGDSIFSTQKYGPLITPQIVSDL-SE  122

Query  818   CVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYAD  997
             CVQKRF+F  +KLD L+  V+ ESGV+NPTRAE+VSALL+KC  KA++S  PS LVH+ +
Sbjct  123   CVQKRFIFPTDKLDALRAKVAVESGVENPTRAEVVSALLFKCATKASSSMLPSKLVHFLN  182

Query  998   MRPPLG--LPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRD----NELVQ  1159
             +R  +   LP N+ GNILS FST+     +++L  LV  LR+  E    +D    NEL+ 
Sbjct  183   IRTMIKPRLPRNTIGNILSMFSTAATNEQDIELPSLVRNLRKEVEVAYKKDQVEQNELIL  242

Query  1160  EIVTSLRTGEKPYENPD---LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFL  1330
             E+V S+R G+ P+EN D    ++Y CS+L KYP  T DFGWG P  V +  GP KN FFL
Sbjct  243   EVVESIRKGKMPFENKDGYHENVYICSNLCKYPYDTVDFGWGRPESVCIANGPFKNAFFL  302

Query  1331  IDNQSGGGFEALVMLKKTDMSGFERDEELLRF  1426
              D ++G G EA VML K  MS FER+EEL  F
Sbjct  303   KDYKAGRGVEARVMLHKQQMSEFERNEELFEF  334



>ref|XP_004243890.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=429

 Score =   300 bits (768),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 171/421 (41%), Positives = 250/421 (59%), Gaps = 17/421 (4%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN--NNRTDPTRVSDILQ  373
             +S+S+++ IKPSSPTP SLR H LS LDQ  + ++ PL FFYP   N+  D   +S +LQ
Sbjct  9     VSMSKKI-IKPSSPTPSSLRHHNLSFLDQINSPLHNPLAFFYPKPKNSSYDINHISTLLQ  67

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHP-DADAQNVAFPA  550
             N+L+  LTS+YP+AG   DN  +DCND GAEFF V+++  + +I++HP   D  N+ +P 
Sbjct  68    NSLANLLTSYYPFAGTYNDNIFIDCNDVGAEFFDVQLDIPMSEILDHPYYNDDINLVYPQ  127

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
             G PW NI+DG L V QL+ FDCGGIAVS  + HKV D  +V  F+  W   TR    +  
Sbjct  128   GCPW-NIYDGTLVVAQLTHFDCGGIAVSVCISHKVADAYSVIKFITDWAYLTRDSS-HAK  185

Query  731   PNFVSD--SVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNP  904
             P+ + D  S FP + +     P   +  + +CV + F FS   LD LK + + ESGV+NP
Sbjct  186   PSVLFDGTSFFPPV-TDTSTLPDFDAGNDRNCVTRMFHFSSSGLDKLKTIAAAESGVENP  244

Query  905   TRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAAGEM  1084
             +R E+ +AL++K  + A+ S +PS+L H   +RPP  LP NS GN  S F TS     EM
Sbjct  245   SRVEVATALIHKHAMIASGSFKPSLLCHIMGLRPP--LPLNSIGNACSFFLTSTQTEDEM  302

Query  1085  DLARLVAELREGKERLQSRDNELVQ-----EIVTSLRTGEKPYENPD-LDIYFCSSLGKY  1246
             +L+  VA LR+ K++L+ +     Q     ++V   + G +  E  +  D+Y CSSL  +
Sbjct  303   ELSNSVAVLRKSKDQLREKMKNATQSDIFFKVVEITKQGAELVEKVNKADVYKCSSLCNF  362

Query  1247  PAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRF  1426
               Y  DFGWG   +VS     +KN  F +D+ +G G + L+ L + +M  F+ D+ +L +
Sbjct  363   GLYDMDFGWGKAIRVSSVSRAVKNQIFFMDSPTGNGMDVLISLDEKEMEIFQSDKVILEY  422

Query  1427  A  1429
             A
Sbjct  423   A  423



>ref|XP_006351214.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=461

 Score =   298 bits (763),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 174/437 (40%), Positives = 262/437 (60%), Gaps = 16/437 (4%)
 Frame = +2

Query  155   LHTQETKMAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN  334
             L T  +K  + AS  LS  E++ IKP+ PTP SL  + LS++DQ +  +Y+P+  FYP  
Sbjct  22    LSTSNSKGNMSASRLLSFGEKI-IKPNCPTPFSLGRYNLSVIDQIMFPVYMPIAAFYPFP  80

Query  335   NRTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINH  514
             ++T P +VS+I++ +LS+ L+S+YP+AG L DN  VDCND GA+F  VR +C + +I+N 
Sbjct  81    SKT-PQQVSNIIEKSLSKVLSSYYPFAGTLRDNTFVDCNDRGAKFMNVRYDCPMSEIVNL  139

Query  515   PDADAQNVAFPAGLPWANIHDGGLAVF-QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGH  691
             PD   + + FP G+PW    D    +F QLS F+CGG+A+SA++ HKV DG T+ NF   
Sbjct  140   PDIGPEYLPFPKGVPWGRTSDEKSLLFVQLSHFNCGGLAISASLSHKVADGCTLCNFFSD  199

Query  692   WVAATRHPKLNL-SPNFVS---DSVFPTLPSGPLDKPMIPSKIEDDCV-QKRFVFSGEKL  856
             W +       N+ SP  +     S F  +PS       +  +I++  + +KR+VF   KL
Sbjct  200   WASIACDHNANIPSPQMIGLPILSSFTNMPSTESFTDTVVDEIDNQPLSRKRYVFFNSKL  259

Query  857   DLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAA----ASRRPSILVHYADMRPPLG--L  1018
             + LK  V  E+GV+NPTR E++SAL YKC   AA    +S +PS+L+   ++RP L   L
Sbjct  260   EKLKTQVESETGVQNPTRFEVLSALFYKCAATAARANSSSFKPSMLLLPVNLRPILDPPL  319

Query  1019  PCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPY  1198
             P  + GNILS    +  +  EM +AR+V E+R+ K+ L+  D+    ++V SL +     
Sbjct  320   PTRAIGNILSMIKVTAMSEDEMTIARVVREIRKAKDELKKEDHVKESKLV-SLWSELSSM  378

Query  1199  ENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLK  1378
              N + ++Y  +S+  YP    DFGWG P  V++P   + N F  +DNQSG G EA+V L 
Sbjct  379   GN-EFELYRSTSVCNYPLNNLDFGWGKPNMVTIPITGIGNSFIFMDNQSGDGIEAIVALP  437

Query  1379  KTDMSGFERDEELLRFA  1429
             + +++ FE  +ELL FA
Sbjct  438   EKNVTRFENSKELLEFA  454



>ref|XP_006357899.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=429

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 171/425 (40%), Positives = 249/425 (59%), Gaps = 25/425 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFY--PNNNRTDPTRVSDILQ  373
             +S+S+++ IKPSSPTP SLR H LS LDQ ++ ++ PL FFY  P N+  D   +S +LQ
Sbjct  9     VSMSKKI-IKPSSPTPSSLRHHNLSFLDQIVSPLHNPLAFFYLKPENSSYDINHISTLLQ  67

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHP-DADAQNVAFPA  550
             N+L+  LTS+YP+AG   DN  +DCND GAEFF V ++  + +I++HP   D  N+ +P 
Sbjct  68    NSLANLLTSYYPFAGTCNDNIFIDCNDVGAEFFNVELDIPISEILDHPYYNDDINLVYPQ  127

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
             G PW N +DG L V QL+ FDCGGIAVS  + HKV D  +V  F+  W   TR    +  
Sbjct  128   GCPW-NTYDGTLVVAQLTLFDCGGIAVSVCISHKVADAYSVIKFITDWANLTRDSS-HAK  185

Query  731   PNFVSD--SVFPTLPSGPLDKPMIPS---KIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
             P+ + D  S FP +     D   +P      + +CV + F FS   LD LK + + ESGV
Sbjct  186   PSILFDGTSFFPPVT----DTSTLPDFDVGNDGNCVTRLFHFSSSGLDKLKIIAAAESGV  241

Query  896   KNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAA  1075
             +NP+R E+ +AL++K  + A+ S +PS+L H   +RPP  LP NS GN  S F TS    
Sbjct  242   ENPSRVEVATALIHKHAMIASGSFKPSLLCHIMGLRPP--LPLNSIGNACSFFVTSTQTE  299

Query  1076  GEMDLARLVAELREGKERLQSRDNELVQ-----EIVTSLRTGEK--PYENPDLDIYFCSS  1234
              +M L+  VA LR+ KE+L+ +   + Q     +++   + G +   Y N D D + CSS
Sbjct  300   DDMKLSNSVAVLRKSKEQLREKLKNVTQSDIFFKVLELTKQGAELLEYVNKD-DAFKCSS  358

Query  1235  LGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
             L  +  Y  DFGWG   +VS     +KN  F +D+ +G G + +V L + +M  F+ D+ 
Sbjct  359   LCNFGLYNMDFGWGKAIRVSSVSRGVKNQIFFMDSPTGNGMDVMVTLDEKEMEIFQSDKV  418

Query  1415  LLRFA  1429
             +L +A
Sbjct  419   ILEYA  423



>ref|XP_004251404.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=474

 Score =   295 bits (754),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 177/455 (39%), Positives = 255/455 (56%), Gaps = 51/455 (11%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN-RTDPTRVSDILQN  376
             LS   + ++KP SPTP + + HKLSLLDQ + + Y+PLV FYP +     P ++S +L+ 
Sbjct  8     LSTISKKVVKPFSPTPSTQKIHKLSLLDQCMGNFYMPLVLFYPKHQLEQGPKQLSKLLET  67

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             + S+ LT   P+AG L DNAT+ C+  GAEFF V VNC +  I++ PD     + FP GL
Sbjct  68    SFSKVLTYHQPWAGSLRDNATIHCDGTGAEFFEVEVNCPMNQIVHRPD-----LTFPPGL  122

Query  557   PWAN---IHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR-----  709
             PW N   ++DGG L+V QLS FDCGGIA+S  M HKVGD  +  +F+  W   TR     
Sbjct  123   PWKNVPHVNDGGRLSVAQLSHFDCGGIAISVCMSHKVGDARSAFSFLKDWATLTREQSND  182

Query  710   --------HPKLNLSPNFVSDSVFPTLPSGPLDKPMI--PSKIEDDCVQKRFVFSGEKLD  859
                     + +L+    +V DS+ P+LP GPL  P++  P+  E    +KRF  S   + 
Sbjct  183   QLSCPSNSNDQLSCPSYYVQDSLMPSLPDGPLKFPVVVEPNGEESIEFEKRFFLSESNIR  242

Query  860   LLKDVVSEE--SGVKNPTRAEIVSALLYKCCVKAAASR------RPSILVHYADMR---P  1006
              LK ++ ++  S V+NPT  E+VSA++YKC   A A+         S +V  +D+R   P
Sbjct  243   ALKALIVDDPSSIVQNPTTTEVVSAIVYKCAAIAGANTSNGNNDSSSQMVFVSDLRKTIP  302

Query  1007  PLGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDN--------ELVQE  1162
             P     ++ GNIL+TFST      ++ L +LVA++R+ K  L +RDN        E++ E
Sbjct  303   PSIKSTSTIGNILTTFSTPTYNLEDLRLPKLVADIRKSKHELSTRDNFNENRWVSEMI-E  361

Query  1163  IVTSLRTG---EKPY--ENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFF  1327
                 + TG   E  Y  E+   D+Y CSS+   P    DFGWG P + S+   P  NM +
Sbjct  362   YANKINTGTEYELSYRRESSSHDVYRCSSVCNIPFQDLDFGWGRPTRASIASTPFNNMIY  421

Query  1328  LIDNQSGG-GFEALVMLKKTDMSGFERDEELLRFA  1429
             L++ Q    G E  + L +  MS FE+D+E L+FA
Sbjct  422   LMNTQDQNRGIEVFINLDQQQMSIFEQDKEFLQFA  456



>ref|XP_004243889.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
 ref|XP_010323938.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=427

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 188/430 (44%), Positives = 251/430 (58%), Gaps = 33/430 (8%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTR-VSDILQNALSRT  391
             R +IKPSS TPPS + H LSLLD    + Y   V FYP    T P+  +S +LQ +LS+ 
Sbjct  3     RKIIKPSSATPPSHKRHNLSLLDCYANNEYASSVMFYPK--PTIPSNNISQLLQKSLSKA  60

Query  392   LTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD--AQNVAFPAGLPWA  565
             LT +YP+AG L DN  VDCND GAEF  VRV+  + D+IN  D D   +N  FP GL + 
Sbjct  61    LTYYYPFAGMLKDNTYVDCNDRGAEFLNVRVDGRMSDVINSCDNDRSGKNCVFPQGLCFG  120

Query  566   NIHD---GGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLN--LS  730
             N  D   G LA+ QL+ FDCGGIAVS    HK+ DG +   FM  W A  + P  +    
Sbjct  121   NTSDSFDGRLAMTQLTHFDCGGIAVSFCFSHKIVDGYSAGKFMSDWAAIAKDPNHHAITY  180

Query  731   PNFVSDSVFP--TLPSGPLDKPMIPSK--IEDDCVQKRFVFSGEKLDLLK-DVVSEESG-  892
             P F   S FP     +G  +   +P +  ++   V +R++FS  KL+ LK  +V   SG 
Sbjct  181   PQFDGASFFPPGIHDAGTSEVNSLPEEGLVQQRFVTRRYLFSASKLNTLKAKIVDSGSGI  240

Query  893   VKNPTRAEIVSALLYKCCVKAAASR-----RPSILVHYADMRPPLGLPCNSAGNILSTFS  1057
             V NP+R E VSALLYK    AAA+R     RPS    +A+MRPPL  P N+ GN     S
Sbjct  241   VGNPSRIESVSALLYK---SAAANRNNTSFRPSTFTLFANMRPPL--PLNTIGNAPGYIS  295

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSR-----DNELVQEIVTSLRTGEKPYENPDLDIY  1222
             TS     +M L R+VAELR+GKE+L++R      N+LV E    ++   + Y     DIY
Sbjct  296   TSIEEEVDMQLPRIVAELRKGKEKLRNRFNTVDPNKLVFESFELMKEVGQVYNREGFDIY  355

Query  1223  FCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQS-GGGFEALVMLKKTDMSGF  1399
              CSSL  +P Y  DFGWG P +V+    P  N F L+DNQ+  GG EALV L++++M+ F
Sbjct  356   RCSSLCNFPFYGIDFGWGTPQRVAFLIPPC-NFFVLLDNQNRDGGVEALVTLEESEMTVF  414

Query  1400  ERDEELLRFA  1429
             ++D+++L+FA
Sbjct  415   QQDQQILQFA  424



>ref|XP_009783683.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
sylvestris]
Length=423

 Score =   292 bits (747),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 167/422 (40%), Positives = 244/422 (58%), Gaps = 24/422 (6%)
 Frame = +2

Query  203   SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTR-VSDILQNA  379
             +I  R +IKPSSPTP SL  H L  LD   TS Y P+  FYP      PT  +S IL+N+
Sbjct  5     TIVSRKMIKPSSPTPSSLSRHNLCFLDHIATSAYAPIAVFYPK-----PTNNISQILENS  59

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS+ L+S+YP+AG + DN  VDCND GAEF  VR++C++ +I++H   DA +V FP  LP
Sbjct  60    LSKVLSSYYPFAGIITDNKYVDCNDTGAEFLNVRISCSMSEILDHAYNDAIDVVFPPDLP  119

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
             W +       V QLS FDCGGIA+S  + HK+ DG ++  F+  W A ++H     S  F
Sbjct  120   WTSSFGRSPLVVQLSHFDCGGIAISICLSHKIVDGYSLFKFLKDWAATSQHLDFKPSTQF  179

Query  740   VSDSVFPTLPSGPLDKPMIPSKIEDD---CVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
              ++S FP +     D P++   I  +   CV + + FS   LD LK++V+  S V+NPTR
Sbjct  180   DANSFFPLMD----DPPVLLRDIVREPQRCVSRIYHFSSSSLDRLKEIVAMNSQVQNPTR  235

Query  911   AEIVSALLYKCCVKAAAS-----RRPSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAA  1075
              E+ +ALL+KC    + +      +PS+L H  + RPP  LP N+ GN  S F+++    
Sbjct  236   VEVATALLHKCGASVSMTINSGVFQPSLLFHVMNFRPP--LPLNTIGNACSAFASAAILE  293

Query  1076  GEMDLARLVAELREGKERLQSR---DNELVQEIVTSLR-TGEKPYENPDLDIYFCSSLGK  1243
              E+ +   VA+LRE K+ LQ +     +L   ++ +++ T  K  +N   D Y C+SL  
Sbjct  294   NEIQVPNFVAQLREAKKHLQDKLKDPEQLTSYVLETIKGTTNKTEKNIVFDFYMCTSLCN  353

Query  1244  YPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLR  1423
             +  +  DFGWG P +V++    MKN F  +D+ SG G + L+ L + DM  F  ++ELL 
Sbjct  354   FGLHNIDFGWGNPIRVTVATNSMKNHFIFMDSPSGDGIDVLITLTEADMLIFHNNKELLE  413

Query  1424  FA  1429
             FA
Sbjct  414   FA  415



>ref|XP_004251378.2| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=430

 Score =   288 bits (738),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 154/420 (37%), Positives = 237/420 (56%), Gaps = 13/420 (3%)
 Frame = +2

Query  203   SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNAL  382
             +I  R +IK  SPTP SLR HKLS +D     ++ P  FFYP   +    ++S +L+N+L
Sbjct  5     TIISRKMIKLLSPTPSSLRCHKLSFMDHINFPLHSPYAFFYPKIPQNYSNKISQVLENSL  64

Query  383   SRTLTSFYPYAGRLLDNAT-VDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             S+ L+ +YP AG++ +N T VDCND GAE+  VR++C +  I+NHP  D  +V FP  LP
Sbjct  65    SKVLSFYYPLAGKINNNYTYVDCNDTGAEYLNVRIDCPMSQILNHPYNDVVDVVFPQDLP  124

Query  560   WANIH-DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPN  736
             W++        V QLS FDCGG+AVSA   H + DG  +  F+  W +  R+ +   SP 
Sbjct  125   WSSSSLTRSPLVVQLSHFDCGGVAVSACTSHTIFDGYCLSKFINDWASTARNMEFKPSPQ  184

Query  737   FVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
             F + + FP      L   +  ++     V + + FS   L  LKD+V++ES VKNPTR E
Sbjct  185   FNASTFFPLPSETNLSSTLPATRPSQRHVSRMYNFSSSNLTRLKDIVTKESHVKNPTRVE  244

Query  917   IVSALLYKCCV----KAAASRRPSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAAGEM  1084
             + SAL++KC V    +++   +P+++ H  ++RPP  +P N+ GN      T+     E+
Sbjct  245   VASALVHKCGVTMSMESSGMFKPTLMSHAMNLRPP--IPLNTMGNATCIILTTAMTEDEV  302

Query  1085  DLARLVAELREGKERLQSRDNELVQEI--VTSLRTGEKPY---ENPDLDIYFCSSLGKYP  1249
              L   VA+L++ K++L+ +  ++ ++   + +L  G+      E    D+Y CS +    
Sbjct  303   KLPNFVAKLQKDKQQLRDKLKDMKEDRMPLYTLELGKNAMNIIEKDTHDVYLCSGMTNTG  362

Query  1250  AYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              +  DFGWG P +V++   P KN F  +D QSG G   L+ L K DM  F+ ++ELL FA
Sbjct  363   LHKIDFGWGEPVRVTLATHPNKNNFIFMDEQSGDGLNVLITLTKDDMLKFQSNKELLEFA  422



>ref|XP_006351057.1| PREDICTED: deacetylvindoline O-acetyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=350

 Score =   286 bits (731),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 212/347 (61%), Gaps = 15/347 (4%)
 Frame = +2

Query  422   LLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGLAVFQL  601
             + DNA +DCND G EF  V ++  +  ++N  D + +++ FP G+ W N  D GLAV QL
Sbjct  1     MKDNAEIDCNDKGVEFLNVHIDAPMSQVLNDQDCNVKDLIFPHGVAWENDSDYGLAVIQL  60

Query  602   SEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS-PNFVSDSVFPTLPSGP  778
             + FDCGGIAVS  + HK+GD      F   W   TR     ++ P ++SD++FP+ PSGP
Sbjct  61    THFDCGGIAVSTCLSHKIGDACNGLQFSIDWATLTRDSNAKITPPYYISDTIFPSPPSGP  120

Query  779   LDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKA-  955
             LD P++PS I D C QKR++FS  K+  L+  V+ ES VKNPT  E++SALL+KC  KA 
Sbjct  121   LDSPVVPS-ILDGCTQKRYIFSSSKVSELRSSVASESHVKNPTPTEVLSALLFKCVAKAV  179

Query  956   ---AASRRPSILVHYADMRPPLG--LPCNSAGNILSTFSTSPAAAGEMDLARLVAELREG  1120
                + S  PS L+ YAD+R  +   LP NS GN+LS FST  +   +M+L ++V+ +RE 
Sbjct  180   TANSGSFVPSKLIQYADLRGMISPKLPPNSIGNVLSHFSTHISNETDMNLPQIVSLMREE  239

Query  1121  KERLQSRDNELVQEIVTSLRTGE----KPYENPDLDIYFCSSLGKYPAYTADFGWGWPCK  1288
             K+  ++RDN  ++E   +L   +     P +  + D Y CSS+ K+P Y  DFGWG P  
Sbjct  240   KQLFRTRDN--IKENAWALEILQLAKGLPPKKKEFDEYTCSSVCKFPFYDVDFGWGKPMA  297

Query  1289  VSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              ++  GP K +F L+ N    G EA VML + DMS FERDEE L FA
Sbjct  298   ATIATGPYKKLFNLM-NYKDDGIEAFVMLDEQDMSVFERDEEFLEFA  343



>ref|XP_004246214.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=424

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 164/430 (38%), Positives = 256/430 (60%), Gaps = 26/430 (6%)
 Frame = +2

Query  182   IIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVS  361
             + AS  +S++E++ IKP SPTP S++ + L L+D+ +  +Y+P+V FYPN ++T P +VS
Sbjct  1     MTASSFVSMAEKI-IKPHSPTPFSVKRYNLCLMDEIMVPVYMPIVAFYPNPSKT-PEQVS  58

Query  362   DILQNALSRTLTSFYPYAGRL-LDNAT-VDCNDAGAEFFRVRVNCTLLDIINHPDADAQN  535
             +IL+++LS+ L+S+YP+AG L  DNAT VDCND GA+  +VR +C + +I+N PD   + 
Sbjct  59    NILEDSLSKVLSSYYPFAGTLGSDNATFVDCNDRGAKSIQVRYDCPMSEIVNLPDTGPEY  118

Query  536   VAFPAGLPWANI-HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
             + F  G PW++   +  L V QLS F+CGG+ +SA + HK+ DG T+ NF+  W +  R 
Sbjct  119   LPFAKGTPWSSTPEEQSLLVVQLSHFNCGGLGISARLSHKIADGCTLANFISDWASVARD  178

Query  713   PKLNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIEDD-------CVQKRFVFSGEKLDLLK  868
                N+ SP  +  S+FP     P  +  I +    D         +KR++FS  KL++LK
Sbjct  179   DNANIPSPQLIGSSIFP-----PFTEMRIHTDTNVDYEFYNLPVCKKRYLFSNAKLEMLK  233

Query  869   DVVSEESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHY-ADMRPPLGLP--CNSAGN  1039
               V  E+GV+NPTR E++SAL+YKC V A +S      +    ++RP L  P    + GN
Sbjct  234   TQVESETGVQNPTRIEVLSALIYKCAVTANSSSFRPSSLSLPVNLRPILNPPLETRTVGN  293

Query  1040  ILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYENPDLDI  1219
             I+S       +  EM + R+V E+R+GK+ L+ ++  + +E + SL +         +D+
Sbjct  294   IISFIKVETTSEDEMTIGRVVREIRKGKDELK-QEGGVKKEKLVSLWSEWIH----SIDL  348

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             Y  SS+  YP    DFGWG P +V++P   + N    +DN SG G E ++ L + D + F
Sbjct  349   YRSSSVCNYPLNNLDFGWGKPNRVAIPVFGVANTCMFMDNLSGDGIEVIIALPEKDATQF  408

Query  1400  ERDEELLRFA  1429
             E  +ELL FA
Sbjct  409   ENSKELLHFA  418



>ref|XP_009359304.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Pyrus 
x bretschneideri]
Length=437

 Score =   282 bits (721),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 165/432 (38%), Positives = 239/432 (55%), Gaps = 41/432 (9%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT--RVSDILQNALSR  388
             R +IKPS+PTPP LR H LS ++Q     Y+P+V+FY   +   P     S+ L+ +LS 
Sbjct  10    REIIKPSTPTPPHLRTHNLSFIEQNTPRTYLPVVYFYHKESSASPNGDHESNQLKKSLSE  69

Query  389   TLTSFYPYAGRLLDNATVDCNDAGAEFFRVRV-NCTLLDIINHPDADAQNVAFPAGLPWA  565
              L+ +YP+AGR+ D A+VDCND G  F   RV N  L +I+ HP+     + F   L W 
Sbjct  70    ILSKYYPFAGRIRDRASVDCNDEGVAFVEARVRNVKLSEILEHPEDTWLALLFTDNLQWN  129

Query  566   NIHDGGLAVF---QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPN  736
             +  D  L+V    Q+S FDCGG+A+   M HKV D  TV NF+  W A  +  +   SP 
Sbjct  130   D--DSSLSVIFAVQVSFFDCGGMAIGICMSHKVADTSTVANFINDWAARNKCDQYVPSPL  187

Query  737   FVSDSVFPTLPSGPLDKPMIPSKI--EDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
             F+    FP    G  D P+ P  +  + DCV KRFVF   K+  LK +V+++  V+NPTR
Sbjct  188   FIGADTFP---QG--DMPLFPETVLEKGDCVTKRFVFDALKIASLKAIVADK--VQNPTR  240

Query  911   AEIVSALLYKCCVKA-----AASRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTS  1063
              E+V+AL+Y C + A      +S  P++ +H  ++R    PPL  P NS G+++  F+ S
Sbjct  241   VEVVTALIYSCAISALRSTSQSSLNPTVFIHTVNLRTRVVPPL--PKNSVGSMIWAFTLS  298

Query  1064  PAAAGEMDLARLVAELREGKERL----------QSRDNELVQEIVTSLRTGEKPYENPDL  1213
              A    M+L  LV ++++   R           + +   + +E   +LR   K +   +L
Sbjct  299   TAEDSVMELHDLVTQMKQSMTRFCDSYAQKFRGEDQWPAIFKECTQALR---KEFSIANL  355

Query  1214  DIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
               Y CSS  ++P Y ADFGWG P  V++   P+KN  FLID ++G G EA V L+K  + 
Sbjct  356   VTYRCSSWCRFPVYEADFGWGKPIWVTIASCPLKNAIFLIDTRNGEGIEAYVNLEKQQLD  415

Query  1394  GFERDEELLRFA  1429
              FERD +LL FA
Sbjct  416   VFERDAQLLAFA  427



>ref|XP_004237145.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=409

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 165/405 (41%), Positives = 231/405 (57%), Gaps = 32/405 (8%)
 Frame = +2

Query  299   MYIPLVFFYPNNNRTDPTR----VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAE  466
             +YIPL  FYP  + T   +    VS  L+ +LS+ LT++YP+AG+L DN ++DCND G E
Sbjct  5     IYIPLALFYPKLSNTWSNKPNNVVSQHLEKSLSKVLTNYYPFAGKLNDNISIDCNDNGVE  64

Query  467   FFRVRVNCTLLDIINHPDADAQNVAFPAG-LPWANIHDGGLAVFQLSEFDCGGIAVSAAM  643
             FF   +NC + +I NHP  +  N+ +P   +     ++G LAVFQL+ F+CGGIA+S  +
Sbjct  65    FFVTEINCPMSEIFNHPYFEKHNLVYPTEVINNQYTYEGSLAVFQLTHFNCGGIAISMCL  124

Query  644   CHKVGDGGTVRNFMGHWVAATRHPKLN----LSPNFVSDSVFPTLP----SGPLDKPMIP  799
              HKVGDG T  NFM HW    R+P  +    +SP F     FP       S   +  ++P
Sbjct  125   SHKVGDGYTFGNFMNHWATIARNPLSSEIYPISPKFDGSFYFPPAKDEDSSNVSNNNIVP  184

Query  800   SKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKA-----AAS  964
              +  ++CV K F  S  KL  LK  V  +S V+NP+  E+VSA LY+  +       + S
Sbjct  185   QR--EECVSKGFSISSSKLTALKARVINDSEVQNPSDTEVVSAFLYQRAMATKKLVNSDS  242

Query  965   RRPSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERL-QSR  1141
              RPS+L    ++RPP  LP ++ GNI S FS       EMDLAR+V++LR+ KE + Q  
Sbjct  243   IRPSLLHQAVNLRPP--LPKHTMGNICSLFSILTKEEKEMDLARVVSKLRKEKEEVKQKY  300

Query  1142  DNELVQEIV-TSLRTGEKPYE----NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKG  1306
              N  ++E++  +L    K  +    N   D+Y  SSL  +P+Y  DFGWG P KV  P  
Sbjct  301   KNAKIEELLPITLEQHRKANDLLVNNSCYDLYRFSSLITFPSYEVDFGWGKPEKVISPIS  360

Query  1307  ----PMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
                 P+KNMFFL+ +++  G      +KK DM  FERDEELLRFA
Sbjct  361   TSNPPIKNMFFLMADKNRDGVNLTCSMKKQDMLAFERDEELLRFA  405



>ref|XP_009793426.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
sylvestris]
Length=405

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 164/434 (38%), Positives = 247/434 (57%), Gaps = 59/434 (14%)
 Frame = +2

Query  182   IIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD----P  349
             +  S  LS   + +IKPSSPTP + R HKLSLLDQ   + Y+PLVFFYP +        P
Sbjct  2     VSVSKMLSTISKKIIKPSSPTPSTQRCHKLSLLDQRPYN-YMPLVFFYPKHQVATIPNGP  60

Query  350   TRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADA  529
              ++ ++L N++S+TLT +YP+AG L DNAT+DC+D+G EFF V+++  +  +I+HP+++ 
Sbjct  61    KQLPNLLANSVSKTLTCYYPWAGSLKDNATIDCDDSGVEFFEVQISSQMDKVIHHPNSNI  120

Query  530   QNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             + + F                                   +VGD  +   F+  W A TR
Sbjct  121   KELTF----------------------------------RQVGDACSAYYFLRDWAALTR  146

Query  710   HPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIED---DCVQKRFVFSGEKLDLLKDVVS  880
             +P   +SP F  DS+FP+    P D P++ S IE    DC+QKRFVFS  KL  LK  ++
Sbjct  147   NPNAKISPYFAEDSLFPS----PFDGPLVASVIESKNKDCIQKRFVFSDSKLSALKAYIA  202

Query  881   EESGVKNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLG--LPCNSAGNI  1042
             +ESG++NPTR+E+V+ALLYKC   A    + S + S L+ Y+++R  +   LP ++ GNI
Sbjct  203   DESGLQNPTRSEVVNALLYKCAAFAVSGSSGSFQRSQLIQYSNLRERISPPLPPSTIGNI  262

Query  1043  LSTFSTSPAAAGEMDLA--RLVAELREGKERLQSR----DNELVQEIVTSLRTGEKPYEN  1204
             L+ FST P    E DL   ++V ++R+ K  L S+    +NE V E++ + RTG++ +  
Sbjct  263   LTVFST-PIYNNERDLRLPKIVRDIRKYKNNLSSKNNLEENEWVVEMLDAYRTGKELFNQ  321

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
              + D+Y CSS   Y     DFGWG P K S+      +  F++ N    G EA V L + 
Sbjct  322   RNCDVYLCSSTLMYEYEKLDFGWGRPAKGSLGNVGQFSKNFILMNTPDRGVEAFVNLNEQ  381

Query  1385  DMSGFERDEELLRF  1426
             +M  F++D++LL F
Sbjct  382   EMCLFDKDKDLLEF  395



>ref|XP_010321585.1| PREDICTED: deacetylvindoline O-acetyltransferase-like isoform 
X2 [Solanum lycopersicum]
Length=357

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/349 (42%), Positives = 209/349 (60%), Gaps = 13/349 (4%)
 Frame = +2

Query  416   GRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGLAVF  595
              RL DN TVDCNDAGAEF +V+++C + + +N  +   +++ FP GLPW+N    GL V 
Sbjct  5     NRLKDNTTVDCNDAGAEFIQVQIDCLISETLNWHNTAIEDLLFPQGLPWSNCASRGLVVV  64

Query  596   QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSP--NFVSDSVFPTLP  769
             QL+ F+CGGIA+S  + HK+GDG +  N    W   T HP     P  ++V  SVFP   
Sbjct  65    QLTYFNCGGIAISMCISHKIGDGCSGYNLFRDWSHITSHPNNFSIPSLHYVEQSVFPPPS  124

Query  770   SGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCV  949
             SGP   P+  S  + DCVQ+R++FS +KL  LK+ V+ ES V+NPTR E+VSAL++KC V
Sbjct  125   SGPFLSPLFMSN-KHDCVQRRYIFSNQKLLNLKNTVASESEVQNPTRTEVVSALIFKCAV  183

Query  950   KAAASRR----PSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAAGE--MDLARLVAEL  1111
             +AA +      PS +V   D+R  +GLP N+ GN+L+   TS     E  M +++LV+E+
Sbjct  184   RAAKANSGIFLPSSMVQAVDLRAQVGLPPNAIGNLLTICPTSIITNNEESMTISKLVSEM  243

Query  1112  REGKERLQSRDN---ELVQEIVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWP  1282
             R+ KE +  RDN    +   ++  L   ++ Y +   + Y  +SL K+  +  DFGWG P
Sbjct  244   RKSKELVYKRDNVNDNMFVALLLELAKSKREYHDNGPNAYQITSLVKFALHEIDFGWGKP  303

Query  1283  CKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              KVS+  G    +  L+ NQ+ GG +A V L + DMS  + D ELL FA
Sbjct  304   TKVSIANGLNNKLAILMGNQT-GGIDAFVTLTEQDMSVLQYDTELLEFA  351



>ref|XP_002515007.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47561.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=441

 Score =   272 bits (695),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 168/442 (38%), Positives = 241/442 (55%), Gaps = 36/442 (8%)
 Frame = +2

Query  176   MAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN------  337
             MA+ A   + I +R  IKPSSPTPP L+ HKLSLLDQ + + YIP+V FYP N+      
Sbjct  1     MAMAAK--VKIIQRETIKPSSPTPPELKIHKLSLLDQLIPTNYIPVVLFYPANDGDNLDH  58

Query  338   RTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHP  517
               + T  S  L+ +LS TLT +YP+AGR+ D+ +V+C+D GA+F + R+NC L D++  P
Sbjct  59    HANSTERSLKLKTSLSETLTHYYPFAGRIKDSTSVECDDQGADFIQARINCLLSDVLKSP  118

Query  518   DADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWV  697
             DA       PA +       G L + Q + F CGG+AV   + HK+ D  T++ F+  WV
Sbjct  119   DAVVLRQFLPAAITSTEAATGNLLLVQATFFHCGGLAVGVCISHKISDATTLKAFIKCWV  178

Query  698   A-ATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIE---DDCVQKRFVFSGEKLDLL  865
             A AT     + +P F+  S+FP     P+D  +  S +E     C+ KRFVF+G K+  L
Sbjct  179   ATATSSSTESATPLFMGASIFP-----PVDISIPTSVVELMKKQCITKRFVFTGSKIAAL  233

Query  866   KDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLP  1021
             K  V+  + ++NPTR E VS LL+K  + A  S+    RPS+     +MR    PP  LP
Sbjct  234   KAKVASTT-MRNPTRVETVSGLLWKTAMAATRSKLGYSRPSVWSMPVNMRTRFLPP--LP  290

Query  1022  CNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQS------RDNELVQEIVTSLRT  1183
              + AGN L     +P  A E +L  LV  +R+  E  +       R    V       + 
Sbjct  291   ESYAGNCL--LHINPKIADESELKELVGRIRKEIEGFRENYVKKLRGERAVLATFGFFQE  348

Query  1184  GEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEA  1363
                   N D+D+Y C+S  K   Y ADFGWG P  V +   P+ N+  L+D + G G EA
Sbjct  349   YGNLAMNNDIDLYTCTSWCKLELYDADFGWGRPLWVGIDSIPLSNVVCLMDTRDGDGIEA  408

Query  1364  LVMLKKTDMSGFERDEELLRFA  1429
              + L + +M+ FE ++ELL+FA
Sbjct  409   WLTLGEENMALFESNQELLQFA  430



>ref|XP_002514985.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47539.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=437

 Score =   271 bits (694),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/422 (37%), Positives = 229/422 (54%), Gaps = 26/422 (6%)
 Frame = +2

Query  221   LIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRT------DPTRVSDILQNAL  382
             +IKPSS +P   R H LS  DQ  + +YIP++FFYP    +      D    S +L+ +L
Sbjct  10    IIKPSSASPNRPRIHHLSFFDQISSCIYIPVIFFYPKQQLSHNPIDDDIVHKSTLLKESL  69

Query  383   SRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPW  562
             S TL+ +YP AGR+ D+ T+DCND G EF   R+   L +I+ HPD       FP  L +
Sbjct  70    SLTLSHYYPLAGRIKDDLTIDCNDKGVEFLEARMRSNLSEILKHPDDSTLKSLFPGDLQY  129

Query  563   ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFV  742
              +     L + Q + FDCGG+AV+  + HK+ D  ++  F+ HW A        L P F 
Sbjct  130   KDPILSSLLIVQSTFFDCGGMAVAVCISHKISDIASMCYFINHWAAIACSQGEKLCPEFN  189

Query  743   SDSVFPTLPSGPLDKPMIPSKIED--DCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
               S++P     P+D P+  +   +   CV +R VF   K+  LK++V++E  V NPTR E
Sbjct  190   LGSLYP-----PIDLPVTETYQGEKVKCVSRRLVFDALKIAKLKEMVAKE--VSNPTRVE  242

Query  917   IVSALLYKCCVKAA----ASRRPSILVHYADMRPPL--GLPCNSAGNILSTFSTSPAAAG  1078
             +VSA+LY+  + AA     S +P+ + + A++RP +   LP  SAGNI  TFS +     
Sbjct  243   VVSAILYRSAISAARLRSGSSKPTAMHNAANLRPRVLPPLPECSAGNISGTFSVTTMEDS  302

Query  1079  EMDLARLVAELREGKERL-----QSRDNELVQEIVTSLRTGEKPYENPDLDIYFCSSLGK  1243
              ++L +L +E+++ K        Q    E +   V     G +     D D+Y CSS  +
Sbjct  303   VIELVQLASEVKKEKTEYCNSCGQKFSAEELCAFVLDASVGLRLCHGKDQDVYLCSSFCR  362

Query  1244  YPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLR  1423
             YP Y ADFGWG P  V++    +KN+  L+D + G G EA V L++ +M  FE DEELL 
Sbjct  363   YPFYDADFGWGKPGWVTVASCEVKNVIILMDTKCGDGIEAYVTLEEQEMDLFENDEELLC  422

Query  1424  FA  1429
             FA
Sbjct  423   FA  424



>ref|XP_004251382.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=433

 Score =   271 bits (692),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 158/425 (37%), Positives = 231/425 (54%), Gaps = 20/425 (5%)
 Frame = +2

Query  203   SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNAL  382
             +I  R  IKPS PTP S R + LS  DQ   ++Y+P+   Y        T++S+IL+N+L
Sbjct  5     TILSRKFIKPSPPTPSSHRHYNLSFRDQTANNLYLPIAALYSKPENHTITQISNILENSL  64

Query  383   SRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPW  562
             S+ L  +YP+ GR+ DN  VDCND GAE+F V +NC + +I+++P  DA  + FP  L W
Sbjct  65    SKILFFYYPFGGRIKDNKYVDCNDIGAEYFNVHINCQMSEILSNPYNDAIEIVFPQNLAW  124

Query  563   ANI---HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP-KLN--  724
              N        L V QLS FDCGG+ +S  + HKV DG +   F+  WV+  R   KLN  
Sbjct  125   GNSLSEERSSLLVVQLSHFDCGGVGISICLSHKVADGYSGCKFLSDWVSMARDDHKLNFQ  184

Query  725   LSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKD-VVSEESGVKN  901
             LS  F   S FP + + P           + CV + +  S   L  LKD VVS    ++N
Sbjct  185   LSCQFDGASFFPPIDNPP--PMPNVVPDPERCVSRMYNLSSSTLLKLKDIVVSTNPQIQN  242

Query  902   PTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPCNSAGNILSTFSTSPA  1069
             P+R E+ +AL +KC V  + ++    R ++L H  ++RPP  +P N+ GN    FST   
Sbjct  243   PSRIEVATALFHKCGVDVSMAKSGVFRRTVLFHVMNLRPP--IPFNTIGNATCYFSTRAM  300

Query  1070  AAGEMDLARLVAELREGKE--RLQSRD---NELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
             +  +  L   V EL++ K+  R + +D    EL    +  ++      ++   D+YFC+S
Sbjct  301   SIDKTTLPNYVGELQKAKQQIRYELKDMNTKELALHAIEKIKEIVNIAKDDCFDMYFCTS  360

Query  1235  LGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
             L  + +   DFGWG P +V+  K PMKN F  +D+ SG G   L+ L + DM  FE ++E
Sbjct  361   LCTFGSRKIDFGWGSPLRVTHVKDPMKNKFIFMDDPSGEGINVLITLTEADMLLFESNKE  420

Query  1415  LLRFA  1429
             LL FA
Sbjct  421   LLEFA  425



>gb|KDP26743.1| hypothetical protein JCGZ_17901 [Jatropha curcas]
Length=438

 Score =   270 bits (691),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 152/425 (36%), Positives = 244/425 (57%), Gaps = 28/425 (7%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALS  385
             I  R ++KPSSPTP   + H L   +Q  +++Y+P VFFY  +   D + +S +L+ +LS
Sbjct  9     IISREMVKPSSPTPKHQKIHALCFFEQISSTIYVPFVFFYAKDTCPDRSHISYLLKGSLS  68

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWA  565
              TL+ +YP AGRL D+ TVDCND G EFF  R+NC L  I  +P+A+   +  P  L + 
Sbjct  69    ETLSKYYPLAGRLKDSVTVDCNDEGIEFFETRINCDLSYIFKNPNAETIKILIPNDLEYK  128

Query  566   NIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP-KLNLSPNFV  742
             +     L + Q++ FDCGG+ ++  + HK+ D  T+ +F+ +W A  R+  K  +SP F 
Sbjct  129   DPFLSSLVIVQVNFFDCGGMGLTVCISHKIADMATLYSFINNWAAIARNSGKEYISPLFN  188

Query  743   SDSVFPTLPSGPLDKPM----IPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
               S++P     P+D P+    +P K++  C+ +R +F   K+ +LK ++++E  +++PTR
Sbjct  189   LGSLYP-----PIDLPVMSYEVPEKVK--CISRRIIFDFPKIAILKSIIAKE--IQDPTR  239

Query  911   AEIVSALLYKCCVKAAA----SRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTSP  1066
              E+V+AL+YK  + AA     S +P+IL     +R    PP  +P N+ G +   F    
Sbjct  240   VEVVTALIYKSAISAAKTVSRSLKPTILHQAIHLRSWVSPP--VPENAMGCLTGIFPVPI  297

Query  1067  AAAGEM-DLARLVAELREGKERL--QSRDNELVQEIVT-SLRTGEKPYENPDLDIYFCSS  1234
                 E+  LA+LV + R+GK R   +S+   +++E  +  L   +   E+ + +IY CSS
Sbjct  298   MDESEIHQLAQLVRQTRQGKIRFREESKKKLVLEEFYSFILECSKGVRESQNKNIYMCSS  357

Query  1235  LGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
             L  +  Y ADFGWG P  V+      +N+  LID + G G EA V L++ +M+ FE ++E
Sbjct  358   LCGFSFYVADFGWGKPTWVTHSILDARNIIMLIDTREGNGIEAYVSLEENEMAVFESNKE  417

Query  1415  LLRFA  1429
             LL FA
Sbjct  418   LLAFA  422



>ref|XP_008340165.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Malus 
domestica]
Length=437

 Score =   269 bits (688),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 157/429 (37%), Positives = 240/429 (56%), Gaps = 36/429 (8%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSD---ILQNALS  385
             R +IKPS+PTPP LR HKLS+LDQ     Y+P+V+FYP    +D   V+D    L+ +LS
Sbjct  11    REVIKPSTPTPPHLRTHKLSILDQINPRSYVPVVYFYPKE-ASDYWSVADKSNQLKKSLS  69

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRV-NCTLLDIINHPDADAQNVAFPAGLPW  562
              TL+ +YP+AGR+ D  ++DCND G  F   ++ N  L DI+ +P  +   +     + W
Sbjct  70    ETLSKYYPFAGRIRDRFSIDCNDEGVAFVETQIRNFKLSDILENPKDEDLALLISEDVAW  129

Query  563   ANIHDGGLAV-FQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
                 D  + V  Q+S F+CGG+A+   M HK+ D  T+ NF+  W A  R   +  SP F
Sbjct  130   NEDPDVSVIVDVQVSFFECGGMALGIGMSHKIADASTIINFVNDWAAVARDQYVP-SPEF  188

Query  740   VSDSVFPTLPSGPLDKPMIPSKI--EDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRA  913
             V++++FP       D P+ P  +  + DCV KRFVF   K+  LK +V+++  V+NPTR 
Sbjct  189   VAENIFPQG-----DLPLFPEAVPEKSDCVAKRFVFDATKIAALKALVADK--VQNPTRV  241

Query  914   EIVSALLYKCCVKA-----AASRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTSP  1066
             E+V+A +Y C + A      +S  P++L    ++R    PP+  P NS G ++  ++ S 
Sbjct  242   EVVAAFIYSCTISALRLTSGSSSNPTVLTQSVNLRTRMVPPV--PQNSVGCMVWIYTVST  299

Query  1067  AAAGEMDLARLVAELREG--------KERLQSRDNELVQEIVTSLRTGEKPYENPDLDIY  1222
             A    ++L  LVA+L++          ++ + +D   V      L+     +  P+L +Y
Sbjct  300   AEDSVIELHDLVAQLKQNMTRFCDSYAQKFRGKDQWPVI-FQXCLQESMVEFSRPNLVMY  358

Query  1223  FCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFE  1402
              C+S  ++P Y  DFGWG P  +++P    K+ F LID ++G G EA V L+K  +  FE
Sbjct  359   KCTSWCRFPMYEVDFGWGKPIWITVPSCTTKDCFILIDTKNGEGIEAYVNLEKQQLDVFE  418

Query  1403  RDEELLRFA  1429
             RDEELL FA
Sbjct  419   RDEELLAFA  427



>ref|XP_009588593.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 165/417 (40%), Positives = 235/417 (56%), Gaps = 29/417 (7%)
 Frame = +2

Query  221   LIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRT---DPTRVSDILQNALSRT  391
             +IKPSSPTP S R HKLSL+DQ  T  Y+P+ FFYP  +     +PT+VS IL+ +LS+ 
Sbjct  13    IIKPSSPTPFSHRIHKLSLMDQMGTRTYMPISFFYPKQDTAISLEPTKVSQILEKSLSKV  72

Query  392   LTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANI  571
             LT++YP+AGR+ DN+ ++CND G    +VR++C +  I N P  D + + FP   PW+  
Sbjct  73    LTAYYPFAGRVRDNSFIECNDMGINLSQVRIDCPMSSIFNQPRTDIEKLIFPKD-PWSTS  131

Query  572   HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDS  751
              D  L V QL+ F+CGGI +SA + H V D  ++ NF+  W       +   SP F   S
Sbjct  132   TD-SLIVAQLNHFECGGIVLSACISHNVADAYSMANFVRDWALVALDSEAKPSPLFNGAS  190

Query  752   VF-PTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSA  928
             +F P   S P  +   PS+ ++    KR+ FS  KL  LK      S +  PT  E V+A
Sbjct  191   IFQPANYSAP--QVADPSRKQN--ASKRYHFSASKLKALK----ARSQIP-PTTVEAVTA  241

Query  929   LLYKCCVKAAASRRPSILVHYADMRPPLG---LPCNSAGNILSTFSTSPAAAGEMDLARL  1099
              L KC      + +PS+L+   ++R       +P    GN +  +  S A   +++L RL
Sbjct  242   FLCKCA--NTPTFKPSLLIQAVNLRGTSNDALVPAGLVGNAVLPYVVSAANEEDLNLQRL  299

Query  1100  VAELREGKERLQS-----RDNELVQEIVTSLRT--GEKPYENPDLDIYFCSSLGKYPAYT  1258
             + ELREGKE++ +     +  EL+   V+ L T   E+   N    IY  SSL K P   
Sbjct  300   IGELREGKEKVHNMLKYIKSEELLCSRVSELATQINEQTSSNA-FSIYRFSSLRKLPFRD  358

Query  1259  ADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              +FGWG P +V +   P+ NMF L+DNQ+G G E LV L + +MSGFE +EELL+FA
Sbjct  359   INFGWGRPTRVDIATFPV-NMFVLLDNQNGDGVEVLVNLDEGEMSGFESNEELLQFA  414



>ref|XP_006340447.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=427

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 225/412 (55%), Gaps = 42/412 (10%)
 Frame = +2

Query  305   IPLVFFYPNNN-RTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVR  481
             +P+V FYP +  +  P  +S +L+N+ S+ ++   P+ G L DNAT+ C++ GAEFF V 
Sbjct  1     MPIVLFYPKHQLQQGPKHLSKLLENSFSKAISYHQPWVGSLSDNATIHCDNTGAEFFEVE  60

Query  482   VNCTLLDIINHPDADAQNVAFPAGLPWANI---HDGG-LAVFQLSEFDCGGIAVSAAMCH  649
             VNC +  +++HPD     +AFP GLPW N+   HDGG L+V QLS F+CGGIAVS  M H
Sbjct  61    VNCPMDQVVHHPD-----LAFPPGLPWRNVPPAHDGGCLSVAQLSHFECGGIAVSVCMSH  115

Query  650   KVGDGGTVRNFMGHWVAATR---HPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDC  820
             KVGD  +   F+  W   TR   + +   +P +V DS+ P+ P GPLD P++      D 
Sbjct  116   KVGDARSAFFFLKDWATLTRKYPNGESTCAPYYVQDSLMPSRPDGPLDFPVMVEPNTQDT  175

Query  821   V--QKRFVFSGEKLDLLKDVVSEE--SGVKNPTRAEIVSALLYKCCVKAAA---------  961
             +  +KRF  S  K+  LK  VS +  S V+NPT  E+VSAL YKC   A A         
Sbjct  176   IDLEKRFFLSEFKIRALKAFVSSDKSSTVQNPTTTEVVSALFYKCAATAGANLSNTGNSS  235

Query  962   SRRPSILVHYADMR---PPLGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERL  1132
             +   S LV  +D+R   PP      + GNIL+ FST      ++ L +LV+++R+ K  L
Sbjct  236   NDSSSQLVLVSDLRKTIPPSIQSTTTIGNILTAFSTPTYNLEDLRLPKLVSDIRKSKLEL  295

Query  1133  QSRDN-----------ELVQEIVTSLRTGEKPYENPDL-DIYFCSSLGKYPAYTADFGWG  1276
              ++DN           E   ++ T +   +   +     D+Y CSS+   P    DFGWG
Sbjct  296   SNKDNFKNNTWISEMLEYTNKVNTRVEDAQSYLQKSSCHDVYRCSSICNMPYQDLDFGWG  355

Query  1277  WPCKVSMPKGPMKNMFFLIDNQ-SGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              P + SM   P  N+ +L++      G E  + L +  MS FE+D++LL+FA
Sbjct  356   RPSRASMASAPFNNVLYLMNTHDQSKGIEVFINLNEQQMSIFEQDKDLLQFA  407



>ref|XP_009618364.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Nicotiana 
tomentosiformis]
Length=415

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 151/351 (43%), Positives = 206/351 (59%), Gaps = 18/351 (5%)
 Frame = +2

Query  413   AGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGLAV  592
             AG+L +N +VDCND G EFF  +++C +  I+  P +D +++ +P G+P    ++G LAV
Sbjct  65    AGKLNENISVDCNDRGVEFFTTKIDCPMAKILKDPYSDKEDLVYPKGIPCTYSYEGSLAV  124

Query  593   FQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL-SPNFVSDSVFPTLP  769
              QLS F+CGGIAVSA + HKVGDG T+ NF+  W    R+P   + SP F + S++P  P
Sbjct  125   VQLSYFNCGGIAVSACLTHKVGDGYTIANFIRDWATIARNPSSKIQSPQFNAASIYP--P  182

Query  770   SGPL-DKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCC  946
             +  + + P I  K E +C  K F FS  KL  LK +V   S V+NPT  EIVSA +Y+  
Sbjct  183   TKDMVNLPEIVPKGE-ECSSKSFAFSLSKLAALKSMVINNSVVQNPTATEIVSAFIYQRA  241

Query  947   V----KAAASRRPSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELR  1114
             +    K + S  PS+LV   ++RPP  LP    GNI S FS       EMDL R+V +LR
Sbjct  242   MATKKKTSGSICPSVLVQAMNLRPP--LPKTLMGNIGSFFSVITTEEKEMDLPRVVGKLR  299

Query  1115  EGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWG  1276
             E K+ ++ +      D  L   I       +  + N   DIY  SS+ K+P Y  DFGWG
Sbjct  300   EAKQEVRKKYKHDKTDEFLPMTIELFREANDSFFNNSCYDIYRFSSINKFPFYDIDFGWG  359

Query  1277  WPCKVSMP-KGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRF  1426
              P KVS+   GP+KNMF LIDN+S  G E +  +K+ D S  ERDEELL+F
Sbjct  360   KPEKVSLASNGPVKNMFVLIDNKSRDGMEVVSCMKEQDTSALERDEELLKF  410



>ref|XP_008226170.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=454

 Score =   261 bits (666),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 166/454 (37%), Positives = 240/454 (53%), Gaps = 45/454 (10%)
 Frame = +2

Query  167   ETKMAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD  346
             ETK+ II        ER  IKPSS TPP LR  KLS  DQ    +YIP++ +YPN   T 
Sbjct  4     ETKVQII--------ERQTIKPSSATPPHLRSFKLSFFDQTAIVIYIPILLYYPNTGSTS  55

Query  347   PTRVS------------DILQNALSRTLTSFYPYAGRLLD-NATVDCNDAGAEFFRVRVN  487
               R                L  +LS+TLT FYP AGR+++  A V+CNDAGAEF + R+N
Sbjct  56    KVRTGHHDHVVAINERCQHLIESLSKTLTHFYPLAGRIIEGKAMVECNDAGAEFVKARIN  115

Query  488   CTLLDIINHPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGG  667
             C+L +I+ HPDA       P          G L   Q++ F+CGG+A+  ++ H++ D  
Sbjct  116   CSLSEILEHPDAQMLKEFLPIEYESKEASTGRLLRVQINCFECGGMAIGLSISHRIADAS  175

Query  668   TVRNFMGHWVAATRHPK-----LNLSPNFVSDSVFPTLPSGPLDKPMIPSKIE-DDCVQK  829
             T+  F+  W       +     L + P F +  VFP +      +P     I+ ++C+ K
Sbjct  176   TLSTFIKCWATIAFGSRDSDQVLLVLPKFGAAPVFPPIDFSNCTQPPAREVIKVENCITK  235

Query  830   RFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAA-----SRRPSILVHYA  994
             RFVF   K+  L+   S  S V  PTR E VSAL++KC ++A++     ++R S      
Sbjct  236   RFVFDASKIAALQS-ESTSSVVPKPTRVEAVSALIWKCAMEASSRSKLGTQRRSGFCQDV  294

Query  995   DMR----PPLGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR-DNELV-  1156
             ++R    PP  LP N  GN++ +F TS A  G +DL  LVA+LREG E L+ +   +LV 
Sbjct  295   NLRKRVVPP--LPENLVGNVVGSF-TSTAEEGTIDLKGLVAKLREGIEELKEKYAKKLVF  351

Query  1157  --QEIVTSLRTGEKPYENPD-LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFF  1327
                E    ++      +N D ++IY C+S  ++P Y ADFGWG P  VS+    +KN+  
Sbjct  352   DSNEAWQGIKDKHSKLKNDDEMEIYSCTSWCRFPFYEADFGWGKPSWVSVISIAIKNIIV  411

Query  1328  LIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             L+D     G EA + + +  M+ FE + ELLR+A
Sbjct  412   LMDKGDCNGIEAWLTMSQESMALFESNVELLRYA  445



>ref|XP_008222036.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Prunus 
mume]
Length=442

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 159/444 (36%), Positives = 239/444 (54%), Gaps = 48/444 (11%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRV-----SD  364
             + I  R  IKP + T P  R + LS L+Q     Y+P+V+FYP      P  +     S+
Sbjct  6     VEIISRETIKPFTSTSPHNRTYNLSFLEQVNPRTYVPVVYFYPKEASETPDFLTGGDKSN  65

Query  365   ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRV-NCTLLDIINHPDADAQNVA  541
              L+ +LS TL  +YP+AGR+ D  ++DCND G  F   R+ N  L +I+ HP  +  ++ 
Sbjct  66    QLKKSLSETLAKYYPFAGRIRDRVSIDCNDDGVTFVEARIKNIELSEILEHPKDEVLDLL  125

Query  542   FPAGLPW---ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
             F   L W   +NI+   L   Q+S FDCGG+AV   M HK+ D  T+ NF+  W A  R+
Sbjct  126   FTDNLQWNDDSNIN--VLLAVQVSFFDCGGMAVGICMSHKIADTSTMINFINDWAAVARN  183

Query  713   PK----LNLSPNFVSDSVFPTLPSGPLDKPMIPSKI--EDDCVQKRFVFSGEKLDLLKDV  874
              K       SP F+S +VFP       D P+ P  +  + +CV KRFVF   K+  LK +
Sbjct  184   NKKCDQYVPSPEFISATVFPRC-----DLPLSPEAMIEKSNCVTKRFVFDATKIAALKAI  238

Query  875   VSEESGVKNPTRAEIVSALLYKCCVKA-----AASRRPSILVHYADMR----PPLGLPCN  1027
             V+E+  ++NPTR E V+A ++   + A      +S  P+  +   ++R    PPL  P +
Sbjct  239   VTEK--LQNPTRVEAVTAFIHSRAISALRSTSGSSSNPTTFIQTVNLRARMVPPL--PQS  294

Query  1028  SAGNILSTFSTSPAAAGEMDLARLVAELREGK--------ERLQSRDN--ELVQEIVTSL  1177
             SAG+++  F+ S A    ++L  LV ++++ K         + +++D    + +E +   
Sbjct  295   SAGSMIWFFTVSTAEDSVVELHDLVGQMKQRKTKFCDTYVRKFRAKDQWPSIFKECIQES  354

Query  1178  RTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGF  1357
             R   KP+   +L IY CSS  ++P Y ADFGWG P  V++    MKN  F+ID + G G 
Sbjct  355   R---KPFSKGNLVIYRCSSWCRFPVYEADFGWGKPIWVTIASCAMKNAVFMIDTRDGEGI  411

Query  1358  EALVMLKKTDMSGFERDEELLRFA  1429
             EA V L+K ++  FERD ELL FA
Sbjct  412   EAYVNLEKQELDVFERDAELLAFA  435



>emb|CDP12986.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 154/431 (36%), Positives = 243/431 (56%), Gaps = 25/431 (6%)
 Frame = +2

Query  197   PLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP---NNNRTDPTRVSDI  367
             P +IS ++LIKPS PT   L+ + LS+LDQ     Y+P+V FYP   ++N ++ T +S  
Sbjct  6     PQTIS-KVLIKPSLPTSEHLKTYNLSVLDQLSPHFYLPIVLFYPPPDSDNSSNYTTISSH  64

Query  368   LQNALSRTLTSFYPYAGRLLDNA-TVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAF  544
             L+ +LS TLT +YP+AGRL  N  ++DCND G +F+  R+ C + D++ +PD +  +   
Sbjct  65    LKKSLSETLTHYYPFAGRLAPNKDSIDCNDEGLDFYEARIECKISDVLKNPDPETMDSFS  124

Query  545   PAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLN  724
             P G+ +     G   + Q++ F CGG A+S +M HKV D   +  F+  W A      + 
Sbjct  125   PPGMLFNESFQGSPFIVQVTYFSCGGTAISVSMLHKVTDACALLGFINDWAALASGSMV-  183

Query  725   LSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESG-VKN  901
              SP F++  V      G ++ P I      + V +RF F+  KL  LK + S++ G + +
Sbjct  184   -SPMFLTQQVISPY-KGEINVPGINLDKNINVVTRRFSFNPSKLSDLKAMASDDLGKIHS  241

Query  902   PTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPL--GLPCNSAGNILSTFSTS  1063
             P+R E+V+AL+YKC + A+ ++    RPS+L+  A+MRP +   LP N AGN    FS  
Sbjct  242   PSRVEVVAALIYKCAMAASEAKSGMSRPSMLMQAANMRPRVVPPLPDNCAGNFSWFFSIM  301

Query  1064  PAAAGEMDLARLVAELREGKERLQ-------SRDN--ELVQEIVTSLRTGEKPYENPDLD  1216
                  + ++  +++ +++  +          S DN   L+ E +   R   +  +  +++
Sbjct  302   TNDEKDKNMTTIISAVKKAAQGFSEKFGNGLSADNCYSLICESIEGARKVMRQNQG-EIE  360

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             +Y CSSL +YP    +FGWG P  V      MKN F L+DN   GG EALV L++++MS 
Sbjct  361   VYRCSSLCRYPFNLINFGWGRPIWVGTSTSQMKNTFHLLDNPKSGGIEALVTLEESNMSM  420

Query  1397  FERDEELLRFA  1429
             FE+DEELL+FA
Sbjct  421   FEKDEELLKFA  431



>ref|XP_006357897.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=432

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 157/435 (36%), Positives = 241/435 (55%), Gaps = 26/435 (6%)
 Frame = +2

Query  185   IASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNR----TDPT  352
             +A+  L++  + +IKPSSPTP S R  K S+ DQ     Y+    F+P         DPT
Sbjct  1     MAASRLALISKKIIKPSSPTPLSHRIKKHSIFDQLNPCSYMSFGMFFPKQYNPTLPVDPT  60

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNAT-VDCNDAGAEFFRVRVNCTLLDIINHPDADA  529
              +S IL+N+LSR LTS+YP AG + D+   V+CND GA+F   +++C + +IIN     A
Sbjct  61    HISTILENSLSRALTSYYPLAGTIRDDGLHVECNDVGAKFLEAKIDCPMSEIINRNSTKA  120

Query  530   QNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             + + FP  LPW    +  L V QL+ F+CGGI++   + HK+ DG ++ NF+ HW A  R
Sbjct  121   EELIFPTDLPWTPSKEN-LVVAQLNHFNCGGISIGLCVSHKIVDGSSLTNFIHHWAAMAR  179

Query  710   HPKLNLSPNFVSD--SVFPTLPSGPLDKPMIPSKIEDD--CVQKRFVFSGEKLDLLKDVV  877
             +P   + P+F  D  S FP + S P+ + ++ SK   +  C+  ++ FS  K++ LK ++
Sbjct  180   NPSAPI-PSFQFDGGSHFPPV-SSPIAEAILKSKTRGNHPCISNKYFFSRSKINSLKAMI  237

Query  878   SEESGVK-----NPTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAG  1036
             + ESG       +PT  E  SA +YKC   A+ S RPSI     ++RP +   LP    G
Sbjct  238   AAESGTSKSSSIDPTSVEAASAFVYKCI--ASNSTRPSIFTQSVNLRPIMKKWLPEEFQG  295

Query  1037  NILSTFSTSPAAA--GEMDLARLVAELREGKERLQSRDNEL--VQEIVTSLRTGEKPYEN  1204
             N    F  +P  A   ++ L RL++ELR+ K+      N +  + E V SL+   +   +
Sbjct  296   NASFLF-MAPEIADPADIKLHRLISELRKEKKMYWETKNLMSTMLEKVKSLQNQLERDHD  354

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
              ++D+Y C+SL K+     D+GWG P ++ +   P+    FL+D+Q+  G E LV LK+ 
Sbjct  355   DEVDVYKCTSLSKFSFRDIDYGWGSPRRMCLGSVPINKKIFLMDSQNEDGIEVLVSLKEE  414

Query  1385  DMSGFERDEELLRFA  1429
              MS  E +  LL FA
Sbjct  415   VMSALETNSNLLEFA  429



>ref|XP_004252044.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=426

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 155/429 (36%), Positives = 233/429 (54%), Gaps = 26/429 (6%)
 Frame = +2

Query  188   ASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRT----DPTR  355
             AS  +S+S R +IKPSSPTP S R HKLSL+DQ  T  Y+  + FYP  N T    +PT+
Sbjct  3     ASRLVSLS-RKIIKPSSPTPLSHRIHKLSLMDQMGTHSYMAALIFYPKQNTTTSMPEPTK  61

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQN  535
             +S +L+ +LS+ LTS+YP+AG++ DN+ V+CND GA+  +VR++C +  I +HP     N
Sbjct  62    ISRVLEKSLSKVLTSYYPFAGQVRDNSFVECNDIGADLSQVRIDCPMSSIFDHPRTYIDN  121

Query  536   VAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP  715
             +  P   PW    D  +A  +L  F+CGG+A+   + HKV DG ++  F+  W    R  
Sbjct  122   LVLPFD-PWFPSTDSLVAA-KLCHFECGGVALGVCLSHKVSDGYSLGKFLKDWSMVARDS  179

Query  716   KLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
             +  LS  F   S+F    S        P   +++   KRF FS   L  LK ++S     
Sbjct  180   EAKLSLLFNGSSIFKPSNSSSFQVVADPPLYKNE--SKRFHFSASNLKSLKSLISSADSA  237

Query  896   KN--PTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG---LPCNSAGNILSTFST  1060
                 PT  E ++A +Y+C      S   S+L+   D R       +P +  GN +  F  
Sbjct  238   TQICPTTVEAITAFIYRC-----VSTPQSLLIQAVDQRGTSNDALVPADLTGNAILPFVV  292

Query  1061  SPAAAGEMDLARLVAELREGKERLQ------SRDNELVQEIVTSLRTGEKPYENPDLDIY  1222
             S     EM+L RLV+ELR+GKE++Q        +  L  ++    R   K   N D+ +Y
Sbjct  293   SATNKEEMNLERLVSELRKGKEKIQDMLKYIESEEFLCSKVSDIARELNKRTSNNDIPMY  352

Query  1223  FCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFE  1402
               SSL ++P+   +FGWG P +V +   P+ NMF L+DNQ+G G E +  L+  ++S  E
Sbjct  353   RFSSLRRFPSNDINFGWGRPRQVDISTFPI-NMFILMDNQNGDGVEVIASLQDGELSALE  411

Query  1403  RDEELLRFA  1429
             R+++ L+FA
Sbjct  412   RNDDFLQFA  420



>ref|XP_011041560.1| PREDICTED: BAHD acyltransferase At5g47980-like [Populus euphratica]
Length=441

 Score =   256 bits (655),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 161/431 (37%), Positives = 235/431 (55%), Gaps = 25/431 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-NRTD----PTRVSD  364
             + I +R  IKPSSPTP  LR  KLSLLDQ +  ++IPL+ FYP N N TD     T  S 
Sbjct  7     IQIMQRETIKPSSPTPLHLRSLKLSLLDQFMPLVHIPLLLFYPRNGNDTDHLAKATERSL  66

Query  365   ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAF  544
             +L+ +LS  LT FYP+AGRL +N++++C+D GAE+   R++C L DI+  PD D      
Sbjct  67    LLKTSLSEALTHFYPFAGRLKENSSIECDDHGAEYIEARIHCILSDILKKPDTDVLKQLL  126

Query  545   PAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP--K  718
             PA +  A        + Q S FDCGG+A+   + HKV D  TV +F+  W A+ R    +
Sbjct  127   PAAISEAATARDSQLLVQASFFDCGGLAIGVNLSHKVADAATVTSFIKCWAASARRSSTE  186

Query  719   LNLSPNFVSDSVFPTLPSGPLDKPMIPSK-IEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
             + +SP F+  S+FP +    L  PM+P   I+ + V KRFVF   K+  LK   +  + V
Sbjct  187   VVISPVFIGASIFPQM---DLPIPMLPVDLIQGESVTKRFVFEAPKITALK-AKAISASV  242

Query  896   KNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPL--GLPCNSAGNILSTFS  1057
              +PTR E V+AL++KC + A+ S     R S+L    ++R  L   LP N  GN + + S
Sbjct  243   PDPTRVESVTALIWKCAMSASRSNLGVPRKSVLSLGVNIRKRLVPTLPDNYGGNYVGSIS  302

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYE------NPDLDI  1219
                    +++L  +V+ +R+          ++ Q   TSL   +   E      + D+D 
Sbjct  303   ARMEDHDDLELQGIVSRIRKDLIEFGENYAKITQGDDTSLAICKAVEEFGKMAMSKDIDY  362

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMP-KGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             Y C+S  ++  Y ADFGWG P  +S      +KN+  LID + G G EA + L   DM+ 
Sbjct  363   YNCTSWCRFELYDADFGWGKPTWLSTVFTIELKNLMCLIDTRDGDGIEACISLSPEDMAL  422

Query  1397  FERDEELLRFA  1429
              E ++ELL FA
Sbjct  423   LESNKELLEFA  433



>ref|XP_004310187.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   256 bits (655),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 155/438 (35%), Positives = 236/438 (54%), Gaps = 39/438 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP-----NNNRTDPTRVSD  364
             + I  R  IKPS+PT P  R + LS L+Q     Y P+V+FYP     +++  +    SD
Sbjct  3     VEIVSRETIKPSTPTLPHYRTYNLSFLEQLNPRTYTPIVYFYPKEASASDHYPNFCDKSD  62

Query  365   ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAF  544
              L+ +LS TL  +YP++GR+ D  ++DCND G  F   R+   L  I+  P  +  ++ F
Sbjct  63    QLKKSLSETLAIYYPFSGRIKDRVSIDCNDEGVIFIEARIKVQLSQILEQPKDEELDLLF  122

Query  545   PAGLPWANIHDGGLAVF---QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP  715
                L W +  D  L V    Q+S FDCGG+A+   M HKV D  T+ NF+  W A TR  
Sbjct  123   TDKLQWND--DSNLTVILAVQVSFFDCGGMAIGICMSHKVADTSTMINFINDWAAMTRDH  180

Query  716   KLN--LSPNFVSDSVFPTLPSGPLDKPMIPSKI--EDDCVQKRFVFSGEKLDLLKDVVSE  883
             K +  +SP F++++VFP    G +  P+ P  +  + DC+ KR+VF   K+  LK +V +
Sbjct  181   KADQYVSPKFIAETVFP---RGEI--PLPPESVIEKGDCISKRYVFDASKIAALKALVCD  235

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASRRPSI------LVHYADMR----PPLGLPCNSA  1033
             +  V+NPTR E+V+A +++C + A  S   S+      L+   +MR    PPL  P +S 
Sbjct  236   K--VQNPTRVEVVTAFIHRCAISALKSNSGSLSNPNTLLIQTVNMRARMVPPL--PKSSV  291

Query  1034  GNILSTFSTSPAAAGE-MDLARLVAELREGKER-----LQSRDNELVQEIVTSLRTGEKP  1195
             G+++  ++ S A     ++L  LV +++E   +     L+    E     +  +    K 
Sbjct  292   GSMVWYYAVSTAEEESVIELHELVTQMKERMAQFCGTYLEKFGKEWPSIFLECMEESRKS  351

Query  1196  YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVML  1375
             +   +L +Y CSS  ++P Y ADFGWG P  V++    +KN  FLID ++G G E  V L
Sbjct  352   FHIQNLVVYRCSSWCRFPIYEADFGWGKPIWVTIASCVLKNTIFLIDARNGEGIEVYVNL  411

Query  1376  KKTDMSGFERDEELLRFA  1429
             +K  M  FERD ELL FA
Sbjct  412   EKQHMDMFERDPELLAFA  429



>ref|XP_009783370.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=386

 Score =   254 bits (649),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 162/412 (39%), Positives = 232/412 (56%), Gaps = 48/412 (12%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRT---DPTRV-SDILQNAL  382
             + +IKP  PTP SLR HKLS LDQ +  +Y PL  FYP  + T    P+ V S+ L+N+L
Sbjct  12    KKIIKPYFPTPTSLRCHKLSYLDQMVAGIYEPLALFYPKLSDTWSDKPSNVISEHLENSL  71

Query  383   SRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPW  562
             S+ L+ +YP+AG+L +N +VDCND G EFF  +++C +  I+  P +D +++ +P G+P 
Sbjct  72    SKVLSHYYPFAGKLNENISVDCNDRGVEFFTTKIDCPMSKILKDPYSDKEDLVYPKGIPC  131

Query  563   ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL-SPNF  739
                +DG LAV QLS F+CGGIAVSA + HK+GDG TV NF+  W    R+P   + SP F
Sbjct  132   TYSYDGSLAVVQLSHFNCGGIAVSACLTHKIGDGYTVANFIHDWATIARNPSSKIQSPQF  191

Query  740   VSDSVFPTLPSGPL-DKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
              + S++P  P+  + + P I  K E +C  K F FS  K+  LK +V   S V+NPT  E
Sbjct  192   NAASIYP--PTKDMANLPEIVPKGE-ECSSKSFAFSSSKIASLKAMVINNSEVQNPTTTE  248

Query  917   IVSALLYKCCVKAAASRRPSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAAGEMDLAR  1096
             IVSA +Y+   +A A+++      + D+   +   C    +I   F+      G+     
Sbjct  249   IVSAFIYQ---RAMATKKEDF---WFDLSIRISPCCELTTSIADKFN------GKYWFFL  296

Query  1097  LVAELREGKERLQSRDNELVQEIVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWG  1276
                  R      + RD         S ++G            + SS+ K+P Y  DFGWG
Sbjct  297   FYINNR------RERDG--------STKSG------------WFSSISKFPIYDIDFGWG  330

Query  1277  WPCKVSM-PKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              P KVS+   GP+KNMF L+DN+S  G E +  +K+ DMS  E+DEELL FA
Sbjct  331   KPEKVSLVSNGPVKNMFLLMDNKSRDGMEVVTYMKEQDMSALEKDEELLEFA  382



>ref|XP_010313351.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=427

 Score =   255 bits (652),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 144/420 (34%), Positives = 224/420 (53%), Gaps = 16/420 (4%)
 Frame = +2

Query  203   SISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNAL  382
             +I  R +IK  SPTP SLR HKLS +D      Y P  F YP       T++S IL+N+L
Sbjct  5     TILSRKMIKLLSPTPSSLRHHKLSFMDCINLPQYSPFAFLYPKPKNHTKTQISQILENSL  64

Query  383   SRTLTSFYPYAGRLLDNAT-VDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             S+ L+S+YP+AGR+ DN T VDCND G E+  VR+N ++ DI+N    D  ++ +P  LP
Sbjct  65    SKVLSSYYPFAGRIKDNNTYVDCNDIGVEYLNVRINHSMSDILNSRCNDVADIVYPKDLP  124

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
             W++  +    V QLS FDCGGI +   + HK+ DG  +  F+  W    R      S  F
Sbjct  125   WSSSVNRSPLVIQLSHFDCGGIGLGVCLSHKIVDGYCIAKFISDWANTARDMDFKPSIKF  184

Query  740   VSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEI  919
              + + FP +   P    +  S      V + + FS   L  LK  +   +GV+NPTR E+
Sbjct  185   NASTFFPLIEGAPNIMSINSSPQSQRYVSRAYNFSSSNLKRLKRSI---TGVQNPTRVEV  241

Query  920   VSALLYKC----CVKAAASRRPSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAAGEMD  1087
              ++L++KC     +K   S +PS++    ++RP   +P ++ GN    +S       E++
Sbjct  242   ATSLIHKCGAIASMKNLGSFKPSLISQVINLRPL--IPLDTMGNATCIYSIIATTENEIE  299

Query  1088  LARLVAELREGKERLQSR-----DNELVQEIVTSLRTGEKPYENPDLDIYFCSSLGKYPA  1252
             L   VA+++  K+++++       +++V   +  +R      E    DIY  +S+  +  
Sbjct  300   LPNYVAQMQNVKQQIRNELKNLDTDKIVPYTLEKVRGIVDIMEKDIFDIYLSTSVHNFGL  359

Query  1253  YT-ADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             Y+ A+FGWG P KVS  K P K    L D+ S  G +A + L + +M+ F+ D+ELL FA
Sbjct  360   YSKANFGWGKPIKVSNTKYPTKKSIMLFDDPSEEGIDAQITLTEDEMAIFQEDKELLEFA  419



>ref|XP_004243893.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
lycopersicum]
Length=431

 Score =   254 bits (649),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 153/433 (35%), Positives = 237/433 (55%), Gaps = 23/433 (5%)
 Frame = +2

Query  185   IASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNR----TDPT  352
             +A+  L++  + +IKPSSPTP   R  KLS+ DQ     Y+    F+P         DPT
Sbjct  1     MAASQLALISKKIIKPSSPTPLIHRIQKLSIFDQLNPCSYMSYGLFFPKQCHPTLPDDPT  60

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNAT-VDCNDAGAEFFRVRVNCTLLDIINHPDADA  529
              +S IL+N+LSR LTS+YP AG + D    V+CND GA+F +V+++C +  I +    +A
Sbjct  61    HISTILENSLSRALTSYYPLAGTIRDEGLHVECNDVGAKFLQVKIDCPMSQIFDQKSTEA  120

Query  530   QNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             +++  P  LPW    +  L V Q++ F+CGGIA+   + HKV DG ++ NF  HW    R
Sbjct  121   EDLVLPRDLPWTPSKEN-LVVAQVNHFNCGGIAIGVCVSHKVVDGSSMANFTHHWSTMAR  179

Query  710   HPKLNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIE--DDCVQKRFVFSGEKLDLLKDVVS  880
             +P   + S  FV  S FP + S P+ + ++ SK    + C+ K+++ S  K++ LK +++
Sbjct  180   NPSAPIPSFQFVGGSHFPPV-SSPIAEAILQSKTRGNNTCISKKYLLSRSKINSLKAMIA  238

Query  881   EESGVKN----PTRAEIVSALLYKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNI  1042
              ESG K+    P+  E  SA +YKC   A+ S +PSI     ++RP +   LP    GN 
Sbjct  239   AESGNKSSSITPSSVEAASAFVYKCI--ASNSTKPSIFTQSVNLRPIMKKWLPEEFQGNA  296

Query  1043  LSTFSTSPAAA--GEMDLARLVAELREGKERLQSRDNEL--VQEIVTSLRTGEKPYENPD  1210
                F  +P  +   ++ L RL++ELR+ KE      N +  + E V  L+   +   + +
Sbjct  297   SFLF-MAPEISDPADIKLHRLISELRKEKEMYWETTNLMSTLLEKVKLLQNQLERDHDDE  355

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             +D+Y C+SL K+     D+GWG P +V +   P+    FL D+Q+  G E +V LK+  M
Sbjct  356   VDVYKCTSLSKFIFGQMDYGWGSPTRVCLGSVPINKKIFLTDSQTEDGIEVVVSLKQQQM  415

Query  1391  SGFERDEELLRFA  1429
             S  E    LL FA
Sbjct  416   SALETKSNLLEFA  428



>ref|XP_006378283.1| hypothetical protein POPTR_0010s06650g [Populus trichocarpa]
 gb|ERP56080.1| hypothetical protein POPTR_0010s06650g [Populus trichocarpa]
Length=441

 Score =   254 bits (649),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 162/431 (38%), Positives = 233/431 (54%), Gaps = 25/431 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-NRTD----PTRVSD  364
             + I +R  IKPSSPTP  LR  KLSLLDQ +  ++IPL+ FYP N N TD     T  S 
Sbjct  7     IEIMQRETIKPSSPTPLHLRSLKLSLLDQFMPVVHIPLLLFYPRNGNDTDHLAKATERSL  66

Query  365   ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAF  544
             +L+ +LS  LT FYP+AGRL DN++++C+D GAE+   R++C L DI+  PD +      
Sbjct  67    LLKTSLSEALTHFYPFAGRLKDNSSIECDDHGAEYIEARIHCILSDILKKPDTEVLKQLL  126

Query  545   PAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP--K  718
             PA L  A        + Q S FDCGG+A+   + HKV D  TV +F+  W A  R    +
Sbjct  127   PAALSEAATARDSQLLVQASFFDCGGLAIGVNLSHKVADAATVTSFIKCWAATARRSSTE  186

Query  719   LNLSPNFVSDSVFPTLPSGPLDKPMIPSK-IEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
             + +SP F+  S+FP +    L  PM+P   I+ + V KRFVF   K+  LK   +  + V
Sbjct  187   VVISPVFMGASIFPQM---DLPIPMLPVDLIQGESVMKRFVFEAPKITALK-AKAISASV  242

Query  896   KNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPL--GLPCNSAGNILSTFS  1057
              +PTR E V+AL++KC + A+ S     R S+L    ++R  L   LP N  GN + + S
Sbjct  243   PDPTRVESVTALIWKCAMSASRSNLGVPRKSVLSLGVNIRKRLVPTLPDNYGGNYVGSIS  302

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYE------NPDLDI  1219
                    +++L  +V+ +R+          ++ Q   TSL   +   E      + D+D 
Sbjct  303   ARMEDHDDLELQGIVSRIRKDLIEFGENYAKITQGDDTSLAICKAVEEFGKMATSKDIDY  362

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMP-KGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             Y  +S  ++  Y ADFGWG P  +S      +KN+  LID + G G EA + L   DM+ 
Sbjct  363   YNGTSWCRFELYDADFGWGKPTWLSTVFTIELKNLMCLIDTRDGDGIEACISLSPEDMAL  422

Query  1397  FERDEELLRFA  1429
             FE + ELL FA
Sbjct  423   FESNRELLEFA  433



>ref|XP_003532711.2| PREDICTED: vinorine synthase-like [Glycine max]
Length=456

 Score =   254 bits (649),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 156/438 (36%), Positives = 231/438 (53%), Gaps = 42/438 (10%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTL  394
             R  IKPS+PTPP LR H LS +D  +   YIPL+FFY + N    + +S  L+ +LS+ L
Sbjct  6     RETIKPSNPTPPHLRIHPLSFIDHIVFRNYIPLLFFYNSPNHEQASTISK-LKKSLSQVL  64

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
             + +YP+AG+L D  ++DCND G  F   R+ C L  I+ +P  ++ N  FP  L W  + 
Sbjct  65    SRYYPFAGKLRDQVSIDCNDQGVSFLVTRLRCNLSTILQNPTEESLNPLFPDELQWKPMS  124

Query  575   DGG---LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVS  745
                   +   Q++ F CGGIA+S  MCHKVGD  T+ NF+  W    R  +L      + 
Sbjct  125   SSSSSSIIAIQINCFACGGIAMSVCMCHKVGDAATLSNFINDWATLNRQKELEQETAELL  184

Query  746   DSVFPTLPSGPL----DKPMIPSK--IEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPT  907
                FP +P   L    + P+ P    +E+D V +RFVF   K+D LK  VS  + V NPT
Sbjct  185   LLPFP-VPGASLFPQENLPVFPEVLFVENDTVCRRFVFEASKIDSLKSTVSSHN-VPNPT  242

Query  908   RAEIVSALLYKCCVKA------AASRRPSILVHYADMRPPLGLPCNSAGNILS-TFSTSP  1066
             R E+VSAL+Y   V A        S R ++ +    + P   LP  S GN++   F  SP
Sbjct  243   RVEVVSALIYNRAVSALGLISKTTSFRTAVNLRTRTVPP---LPEKSVGNLVWFLFVLSP  299

Query  1067  AAAGEMDLARLVAELREGKERL----------QSRDNELVQEIVTSLRTGEKPY------  1198
                 E +L  LV ++++G              + +D   + E +    +  +P       
Sbjct  300   ---WETELHELVLKMKQGLTEFCETYAKKFGGEDKDMSFISECLKQAASVPEPQPGGSDD  356

Query  1199  -ENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVML  1375
              E+  + ++ C+S  ++P Y ADFGWG P   +  K P+KN   L+D + GGG EA+V +
Sbjct  357   EESQIVTMFCCASWCRFPMYEADFGWGKPVWFTTSKCPVKNSIVLMDTRDGGGIEAIVNM  416

Query  1376  KKTDMSGFERDEELLRFA  1429
             ++ DM+ FERD ELL++A
Sbjct  417   EEQDMARFERDVELLKYA  434



>ref|XP_011041559.1| PREDICTED: BAHD acyltransferase At5g47980-like [Populus euphratica]
Length=447

 Score =   253 bits (645),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 165/438 (38%), Positives = 236/438 (54%), Gaps = 27/438 (6%)
 Frame = +2

Query  185   IASPPLSIS--ERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-NRTD---  346
             I S PL I   +R  IKPSSPTP  LR  KLSLLDQ +   +IPL+ FYP N N TD   
Sbjct  6     IMSVPLRIEIMQRETIKPSSPTPFDLRSLKLSLLDQIMPVGHIPLLLFYPRNGNDTDHLA  65

Query  347   -PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA  523
               T  S +L+ +LS  LT FYP+AGRL DN++++C+D GAE+   R++C L DI+  PD 
Sbjct  66    KATERSLLLKTSLSEALTHFYPFAGRLKDNSSIECDDHGAEYIEARIHCILSDILKKPDT  125

Query  524   DAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAA  703
                    PA +  A        + Q S FDCGG+A+   + HKV D  T+ +F+  W A 
Sbjct  126   KVLKQLLPADISEAATARDNQLLVQASFFDCGGLAIGVNLSHKVADAATLTSFIKCWAAT  185

Query  704   TRHP--KLNLSPNFVSDSVFPTLPSGPLDKPMIPSK-IEDDCVQKRFVFSGEKLDLLKDV  874
              R    ++ +SP F+  S+FP +    L   M+P   I+ + V KRFVF   K+  LK  
Sbjct  186   ARRSSTEVVISPVFMGASIFPQM---DLPISMLPVDLIQGESVMKRFVFEAPKITALK-A  241

Query  875   VSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPL--GLPCNSAG  1036
              +  + V +PTR E V+AL++KC + A+ S     R S+L    ++R  L   LP N  G
Sbjct  242   KAISASVPDPTRVESVTALIWKCAMSASRSNLGVPRKSVLSLGVNIRKRLVPTLPDNYGG  301

Query  1037  NILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYE-----  1201
             N + + S       +++L  +V+ +R+          ++ Q   TSL   +   E     
Sbjct  302   NYVGSISARMEDHDDLELQGIVSRIRKDLIEFGENYAKITQGDDTSLAICKTVAEFGKMA  361

Query  1202  -NPDLDIYFCSSLGKYPAYTADFGWGWPCKVS-MPKGPMKNMFFLIDNQSGGGFEALVML  1375
              + D+D Y C+S  ++  Y ADFGWG P  +S +    +KN+  LID + G G EA V L
Sbjct  362   MSKDIDYYNCTSWCRFELYDADFGWGKPTWLSNVLTIELKNVMCLIDTRDGDGIEACVSL  421

Query  1376  KKTDMSGFERDEELLRFA  1429
                DM+ FE ++ELL FA
Sbjct  422   SPEDMALFESNKELLEFA  439



>ref|XP_011041557.1| PREDICTED: BAHD acyltransferase At5g47980-like [Populus euphratica]
 ref|XP_011041558.1| PREDICTED: BAHD acyltransferase At5g47980-like [Populus euphratica]
Length=441

 Score =   252 bits (643),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 160/431 (37%), Positives = 233/431 (54%), Gaps = 25/431 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-NRTD----PTRVSD  364
             + I +R  IKPSSPTP  L   KLSLLDQ +  ++IPL+ FYP N N TD     T  S 
Sbjct  7     IEIMQRETIKPSSPTPFDLGSLKLSLLDQIMPLVHIPLLLFYPRNGNDTDHLAKATERSL  66

Query  365   ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAF  544
             +L+ +LS  LT FYP+AGRL DN++++C+D GAE+   R++C L DI+  PD D      
Sbjct  67    LLKTSLSEALTHFYPFAGRLKDNSSIECDDHGAEYIEARIHCILSDILKKPDTDVLKQLL  126

Query  545   PAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP--K  718
             PA +  A        + Q S FDCGG+A+   + HKV D  T+ +F+  W A  R    +
Sbjct  127   PAAISEAATARDSQLLVQASFFDCGGLAIGVNLSHKVADAATLTSFIKCWAATARRSSTE  186

Query  719   LNLSPNFVSDSVFPTLPSGPLDKPMIPSK-IEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
             + +SP F+  S+FP +    L   M+P   I+ + V KRFVF   K+  LK   +  + V
Sbjct  187   VVISPVFMGASIFPQM---DLPISMLPVDLIQGESVMKRFVFEAPKITALK-AKAISASV  242

Query  896   KNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPL--GLPCNSAGNILSTFS  1057
              +PTR E V+AL++KC + A+ S     R S+L    ++R  L   LP N  GN + + S
Sbjct  243   PDPTRVESVTALIWKCAMSASRSNLGVPRKSVLSLGVNIRKRLVPTLPDNYGGNYVGSIS  302

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYE------NPDLDI  1219
                    +++L  +V+ +R+          ++ Q   TSL   +   E      + D+D 
Sbjct  303   ARMEDHDDLELQGIVSRIRKDLIEFGENYAKITQGDDTSLAICKAVEEFGKMAMSKDIDY  362

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMP-KGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             Y C+S  ++  Y ADFGWG P  +S      +KN+  LID + G G EA + L   DM+ 
Sbjct  363   YNCTSWCRFELYDADFGWGKPTWLSTVFTIELKNLMCLIDTRDGDGIEACISLSPEDMAL  422

Query  1397  FERDEELLRFA  1429
             FE ++ELL FA
Sbjct  423   FESNKELLEFA  433



>emb|CDP19225.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   249 bits (636),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 163/441 (37%), Positives = 229/441 (52%), Gaps = 31/441 (7%)
 Frame = +2

Query  188   ASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMY-IPLVFFYPN--NNRTDPTRV  358
             AS    I    +IKPSSPTPP LR+HKLS +DQA+   Y I L FFY N    R     +
Sbjct  3     ASLQFEIISETVIKPSSPTPPPLRYHKLSSVDQAMPPNYRIRLAFFYANIKGTRWLANEI  62

Query  359   SDILQNALSRTLTSFYPYAGRLLDNA-TVDCNDAGAEFFRVRVNCTLLDI---INHPDAD  526
             S +L+++ S+ L  +YP+AGRL+ N   +DCND GA+F   R+N  + +I   ++     
Sbjct  63    SQLLKSSFSKALAQYYPFAGRLMKNGYMIDCNDMGAQFTEGRINSRVAEIRKQLSSSSEK  122

Query  527   AQNVAFPAGL---PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWV  697
              Q++ F   L   P A+ +   L   QLS F+CGGI +S ++ H++ D  +V  FM  W 
Sbjct  123   VQDLIFARSLFSGP-ASANHRSLVFVQLSSFNCGGIVLSVSINHRIADASSVSTFMNDWA  181

Query  698   AATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVV  877
             A  R      SP+    S+FP +       P  P   +    ++   F   K+  LK   
Sbjct  182   AIARQTSDIPSPHLHGASLFPPVDGQQYRHPFPPKPDQGKYAKRILAFHASKIGELK-AA  240

Query  878   SEESGVKNPTRAEIVSALLYKCCVKAAASR------RPSILVHYADMR----PPLGLPCN  1027
             +  SGV+NPTR E+VSALLY C + AA+        RPSI  +  + R    PP  LP N
Sbjct  241   ALNSGVENPTRFEVVSALLYSCFMSAASKANSGSHIRPSIFFNAVNFRQIIVPP--LPQN  298

Query  1028  SAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEK-----  1192
             S GN +++F TS     E+ L  LV +LREGK +L+    E +  I + L+         
Sbjct  299   SVGNFVTSFLTSVDNNAEVKLPELVNKLREGKTKLRKECTENINAIPSKLKASHSASPTV  358

Query  1193  PYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMK--NMFFLIDNQSGGGFEAL  1366
               E  + D Y CSS  ++P Y  DFGWG P  V     P +  N+  LID + G G  A 
Sbjct  359   AIETINSDCYGCSSWCRFPFYGVDFGWGTPSLVYPAIIPEQNANILVLIDMEDGNGIYAH  418

Query  1367  VMLKKTDMSGFERDEELLRFA  1429
             ++LK+ DMS  E +E LL +A
Sbjct  419   LILKELDMSLLEENEVLLAYA  439



>emb|CAN63243.1| hypothetical protein VITISV_028808 [Vitis vinifera]
Length=429

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 156/432 (36%), Positives = 228/432 (53%), Gaps = 37/432 (9%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTS-MYIPLVFFYPN---NNRTDPTRVSDILQ  373
             I  R  IKPSSPTP S + +KLSLLD  + + +Y+P++FFY N   +N  D   +S  L+
Sbjct  8     IISRQTIKPSSPTPDSKKIYKLSLLDLLIANRIYVPIIFFYQNKEGDNSVDVAHISSGLK  67

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-DAQNVAFPA  550
              +LS TLT +YP AGR+ D  TV+CND GA F   R++C L   + HP+A D  ++  P 
Sbjct  68    KSLSETLTHYYPLAGRIKDGVTVECNDEGAYFSEARIDCHLEGFLKHPEARDYLDLLMPV  127

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
              +   +   G L + Q++ F CG IA+   + HKV D   +  F+  W    R      S
Sbjct  128   EIQSNSSDMGSLLLIQITFFSCGRIAIGMRVSHKVSDLHGISAFLNDWATMARK-----S  182

Query  731   PNFVSDSVFPTLPSG-----PLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
                +S  + P  P G     P  KP      + + V+KRFVF   KL  LK  ++ +SGV
Sbjct  183   GEEISAELTPFFPPGDSLSMPEAKPY-----KGNLVKKRFVFDAVKLGALK-AMATQSGV  236

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMR----PPLGLPCNSAGNILST  1051
             +NPTR E+V+AL+Y+C V A    + S +PS+L+   ++R    PP  LP  S GN++  
Sbjct  237   ENPTRVEVVAALIYRCAVAASKVSSGSLKPSVLLQTVNLRKRIVPP--LPEKSFGNMVWF  294

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQS------RDNELVQEIVTSLRTGEKPYENPDL  1213
             +S   A   E++   LV +L+ G               EL++ I           +N  +
Sbjct  295   YSIHTARESEIEFHALVGQLKAGLAHFCDTYGKIFTGQELIRLIFKERAKFTHSNDNHHV  354

Query  1214  DIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
             + Y C+S  +   Y  D+GWG P  +S      KN+  L D + G G EA V L+K +M+
Sbjct  355   NKYICTSWCRTSLYQTDYGWGKPIWLSPTGIGSKNIICLTDTREGDGIEAFVTLEKQEMA  414

Query  1394  GFERDEELLRFA  1429
              FERDEELL+F+
Sbjct  415   VFERDEELLQFS  426



>gb|KDP26744.1| hypothetical protein JCGZ_17902 [Jatropha curcas]
Length=438

 Score =   248 bits (632),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 140/408 (34%), Positives = 231/408 (57%), Gaps = 31/408 (8%)
 Frame = +2

Query  260   FHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTLTSFYPYAGRLLDNAT  439
              H LS  DQ  + +Y+P VFFY        T+ + +L+ +LS  L+ +YP AGR+ D+ +
Sbjct  28    IHNLSFFDQISSHIYLPFVFFY--TKHVSNTKSTLLLKESLSAALSRYYPLAGRIRDDFS  85

Query  440   VDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCG  619
             VDCND G +F   R++C L +I+ +P+ +   +  P  L + +     L + Q++ F+CG
Sbjct  86    VDCNDEGVDFLEARIDCKLSEILKNPEDETLKILLPDDLQYKDPTLSSLLIVQVTLFECG  145

Query  620   GIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMI-  796
             G+A++  + HKV D  ++  F+ +W A  ++P   + P F    ++      P+D P++ 
Sbjct  146   GMALAICISHKVMDIASMCYFINNWAAIAKNPDEKMGPEFNLGYLYL-----PIDLPVME  200

Query  797   ---PSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR  967
                P K++  CV KR VF G K+D LK   ++E  VKNPTR E+V+A+L+K  + AA +R
Sbjct  201   VYEPEKVK--CVSKRIVFYGSKIDKLKATAAKE--VKNPTRVEVVTAILHKTAISAARAR  256

Query  968   ----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGK  1123
                 + +++ + A++R    PP  LP ++AGNI  TF  S     ++++A L  ++ + K
Sbjct  257   SGSLKSTVMHNAANLRTRLFPP--LPESTAGNISGTFPVSTTEESDIEVALLANKINKEK  314

Query  1124  ERLQS---RDNELVQE---IVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPC  1285
              +  S   ++N   +E   +V    TG +     + D+Y CSS  ++P Y ADFGWG P 
Sbjct  315   SKYFSSCGKENISAEELCSLVLEASTGLRLSHGSNQDVYLCSSYCRFPFYGADFGWGKPV  374

Query  1286  KVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              V++    +KN+  L+D + G G EA V L++ +M  FE +EELL FA
Sbjct  375   WVTVANCEVKNVIVLMDTRGGDGIEAYVTLEEHEMGLFESNEELLAFA  422



>ref|XP_002267080.1| PREDICTED: vinorine synthase-like [Vitis vinifera]
Length=429

 Score =   246 bits (629),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 155/432 (36%), Positives = 230/432 (53%), Gaps = 37/432 (9%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTS-MYIPLVFFYPN---NNRTDPTRVSDILQ  373
             I  R  IKPSSPTP S + +KLSLLD  + + +Y+P++FFY N   +N  D   +S  L+
Sbjct  8     IISRQTIKPSSPTPDSKKIYKLSLLDLLIANRIYVPIIFFYQNKEGDNSVDVAHISSGLK  67

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-DAQNVAFPA  550
              +LS TLT +YP AGR+ D  TV+CND GA F   R++C L   + HP+A D  ++  P 
Sbjct  68    KSLSETLTHYYPLAGRIKDGVTVECNDEGAYFSEARIDCHLEGFLKHPEARDYLDLLMPV  127

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
              +   +   G L + Q++ F CG  A+   + HKV D   +  F+  W    R      S
Sbjct  128   EIQSNSSDMGSLLLIQITFFSCGRTAIGMRVSHKVSDLHGISAFLNDWATMARK-----S  182

Query  731   PNFVSDSVFPTLPSG-----PLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
                +S  + P  P G     P  KP      + + V+KRFVF   KL  LK  ++ +SGV
Sbjct  183   GEEISAELTPFFPPGDSLSMPEAKPY-----KGNLVKKRFVFDAVKLGALK-AMATQSGV  236

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMR----PPLGLPCNSAGNILST  1051
             +NPTR E+V+AL+Y+C V A    + S +PS+L+   ++R    PP  LP  S GN++  
Sbjct  237   ENPTRVEVVAALIYRCAVAASKVSSGSLKPSVLLQTVNLRKRIVPP--LPEKSFGNMVWF  294

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSRDNELV--QEIVTSLRTGEKPY----ENPDL  1213
             +S   A   E++   LV +L+ G         ++   QE++  +      +    +N  +
Sbjct  295   YSIHTARESEIEFHALVGQLKAGLAHFCDTYGKIFTGQELIPLMFKERAKFTHSNDNHHV  354

Query  1214  DIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
             + Y C+S  +   Y  DFGWG P  +S      KN+  L D + G G EA V L+K +M+
Sbjct  355   NKYICTSWCRTSLYQTDFGWGKPIWLSPTGIGSKNIICLTDTREGDGIEAFVTLEKQEMA  414

Query  1394  GFERDEELLRFA  1429
              FERDEELL+F+
Sbjct  415   VFERDEELLQFS  426



>ref|XP_008383040.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=474

 Score =   246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 152/458 (33%), Positives = 236/458 (52%), Gaps = 27/458 (6%)
 Frame = +2

Query  128   KYHGVEYMFLHTQETKMAIIA-SPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMY  304
             +Y  V  M +  +E +  + + +  + I+ + +IKPSSPTP  L    LS+ DQ    +Y
Sbjct  13    RYMEVRVMIVKLEEWRKTMASENIKVEITHKEIIKPSSPTPRHLSSTDLSVFDQFTPEIY  72

Query  305   IPLVFFYPNNNRTDPTRV---------SDILQNALSRTLTSFYPYAGRLLDNATVDCNDA  457
             +PL+ FYP+++  +   +         S++L+ +LS  LT FYP+AG  + N ++ CND 
Sbjct  73    VPLLLFYPSSSDEEVNSIDHHSLFAERSNLLKTSLSEALTRFYPFAGEFVYNVSIRCNDH  132

Query  458   GAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSA  637
             GA F   +VNC+L  I+  PD     +  P  +       G L + Q++ F CGG+A+  
Sbjct  133   GAGFHEAQVNCSLSKILEKPDLGILKLFVPTAVESKQAEAGHLLLVQVNLFKCGGMAIGV  192

Query  638   AMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF------VSDSVFPTLPSGPLDKPMIP  799
             ++ HKV D  T+  F+  W          + P        V+ ++FP        KP++ 
Sbjct  193   SISHKVADAATLSTFIKSWTEIALGSDSTIVPAVLPAEFRVAATLFPPQDFFSSSKPIVE  252

Query  800   SKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----  967
                E+ CV KRFVF    +  LK   +  + + NPTR E++SAL++KC  +A+ S     
Sbjct  253   FA-ENKCVTKRFVFDAANIAALKSKAA-STTLPNPTRVEVLSALIWKCATEASRSNLGFV  310

Query  968   RPSILVHYADMRPPLG--LPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR  1141
             +PS+L+   +MR   G  L  N  GN L  F TS     E+DL  LV +LR+G E  + +
Sbjct  311   KPSVLLQVLNMRKRSGQALTENILGNFLWYF-TSTTMESELDLESLVEKLRKGIEEYKEK  369

Query  1142  -DNELVQEIV-TSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMK  1315
               + L  E++  SL+           + Y C+S  ++P Y A+FGWG P  VS     +K
Sbjct  370   YPSGLSSEVIFQSLKESGNLLLKDSTENYTCTSWCRFPFYEANFGWGKPSWVSTHGSELK  429

Query  1316  NMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             N   L+D   G G EAL+ LK+ DM+  E +EELL +A
Sbjct  430   NKILLMDMSDGVGIEALLTLKEEDMAIIESNEELLAYA  467



>emb|CAN69388.1| hypothetical protein VITISV_027664 [Vitis vinifera]
Length=429

 Score =   245 bits (625),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 155/432 (36%), Positives = 229/432 (53%), Gaps = 37/432 (9%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTS-MYIPLVFFYPN---NNRTDPTRVSDILQ  373
             I  R  IKPSSPTP S +  KLSLLD  + + +Y+P++FFY N   +N  D   +S  L+
Sbjct  8     IISRQTIKPSSPTPDSKKICKLSLLDLLIANRIYVPIIFFYQNKEGDNSVDVAHISSGLK  67

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-DAQNVAFPA  550
              +LS TLT +YP AGR+ D  TV+CND GA F   R++C L   + HP+A D  ++  P 
Sbjct  68    KSLSETLTHYYPLAGRIKDGVTVECNDEGAYFSEARIDCHLEGFLKHPEARDYLDLLMPV  127

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
              +   +   G L + Q++ F CG  A+   + HKV D   +  F+  W    R      S
Sbjct  128   EIQSNSSDMGSLLLIQITFFSCGRTAIGMRVSHKVSDLHGISAFLNDWATMARK-----S  182

Query  731   PNFVSDSVFPTLPSG-----PLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
                +S  + P  P G     P  KP      + + V+KRFVF   KL  LK  ++ +SGV
Sbjct  183   GEEISAELTPFFPPGDSLSMPEAKPY-----KGNLVKKRFVFDAVKLGALK-AMATQSGV  236

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMR----PPLGLPCNSAGNILST  1051
             +NPTR E+V+AL+Y+C V A    + S +PS+L+   ++R    PP  LP  S GN++  
Sbjct  237   ENPTRVEVVAALIYRCAVAASKVSSGSLKPSVLLQTVNLRKRIVPP--LPEKSFGNMVWF  294

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSRDNELV--QEIVTSLRTGEKPY----ENPDL  1213
             +S   A   E++   LV +L+ G         ++   QE++  +      +    +N  +
Sbjct  295   YSIHTARESEIEFHALVGQLKAGLAHFCDTYGKIFTGQELIRLMFKERAKFTHSNDNHHV  354

Query  1214  DIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
             + Y C+S  +   Y  DFGWG P  +S      KN+  L D + G G EA V L+K +M+
Sbjct  355   NKYICTSWCRTSLYQTDFGWGKPIWLSPTGIGSKNIICLTDTREGDGIEAFVTLEKQEMA  414

Query  1394  GFERDEELLRFA  1429
              FERDEELL+F+
Sbjct  415   VFERDEELLQFS  426



>ref|XP_006346791.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Solanum 
tuberosum]
Length=377

 Score =   243 bits (619),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 148/366 (40%), Positives = 206/366 (56%), Gaps = 16/366 (4%)
 Frame = +2

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQN  535
             VS  L+ +LS+ LT++YP AG L DN +VDCND G EFF  +++C + + +N P AD  N
Sbjct  16    VSQHLEKSLSKVLTNYYPLAGELNDNISVDCNDNGVEFFTTKIDCPMSEFLNDPYADKHN  75

Query  536   VAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP  715
             + +P G+  A  + G LAVFQLS F+CGGIA+S    HK+ DG T+ NF  HW    R+P
Sbjct  76    LVYPKGVANAYSYKGSLAVFQLSHFNCGGIAISICFSHKIADGYTLCNFTNHWATIARNP  135

Query  716   K----LNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSE  883
                  L ++P F   S FP +         IP    +    K F FS  KL  LK  V  
Sbjct  136   MSSEILPMTPQFNGASYFPPIKEDLSQTTFIPELETEKYSIKSFSFSSSKLTALKARVIN  195

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASRR--PSILVHYADMRPPLGLPCNSAGNILSTFS  1057
             +S V+NPT  E+VSA +Y+   +A A+++   S L    ++RPP  LP N+ GN +S + 
Sbjct  196   QSEVQNPTDTEVVSAFIYQ---RAMATKKVVTSTLHQALNLRPP--LPKNTMGNNVSPYC  250

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSR-DNELVQEIVTSLRTG-EKPYENPDLDIYFCS  1231
                    EMDL ++V +LR+ KE L+ +  N    E  +  +    +   N     ++ S
Sbjct  251   IHTKDEKEMDLPQIVGKLRKAKEELRKKYKNAQPNEFASIAQEALNETIFNSSSSNFYMS  310

Query  1232  SLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             S  K+P Y  DFGWG P KV     P+KNMF L+DN++  G E +  LK+ DM  FERDE
Sbjct  311   STTKFPIYDVDFGWGKPEKVCT---PLKNMFMLMDNKNRDGVEVISGLKEQDMLAFERDE  367

Query  1412  ELLRFA  1429
             ELL+FA
Sbjct  368   ELLQFA  373



>ref|XP_008226167.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=450

 Score =   244 bits (624),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 156/439 (36%), Positives = 231/439 (53%), Gaps = 32/439 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN------NNRTDPTRVS  361
             + I +R  +KPSSPTP  LR +KLS+LDQ     YIP++ FYPN      N+        
Sbjct  7     VEIIQRQTVKPSSPTPHHLRNYKLSILDQIAPQTYIPILLFYPNAADATSNDVMATNERC  66

Query  362   DILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA  541
               L  +L++TLT FYP AGR+  +A ++CND GAEF   RV C+L +I  HPDA      
Sbjct  67    QHLMQSLAKTLTHFYPSAGRIKGDAVIECNDDGAEFVEARVKCSLSEIFEHPDAVMLRRF  126

Query  542   FPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR-HPK  718
              P          G L + Q++ F+CGG+A+  ++ HK GD  T+  F+  W AA R    
Sbjct  127   LPVEPESREAGTGTLLLVQVNLFECGGMAIGFSISHKFGDAATLSTFINCWTAAARDQSN  186

Query  719   LNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDD-CVQKRFVFSGEKLDLLKDVVSEESGV  895
             + + P F + S+F  L      +P+   +++++  + +RFVF   K+  L+  V+  S V
Sbjct  187   MLMLPKFGAASLFSPLNFSN-SEPLPSVEVDNEKFITRRFVFDASKIAALQSKVT-SSVV  244

Query  896   KNPTRAEIVSALLYKCCVKAAASR----------RPSILVHYADMRP---PLGLPCNSAG  1036
               PTR E  SAL++KC ++A++            RPS+     +MR    PL LP N  G
Sbjct  245   PKPTRVEAASALIWKCKIEASSRSSSNTLGTSLIRPSVFSLSVNMRKMAVPL-LPENLVG  303

Query  1037  NIL----STFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPY--  1198
             NIL    + +S S   +  +DL  LVA++R G E  + R   +V           K Y  
Sbjct  304   NILEFSTTNYSHSEENSTVIDLKGLVAKIRGGLEETKERCAAVVVFDSNEAWQRTKWYMN  363

Query  1199  --ENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVM  1372
               +N D+D + CSS  ++P Y ADFGWG P  VS     + N+  L++ +   G EA V 
Sbjct  364   LMKNDDMDKFICSSWCRFPFYEADFGWGKPSWVSYVAVAINNITVLMNKRDDNGIEAWVT  423

Query  1373  LKKTDMSGFERDEELLRFA  1429
             L + +M+ FE ++ELL +A
Sbjct  424   LSQENMALFESNKELLEYA  442



>ref|XP_002314550.2| hypothetical protein POPTR_0010s06640g [Populus trichocarpa]
 gb|EEF00721.2| hypothetical protein POPTR_0010s06640g [Populus trichocarpa]
Length=441

 Score =   243 bits (621),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 160/432 (37%), Positives = 235/432 (54%), Gaps = 27/432 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-NRTD----PTRVSD  364
             + I +R  IKPSSPTP  LR  KLSLLDQ +   +IPL  FYP N N TD     T  S 
Sbjct  7     IEIMQRETIKPSSPTPLHLRSLKLSLLDQFMPVGHIPLQLFYPRNGNDTDHLAKATERSL  66

Query  365   ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAF  544
             +L+ +LS  LT FYP+AGRL DN++++C+D GAE+   R++C L DI+  PD +      
Sbjct  67    LLKTSLSEALTHFYPFAGRLKDNSSIECDDHGAEYIEARIHCILSDILKKPDTEVLKQLM  126

Query  545   PAGLPW-ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP--  715
             PA +   A   D  L V Q S FDCGG+A+   + HKV D  T+ +F+  W A  R    
Sbjct  127   PAAVSEPATARDSQLIV-QASFFDCGGLAIGVNLSHKVADAATLTSFIKCWAATARRSST  185

Query  716   KLNLSPNFVSDSVFPTLPSGPLDKPMIPSK-IEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
             ++ +SP F+  S+FP +    L   M+P   I+ + V KRFVF   K+  LK   +  + 
Sbjct  186   EVVISPVFMGASIFPQM---DLPISMLPVDLIQGESVMKRFVFEAPKITALK-AKAISAS  241

Query  893   VKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPL--GLPCNSAGNILSTF  1054
             V +PTR E V+AL++KC + A+ S     R ++L    ++R  L   LP N  GN + + 
Sbjct  242   VPDPTRVESVTALIWKCAMSASRSNLGVPRKAVLSLGVNIRKRLVPTLPDNYGGNYVGSI  301

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYE------NPDLD  1216
             S       +++L  +V+ +R+          ++ Q   TSL   +   E      + D+D
Sbjct  302   SARIEDHDDLELQGIVSRIRKDLIEFGENYAKITQGDDTSLAICKAVEEFGKMAMSKDID  361

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVS-MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
              Y  +S  ++  Y ADFGWG P  +S +    +KN+  L+D + G G EA + L + DM+
Sbjct  362   SYNGTSWCRFELYDADFGWGKPTWLSNVFTIELKNIMCLMDTRDGDGIEACISLSREDMA  421

Query  1394  GFERDEELLRFA  1429
              FE ++ELL FA
Sbjct  422   LFESNKELLEFA  433



>ref|XP_004294207.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=440

 Score =   243 bits (621),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 146/435 (34%), Positives = 226/435 (52%), Gaps = 25/435 (6%)
 Frame = +2

Query  188   ASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDI  367
             A   + I ER +IKPSSPTP  LR  +LS  DQ   ++Y PL+ F+PN   T    + + 
Sbjct  3     AQMKIEIIERQIIKPSSPTPHHLRNFELSFFDQMAITIYTPLLLFFPNTESTSKLEICEH  62

Query  368   LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP  547
             L  +L++TLT FYP AGR+  +  V+CND GAEF + +V+C+L D + +P         P
Sbjct  63    LTESLAKTLTHFYPLAGRIKGSTVVECNDDGAEFVKAQVSCSLSDFLENPAVKILEQFLP  122

Query  548   AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL  727
             A +       G L + Q+S F+CGG+A+  ++ HK+ D  T+  F+  W   T     + 
Sbjct  123   AEILSKEAGSGPLLLVQVSLFECGGMALGFSISHKIADASTLSTFINCWAQTTNTSITDS  182

Query  728   S---PNFVSDSVFPTLPSGPLDKPMIPSKIEDD---CVQKRFVFSGEKLDLLKDVVSEES  889
                 P F S S+FP L     D    P+++       + +RFVF G  +  L+  V+  S
Sbjct  183   EVTLPEFGSASLFPPLEKSS-DSSQPPARVYSKNHINITRRFVFDGANISALQSKVASPS  241

Query  890   GVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNIL  1045
              V  PTR E +SAL++KC ++A+ S+    RPS+     ++R    PP  LP N AGN++
Sbjct  242   -VPKPTRVEAISALIWKCAIEASTSKSGSQRPSVFSQDVNLRKRVVPP--LPENCAGNVV  298

Query  1046  STFST----SPAAAGEMDLARLVAELREGKERLQSRDNELV--QEIVTSLRTGEKPYENP  1207
               F +        +  +DL  LV++ REG E   +    +    E    ++   K  +  
Sbjct  299   GFFRSKVEVEDGTSVAIDLKDLVSKFREGIENYAAITETIFGSDEAWQGIKDKYKNLKKS  358

Query  1208  D-LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
             D +  Y C+S  ++P Y ADFGWG P  VS+    ++N+  ++D + G G E  + +   
Sbjct  359   DAMGFYSCTSWCRFPFYEADFGWGKPNWVSIASVSIENIIVMLDKRDGNGIEVWLTMNHE  418

Query  1385  DMSGFERDEELLRFA  1429
              M+ FE + ELL +A
Sbjct  419   TMALFESNAELLAYA  433



>ref|XP_004295709.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=423

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 149/420 (35%), Positives = 225/420 (54%), Gaps = 17/420 (4%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  +  I PSSPTP  L+   LS +DQ +  +Y+PL+ FYPN    +    S IL+ +
Sbjct  3     VKIIHKETITPSSPTPSHLKTLHLSFMDQLVPEVYVPLLLFYPNPTTHEK---SSILKTS  59

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP AG+   N ++ C+D GA F   RVNC +  I+ +PDA+     FPA   
Sbjct  60    LSETLTHFYPLAGKFQYNDSICCDDHGAAFVEARVNCRVSKILENPDAEMLKHLFPAAFE  119

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWV-AATRHPKLNLSPN  736
                   G L + Q++ F+CGG+A++  + HKV D  T+  F   W   A  HP L  + +
Sbjct  120   STQALTGHLLLVQVNFFECGGMAIAINISHKVADAFTLSTFTKIWARVAQGHPVLLPADS  179

Query  737   FVSDS-VFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRA  913
             F + + ++P        KP+     ++ C+ +RFVF   ++  L+   +  S V NPTR 
Sbjct  180   FGALTYLYPPQDFLNASKPL-AEYTQEQCMIRRFVFDASRIAALQFKAASAS-VTNPTRI  237

Query  914   EIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPC--NSAGNILSTFSTSPAAA  1075
             E+VSAL++KC ++A+ S     RPS+     +MR   G P   N  GN +  F  +    
Sbjct  238   EVVSALIWKCAMEASRSNSGSIRPSVCSQPVNMRKRSGKPFVENVLGNFVWFFK-AITVE  296

Query  1076  GEMDLARLVAELREGKE--RLQSRDNELVQEIVTSLRTGEKPYENPDLDIYFCSSLGKYP  1249
             GE+DL  LVA  R+  E  ++  R+    ++   +++   K  E   +D Y C+S  ++P
Sbjct  297   GEVDLQSLVATFRKCMEDFKVNYRNGVSAEQAYQTIKESAKLLEKEGMDSYTCTSWCRFP  356

Query  1250  AYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              Y  +FGWG P  VS P   +KN F+L+D   G G EA V L + DM+ F  ++ELL +A
Sbjct  357   FYETNFGWGKPSWVSTPYA-LKNKFYLMDANDGNGIEAYVTLLEEDMAIFGSNQELLAYA  415



>ref|XP_004294209.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=441

 Score =   243 bits (619),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 152/423 (36%), Positives = 217/423 (51%), Gaps = 24/423 (6%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-------NRTDPTRVSDILQNAL  382
             IKPSSPTPP L    LS+ DQ     Y+PL+ FYPNN       + +     S++L+ +L
Sbjct  15    IKPSSPTPPHLESLSLSVFDQLQPEFYVPLLLFYPNNRDEINGDHHSLAAERSNLLKTSL  74

Query  383   SRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPW  562
             S+TL  FYP+AG+   N ++ CND GA F + +VNC +  ++  PD        PA +  
Sbjct  75    SKTLCQFYPFAGKFEYNVSICCNDHGAAFLQAQVNCPISKVLEKPDHKVLKQLLPADIAS  134

Query  563   ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA------ATRHPKLN  724
                  G L + Q S F+CGG+A+   + HKVGD  T   F+  W A      A+ H  + 
Sbjct  135   TQEVAGHLLLVQASFFECGGMAIGVNISHKVGDAFTFSKFINSWAAVSLGSSASDHIAVP  194

Query  725   LSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNP  904
                  V  SV P L      +P++   IE   V +RFVF   K+D LK   +  S V NP
Sbjct  195   AVEFGVVASVCPPLDFFNSRQPIVEFAIEKS-VTERFVFEASKIDDLKSKAA-SSAVPNP  252

Query  905   TRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPC--NSAGNILSTFSTSP  1066
             TR E+VSAL++KC  +A+ S     RPS+     +MR   G P   +S GN +  F+ S 
Sbjct  253   TRVEVVSALIWKCATEASRSNSGSVRPSVWCQVVNMRKRSGQPLTEDSLGNFVWFFA-SM  311

Query  1067  AAAGEMDLARLVAELREGKERLQSRDNELV--QEIVTSLRTGEKPYENPDLDIYFCSSLG  1240
                 E+DL  LVA  R+G E  + +    V  Q++  +++          +D Y CSS  
Sbjct  312   TMESEVDLQSLVANFRKGIEEFKEKYPNGVGSQDVCQTIQESGNLMTKDGIDNYSCSSWC  371

Query  1241  KYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELL  1420
             ++P Y A+FGWG P  VS+     KN   L D + G G E  + LK+ DM+    ++ELL
Sbjct  372   RFPFYEANFGWGKPSWVSIRTMSAKNTIQLTDTRDGKGIEVSLALKEEDMAIITSNKELL  431

Query  1421  RFA  1429
              +A
Sbjct  432   EYA  434



>ref|XP_008383117.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=451

 Score =   243 bits (619),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 154/439 (35%), Positives = 221/439 (50%), Gaps = 40/439 (9%)
 Frame = +2

Query  212   ERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVS----------  361
             E+  +KPSS TP  LR  KLSLLDQ     YIP + FYPN   T  + VS          
Sbjct  12    EKQTVKPSSQTPHVLRNFKLSLLDQFSPVAYIPFLLFYPNVVSTTTSNVSTHSVKAINER  71

Query  362   -DILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNV  538
                L  +LS  LT +YP AGR+  N  + CND GAEF +  V C+L +I+ HPDA+    
Sbjct  72    YQHLIKSLSEILTHYYPLAGRIKGNVVIVCNDDGAEFVKAHVKCSLSEILEHPDAEMLRR  131

Query  539   AFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK  718
               P          G L   Q++ F+CGG+A+   + HK+ D  TV  F+  W A      
Sbjct  132   LLPIEPESTEAVTGKLLAVQVNLFECGGMAIGLTISHKIADASTVCTFINSWAATAHKSN  191

Query  719   LNLSPNFVSDSVFPTLPSGPLDKP-MIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
               + P F   S+FP L     + P MI   +++ C  +R+VF   K+ +L+  VS  S V
Sbjct  192   KVMLPQFGVASLFPPLDFSDSEPPSMI--YVKEKCTTRRYVFDDSKISVLQSKVS-SSLV  248

Query  896   KNPTRAEIVSALLYKCCVKAAASR----------RPSILVHYADMR----PPLGLPCNSA  1033
               PTR E +SAL++KC ++A+             RPSI     ++R    PP  LP N A
Sbjct  249   PKPTRVEAISALIWKCAIEASPKSSSNTLGSSPVRPSIFHQAVNLRKRVTPP--LPDNLA  306

Query  1034  GN--ILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELV-----QEIVTSLRTGEK  1192
             GN  +LST     +     DL  LVA++R G E ++    +LV      +++T  RT   
Sbjct  307   GNLLVLSTSKAEESTTSVFDLKDLVAKIRAGIEEMKECATKLVDPNEAMQVLTEYRTN--  364

Query  1193  PYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVM  1372
               ++ +++ Y C+S  ++P Y ADFGWG P  VS     +KN+F  +D +   G E  + 
Sbjct  365   LMKDQEIETYSCTSWCRFPFYGADFGWGMPSWVSFAGCSVKNLFGFMDKRDCNGIETWLT  424

Query  1373  LKKTDMSGFERDEELLRFA  1429
             L +  M+ FE   +LL +A
Sbjct  425   LSEESMALFESKPKLLAYA  443



>gb|KDP26742.1| hypothetical protein JCGZ_17900 [Jatropha curcas]
Length=438

 Score =   241 bits (616),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 151/421 (36%), Positives = 223/421 (53%), Gaps = 25/421 (6%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP-NNNRTDPTRVSDILQNALSRTLTS  400
             I+PSSPTP  L+  KLSL+DQ + + Y  LV FY  NNN    T +   L+ +LS TLT 
Sbjct  15    IRPSSPTPSDLKTLKLSLMDQFVPATYTSLVLFYSLNNNTHTNTEILQKLKTSLSETLTH  74

Query  401   -FYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHD  577
              F+P AGR+ DN++++CND GAEF   R+NC+L DI+  PD +      PA +       
Sbjct  75    HFFPLAGRIKDNSSIECNDEGAEFIEARINCSLSDILEKPDTEFLKQLLPAAIESPEAAT  134

Query  578   GGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA-ATRHPKLNLSPNFVSDSV  754
             G L + Q + FDCGG+A+   + HK+ D  T+  F+  W A A+R  K+  SP F+  S+
Sbjct  135   GNLLLVQANFFDCGGLALGVCVSHKIADAATLTIFINCWAAMASRSNKVVDSPFFMGASL  194

Query  755   FPTLPSGPLDKPMIPSKIE----DDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIV  922
             FP     P+D  +  + +E     +C+ KRFVF+  K+  LK  V+  + V  PTR E V
Sbjct  195   FP-----PIDISIPNASLELVAQQNCITKRFVFTESKIAALKAKVA-STRVPEPTRVEAV  248

Query  923   SALLYKCCVKAAASR----RPSILVHYADMRPPL--GLPCNSAGNIL-STFSTSPAAAGE  1081
             S L++K  +    S+    R S+L    ++R      LP N AGN + S       A+  
Sbjct  249   SGLIWKAVITTVRSKLGVSRKSVLCMAVNLRSRFVPKLPENYAGNCVGSIVPRLDIASSV  308

Query  1082  MDLARLVAELREGKERLQSRDNELVQE-----IVTSLRTGEKPYENPDLDIYFCSSLGKY  1246
             +D   LV ++R+  E       + +QE     I    +       + D+D Y CSS  KY
Sbjct  309   IDAVELVGKIRKEMEEFGENYVKRLQEGGSLAICGFTKQFGDMAMSKDIDFYVCSSWCKY  368

Query  1247  PAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRF  1426
               Y ADFGWG P  +      ++N+  L+D + G G E  + L + +M+  E ++ELL+F
Sbjct  369   DLYGADFGWGKPIWLCTAITTIRNVAVLVDTRDGLGIEVWLTLTEEEMALLESNQELLQF  428

Query  1427  A  1429
             A
Sbjct  429   A  429



>ref|XP_009371382.1| PREDICTED: BAHD acyltransferase At5g47980-like isoform X2 [Pyrus 
x bretschneideri]
Length=474

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 147/433 (34%), Positives = 225/433 (52%), Gaps = 26/433 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRV-------  358
             + I+ +  IKPSSPTP  L    LS+ DQ    +Y+PL+ FYP ++  +   +       
Sbjct  38    VEITHKETIKPSSPTPRHLSSTDLSVFDQFTPEIYVPLLLFYPRSSDEEVNNIDHHSLFA  97

Query  359   --SDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
               S++L+ +LS  LT FYP+AG  + N ++ CND GA F   +VNC+L  I+ +PD    
Sbjct  98    ERSNLLKTSLSEALTRFYPFAGEFVYNVSIRCNDHGAGFHEAQVNCSLSKILENPDLGIL  157

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
              +  P  +       G L + Q++ F CGG+A+  ++ HKV D  T+  F+  W      
Sbjct  158   KLFVPTAVESKQAEAGHLLLVQVNLFKCGGMAIGVSISHKVADASTLSTFIKSWTEIALG  217

Query  713   PKLNLSPNF------VSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDV  874
               +   P        V+ ++FP        KP++    E+ CV KRFVF   K+  LK  
Sbjct  218   SGITTVPAVLPAEFRVAATLFPPQDFFSSSKPIVEFA-ENKCVTKRFVFDAAKIAALKSK  276

Query  875   VSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCNSAG  1036
              +  + + NPTR E+VSAL++KC  +A+ S     +PS+L+   +MR   G  +  N  G
Sbjct  277   AASIT-LPNPTRVEVVSALIWKCATEASRSNLGFVKPSVLLQVLNMRKRSGQAMTENILG  335

Query  1037  NILSTFSTSPAAAGEMDLARLVAELREGKERLQSR-DNELVQEIV-TSLRTGEKPYENPD  1210
             N L  F T+   + E+DL  LV +LR+G E  + +  N L  E++  SL+          
Sbjct  336   NFLWYFPTTTMES-ELDLESLVGKLRKGIEEYKEKYSNGLSSEVIFQSLKESGNLLLKDS  394

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
              + Y C+S  ++P Y A+FGWG P  VS     +KN   L+D   G G EA + LK+ DM
Sbjct  395   TENYTCTSWCRFPFYEANFGWGKPSWVSTHGSELKNKILLMDMSDGVGIEASLTLKEEDM  454

Query  1391  SGFERDEELLRFA  1429
             +  E ++ELL +A
Sbjct  455   AIVESNKELLAYA  467



>ref|XP_008390113.1| PREDICTED: BAHD acyltransferase At5g47980 [Malus domestica]
Length=433

 Score =   240 bits (612),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 157/430 (37%), Positives = 224/430 (52%), Gaps = 33/430 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             +SI  R  IKPSSPTP  L+  KLS+LDQ +   YIP++ FYP    +D  RV   L+ +
Sbjct  7     ISIIARENIKPSSPTPTHLKTFKLSVLDQMVPPTYIPILLFYPT---SDHQRVQQ-LKKS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP+AG + DNA ++CND GA F   RV+C L  I+N PD +      P    
Sbjct  63    LSETLTXFYPFAGTIKDNAFIECNDDGACFIEARVSCLLSHILNEPDHEVLKQFLPINFE  122

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
              +    G + + Q + F  GGIAV   + HK+ D  T+  F+  W A+        S   
Sbjct  123   SSEGGKGCVLLVQANYFKGGGIAVGLCLSHKIADAATLSTFIRSWAASASG-----SDQR  177

Query  740   VSDSVFPTLPSGP-----LDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNP  904
             V + +F ++P  P     +D P +  K+    V KRFVF G K+  LK  V+  + V+NP
Sbjct  178   VVNPLFDSVPMAPPKDISVDPPSVEMKVYKS-VTKRFVFHGSKIADLKVKVA-NNFVENP  235

Query  905   TRAEIVSALLYKCCVKAAA-----SRRPSILVHYADMR----PPLGLPCNSAGNILSTFS  1057
             T+ E ++AL++KC  KA+      S RPS      ++R    PP  +P  S GN + +F 
Sbjct  236   TKVEALAALIWKCARKASRVTLGFSSRPSAFYQNVNIRNKIVPP--VPNGSVGNFVGSFI  293

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSRDNEL-VQEIVTSLRTGEKP----YENPDLDIY  1222
                  A E  L  LVAELR+G E+  S+   + + E ++ +   +          D+D Y
Sbjct  294   ARSEEAAETXLHGLVAELRKGIEQFTSKAKRVPLSEDISVISEPQMAAIGFLSRDDMDFY  353

Query  1223  FCSSLGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
              C+S  ++  Y  ADFGWG P  VS       NM  L+D + G G E  + L + +M  F
Sbjct  354   VCTSWCRFELYEAADFGWGKPMWVSSAVPTCNNMVILVDAEGGDGIECWIRLNEDEMKVF  413

Query  1400  ERDEELLRFA  1429
             E D+ELL +A
Sbjct  414   ECDQELLSYA  423



>ref|XP_002514982.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47536.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=441

 Score =   240 bits (613),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 156/421 (37%), Positives = 225/421 (53%), Gaps = 31/421 (7%)
 Frame = +2

Query  230   PSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTLTSFYP  409
             PSSPTP  LR  KLSLLDQ   + Y  ++  Y  N  +     S +L+ +LS TLT FYP
Sbjct  15    PSSPTPNHLRIFKLSLLDQLSPAAYGSMLLVYSINKPSTAIDKSQLLKRSLSETLTRFYP  74

Query  410   YAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA--FPAG--LPWANIHD  577
              AG++ DN+ V+CND GA +   +V+C L  ++  PD D Q +    PA      +    
Sbjct  75    LAGKIKDNSAVECNDDGAVYLEAQVDCLLSKLLEKPD-DHQVIRNLIPAEHIQSLSETQA  133

Query  578   GGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAA---TRHPKLNLSPNFVSD  748
             G L + Q + F CGG+A+   + HK+ D  TV  F+  W AA   T H  +   P F   
Sbjct  134   GCLLLVQATFFACGGLAIGVCISHKLADARTVCTFIQGWAAAALGTDHEAVR--PKFNVS  191

Query  749   SVFP--TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIV  922
             S+FP   LPS      +     E+ CV KR+VF    +  LKD  + ES V++PTR E V
Sbjct  192   SIFPPQNLPS-----ELAVKLNEEKCVTKRYVFHASGIATLKDKAASES-VRHPTRVEAV  245

Query  923   SALLYKCCVKAAA--SRRP--SILVHYADMRPPLGLPCN--SAGNILSTFSTSPAAAGEM  1084
             +AL++KC +KA+   S++P  S+L    ++R  L  P +  S GN++  F+   A   E+
Sbjct  246   TALIWKCAMKASRSNSKQPKMSVLAQSVNIRKKLVPPLSEYSIGNLMGHFALR-ATENEV  304

Query  1085  DLARLVAELREGKERLQSRDNELVQE------IVTSLRTGEKPYENPDLDIYFCSSLGKY  1246
             +L  LV ++R+G +       + +QE      +  +L+           + Y  SSL ++
Sbjct  305   ELGTLVTKMRKGIQEFGENYVKKLQEGNALKAVFEALKEMGSLLHGGSTEFYITSSLCRF  364

Query  1247  PAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRF  1426
             P Y  DFGWG P  V  P+ P+KN+  LID + G G EA V LK+ DM+ FERD+ELL  
Sbjct  365   PFYGIDFGWGKPAWVVPPRDPIKNIISLIDARDGNGIEAWVTLKEEDMAIFERDQELLAV  424

Query  1427  A  1429
             A
Sbjct  425   A  425



>gb|KHN12420.1| Vinorine synthase [Glycine soja]
Length=479

 Score =   241 bits (615),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 155/470 (33%), Positives = 232/470 (49%), Gaps = 71/470 (15%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTL  394
             R  IKPS+PTPP LR H LS +D  +   YIPL+FFY + N    + +S  L+ +LS+ L
Sbjct  6     RETIKPSNPTPPHLRIHPLSFIDHIVFRNYIPLLFFYNSPNHEQASTISK-LKKSLSQVL  64

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANI-  571
             + +YP+AG+L D  ++DCND G  F   R+ C L  I+ +P  ++ N  FP  L W  + 
Sbjct  65    SRYYPFAGKLRDQVSIDCNDQGVSFLVTRLRCNLSTILQNPTEESLNPLFPDELQWKPMS  124

Query  572   --HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVS  745
                   +   Q++ F CGGIA+S  MCHKVGD  T+ NF+  W    R  +L      + 
Sbjct  125   SSSSSSIIAIQINCFACGGIAMSVCMCHKVGDAATLSNFINDWATLNRQKELEQETAELL  184

Query  746   DSVFPTLPSGPL----DKPMIPSK--IEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPT  907
                FP +P   L    + P+ P    +E+D V +RFVF   K+D LK  VS  + V NPT
Sbjct  185   LLPFP-VPGASLFPQENLPVFPEVLFVENDTVCRRFVFEASKIDSLKSTVSSHN-VPNPT  242

Query  908   RAEIVSALLYKCCVKA------AASRRPSILVHYADMRPPLGLPCNSAGNI---------  1042
             R E+VSAL+Y   V A        S R ++ +    + P   LP  S GN+         
Sbjct  243   RVEVVSALIYNRAVSALGLISKTTSFRTAVNLRNRTVPP---LPEKSLGNLVWFLSFGAK  299

Query  1043  ----------LSTFSTSPAAAG--------------EMDLARLVAELREGKERL------  1132
                       L   ++ P A                E +L  LV ++++G          
Sbjct  300   DKDMPFVSECLKQAASVPEAKSVGNLVWFLFVLSPWETELHELVLKMKQGLTEFCDTYAK  359

Query  1133  ----QSRDNELVQEIVTSLRTGEKPY-------ENPDLDIYFCSSLGKYPAYTADFGWGW  1279
                 + +D   + E +    +  +P        E+  + ++ C+S  ++P Y ADFGWG 
Sbjct  360   KFGGEDKDMSFISECLKQAASVPEPQPGGSDDEESQIVTMFCCASWCRFPMYEADFGWGK  419

Query  1280  PCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             P   +  + P+KN   L+D + GGG EA+V +++ DM+ FERD ELL++A
Sbjct  420   PVWFTTSECPVKNSIVLMDTRDGGGIEAIVNMEEQDMARFERDVELLKYA  469



>ref|XP_008459937.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis melo]
 gb|ADN33685.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase [Cucumis melo 
subsp. melo]
Length=435

 Score =   240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 153/431 (35%), Positives = 216/431 (50%), Gaps = 26/431 (6%)
 Frame = +2

Query  191   SPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDIL  370
             +P + I    +IKPS PTP +L     S LDQ    +Y+PL+ FY   N   P+     L
Sbjct  2     APKVDIINEEIIKPSIPTPKTLNHLNFSFLDQLALPVYVPLLLFYSPKNNQIPSISH--L  59

Query  371   QNALSRTLTSFYPYAGRLL-DNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP  547
             +++LS+TLT FYP+AGR+  DN ++ C D GA F     N +L DI+   + D+ N   P
Sbjct  60    KSSLSKTLTQFYPFAGRVNDDNLSISCTDEGAIFVEAETNYSLNDILTQLNVDSLNQFLP  119

Query  548   AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHW----VAATRHP  715
               L     + G + + Q + F CGGI V   M HK+ D  ++ +F+  W    V+   +P
Sbjct  120   FHLA----NKGCIVLIQTTTFQCGGITVGLLMSHKISDASSISSFVKTWTSVHVSGNDNP  175

Query  716   KLNLSPNFVSDSVFPTLPSGPLDKPMIP-SKIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
                  P F+SDSV P   + P+  P  P S I    + KR VFS  K+  LK   +  S 
Sbjct  176   LSVSKPEFISDSVLPPPKNFPVTTPTTPDSGIHAKGITKRIVFSHSKITSLK-AKAASST  234

Query  893   VKNPTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMRPPL--GLPCNSAGNILSTF  1054
             VKNPTR E V+ LL+K  + A+ S     + S+L    ++R  L   LP NS GN +   
Sbjct  235   VKNPTRVEAVAGLLWKSAISASRSTSGLSKASVLGQAVNLRKRLEPNLPDNSVGNAIGFV  294

Query  1055  STSPAAAGEMDLARLVAELREGKERLQS------RDNELVQEIVTSLRTGEKPYENPDLD  1216
             +   A   E++L  +V  +RE  E  +       +D E       +L   + PY N + +
Sbjct  295   TPETAVGAELELQSMVGLMREAIEEFKKNGYKKYQDTEAYLSYFKALMDPDGPY-NGEKN  353

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
              Y CSS  ++  Y ADFGWG P           N F L+D + G G EALV L + DM  
Sbjct  354   FYLCSSWSRFEFYEADFGWGCPVWFIGGISMFSNFFLLLDTRDGKGIEALVSLSEEDMRL  413

Query  1397  FERDEELLRFA  1429
             FE DE+LL F 
Sbjct  414   FECDEDLLEFG  424



>ref|XP_008222021.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 152/433 (35%), Positives = 224/433 (52%), Gaps = 32/433 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN--NRTDPTRVSDILQ  373
             + I ++  IKPSSPTP +L+  KLSLLDQ     Y PLV FYPNN    T     S  L+
Sbjct  7     IEIVKKETIKPSSPTPHNLKSFKLSLLDQLSPVAYGPLVLFYPNNVSEVTLTEERSHQLK  66

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG  553
              +LS  LT FYP AGR+ DN  ++CND GA +   RVN  L + ++ P  +   +  P  
Sbjct  67    KSLSEALTRFYPLAGRIKDNLFIECNDEGAVYVEARVNALLSNFLDQPSLEILKLLLPIK  126

Query  554   LPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSP  733
             +       G L + Q S F CGG+A+   M HK+ D  T+  F+  W A        + P
Sbjct  127   VDSPEAATGCLLLVQASFFKCGGLAIGVCMSHKLADASTLSTFIKVWAATALGLGHTVVP  186

Query  734   NFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
             +F + + +P        P+  ++  ++       CV KRFVF G K+  LK  V+  S V
Sbjct  187   DFSAATRYPPRDFSAQSPAAAVEMKIV------KCVTKRFVFDGPKMRALKAKVTSGS-V  239

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPL--GLPCNSAGNILSTFS  1057
             + PTR E V+ L++KC  KA    +   + S++    ++R  +   LP  S GN+   ++
Sbjct  240   QRPTRVEAVTGLIWKCATKASKLSSGISKLSMVSQSVNIRKRVVPQLPQTSIGNLAGYYT  299

Query  1058  TSPAAAG-EMDLARLVAELREG--------KERLQSRDNELVQEIVTSLRTGEKPYENPD  1210
                  +G E++   LV+ LR+G         +RLQ  DN + + I    +         D
Sbjct  300   AMAEESGIELNSMELVSRLRKGMVEFNENHSKRLQG-DN-VFEAICEYFKEIGNIMRRDD  357

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             ++++ C+SL  +  Y  DFGWG P  VS+P G +KN+  LID + G G +A + L + DM
Sbjct  358   INLFICTSLCNFGIYEIDFGWGKPIWVSIPGGVVKNVAILIDTKEGDGVDAWISLSEEDM  417

Query  1391  SGFERDEELLRFA  1429
             + FERD ELL FA
Sbjct  418   ALFERDPELLAFA  430



>ref|XP_010100292.1| Vinorine synthase [Morus notabilis]
 gb|EXB82426.1| Vinorine synthase [Morus notabilis]
Length=438

 Score =   239 bits (609),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 157/423 (37%), Positives = 220/423 (52%), Gaps = 26/423 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  R  IKPSSPTP  LR  KLSLLDQ +  MY  +VFFYP    T+ +  S  L+ +
Sbjct  7     VDIIARNTIKPSSPTPDHLRIFKLSLLDQIIPPMYGLIVFFYPAETGTNFSEQSSRLRES  66

Query  380   LSRTLTSFYPYAGRLLDNA---TVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPA  550
             LSRTLT+FYP AGR   NA   ++DC+D GA F   +++C L D +  PD +  N   P 
Sbjct  67    LSRTLTTFYPMAGR--TNAIEPSIDCSDDGAFFVEAKMDCELSDFLRKPDGELLNNFLPT  124

Query  551   GLPW-ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL  727
               P  A + +G + + Q++ F CGG AVS  + HK+GD  ++  F+  W ++        
Sbjct  125   TDPLTAQLSEGYVTLIQITGFRCGGTAVSVCISHKIGDISSLVTFLHGWTSSGEAG----  180

Query  728   SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSE-----ESG  892
             SP FV DS+ P        +  I S    + + KRFVF   K+  LKD V       +  
Sbjct  181   SPVFVGDSLLPPRDLSFAQRTDIKS---GNLITKRFVFEASKISHLKDKVGAIDHNIQMI  237

Query  893   VKNPTRAEIVSALLYKCCVKAA----ASRRPSILVHYADMRPPLG--LPCNSAGNILSTF  1054
              K P+R E+V A ++KC + A+     S + S+L H  ++RP     LP NS GN++  F
Sbjct  238   NKYPSRVEVVMAQIFKCAIAASRSVTGSFKTSVLFHSVNLRPRTDPPLPENSVGNLI-WF  296

Query  1055  STSPAAAGEMDLARLVAEL-REGKERLQSRDNELVQEIVTSLRTGEKPYENPDLDIYFCS  1231
                     EMDL  +V ++ R   E    +  +     ++ L    K  E  +++ Y CS
Sbjct  297   VPVVIEESEMDLRTMVHKMKRLVNEFCNEKAKKFKDHSLSVLGEFGKWAEFKEMEFYSCS  356

Query  1232  SLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             S  K+P Y  DFGWG P  VS      KN   L+D + G G EA V L++  M+ FERD 
Sbjct  357   SWCKFPLYETDFGWGKPIWVSSANLTFKNSIILVDTREGDGIEAWVTLEEEKMAIFERDN  416

Query  1412  ELL  1420
             ELL
Sbjct  417   ELL  419



>ref|XP_010100286.1| Deacetylvindoline O-acetyltransferase [Morus notabilis]
 gb|EXB82420.1| Deacetylvindoline O-acetyltransferase [Morus notabilis]
Length=439

 Score =   238 bits (608),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 154/439 (35%), Positives = 230/439 (52%), Gaps = 40/439 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP----NNNRTDPTRVSDI  367
             + I +R  IKPSSPTP   R H L   DQ  T  +IP++ FY     N +    +  S +
Sbjct  4     IEIIKRETIKPSSPTPQHNRIHNLCWFDQISTPFFIPILLFYRHGLFNTSINAVSETSSL  63

Query  368   LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP  547
             L N+LS+TL+ +YP+AGR+ D  ++ CND G +F   +V   L  ++++P A+  ++ FP
Sbjct  64    LINSLSKTLSKYYPFAGRIRDRESILCNDEGVDFLVAKVKQDLSSLLHNPKAEILHLLFP  123

Query  548   AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL  727
               L W N     L   Q++ FDCGG+A+   M HK+ D  T+ +F+  W +  R+   ++
Sbjct  124   DNLQWRNTDVSFLLAVQVNYFDCGGLAIGVCMSHKLSDAATLVSFINCWASTARNAGRDV  183

Query  728   SPNFVSDSVFPTLPSGPL----DKPMIPSKI--EDDCVQKRFVFSGEKLDLLKDVVSEES  889
             S        FP L    L    D P+ P  +  + +   +RFVF  EK++ LK V+SE+ 
Sbjct  184   S--------FPVLNVASLFPRGDLPLFPEAVHWKGNYASRRFVFEAEKINSLKAVISEK-  234

Query  890   GVKNPTRAEIVSALLYKCCVKAA------ASRRPSILVHYADMRPPL--GLPCNSAGNIL  1045
              V+NPTR E V+ALLYK  +KA+      A     +LV   +MR  +   LP  S G+ L
Sbjct  235   -VENPTRVEAVTALLYKSAIKASRAVVSNAKTSSHLLVQQVNMRTRMVPELPETSVGS-L  292

Query  1046  STFSTSPAAAGEMD----LARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKP  1195
             S F      + EMD       LV+ +RE   +L S         +   E++  L+  +  
Sbjct  293   SWFFPVLWGSIEMDDQSFFVGLVSRMREAFTKLCSSFADKFGGEDWFLEMLEILKEYKGL  352

Query  1196  YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDN-QSGGGFEALVM  1372
                 D  +Y  SS  ++P Y ADFGWG P  V+      KN+  L+D+ ++GGG EA V 
Sbjct  353   LSRSDQVVYRFSSWCRFPVYEADFGWGKPVWVTSVGTVDKNVIILMDHGKNGGGIEAFVT  412

Query  1373  LKKTDMSGFERDEELLRFA  1429
             L++ +M  FE D+ELL FA
Sbjct  413   LEEDEMFVFECDQELLAFA  431



>ref|XP_004298111.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=436

 Score =   238 bits (608),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 156/424 (37%), Positives = 220/424 (52%), Gaps = 31/424 (7%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTLTSF  403
             I+PSS TP  L+   LSLLDQ   + YIP++ FY  ++ T     +  L+ +LS TLT F
Sbjct  14    IRPSSSTPIQLKTFNLSLLDQLAPATYIPVLLFYTTSDLTAAAGRTLQLKKSLSETLTRF  73

Query  404   YPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGG  583
             YP+AGR+ DN ++DCND GA F   +V+C L DI+  PD +      P          G 
Sbjct  74    YPFAGRIKDNFSIDCNDDGAGFTEAQVSCFLSDILKAPDHEVLKQLLPINCESFIEGRGC  133

Query  584   LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSVFPT  763
             +   Q + F CGGI +   + HK+ D  T+  F+  W          + P F + S+ P 
Sbjct  134   VLHVQANYFKCGGIGLGICLSHKIADAATLSTFLRSWANTASGISEKVCPIFNAASMTP-  192

Query  764   LPSGPLDKPMIP------SKIEDD-CVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIV  922
                 P D  M P      +KI DD  V KR+VF+G K+  LK      S VK  T+ EIV
Sbjct  193   ----PRDISMTPPTLENLNKIRDDKSVTKRYVFNGSKMTALKAKAPSLS-VKQATKVEIV  247

Query  923   SALLYKCCVKAA-----ASRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAAA  1075
             +AL++KC +KA+     +S R S L    ++R    PP  LP +S GN + +F  + A  
Sbjct  248   AALIWKCAMKASRTNFGSSSRLSALYQNVNIRNRTVPP--LPNDSVGNFVGSF-IATAED  304

Query  1076  GEMDLARLVAELREGKERLQSRDNEL-----VQEIVTSLRTGEKPYENPDLDIYFCSSLG  1240
              E +L  LV+ELR+G E    + N L     +  I        +   + D+ +Y C+S  
Sbjct  305   TEAELHGLVSELRKGIEEFCKKANRLPLSEDISVICEPQMEAMRMLTSDDMALYACTSWC  364

Query  1241  KYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEEL  1417
             ++P Y  ADFGWG P  +S    P KNM FL+D + G G E+ V L + DM  FE D+EL
Sbjct  365   RFPLYEAADFGWGKPVWMSSCIPPAKNMVFLMDTKGGDGIESWVRLSQEDMKLFECDQEL  424

Query  1418  LRFA  1429
             L +A
Sbjct  425   LAYA  428



>ref|XP_004140566.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
 ref|XP_004157592.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
 gb|AIT72029.1| acetyltransferase [Cucumis sativus]
 gb|KGN46392.1| hypothetical protein Csa_6G088700 [Cucumis sativus]
Length=433

 Score =   238 bits (607),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 154/423 (36%), Positives = 217/423 (51%), Gaps = 32/423 (8%)
 Frame = +2

Query  221   LIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDI--LQNALSRTL  394
             +IKPS  TP +      S LDQ    +Y+PL+ FY       P ++  I  L+++LS+TL
Sbjct  12    IIKPSISTPKTHNHLNFSFLDQLALPVYVPLLLFY----SPKPNQIPSISHLKSSLSQTL  67

Query  395   TSFYPYAGRLLD-NATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANI  571
             T FYP+AGR+ D N ++ CND GA F     N +L DI+ H + D+ N   P  L     
Sbjct  68    TQFYPFAGRVNDDNLSISCNDEGAIFVEAEANYSLNDILTHLNVDSLNQFLPFHLA----  123

Query  572   HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHW----VAATRHPKLNLSPNF  739
             + G + + Q + F CGGI V   M HK+ D  ++ +F+  W    V+ + +P  +  P F
Sbjct  124   NKGCIVLIQTTTFQCGGITVGLLMSHKISDASSISSFVKTWTSINVSGSDNPLFS-KPEF  182

Query  740   VSDSVFPTLPSGPLDKPMIP-SKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
             VSDSV P  P+ P+  P  P S I    + KR VF   K+  LK   +  S VKNPTR E
Sbjct  183   VSDSVLPP-PNFPVASPTTPDSGIHAKGITKRIVFPHSKIASLK-AKAASSTVKNPTRVE  240

Query  917   IVSALLYKCCVKAAAS----RRPSILVHYADMRPPL--GLPCNSAGNILSTFSTSPAAAG  1078
              ++ALL+K  V A+ S     R S+L    ++R  L   LP NS GN +   +   A   
Sbjct  241   AIAALLWKSAVSASRSTSGVSRASVLGQAVNLRKILKPNLPENSVGNAIGFVTPETAVGA  300

Query  1079  EMDLARLVAELREGKERLQS------RDNELVQEIVTSLRTGEKPYENPDLDIYFCSSLG  1240
             E++L  +V  +RE  E  +       +D +       +L   + PY N + + Y CSS  
Sbjct  301   ELELQSMVGLMREAIEEFKKNGYKKYQDTDAYLSYFKTLMDPDGPY-NGEKNFYLCSSWS  359

Query  1241  KYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELL  1420
             ++  Y ADFGWG P           N F L+D + G G E LV L + DMS FERDE+LL
Sbjct  360   RFEFYEADFGWGCPVWFIGGISMFSNFFLLLDTKDGKGIETLVSLSEEDMSVFERDEDLL  419

Query  1421  RFA  1429
              F 
Sbjct  420   EFG  422



>ref|XP_009604797.1| PREDICTED: deacetylvindoline O-acetyltransferase-like, partial 
[Nicotiana tomentosiformis]
Length=229

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 157/221 (71%), Gaps = 10/221 (5%)
 Frame = +2

Query  200  LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-----NNRTDPTRVSD  364
            +SI ++  +KPS  TPP +R+HKLS +DQ+L++MYIP  FFYP      +N +  + ++D
Sbjct  11   VSICDKSFVKPSCLTPPMVRYHKLSFVDQSLSNMYIPFAFFYPKQQKEESNNSQLSHLAD  70

Query  365  ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-DAQNVA  541
            +LQ +LS+TL S+YPYAG L DNATV+CND GAEF  V++NC + +I+NHP A DA+++ 
Sbjct  71   LLQRSLSQTLVSYYPYAGILRDNATVECNDMGAEFLSVKINCPMSEILNHPHATDAESIV  130

Query  542  FPAGLPWANIHDG-GLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK  718
            FP  LPW N ++G  L V QLS+FDCGGIA+SA + HK+GDG +V NF+ HW   TR  +
Sbjct  131  FPKDLPWKNNYEGDNLLVVQLSKFDCGGIAISACLSHKIGDGCSVINFLNHWANVTRDRR  190

Query  719  LNL-SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFV  838
              + SP FV DS+F +L +GPL  P I S +  +CVQKR +
Sbjct  191  FVVPSPRFVGDSIFSSL-NGPLIAPQIMSNVS-ECVQKRLI  229



>ref|XP_002311734.1| hypothetical protein POPTR_0008s18070g [Populus trichocarpa]
 gb|EEE89101.1| hypothetical protein POPTR_0008s18070g [Populus trichocarpa]
Length=439

 Score =   238 bits (607),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 155/421 (37%), Positives = 215/421 (51%), Gaps = 17/421 (4%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-NNRTDPTRVSDILQN  376
             + I  R  +KPSSPTP  LR   L LLDQ     Y PLV FY N   +      S+ L+ 
Sbjct  3     VEIITREAVKPSSPTPDHLREFNLRLLDQLAPVAYEPLVLFYSNFQQKFTVAHKSERLKR  62

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS TL+ FYP AGR+ D+A+++CND GA F + RV+C L  ++  PDA+      P  +
Sbjct  63    SLSETLSRFYPLAGRIKDDASIECNDFGAVFVQARVSCLLSKLLEKPDAEVIRKFIPIEI  122

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAAT-RHPKLNLSP  733
                    G L + Q + F CGG+A+   + HKV D  T   F+  W AA  R     + P
Sbjct  123   ESPEELTGSLVLVQANFFACGGLAIGVCISHKVADPVTFSTFIKAWAAAAFRSGDSTVLP  182

Query  734   NFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRA  913
              F + SVFP   + PL +P     I D CV KR V    K+  L+     ES V  PTR 
Sbjct  183   LFNASSVFPP-QNIPLARPAALEFIRDRCVTKRVVLDASKVAALQVKAVSES-VTCPTRV  240

Query  914   EIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCNSAGNILSTFSTSPAAA  1075
             E V+AL++KC + AA S     R SIL    ++R  +   LP ++ GN+   F+ S A  
Sbjct  241   EAVTALIWKCAMNAARSNSEHLRYSILSQSVNLRKKMVRPLPEHTIGNLAGYFA-SCATE  299

Query  1076  GEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSSL  1237
              E++L  LV +LR+G +            ++    I  S +          +D Y  +S 
Sbjct  300   CEVELQSLVRQLRKGLQDFGENYLKKLGKDKASMAICESFQEAASMLPEGTVDFYVSTSF  359

Query  1238  GKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEEL  1417
              + P Y  DFGWG P  V++P G  KN+  ++D + G G EA V L + DM+ FERD EL
Sbjct  360   CRLPFYGIDFGWGKPTWVTIPTGAYKNVASIMDAKDGKGIEAWVTLTEDDMAFFERDREL  419

Query  1418  L  1420
             L
Sbjct  420   L  420



>emb|CAN73739.1| hypothetical protein VITISV_023236 [Vitis vinifera]
Length=402

 Score =   237 bits (604),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 149/399 (37%), Positives = 217/399 (54%), Gaps = 33/399 (8%)
 Frame = +2

Query  299   MYIPLVFFYPNNNRTDPTRVSDIL---QNALSRTLTSFYPYAGRLLDNATVDCNDAGAEF  469
             +YIP++ FY +N   +P   S  L   + +LS TLT +YP AGR+ D  +++CND G +F
Sbjct  5     VYIPIILFYTSNGGDNPVDFSHRLSGLKKSLSETLTRYYPLAGRIGDGGSIECNDKGVDF  64

Query  470   FRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCH  649
             F  R++C L   +NHP+ +A N+     +   N+      + Q++ FDCGG+A+  +M H
Sbjct  65    FEARMHCHLQGFLNHPEFEALNLLAQGQIQCNNLDLSSTLIVQITFFDCGGMAIGVSMSH  124

Query  650   KVGDGGTVRNFMGHWVAATRHP-KLNLSPNFVSDSVFPTLPSGPLDKP-MIPSKIEDDCV  823
             KV D  ++  F+  W    R   +  +S  F++ S FP  P   LD P  +P KI    V
Sbjct  125   KVADISSMSAFLNDWATMARQSGEAEISAQFIT-SFFP--PHDSLDIPEYVPRKINR--V  179

Query  824   QKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR------RPSILV  985
              +RFVF+  KLD LK + +   GV+NPTR ++V+ALLYKC    AASR      R S LV
Sbjct  180   VRRFVFNASKLDALKTLATSH-GVENPTRVQVVTALLYKCA--DAASRAVSDSPRASDLV  236

Query  986   HYADMR----PPLGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQ-----S  1138
                ++R    PP  LP  S GN++  FS S    GE++   LVA+L+EG    +     S
Sbjct  237   QMVNLRRLVIPP--LPDKSFGNLVWCFSISATEEGEVEFHDLVAQLKEGIAGFRLTYGIS  294

Query  1139  RDNELVQEIVTSLRTGEKP--YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPM  1312
                  +  +V+  R           ++  + C+S  + P Y  DFGWG P  +S     M
Sbjct  295   FSWYELSRLVSEFRKASASSFKRKGNMVRFTCTSWCRSPLYQVDFGWGKPVWISCTN-VM  353

Query  1313  KNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              N F L+D ++G G EALV L++ +M+ FE DEELLRFA
Sbjct  354   WNTFILMDTRNGDGIEALVSLEEQNMNVFEHDEELLRFA  392



>ref|XP_009361768.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=451

 Score =   238 bits (608),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 154/443 (35%), Positives = 234/443 (53%), Gaps = 40/443 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD--PTRVSDI--  367
             + I ER  IKPS+ TP  LR +KLS LDQ    +Y PL+ FYP  + T    TR   +  
Sbjct  7     VEIIERQTIKPSTSTPHHLRSYKLSFLDQMAFVIYTPLLLFYPIASTTSNVSTRHHAMSI  66

Query  368   ------LQNALSRTLTSFYPYAGRLLD-NATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
                   L  +L++TLT FYP AGR++  N+ V+CND GA F + R++C L DI+ +PD  
Sbjct  67    DERCRHLIESLAKTLTHFYPLAGRIVKGNSIVECNDGGAAFIKARISCCLSDILENPDGQ  126

Query  527   AQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWV---  697
                   P  +       G L + Q++ F+CGG+A+  ++ H++ D  T+  F+  W    
Sbjct  127   ILKRFLPIEIESKEAGTGWLLLVQVNLFECGGMAIGLSISHRIADASTLCTFINCWATIA  186

Query  698   --AATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKD  871
               ++     LNL P F + SVF  +      +P     +++ CV +R+VF   K+  L+ 
Sbjct  187   LGSSDSDQVLNL-PEFGAASVFKPIEFSSSSQPPAREVVKEKCVTQRYVFDASKISTLQS  245

Query  872   VVSEESGVKNPTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMR----PPLGLPCN  1027
              V+  S V  PTR E VSAL++KC  +A+ S    + PS      ++R    PP  LP N
Sbjct  246   EVA-SSFVAKPTRVEAVSALIWKCATEASRSNLRKQGPSFFRQDVNLRKRVVPP--LPEN  302

Query  1028  SAGNILSTF-STSPAAAGEMDLARLVAELREGKERLQSR--------DNELVQEIVTSLR  1180
              AGN++ +F S +   +  ++L  LVA+LREG E L+ +         +E  QEI     
Sbjct  303   LAGNVVGSFTSKADEESSVINLKDLVAKLREGIEGLKEKYAAKLVFDSDEAWQEIKDE--  360

Query  1181  TGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFE  1360
                KP  + +++IY C+S  ++P Y ADFGWG P   S+    +KN+  L+D +   G E
Sbjct  361   -QNKPKTHDNMEIYSCTSWCRFPFYEADFGWGRPSWASVASIAIKNIIVLMDKRDCSGIE  419

Query  1361  ALVMLKKTDMSGFERDEELLRFA  1429
             A V + +   + FE + ELL +A
Sbjct  420   AWVTMSEEGKALFESNVELLGYA  442



>ref|XP_004165031.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
Length=434

 Score =   238 bits (606),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 146/426 (34%), Positives = 214/426 (50%), Gaps = 18/426 (4%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDP-TRVSDILQN  376
             L I  + +IKPSSPTP  L    +SLLDQ  T+ Y+P++ F+PN+N        S  L+ 
Sbjct  3     LQILTKEIIKPSSPTPSHLHRFNISLLDQLSTAGYVPVILFFPNSNGAPSFHERSHRLKK  62

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +L+ TLT FYP AGR   N+ +DCND GAE+   R NC L D +  P  D      P   
Sbjct  63    SLAETLTRFYPLAGRPRQNSYIDCNDDGAEYVEARANCVLSDFLKEPTPDLLAQFLPIKT  122

Query  557   PWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSP  733
                   DGG + + Q++ F+CGG+A+  +  HK+ D  ++   +  W AA       + P
Sbjct  123   EAPEAADGGRMLLVQVTLFECGGMAMGISFSHKLVDASSISVILKCWSAAALGSD-PVEP  181

Query  734   NFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRA  913
              F+  S+ P     P+  P      +  C  +R VF+G+++ +LK   + +    NPTR 
Sbjct  182   EFLQASLVPPPEGIPIAVPPTDLGGKVKCSSRRLVFNGQEITVLKSKAATDI-TPNPTRV  240

Query  914   EIVSALLYKCCVKAAASRRPSILVHYADMRPPLGL--------PCNSAGNILSTFSTSPA  1069
             E+V+AL++KC +KAA         H + M   + L        P  S GN++  F T P 
Sbjct  241   EVVTALIWKCAMKAATQETKPFSPHLSVMSQTVNLRKRLTPPSPDYSIGNLVGNFVTDPI  300

Query  1070  AAGEMDLARLVAELREGKERLQS------RDNELVQEIVTSLRTGEKPYENPDLDIYFCS  1231
              A E DL  LV  LR+G +             +   +I+  L+ G   +   D+  Y CS
Sbjct  301   PASEKDLKGLVELLRDGVKEFNKNGIRRYEGKDCFAKILEGLQQGGGLFMRDDVAFYICS  360

Query  1232  SLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             S  ++  Y  DFGWG P  VS+      N   L+D + G G EA V LK+ +M+ F+ D+
Sbjct  361   SWTRFGLYEMDFGWGKPGWVSIGSIMFLNFVVLMDTKDGEGIEAWVTLKEDEMASFQNDD  420

Query  1412  ELLRFA  1429
             ELL FA
Sbjct  421   ELLSFA  426



>ref|XP_008226094.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=435

 Score =   238 bits (606),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 148/440 (34%), Positives = 230/440 (52%), Gaps = 36/440 (8%)
 Frame = +2

Query  182   IIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-------NNR  340
             +++   + +  +  I+PSSPTP  L+   LS+ DQ    +Y PL+ FYP+       +++
Sbjct  1     MVSEIKVEVIHKETIEPSSPTPHHLKKINLSVFDQFQPEIYTPLLLFYPSTSDEGNIDHK  60

Query  341   TDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPD  520
             +     S +L+ +LS  LT FYP+AG  + NA++ CND GA F   +VNC +  I+  PD
Sbjct  61    SLFAEKSKLLKRSLSEALTHFYPFAGEFVYNASITCNDHGAAFLEAQVNCPISKILEKPD  120

Query  521   ADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA  700
                 N   P  +       G + + Q S F+CGG+A+  ++ HKV D  T+  F+  W A
Sbjct  121   FQVLNQFLPTAIESKQAEAGYILLVQASLFECGGLAIGVSILHKVADASTLSAFIKRWAA  180

Query  701   -------ATRHPKLNLSPNFVSDSVFPTLP--SGPLDKPMIPSKIEDDCVQKRFVFSGEK  853
                     T H +       V+ S+FP L   S P    ++ +K   +C+ KRFVF   K
Sbjct  181   IALGSANTTDHVEFG-----VASSLFPPLDFFSSPQFSMILSNK---NCITKRFVFDASK  232

Query  854   LDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRP--PLG  1015
             +  LK   +  + V NPTR E+VSAL++KC ++A+ S+    +PS+     +MR   P G
Sbjct  233   IAALKSKAA--TTVPNPTRVEVVSALIWKCIIQASRSKLGVIKPSMWCPVVNMRKRSPQG  290

Query  1016  LPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR--DNELVQEIVTSLRTGE  1189
             L  N  GN +  F+ + A   E+    LV +LR+G E+ + +  +    ++I  +++   
Sbjct  291   LAENILGNFVWVFA-AMAMESEVKFESLVVKLRKGIEQYKEKYPNGVTGEDIFQAIKGSG  349

Query  1190  KPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALV  1369
                E  DL+   CSS  + P Y  +FGWG P  VS  +  +KN   L+D   G G EA V
Sbjct  350   NLAERDDLETNSCSSWCRLPLYETEFGWGRPSWVST-RSTVKNTIMLMDLSDGEGIEASV  408

Query  1370  MLKKTDMSGFERDEELLRFA  1429
              LK+ DM+  E +EELL +A
Sbjct  409   TLKEEDMTIIESNEELLAYA  428



>gb|KEH20541.1| 3'-N-debenzoyl-2'-deoxytaxol benzoyltransferase [Medicago truncatula]
Length=436

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 159/442 (36%), Positives = 233/442 (53%), Gaps = 47/442 (11%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  R  IKPSSPTP  LR   +S +D      Y+PL+FFY +    D T     L+N+
Sbjct  3     MEIISREFIKPSSPTPSHLRNFPISFIDHISFRNYVPLLFFYDDTKVCDQTSKISHLKNS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLD-IINHPDADAQNVAFPAGL  556
             LS+ L+ +YP+AGR  D  +++CND GA F    +  T L  I+ +P  +  N  FP  L
Sbjct  63    LSQILSIYYPFAGRFKDQLSIECNDQGASFLVANIAGTKLSTILKNPTENLLNPLFPDEL  122

Query  557   PWANIH-DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA------ATRHP  715
              W N+  +G + V Q++ F CGGI +S   CHK+ D  T  NFM  W        +    
Sbjct  123   QWKNMDCNGSILVIQINCFACGGIIISVCACHKIVDAATAFNFMNDWAKLNSEGESNSKS  182

Query  716   KLNLSPN--FVSDSVFP--TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVV--  877
              L+L  N  +  D++F   +LP+ P  + +I   I    V KRFVF   K+ LLK ++  
Sbjct  183   TLSLPYNLLYAGDTIFSQGSLPNFPECEFVIDKTI----VSKRFVFEASKVKLLKSMMVN  238

Query  878   SEESGVKNPTRAEIVSALLYKCCVKA-AASRRPSILVHYADMR----PPLGLPCNSAGNI  1042
             S+ + VKNPTR E+V+A++YKC V A   + + + L    D+R    PPL     S GNI
Sbjct  239   SDSNEVKNPTRVEVVTAMIYKCVVSALELNFKTTSLRMAVDLRRRMVPPLSD--KSVGNI  296

Query  1043  LS-TFSTSPAAAGEMDLARLVAELREGKERL----------QSRDNELVQEIVTSLRT--  1183
             +   F  +P      +L  LV ++R+G              + +D   + E +  + T  
Sbjct  297   VWFLFLINP------ELHDLVFKIRQGLHEFCEVYPKKFGGKEKDLSFIFECLKQVTTPV  350

Query  1184  GEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEA  1363
              E  Y N  L +Y  +S  K+P Y ADFGWG P  V+    P+KN   L+D ++G G EA
Sbjct  351   SESDY-NQSLIVY--ASWCKFPMYEADFGWGKPIWVTTSTCPVKNAIVLMDTRNGDGIEA  407

Query  1364  LVMLKKTDMSGFERDEELLRFA  1429
             +V +K++DM  FER+ ELL++A
Sbjct  408   IVNMKESDMVRFEREVELLQYA  429



>ref|XP_004152528.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
 gb|KGN64241.1| hypothetical protein Csa_1G044900 [Cucumis sativus]
Length=434

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 148/427 (35%), Positives = 220/427 (52%), Gaps = 20/427 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT--RVSDILQ  373
             L I  + +IKPSSPTP  L    +SLLDQ  T+ Y+P++ F+PN+N   P+    S  L+
Sbjct  3     LQILTKEIIKPSSPTPSHLHRFNISLLDQLSTAGYVPVILFFPNSNGA-PSFHERSHRLK  61

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG  553
              +L+ TLT FYP AGR   N+ +DCND GAE+   R NC L D +  P  D      P  
Sbjct  62    KSLAETLTRFYPLAGRPRQNSYIDCNDDGAEYVEARANCVLSDFLKEPTPDLLAQFLPIK  121

Query  554   LPWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
                    DGG + + Q++ F+CGG+A+  +  HK+ D  ++   +  W AA       + 
Sbjct  122   TEAPEAADGGRMLLVQVTLFECGGMAMGISFSHKLVDASSISVILKCWSAAALGSD-PVE  180

Query  731   PNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
             P F+  S+ P     P+  P      +  C  +R VF+G+++ +LK   + +    NPTR
Sbjct  181   PEFLQASLVPPPEGIPIAVPPTDLGGKVKCSSRRLVFNGQEITVLKSKAATDI-TPNPTR  239

Query  911   AEIVSALLYKCCVKAAASR-RP-----SILVHYADMRPPLGLPC--NSAGNILSTFSTSP  1066
              E+V+AL++KC +KAA    +P     S++    ++R  L  P    S GN++  F T P
Sbjct  240   VEVVTALIWKCAMKAATQETKPFSPNLSVMSQTVNLRKRLTPPSPDYSIGNLVGNFVTDP  299

Query  1067  AAAGEMDLARLVAELREGKERLQS------RDNELVQEIVTSLRTGEKPYENPDLDIYFC  1228
               A E DL  LV  LR+G +             +   +I+  L+ G   +   D+  Y C
Sbjct  300   IPASEKDLKGLVELLRDGVKEFNKNGIRRYEGKDCFAKILEGLQQGGGLFMRDDVAFYIC  359

Query  1229  SSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERD  1408
             SS  ++  Y  DFGWG P  VS+      N   L+D + G G EA V LK+ +M+ F+ D
Sbjct  360   SSWTRFGLYEMDFGWGKPGWVSIGSIMFLNFVVLMDTKDGEGIEAWVTLKEDEMASFQND  419

Query  1409  EELLRFA  1429
             +ELL FA
Sbjct  420   DELLSFA  426



>ref|XP_009371381.1| PREDICTED: BAHD acyltransferase At5g47980-like isoform X1 [Pyrus 
x bretschneideri]
Length=483

 Score =   239 bits (609),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 146/432 (34%), Positives = 224/432 (52%), Gaps = 26/432 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRV-------  358
             + I+ +  IKPSSPTP  L    LS+ DQ    +Y+PL+ FYP ++  +   +       
Sbjct  38    VEITHKETIKPSSPTPRHLSSTDLSVFDQFTPEIYVPLLLFYPRSSDEEVNNIDHHSLFA  97

Query  359   --SDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
               S++L+ +LS  LT FYP+AG  + N ++ CND GA F   +VNC+L  I+ +PD    
Sbjct  98    ERSNLLKTSLSEALTRFYPFAGEFVYNVSIRCNDHGAGFHEAQVNCSLSKILENPDLGIL  157

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
              +  P  +       G L + Q++ F CGG+A+  ++ HKV D  T+  F+  W      
Sbjct  158   KLFVPTAVESKQAEAGHLLLVQVNLFKCGGMAIGVSISHKVADASTLSTFIKSWTEIALG  217

Query  713   PKLNLSPNF------VSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDV  874
               +   P        V+ ++FP        KP++    E+ CV KRFVF   K+  LK  
Sbjct  218   SGITTVPAVLPAEFRVAATLFPPQDFFSSSKPIVEFA-ENKCVTKRFVFDAAKIAALKSK  276

Query  875   VSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCNSAG  1036
              +  + + NPTR E+VSAL++KC  +A+ S     +PS+L+   +MR   G  +  N  G
Sbjct  277   AASIT-LPNPTRVEVVSALIWKCATEASRSNLGFVKPSVLLQVLNMRKRSGQAMTENILG  335

Query  1037  NILSTFSTSPAAAGEMDLARLVAELREGKERLQSR-DNELVQEIV-TSLRTGEKPYENPD  1210
             N L  F T+   + E+DL  LV +LR+G E  + +  N L  E++  SL+          
Sbjct  336   NFLWYFPTTTMES-ELDLESLVGKLRKGIEEYKEKYSNGLSSEVIFQSLKESGNLLLKDS  394

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
              + Y C+S  ++P Y A+FGWG P  VS     +KN   L+D   G G EA + LK+ DM
Sbjct  395   TENYTCTSWCRFPFYEANFGWGKPSWVSTHGSELKNKILLMDMSDGVGIEASLTLKEEDM  454

Query  1391  SGFERDEELLRF  1426
             +  E ++ELL +
Sbjct  455   AIVESNKELLAW  466



>ref|XP_008226087.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=455

 Score =   237 bits (604),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 149/453 (33%), Positives = 235/453 (52%), Gaps = 31/453 (7%)
 Frame = +2

Query  149   MFLHTQETKMAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP  328
             M L + + KMA  +   + +  +  IKPSSPTP  LR   LS+ DQ    MYIPL+ FYP
Sbjct  1     MKLSSVKQKMA--SEIKVEVIRKETIKPSSPTPHHLRSSSLSVFDQLQPEMYIPLLLFYP  58

Query  329   NN------NRTDPTRV----SDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRV  478
             NN      N  D   +    S +L+ +LS  LT FYP+AG    N ++ CND GA F   
Sbjct  59    NNISDDVVNNIDHNSLFAERSKLLKTSLSEALTQFYPFAGEFEYNVSISCNDHGAGFIES  118

Query  479   RVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVG  658
             +VNC +  I+ +PD +      P  +       G L + Q++ F+CGG+ +   + HKV 
Sbjct  119   QVNCPISKILENPDFEILKQLLPTAVKSKQSEAGHLLLVQVNLFECGGLTIGVNISHKVA  178

Query  659   DGGTVRNFMGHWV------AATRHPKLNLSPNF-VSDSVFPTLPSGPLDKPM-IPSKIED  814
             D  T+  F+  W       A+T   ++ L   F V+ ++FP  P    + P  I   I++
Sbjct  179   DAFTLSTFIKSWATIALGSASTASDQVLLPVEFGVAATLFP--PQDVFNAPQPIVESIKN  236

Query  815   DCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAAS----RRPSIL  982
             +C+ KRFVF   K+       +  + V NPTR E+VSAL++KC ++A+ S    R+PS  
Sbjct  237   NCITKRFVFDASKIA-ALKSKAASASVPNPTRVEVVSALIWKCALQASKSNLGFRKPSAW  295

Query  983   VHYADMRPPLGLPC--NSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELV  1156
                 +MR   GL    N  G+++S F+     + E+ L  LV +LR+G E+ + +  +  
Sbjct  296   NQLVNMRKISGLAMTENILGSLVSLFTVMTVESDEVKLESLVHKLRKGIEKYKEKYAKGF  355

Query  1157  --QEIVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFL  1330
               ++++ ++   +       ++ Y C+S  ++  Y ADFGWG P  +S+      N   L
Sbjct  356   SGEDLIQTMEGLKNLIMKDSIETYGCTSWCRFSFYEADFGWGKPSWMSLCHIESMNTTLL  415

Query  1331  IDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             +D   G G EAL+ L++  M+  ER+E+LL +A
Sbjct  416   MDTSDGVGIEALLCLEEEHMAIIERNEDLLAYA  448



>ref|XP_010506970.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=459

 Score =   237 bits (604),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 155/434 (36%), Positives = 224/434 (52%), Gaps = 33/434 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP-NNNRTDPTRVSDILQN  376
             + +  R +IKPSSPTP  L+  KLSLL+Q   +++ P+VFFY  NNNR  PT     L+ 
Sbjct  19    VDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSGNNNRIKPTEQLQKLKK  78

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS TLT FYP AGRL  N ++DCN++GA+F    VN  L  ++  P +D      P  +
Sbjct  79    SLSETLTHFYPLAGRLKGNVSIDCNNSGADFLEAEVNSPLSSLLQEPSSDNLQQLIPTSV  138

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL--S  730
                      L + Q S F+CG +A+   + HK  D  ++  FM  W A +    +    S
Sbjct  139   DSIETRT-KLLLAQASFFECGSMAIGVCISHKFADATSIGLFMKTWAAISSRGSIKTVGS  197

Query  731   PNFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
             P F +  +FP      T P+ P+ +P I   + +  + KRFVF    +  L+   S    
Sbjct  198   PVFDTVKIFPPGNFSETSPA-PVIEPEI---MMNQTLSKRFVFDSSSIQSLQAKASSFE-  252

Query  893   VKNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTF  1054
             VK PTR E VSAL++K  +KA    + + +PSIL + A +R  +  P   NS GN++S F
Sbjct  253   VKQPTRVEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSPPFTENSVGNLVSYF  312

Query  1055  ST-SPAAAGEMDLARLVAELREGKERLQSRDNEL--------VQEIVTSL-RTGEKPYEN  1204
             +  +     +  L  LV++LR  K+R   R+N +          EI+ S  R       +
Sbjct  313   AAKAEEGVNQTKLQTLVSKLRNAKQRF--RENHVPKLVGNPNATEIICSYQREAGDMIAS  370

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
              D D Y  SS  ++  Y  DFGWG P  V +P    KN+  L+D +  GG EA V L + 
Sbjct  371   GDFDFYIFSSACRFGLYETDFGWGKPVWVGIPSVRQKNIVTLLDTKEAGGIEAWVNLNEQ  430

Query  1385  DMSGFERDEELLRF  1426
             +M  FE+D ELL F
Sbjct  431   EMKLFEQDRELLHF  444



>gb|KDP38750.1| hypothetical protein JCGZ_04103 [Jatropha curcas]
Length=449

 Score =   236 bits (602),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 148/433 (34%), Positives = 229/433 (53%), Gaps = 33/433 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP-----NNNRTDPTR-VS  361
             + I  R  IKPSSPTP +LR+  LSLLDQ   +M  P++ FYP     NNN     +  S
Sbjct  7     VEIITRETIKPSSPTPRNLRYKNLSLLDQLSFAMSTPMLLFYPFRCDKNNNIVHVIKEQS  66

Query  362   DILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA  541
               L+ +LS+TLT FYP AG L +N+ ++CND G E+   +V+C+++++  +P+       
Sbjct  67    QNLKTSLSKTLTLFYPLAGELKNNSFIECNDYGVEYIEAQVDCSMMELFQNPENYLLENL  126

Query  542   FPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKL  721
             FP  L   +   G  A+  ++ F+CGG+A+  ++ HK+ D  ++  F+  W +       
Sbjct  127   FPIDLNPVDKFTG--AIIHVNFFNCGGLAIGVSLSHKIADAASLGTFLLAWASMASLSME  184

Query  722   NL----SPNFVSDSVFPT------LPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKD  871
              L     P+FVS++V P+      LPS P      PS  +  C+ KRF  S  K+D+LK 
Sbjct  185   ILPETKCPHFVSNTVIPSAENSLILPSPP------PSLTQTKCITKRFTLSSCKIDMLK-  237

Query  872   VVSEESGVKNPTRAEIVSALLYKCCVKAAASR-----RPSILVHYADMRPPL--GLPCNS  1030
               +  S ++ PTR E+V+AL++KC + A+ ++     + S+L    ++R  L   LP N 
Sbjct  238   AKAATSTLQTPTRVEVVTALIWKCLISASQAKSKGKHKKSVLAQAVNLRRRLVPHLPQNY  297

Query  1031  AGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYENPD  1210
              GN+   F    A     +L  LVA LREG E++     + V EI+   +   + +   D
Sbjct  298   IGNLSGKFLVM-AEKERAELKDLVAHLREGIEKVSDNVWKRVDEILDFAKEFAELHSRED  356

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             LD+Y  +SL  +P Y  DFGWG P    +    +KN   ++D +   G E  + L + DM
Sbjct  357   LDLYSFTSLCGFPFYDVDFGWGKPIWTVVTNLVLKNYVVMLDMKDRKGVEVWMSLSEEDM  416

Query  1391  SGFERDEELLRFA  1429
               FE + ELL FA
Sbjct  417   PLFEANGELLEFA  429



>ref|XP_011021361.1| PREDICTED: BAHD acyltransferase At5g47980-like [Populus euphratica]
Length=445

 Score =   236 bits (601),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 157/427 (37%), Positives = 218/427 (51%), Gaps = 28/427 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-NNRTDPTRVSDILQN  376
             + I  R +I+PSSPT   LR   LSLLDQ     Y PLV  Y N   +   T  S  L+ 
Sbjct  8     VEIVAREVIRPSSPTLNHLRKFNLSLLDQLAPVSYEPLVLLYSNFQQQLAGTHESQRLKR  67

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS TLT FYP AGR+ D A+++CND GA F   RV+C L   +  PDA+A     P   
Sbjct  68    SLSETLTRFYPLAGRIKDGASIECNDLGAVFVESRVSCLLSKFLEKPDAEAIRKFIPVET  127

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP--KLNLS  730
                    G L + Q + F CGG+A+   + HK  D  T   F+  W AA         + 
Sbjct  128   ESPEALTGSLVLVQANFFACGGLAIGVCISHKAADPVTFSTFIKAWAAAAFRSVDDSTVL  187

Query  731   PNFVSDSVFPTLPSG-PLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPT  907
             P F + S+FP  P   PL +P     + D CV KR VF   K+  L+     ES V  PT
Sbjct  188   PLFNASSLFP--PQNLPLTRPAAVELMNDKCVTKRLVFDASKIAALQAKAVSES-VTCPT  244

Query  908   RAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTS  1063
             R E V+AL++KC + A+ S     R SIL    ++R    PP  LP N+ GN++  F+ S
Sbjct  245   RVEAVTALIWKCAMNASRSNSEHLRYSILSQSVNLRERMVPP--LPENTIGNLVGYFA-S  301

Query  1064  PAAAGEMDLARLVAELREG--------KERLQSRDNELVQEIVTSLRTGEKPYENPDLDI  1219
              A   E++L  LV +LR+G         E+L   +++    +  S +      +  ++D 
Sbjct  302   CATECEIELQSLVGQLRKGLLDFGENYVEKLG--EDKAFMAVRESFQEAGSMLQEGNVDF  359

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             Y  +   ++P Y  DFGWG P  V++P G  KN+  ++D + G G EA V L + DM+ F
Sbjct  360   YASTDFCRFPFYGIDFGWGKPTWVTIPTGANKNVTTIMDTRDGEGVEAWVTLTEEDMAFF  419

Query  1400  ERDEELL  1420
             ERD ELL
Sbjct  420   ERDRELL  426



>ref|XP_006471031.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=445

 Score =   235 bits (600),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 144/421 (34%), Positives = 218/421 (52%), Gaps = 26/421 (6%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTL  394
             R  IKP+ PTP  LR  KLSL+DQ    +Y+  +F Y  +N     ++S  L+++LS+TL
Sbjct  12    RESIKPAYPTPQHLRNFKLSLMDQINFPVYVSTIFLYKADNNVRAEQMSQRLKSSLSKTL  71

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
             T FYP+AGR+ D+ +++CND GAE+     N  L + +  PD +      P     + + 
Sbjct  72    TKFYPFAGRVKDDFSIECNDEGAEYVEALANGFLFEYLQKPDQNLLRDFHPFNYAESPVA  131

Query  575   DGG--LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSD  748
               G  +   Q + F CGG+A++   CHK+ DG ++  F+  W    R     + P FV+ 
Sbjct  132   SNGCPMLRIQATFFKCGGLAITICTCHKLIDGVSLGIFVNSWTTTARADNKEVVPRFVAS  191

Query  749   SVFPTLPSGPLDKPMIPSKIEDDCVQ-KRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVS  925
             ++FP   S       +P  +    VQ  RFVF  +K+D L+  VS  S V  PTR E ++
Sbjct  192   TIFPASES------FVPLPLHISPVQANRFVFDTKKIDRLRAEVSSAS-VPRPTRVEALT  244

Query  926   ALLYKCCVKAAASR----RPSILVHYADMR--PPLGLPCNSAGNILSTFSTSPAAAGEMD  1087
             AL++KC   A+ S     RPS+ VH  ++R      LP NS GN ++  +   +      
Sbjct  245   ALIWKCARAASRSNLGYSRPSLSVHAMNVRAVAETPLPDNSVGNSVAYLTAQASEKEAET  304

Query  1088  LARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSSLGKYP  1249
             L  LV   R+ K            +N+ + +I  S++     +E  ++D Y  SS+  +P
Sbjct  305   LQDLVCSFRKAKADFSRNGLKNLLENKSIFDIPQSIKAK---FEKDEVDFYTFSSIVNFP  361

Query  1250  AY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRF  1426
              Y  ADFGWG P  V++P   + N+  ++D   G G E LV L   DM+ FERD+ELL F
Sbjct  362   YYEVADFGWGKPVHVTLPNYVLSNLIIIMDTNDGKGIEVLVTLSPEDMAFFERDQELLAF  421

Query  1427  A  1429
             A
Sbjct  422   A  422



>ref|XP_008372859.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=450

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 149/440 (34%), Positives = 230/440 (52%), Gaps = 35/440 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDP--TRVSDI--  367
             + I ER  IKPS+ TP  LR ++LS LDQ    +Y PL+ FYP  + T    TR   +  
Sbjct  7     VEIIERQTIKPSTSTPHHLRSYELSFLDQMAIVIYTPLLLFYPITSTTSKVSTRHHAMSI  66

Query  368   ------LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADA  529
                   L  +L++TLT FYP AGR++    V+C D GA F   R++C L DI+ +PD   
Sbjct  67    DEKCRHLIESLAKTLTHFYPLAGRIVKGNIVECTDDGAAFITARISCCLSDILENPDGQI  126

Query  530   QNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWV----  697
                  P  +       G L + Q++ F+CGG+A+  ++ H++ D  T+  F+  W     
Sbjct  127   LKRFLPIEIESKEAGTGWLLLVQVNLFECGGMAIGLSISHRIADASTLCTFINCWATIAL  186

Query  698   -AATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDV  874
              ++     LNL P F + SVF  +      +P     +++ C+ +R+VF   K+  L+  
Sbjct  187   GSSDSDQVLNL-PEFGAASVFKPIEFSSSSQPPAREVVKEKCITQRYVFDAPKISTLQSE  245

Query  875   VSEESGVKNPTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMRPPLG--LPCNSAG  1036
             V+  S V  PTR E VSAL++KC  +A+ S    + PS      ++R  +   LP N AG
Sbjct  246   VA-SSVVAKPTRVEAVSALIWKCATEASRSNLRKQGPSFFRQDVNLRKRVVXPLPENLAG  304

Query  1037  NILSTF-STSPAAAGEMDLARLVAELREGKERLQSR--------DNELVQEIVTSLRTGE  1189
             N++ +F S +   +  ++L  LVA+LREG E L+ +         +E  QEI        
Sbjct  305   NVVGSFTSRADEESSVINLKDLVAKLREGIEGLKEKYAAKLVFDSDEAWQEIKDK---QN  361

Query  1190  KPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALV  1369
             KP  + +++IY C+S  ++P Y ADFGWG P  VS+    +KN+  L+D +   G EA V
Sbjct  362   KPKTHDNMEIYSCTSWCRFPLYEADFGWGRPSWVSVASIAIKNIIVLMDKRDCSGIEAWV  421

Query  1370  MLKKTDMSGFERDEELLRFA  1429
              + +   + FE + ELL +A
Sbjct  422   TMSEESKALFESNVELLGYA  441



>ref|XP_006469323.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=462

 Score =   236 bits (601),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 161/451 (36%), Positives = 229/451 (51%), Gaps = 52/451 (12%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDI----  367
             + +  R  IKPSSPTP +L   KL L+DQ   +M+  L+FFYP  N  D    + I    
Sbjct  8     VDVIARETIKPSSPTPKALEDFKLCLMDQTAPAMFTALLFFYPAANDADHDTENKIAEKL  67

Query  368   --LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA  541
               L+++LS+ LT  YP AG + D+ T++CND GAEF   RV+C L DI+  PD+      
Sbjct  68    RHLKSSLSKMLTQLYPLAGIIKDHITIECNDEGAEFVEARVSCRLCDILKQPDSVLLGNF  127

Query  542   FPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP--  715
              P  +       G L   Q + F CGG+A+   + HK+ D  T+  F+  W  A      
Sbjct  128   LPVEIESTAAQSGRLLFVQANLFTCGGLAIGVCISHKIADAATLGTFINSWATAAAAADP  187

Query  716   ---------------KLNLSPNFVSDSVFPTLPSGPLDKPMIPSK-IEDDCVQKRFVFSG  847
                            +   SP F++ S+FP     PLD  +  ++ I D    KR+VF+ 
Sbjct  188   HHHHHHHHHHHRPTHESPASPLFMASSLFP-----PLDTQIPTTRLIPDKYATKRYVFNT  242

Query  848   EKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMR----  1003
               L       +  + V+ PTR E V+AL++KC +    S    +  S++ H  D+R    
Sbjct  243   SNL-AALKAKAASASVQQPTRVESVTALMWKCMINVTRSNKGLKELSLVSHSVDLRKRVV  301

Query  1004  PPLGLPCNSAGNILST-FSTSPAAA-GEMDLARLVAELREGKERLQSRDNELVQEIVTSL  1177
             PP  LP N+ GNI+   FS  P AA  E+DL  LV  LR+ K+     D   ++ I    
Sbjct  302   PP--LPENTIGNIVGMFFSAQPVAAEEEIDLPGLVWALRKAKKEF---DKNALEMINVEK  356

Query  1178  RTGEKPYENPDL-----DIYFC--SSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLID  1336
             RT  K     DL     D+ +C  +S  ++P Y ADFGWG P  V++P   +KN+ +L+D
Sbjct  357   RTWLKMCGVVDLFARRNDVDYCAYTSWCRFPLYEADFGWGKPVWVTLPHTMLKNVVYLLD  416

Query  1337  NQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              + G G EALV L K DM+ FER E LL+FA
Sbjct  417   TKDGEGIEALVSLTKEDMAEFERQEMLLQFA  447



>ref|XP_006431838.1| hypothetical protein CICLE_v10001160mg [Citrus clementina]
 gb|ESR45078.1| hypothetical protein CICLE_v10001160mg [Citrus clementina]
Length=445

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/421 (34%), Positives = 218/421 (52%), Gaps = 26/421 (6%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTL  394
             R  IKP+ PTP  LR  KLSL+DQ    +Y+  +F Y  +N     ++S  L+++LS+TL
Sbjct  12    RESIKPAYPTPQHLRNFKLSLMDQINFPVYVSTIFLYKADNNVRAEQMSQRLKSSLSKTL  71

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
             T FYP+AGR+ D+ +++CND GAE+     N  L + +  PD +      P     + + 
Sbjct  72    TKFYPFAGRVKDDFSIECNDEGAEYVEALANGFLFEYLQKPDQNLLRDFHPFNYAESPVA  131

Query  575   DGG--LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSD  748
               G  +   Q + F CGG+A++   CHK+ DG ++  F+  W    R     + P FV+ 
Sbjct  132   SNGCPMLRIQATFFKCGGLAITICTCHKLIDGVSLGIFVNSWTTTARTDNKEVVPRFVAS  191

Query  749   SVFPTLPSGPLDKPMIPSKIEDDCVQ-KRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVS  925
             ++FP   S       +P  +    VQ  RFVF  +K+D L+  VS  S V  P+R E ++
Sbjct  192   TIFPASES------FVPLPLHISPVQANRFVFDTKKIDQLRAKVSSAS-VPRPSRVEALT  244

Query  926   ALLYKCCVKAAASR----RPSILVHYADMR--PPLGLPCNSAGNILSTFSTSPAAAGEMD  1087
             AL++KC   A+ S     RPS+ VH  ++R      LP NS GN ++  +   +      
Sbjct  245   ALIWKCARAASRSNLGYSRPSLSVHAMNVRAVAETPLPDNSVGNTVAYLTAQASEKEAET  304

Query  1088  LARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSSLGKYP  1249
             L  LV   R+ K            +N+ + +I  S++     +E  ++D Y  SS+  +P
Sbjct  305   LQDLVCSFRKAKADFSRNGLKNLLENKSIFDIPQSIKAK---FEKDEIDFYTFSSIVNFP  361

Query  1250  AY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRF  1426
              Y  ADFGWG P  V++P   + N+  ++D   G G E LV L   DM+ FERD+ELL F
Sbjct  362   YYEVADFGWGKPVHVTLPNYVLSNLIIIMDTNDGKGIEVLVTLSPEDMAFFERDQELLAF  421

Query  1427  A  1429
             A
Sbjct  422   A  422



>ref|XP_002314561.1| transferase family protein [Populus trichocarpa]
 gb|EEF00732.1| transferase family protein [Populus trichocarpa]
Length=445

 Score =   235 bits (599),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 157/425 (37%), Positives = 213/425 (50%), Gaps = 24/425 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-NNRTDPTRVSDILQN  376
             + I  R +I PSSPT   LR   LSLLDQ     Y PLV  Y N   R      S  L+ 
Sbjct  8     VEIVAREVIGPSSPTLNHLRKFNLSLLDQLAPVSYEPLVLLYSNFQQRLTGNHQSLRLKR  67

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS TLT FYP AGR+ D A+++CND GA F   RV+C L   +  PDA+A     P   
Sbjct  68    SLSETLTRFYPLAGRIKDGASIECNDLGAVFVESRVSCLLSKFLEKPDAEAIRKFIPVET  127

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP--KLNLS  730
                    G L + Q + F CGG+A+   + HK  D  T   F+  W AA         + 
Sbjct  128   ESPEALTGSLVLVQANFFACGGLAIGVCISHKAADPVTFSTFIKAWAAAAFRSVNDSTVL  187

Query  731   PNFVSDSVFPTLPSG-PLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPT  907
             P F + S+FP  P   PL +P     + D CV KR VF   K+  L+     ES V  PT
Sbjct  188   PLFNASSLFP--PQNLPLTRPAAVELMNDKCVTKRLVFDASKIAALQAKAVSES-VTCPT  244

Query  908   RAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTS  1063
             R E V+AL++KC + A+ S     R SIL    ++R    PP  LP N+ GN++  F+ S
Sbjct  245   RVEAVTALIWKCAMNASRSNSEHLRYSILSQSVNLRKRMVPP--LPENTIGNLVGYFA-S  301

Query  1064  PAAAGEMDLARLVAELREGKERLQSRDNELVQE------IVTSLRTGEKPYENPDLDIYF  1225
              A   E++L  LV +LR+G         E + E      +  S +      +  ++D Y 
Sbjct  302   CATECEIELQSLVGQLRKGLRDFGENYVEKLGEGKAFMAVCESFQEAGSMLQEGNVDFYA  361

Query  1226  CSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
              +   ++P Y  DFGWG P  V++P G  KN+  ++D + G G EA V L + DM+ FER
Sbjct  362   STDFCRFPFYGIDFGWGKPTWVTIPTGANKNVTTIMDTRDGEGVEAWVTLTEEDMAFFER  421

Query  1406  DEELL  1420
             D ELL
Sbjct  422   DRELL  426



>sp|Q9ZTK5.1|DAT_CATRO RecName: Full=Deacetylvindoline O-acetyltransferase; AltName: 
Full=Acetyl-coenzyme A:deacetylvindoline 4-O-acetyltransferase 
[Catharanthus roseus]
 gb|AAC99311.1| deacetylvindoline 4-O-acetyltransferase [Catharanthus roseus]
Length=439

 Score =   234 bits (598),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 149/432 (34%), Positives = 240/432 (56%), Gaps = 36/432 (8%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTL  394
             + LIKPSSPTP SL  + LS  DQ +    + + FFY N +  + + + + LQN+LS+TL
Sbjct  15    KTLIKPSSPTPQSLSRYNLSYNDQNIYQTCVSVGFFYENPDGIEISTIREQLQNSLSKTL  74

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHP-DADAQNVAFPAGLPWANI  571
              S+YP+AG+++ N  + CND G EF  VR+ C + DI+ +   + A+++  P  +   + 
Sbjct  75    VSYYPFAGKVVKNDYIHCNDDGIEFVEVRIRCRMNDILKYELRSYARDLVLPKRVTVGS-  133

Query  572   HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL---SPNFV  742
              +   A+ QLS FDCGG+AV+  + HKV DGGT+ +FM  W A+  +   +    +P  V
Sbjct  134   -EDTTAIVQLSHFDCGGLAVAFGISHKVADGGTIASFMKDWAASACYLSSSHHVPTPLLV  192

Query  743   SDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIV  922
             SDS+FP   +   ++   P+    +CV+K F+F  E ++ LK   + E G++ PTR E++
Sbjct  193   SDSIFPRQDNIICEQ--FPTS--KNCVEKTFIFPPEAIEKLKS-KAVEFGIEKPTRVEVL  247

Query  923   SALLYKCCV---KAAASRR------PSILVHYADMRPPLGLPCNSAGNILSTFSTSPAAA  1075
             +A L +C     K+AA         P  ++   ++RP L LP NS GN++S + +     
Sbjct  248   TAFLSRCATVAGKSAAKNNNCGQSLPFPVLQAINLRPILELPQNSVGNLVSIYFSRTIKE  307

Query  1076  ----GEMDLARLVA-ELREGKERLQSRDNE------LVQEIVTSLRTGEKPYEN-PDLDI  1219
                  E +  +LV  ELR+ K+++++   E       ++E V SL+  E    N  D+D 
Sbjct  308   NDYLNEKEYTKLVINELRKEKQKIKNLSREKLTYVAQMEEFVKSLK--EFDISNFLDIDA  365

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGG--GFEALVMLKKTDMS  1393
             Y   S  ++P Y  DFGWG P  V + +  +KN   ++D   G   G EA+V  ++  MS
Sbjct  366   YLSDSWCRFPFYDVDFGWGKPIWVCLFQPYIKNCVVMMDYPFGDDYGIEAIVSFEQEKMS  425

Query  1394  GFERDEELLRFA  1429
              FE++E+LL+F 
Sbjct  426   AFEKNEQLLQFV  437



>ref|XP_010682887.1| PREDICTED: vinorine synthase-like [Beta vulgaris subsp. vulgaris]
Length=426

 Score =   234 bits (597),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 142/425 (33%), Positives = 222/425 (52%), Gaps = 22/425 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  +  IKPS PTP   + ++LS LDQ   S+Y+P++ FY     T P + +D+    
Sbjct  3     VEIISKEAIKPSKPTPSHCKLYRLSSLDQLSPSIYVPILLFY--EAPTTPQKRADLSSQL  60

Query  380   LS---RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPA  550
              S    TLT +YP+AGR+ D + +DC+D G+ F   +    L+DI+  P  +A +V FP 
Sbjct  61    KSSLSETLTYYYPFAGRIKDGSYIDCDDEGSLFIEAQAKNNLVDILTFPKLEALDVLFPD  120

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
                W +  +  +   QLS FDCGG+++   + HK+ D  T+  F+  W +  R    ++ 
Sbjct  121   EKQWKSSRNSSVLAVQLSYFDCGGLSIGICISHKIADACTIFTFLNDWASQARKSGESIC  180

Query  731   PNFVSDSVFPTLPSGPLDKPMIPSK--IEDDCVQKRFVFSGEKLDLLK-DVVSEESGVKN  901
             P F + S+FP     P D+ +IP    ++ + V +R+VF   K+  LK  +VS  + + N
Sbjct  181   PLFNTTSIFP-----PNDEFVIPELEFVKSNVVTRRYVFHPTKISELKATIVSNSNSLHN  235

Query  902   PTRAEIVSALLYKCCVKAAASR-----RPSILVHYADMRPPLGLPC--NSAGNILSTFST  1060
             PTR E+V++L++   ++A   R     +  +L    +MR  +  P   NS GNI+  F  
Sbjct  236   PTRVEVVTSLIFNSIIQATKIRSFGLVKSYVLAQTVNMRSRMVPPLVRNSMGNIVWYFPV  295

Query  1061  SPAAAGEMDLARLVAELREGKERLQ--SRDNELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
                   ++ L RL  ++REG  +L   +++ E    ++ +  +     E+   D Y  SS
Sbjct  296   MIKDNEDISLERLATQMREGLVKLCDFAKNVEGKDWLLMAAASENNGSEHSMNDAYKISS  355

Query  1235  LGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
               KYP Y  DFGWG P  VS  + P KN  FLID + G G EA V L +  M   + DEE
Sbjct  356   WCKYPVYQVDFGWGNPMWVSTAEYPYKNNIFLIDCKDGEGIEAWVTLDEDVMFILQGDEE  415

Query  1415  LLRFA  1429
              L+FA
Sbjct  416   FLKFA  420



>ref|XP_006448149.1| hypothetical protein CICLE_v10015171mg [Citrus clementina]
 gb|ESR61389.1| hypothetical protein CICLE_v10015171mg [Citrus clementina]
Length=462

 Score =   235 bits (599),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 162/452 (36%), Positives = 229/452 (51%), Gaps = 54/452 (12%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDI----  367
             + +  R  IKPSSPTP +L   KL L+DQ   +M+  L+FFYP  N  D    + I    
Sbjct  8     VDVIARETIKPSSPTPKALEDFKLCLMDQTAPAMFTALLFFYPAANDADHDTENKIAEKL  67

Query  368   --LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA  541
               L+++LS+ LT  YP+AG + D+  ++CND GAEF   RV+C L DI+  PD+      
Sbjct  68    RHLKSSLSKMLTQLYPFAGIIKDHIIIECNDEGAEFVEARVSCRLCDILKQPDSVLLGNF  127

Query  542   FPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP--  715
              P  +       G L   Q + F CGG+A+   + HK+ D  T+  F+  W  A      
Sbjct  128   LPVEIESTAAQSGRLLFVQANLFTCGGLAIGVCISHKIADAATLGTFINSWATAAAAADP  187

Query  716   ---------------KLNLSPNFVSDSVFPTLPSGPLDKPMIPSK--IEDDCVQKRFVFS  844
                            +   SP F++ S+FP     PLD   IP+   I D    KR+VF+
Sbjct  188   HHHHHHHHHHHRPTHESPASPLFMASSLFP-----PLDT-QIPTMRLIPDKYATKRYVFN  241

Query  845   GEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMR---  1003
                L       +  + V+ PTR E V+AL++KC +    S    +  S++ H  D+R   
Sbjct  242   TSNL-AALKAKAASASVQQPTRVESVTALMWKCMINVTRSNKGLKELSLVSHSVDLRKRV  300

Query  1004  -PPLGLPCNSAGNILST-FSTSPAAA-GEMDLARLVAELREGKERLQSRDNELVQEIVTS  1174
              PP  LP N+ GNI+   FS  P AA  E+DL  LV  LR+ K+     D   ++ I   
Sbjct  301   VPP--LPENTIGNIVGMFFSAQPVAAEEEIDLPGLVWALRKAKKEF---DKNALEMINVE  355

Query  1175  LRTGEKPYENPDL-----DIYFC--SSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLI  1333
              RT  K     DL     D+ +C  +S  ++P Y ADFGWG P  V++P   +KN+ +L+
Sbjct  356   KRTWLKMCGVVDLFARRNDVDYCAYTSWCRFPLYEADFGWGKPVWVTLPHTMLKNVVYLL  415

Query  1334  DNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             D + G G EALV L K DM+ FER E LL+FA
Sbjct  416   DTKDGEGIEALVSLTKEDMAEFERQEMLLQFA  447



>ref|XP_008383041.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=441

 Score =   234 bits (596),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 151/440 (34%), Positives = 223/440 (51%), Gaps = 42/440 (10%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSD-----  364
             + I  +  IKPSSPTP  L+   LS  DQ    +Y+PL+ FYPN    D   +       
Sbjct  7     VEILHKETIKPSSPTPHHLKTSSLSGYDQLTPEIYVPLILFYPNGG--DEASIDHHALFA  64

Query  365   ----ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
                 +L+ +LS  LT FYP+AG  + N ++ C+D GA     +VNC +  I++ PD    
Sbjct  65    DRFGLLKRSLSEALTHFYPFAGEFIFNVSISCSDHGAGLIEAQVNCPISKILDKPDFQIL  124

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA----  700
                 P  +       G L + Q+S F CGG+A+  ++ HKV D  T+  F+  W A    
Sbjct  125   GQLIPTSIDSKQAETGHLLLVQVSSFKCGGLAIGISISHKVADASTLSAFIKSWTAIALG  184

Query  701   ---ATRHPKLNLSPNF-VSDSVFP-----TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEK  853
                AT H     SP F ++ ++FP         G ++ P      ++  + KRFVF   K
Sbjct  185   SAGATDHAV--PSPEFGIAATIFPPQDIFNSQQGTMEFP------QEKGIGKRFVFDASK  236

Query  854   LDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--  1015
             +  LK   +  + V NPTR E+VSAL++KC ++A+ S     +PS+     +MR   G  
Sbjct  237   IAALKSKAAGAT-VPNPTRVEVVSALIWKCAMEASRSNLGFTKPSVWSQVVNMRKRSGKS  295

Query  1016  LPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR--DNELVQEIVTSLRTGE  1189
             L  N  GN LS F+ + +   E+DL RLVA+ R+G E  + +  +N   ++ + SL+   
Sbjct  296   LVENILGNFLSYFA-AMSTESEVDLERLVAKFRKGIEEHKEKYPNNVGCEDALQSLKEYG  354

Query  1190  KPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALV  1369
                 N  + IY CSS  K+P Y  +FGWG P  VS      KN   L+D+  G G EAL+
Sbjct  355   NILINDSIVIYSCSSWCKFPFYETNFGWGQPSWVSTRSSEFKNTIILMDSSDGFGVEALL  414

Query  1370  MLKKTDMSGFERDEELLRFA  1429
                + DM+  ER E+LL +A
Sbjct  415   TFPEEDMAIIERHEDLLAYA  434



>gb|KDO60771.1| hypothetical protein CISIN_1g012483mg [Citrus sinensis]
Length=462

 Score =   234 bits (598),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 162/452 (36%), Positives = 230/452 (51%), Gaps = 54/452 (12%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDI----  367
             + +  R  IKPSSPTP +L   KL L+DQ+  +M+  L+FFYP  N  D    + I    
Sbjct  8     VDVVARETIKPSSPTPKALEDFKLCLMDQSAPAMFTALLFFYPAANDADHDTENKIAEKL  67

Query  368   --LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA  541
               L+++LS+ LT  YP AG + D+ T++CND GAEF   RV+C L DI+  PD+      
Sbjct  68    RHLKSSLSKMLTQLYPLAGIIKDHITIECNDEGAEFVEARVSCRLCDILKQPDSVLLGNF  127

Query  542   FPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP--  715
              P  +       G L   Q + F CGG+A+   + HK+ D  T+  F+  W  A      
Sbjct  128   LPVEIESTAAQSGRLLFVQANLFTCGGLAIGVCISHKIADAATLGTFINSWATAAAAADP  187

Query  716   ---------------KLNLSPNFVSDSVFPTLPSGPLDKPMIPSK--IEDDCVQKRFVFS  844
                            +   SP F++ S+FP     P D   IP+   I D    KR+VF+
Sbjct  188   HHHHHHHHHHHRPTHESPASPLFMASSLFP-----PSDT-QIPTMRLIPDKYATKRYVFN  241

Query  845   GEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMR---  1003
                L       +  + V+ PTR E V+AL++KC +    S    ++ S++ H  D+R   
Sbjct  242   TSNL-AALKAKAASASVQQPTRVESVTALMWKCMINVTRSNKGLKKLSLVSHSVDLRKRV  300

Query  1004  -PPLGLPCNSAGNILST-FSTSPAAA-GEMDLARLVAELREGKERLQSRDNELVQEIVTS  1174
              PP  LP N+ GNI+   FS  P AA  E+DL  LV  LR+ K+     D   ++ I   
Sbjct  301   VPP--LPENTIGNIVGMFFSAQPVAAEEEIDLPGLVWALRKAKKEF---DKNALEMINVE  355

Query  1175  LRTGEKPYENPDL-----DIYFC--SSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLI  1333
              RT  K     DL     D+ +C  +S  ++P Y ADFGWG P  V++P   +KN+ +L+
Sbjct  356   KRTWLKMCGVVDLFARRNDVDYCAYTSWCRFPLYEADFGWGKPVWVTLPHTMLKNVVYLL  415

Query  1334  DNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             D + G G EALV L K DM+ FER E LL+FA
Sbjct  416   DTKDGEGIEALVSLTKEDMAEFERQEMLLQFA  447



>ref|XP_007044970.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY00802.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=436

 Score =   233 bits (595),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 159/435 (37%), Positives = 225/435 (52%), Gaps = 43/435 (10%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN---------NNRTDPT  352
             + I+ R  IKPSSPTP  L+  +LSLLDQ L S Y  +VFFY +         + R+   
Sbjct  6     VEITSRQTIKPSSPTPYHLKNFRLSLLDQLLPSFYGLIVFFYASTPSTHHQNEDCRSKSC  65

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
               S IL+++LS+ LT FYP AGRL D  ++DCND GA F   R++C L D +  PD +A 
Sbjct  66    DRSHILKSSLSKVLTHFYPMAGRLKDATSIDCNDEGAYFVEARIDCQLSDFLKQPDMEAL  125

Query  533   NVAFPAGLPWANIHDGGLAVF-QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR  709
             N   P   P  +    G  +  QL+ F+CGG A+S  + HK  D  ++  F+  W A  R
Sbjct  126   NGFLPTTDPETSKAASGCNLLVQLTTFECGGTAISICLLHKNTDVSSLATFLQSWTAIAR  185

Query  710   HPKLNLSPNFVSDSVFPTLPSGPLDKPMIP--SKIEDDCVQKRFVFSGEKLDLLKDVVSE  883
                  +SP FV  S+ P     P D   +P  +    + V KRF F   K+  LK   ++
Sbjct  186   DSGEAVSPEFVGASLLP-----PGDLSFMPPVNNPSGNFVTKRFKFEASKIASLK---AK  237

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGN  1039
              +G   P+R E+V AL+ KC V A+ ++    RP  L    ++R    PP  LP NS GN
Sbjct  238   AAGQFVPSRVEVVLALILKCSVAASRAKSGLARPIALFQAVNLRKRIVPP--LPENSIGN  295

Query  1040  ILSTFSTSPAAAGEMDLARLVAELR--------EGKERLQSRDNELVQEIVTSLRTGEKP  1195
             ++ T        GEM+L  LV  +R        E   + +  D  L+  I  SL+  E+ 
Sbjct  296   LIWTVPVF-LGDGEMELNELVTVMRREMTQFCNEKANKFKGDDGFLL--ITESLK--ERR  350

Query  1196  YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVML  1375
                 D  +Y C+S  ++P Y  D+GWG P  VS      +N+  LID ++G G EA V L
Sbjct  351   ELCKDAAVYRCTSWCRFPLYEMDYGWGKPVWVSSASLSFRNIVVLIDTKNGDGIEAWVTL  410

Query  1376  KKTDMSGFERDEELL  1420
             ++ +MS FE D+ELL
Sbjct  411   EEQEMSIFECDKELL  425



>ref|XP_004143047.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Cucumis 
sativus]
 gb|KGN62352.1| hypothetical protein Csa_2G350350 [Cucumis sativus]
Length=447

 Score =   234 bits (596),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 152/455 (33%), Positives = 235/455 (52%), Gaps = 52/455 (11%)
 Frame = +2

Query  176   MAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT-  352
             MA+++   L I    +IKPSSPTPP+L  H LSL DQ     ++PL+FF+ ++  +  T 
Sbjct  1     MAMMSLQHLQIVSTQIIKPSSPTPPNLNIHTLSLFDQLAPHTFVPLLFFFSHHGPSSGTY  60

Query  353   ---RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVN-CTLLDIINHPD  520
                   ++L+ +LS TL+ +YP AGR+ D  ++DCND G  F   R+   T+  I+ +P 
Sbjct  61    YDHTTVELLRQSLSTTLSRYYPLAGRIKDKVSIDCNDEGVTFVEARLEGVTVSKILENPR  120

Query  521   ADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA  700
             ++     F  GL W +   G L   Q++ F+CGG+++   + HK+GD  T+  F+  W  
Sbjct  121   SEIVEKLFVDGLQWKDSKMGSLLKVQITLFECGGLSIGVLLSHKLGDLATLVKFIQDWGV  180

Query  701   ATRH-----PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKI--EDDCVQKRFVFSGEKLD  859
              TR+      +  ++P F S  +FP       D P +   +  E +   KRFVF G K++
Sbjct  181   ITRNNGFCDEEEIINPLFFSGDLFPHG-----DLPAMSGAVIEEGNFTCKRFVFEGSKIE  235

Query  860   LLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASRRPS------ILVHYADMR----PP  1009
              LK+ +SE+  V+NP+R E+VSAL+YK  + A+ +   S      +L+   ++R    PP
Sbjct  236   SLKNRISEK--VQNPSRVEVVSALIYKAIISASRTNNNSQNHPATLLLQTLNLRKRVAPP  293

Query  1010  LGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGE  1189
             L  P    G+++S F         +D  R V EL E    ++    E  ++     RT E
Sbjct  294   L--PDTLVGSLVSFFPVG------VDGEREVVELHELVGTMRKEMGEFCEKYAKKYRTKE  345

Query  1190  -----KPYENPDLDI----------YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMF  1324
                  K   N   +I          Y CSS   +P Y  DFGWG    ++MP   MKN  
Sbjct  346   WLELIKKRLNESREILSKNGNNQLVYRCSSGCNFPIYEVDFGWGAADWITMPAFKMKNTV  405

Query  1325  FLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              ++D ++G G EALV L+  +M+ F+ +EELL FA
Sbjct  406   MMLDAKNGRGIEALVSLQDGEMAAFQDNEELLAFA  440



>ref|XP_010514234.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=459

 Score =   234 bits (596),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 155/434 (36%), Positives = 223/434 (51%), Gaps = 33/434 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP-NNNRTDPTRVSDILQN  376
             + +  R +IKPSSPTP  L+  KLSLL+Q   +++ P+V+FY  NNNR  PT     L+ 
Sbjct  19    VDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVYFYSGNNNRIKPTEQLQKLKK  78

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS TLT FYP AGRL  N ++DCND+GA+F    VN  L  ++  P +D      P  +
Sbjct  79    SLSETLTHFYPLAGRLKGNVSIDCNDSGADFLEAEVNSPLSSLLQEPSSDNLQRLIPTSV  138

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL--S  730
                      L + Q S F+CG +A+   + HK  D  ++  FM  W A +    +    S
Sbjct  139   DSIETRT-KLLLAQASFFECGSMAIGVCISHKFADATSIGLFMKTWAAISSRGSIKTVGS  197

Query  731   PNFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
             P F +  +FP      T P+ P+ +P I   + +  +  RFVF    +  L+   S    
Sbjct  198   PVFDTVKIFPPGNFSETSPA-PVIEPEI---MMNQTLSNRFVFDSSSIQSLQANASSFE-  252

Query  893   VKNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTF  1054
             VK PTR E VSAL++K  +KA    + + +PSIL + A +R  +  P   NS GN++S F
Sbjct  253   VKQPTRVEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSPPFTENSVGNLVSYF  312

Query  1055  ST-SPAAAGEMDLARLVAELREGKERLQSRDNEL--------VQEIVTSL-RTGEKPYEN  1204
             +  +     +  L  LV+ELR+ K+R   RDN +          EI+ S  R       +
Sbjct  313   AAKAEEGVNQTKLQTLVSELRKEKQRF--RDNHVPKLVGNPSATEIICSYQREAGHMIAS  370

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
              D D Y  SS  ++  Y  DFGWG P  V +P    KN+  L+D +  GG EA V L + 
Sbjct  371   GDFDFYIFSSACRFGLYETDFGWGKPAWVGIPCVRQKNIVTLLDTKEAGGIEAWVNLNEQ  430

Query  1385  DMSGFERDEELLRF  1426
             +M   E+D ELL F
Sbjct  431   EMKLLEQDSELLHF  444



>ref|NP_189233.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AEE77107.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=442

 Score =   233 bits (595),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 150/434 (35%), Positives = 227/434 (52%), Gaps = 32/434 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + +  R +IKPSSPTP  L+  KLSLL+Q   +++ P+VFFY  NN   PT    +L+ +
Sbjct  3     VDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSANNSIKPTEQLQMLKKS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP AGRL  N ++DCND+GA+F   RVN  L +++  P +D+     P  + 
Sbjct  63    LSETLTHFYPLAGRLKGNISIDCNDSGADFLEARVNSPLSNLLLEPSSDSLQQLIPTSVD  122

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL--SP  733
                     L + Q S F+CG +++   + HK+ D  ++  FM  W A +    +    +P
Sbjct  123   SIETRT-RLLLAQASFFECGSMSIGVCISHKLADATSIGLFMKSWAAISSRGSIKTIGAP  181

Query  734   NFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
              F +  +FP      T P+ P+ +P I   + +  + KRF+F    +  L+   S    V
Sbjct  182   VFDTVKIFPPGNFSETSPA-PVVEPEI---MMNQTLSKRFIFDSSSIQALQAKASSFE-V  236

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTFS  1057
               PTR E VSAL++K  +KA    + + +PSIL +   +R  +  P   NS GN++S F+
Sbjct  237   NQPTRVEAVSALIWKSAMKATRTVSGTSKPSILANSVSLRSRVSPPFTKNSIGNLVSYFA  296

Query  1058  T-SPAAAGEMDLARLVAELREGKERLQSRD--------NELVQEIVTSL-RTGEKPYENP  1207
               +     +  L  LV+++R+ K+R   RD        N    EI+ S  +       + 
Sbjct  297   AKAEEGINQTKLQTLVSKIRKAKQRF--RDIHIPKLVGNPNATEIICSYQKEAGDMIASG  354

Query  1208  DLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTD  1387
             D D Y  SS  ++  Y  DFGWG P  V  P    KN+  L+D +  GG EA V L + +
Sbjct  355   DFDFYIFSSACRFGLYETDFGWGKPVWVGFPSVRQKNIVTLLDTKEAGGIEAWVNLNEQE  414

Query  1388  MSGFERDEELLRFA  1429
             M+ FE+D ELL+FA
Sbjct  415   MNLFEQDRELLQFA  428



>ref|XP_008222084.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   233 bits (595),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 148/433 (34%), Positives = 223/433 (52%), Gaps = 32/433 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN--NRTDPTRVSDILQ  373
             + I ++  IKPSSPTP +L+  KLSLLDQ     Y PLV FYPNN    T     S  L+
Sbjct  7     IEIVKKETIKPSSPTPHNLKSFKLSLLDQLSLVAYGPLVLFYPNNVSEVTLTEERSHQLK  66

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG  553
              +LS  LT FYP AGR+ DN  ++CND GA +   RVN  L + ++ P  +   +  P  
Sbjct  67    KSLSEALTRFYPLAGRIKDNLFIECNDEGAVYVEARVNALLSNFLDQPSLEILKLLLPIK  126

Query  554   LPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSP  733
             +       G L + Q S F+CGG+A+   M HK+ D  T+  F+  W A        + P
Sbjct  127   VDSPEAATGCLLLVQASFFECGGLAIGVCMSHKLADASTLSTFIKVWAATALGLGHTVVP  186

Query  734   NFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
             +F + + +P        P+  ++  ++       CV KRFVF G K+  LK  V+  S V
Sbjct  187   DFSAATRYPPRDFSAQSPAAAVEMKIV------KCVAKRFVFDGPKMRALKAKVTSGS-V  239

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPL--GLPCNSAGNILSTFS  1057
             + PTR E V+ L++ C +KA    +   + S++    ++R  +   LP  S GN++  ++
Sbjct  240   QRPTRVEAVTGLIWNCAMKASKLSSGISKLSMVSQSVNIRKRVVPRLPQTSIGNLVGYYT  299

Query  1058  TSPAAAG-EMDLARLVAELREG--------KERLQSRDNELVQEIVTSLRTGEKPYENPD  1210
                  +G E++   LV+ LR+G         +RLQ   + + + I              D
Sbjct  300   AMAEESGIELNSMELVSRLRKGMVEFNEIHSKRLQG--DIVFEAICEYFMEIGNIMRRDD  357

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             ++++ C+SL  +  Y  DFGWG P  VS+P   +KN+  LID + G G +A + L + DM
Sbjct  358   INLFICTSLCNFGIYEIDFGWGKPIWVSIPFDIIKNVACLIDTKEGDGVDAWISLSEEDM  417

Query  1391  SGFERDEELLRFA  1429
             + FERD ELL FA
Sbjct  418   ALFERDPELLAFA  430



>ref|XP_006292162.1| hypothetical protein CARUB_v10018368mg [Capsella rubella]
 gb|EOA25060.1| hypothetical protein CARUB_v10018368mg [Capsella rubella]
Length=431

 Score =   233 bits (594),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 148/432 (34%), Positives = 222/432 (51%), Gaps = 30/432 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + ++ R +IKPSSPTP  L+  KLSLL+Q   +++ P+VFFY  NNR  P      L+ +
Sbjct  3     VDVTSRDIIKPSSPTPNHLKTFKLSLLEQLGPTIFGPMVFFYSGNNRIKPAEQIQKLKQS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT F+P AGRL  N ++DCND+G +F   +V+  L  ++  P +D+     P    
Sbjct  63    LSETLTHFHPLAGRLKGNVSIDCNDSGVDFIEAQVDSPLSSLLQEPSSDSLQQLIPTSAD  122

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL--SP  733
                     L + Q S F+CG +AV   + HK  D  ++  FM  W A +    +    SP
Sbjct  123   SIETRT-KLLLAQASFFECGSMAVGVCISHKFADATSIGLFMKTWAAISSRGSIETVGSP  181

Query  734   NFVSDSVFP------TLPSGPLDKPMIPSKIE-DDCVQKRFVFSGEKLDLLKDVVSEESG  892
              F +  +FP      T P+     P+I  +I+ +  V KRF+F    +  L+   S    
Sbjct  182   VFDTAKIFPPGNFSETSPA-----PVIEPEIKMNQTVSKRFIFDSSSIQSLQAKASSFE-  235

Query  893   VKNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTF  1054
             V  PTR E VSAL++K  VKA    + + +PSIL + A +R  L  P   N+ GN++S F
Sbjct  236   VNQPTRVEAVSALIWKTAVKATRTVSGTSKPSILANSASLRSRLSPPFTENTIGNLVSYF  295

Query  1055  ST-SPAAAGEMDLARLVAELREGKERLQSRD------NELVQEIVTSL-RTGEKPYENPD  1210
             +  +     +  L  LV+E+R+ K+R Q         N    E++ S  +       + +
Sbjct  296   AAKAEEGINQTKLQTLVSEIRKAKQRFQENHVPKLVGNPNATEVICSYQKEAGDMIASGE  355

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
              D Y  SS  ++  Y  DFGWG P  V +P    K++  L+D +  GG EA V L + +M
Sbjct  356   FDFYIISSACRFGLYEIDFGWGKPVWVGIPSIRQKSIVTLLDTREAGGIEAWVNLNEQEM  415

Query  1391  SGFERDEELLRF  1426
               FE+D ELL+F
Sbjct  416   KLFEQDRELLQF  427



>ref|XP_002875299.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51558.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 150/429 (35%), Positives = 223/429 (52%), Gaps = 32/429 (7%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTL  394
             R +IKPSSPTP  L+  +LSLL+Q   +++ P+VFFY  NNR  P      L+ +LS TL
Sbjct  8     RDIIKPSSPTPNHLKKFQLSLLEQLGPTIFGPMVFFYSGNNRIKPAEQLQKLKKSLSETL  67

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
             T FYP AGRL  N ++DCND+GA+F    VN  L  ++  P +D+     P  +      
Sbjct  68    THFYPLAGRLKGNISIDCNDSGADFLEAEVNSPLSSLLQEPSSDSLQQLIPTSVDSIETR  127

Query  575   DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS--PNFVSD  748
                L + Q S F+CG +A+   + HK+ D  ++  FM  W A +    +     P F + 
Sbjct  128   T-RLFLAQASFFECGSMAIGVCISHKLADATSIGLFMKSWAAISSQGSIKTVGFPVFDTA  186

Query  749   SVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
              +FP      T P+ P+ +P I   + +  + KRFVF    +  L+   S    V  PTR
Sbjct  187   KIFPPGNFSETSPA-PVVEPEI---MMNQTLSKRFVFDSSSIQALQAKASSFE-VNQPTR  241

Query  911   AEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTFST-SPA  1069
              E VSAL++K  +KA    + + +PSIL + A +R  +  P   NS GN++S F+  +  
Sbjct  242   VEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSPPFTKNSIGNLVSYFAAKAEE  301

Query  1070  AAGEMDLARLVAELREGKERLQSRDNEL--------VQEIVTSL-RTGEKPYENPDLDIY  1222
                +  L  LV+++R+ K+    RDN +          EI+ S  +       + D D Y
Sbjct  302   GTNQTKLQTLVSKIRKAKQWF--RDNHIPKLVGNPNATEIICSYQKEAGDMIASGDFDFY  359

Query  1223  FCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFE  1402
               SS  ++  Y  DFGWG P  V +P    KN+  L+D +  GG EA V L + +M+ FE
Sbjct  360   IFSSACRFGLYDTDFGWGKPVWVGIPTVRQKNIVTLLDTKEAGGIEAWVNLYEQEMNLFE  419

Query  1403  RDEELLRFA  1429
             +D ELL+FA
Sbjct  420   QDRELLQFA  428



>dbj|BAB01067.1| acetyltranferase-like protein [Arabidopsis thaliana]
Length=455

 Score =   233 bits (594),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 150/434 (35%), Positives = 227/434 (52%), Gaps = 32/434 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + +  R +IKPSSPTP  L+  KLSLL+Q   +++ P+VFFY  NN   PT    +L+ +
Sbjct  16    VDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSANNSIKPTEQLQMLKKS  75

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP AGRL  N ++DCND+GA+F   RVN  L +++  P +D+     P  + 
Sbjct  76    LSETLTHFYPLAGRLKGNISIDCNDSGADFLEARVNSPLSNLLLEPSSDSLQQLIPTSVD  135

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL--SP  733
                     L + Q S F+CG +++   + HK+ D  ++  FM  W A +    +    +P
Sbjct  136   SIETRT-RLLLAQASFFECGSMSIGVCISHKLADATSIGLFMKSWAAISSRGSIKTIGAP  194

Query  734   NFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
              F +  +FP      T P+ P+ +P I   + +  + KRF+F    +  L+   S    V
Sbjct  195   VFDTVKIFPPGNFSETSPA-PVVEPEI---MMNQTLSKRFIFDSSSIQALQAKASSFE-V  249

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTFS  1057
               PTR E VSAL++K  +KA    + + +PSIL +   +R  +  P   NS GN++S F+
Sbjct  250   NQPTRVEAVSALIWKSAMKATRTVSGTSKPSILANSVSLRSRVSPPFTKNSIGNLVSYFA  309

Query  1058  T-SPAAAGEMDLARLVAELREGKERLQSRD--------NELVQEIVTSL-RTGEKPYENP  1207
               +     +  L  LV+++R+ K+R   RD        N    EI+ S  +       + 
Sbjct  310   AKAEEGINQTKLQTLVSKIRKAKQRF--RDIHIPKLVGNPNATEIICSYQKEAGDMIASG  367

Query  1208  DLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTD  1387
             D D Y  SS  ++  Y  DFGWG P  V  P    KN+  L+D +  GG EA V L + +
Sbjct  368   DFDFYIFSSACRFGLYETDFGWGKPVWVGFPSVRQKNIVTLLDTKEAGGIEAWVNLNEQE  427

Query  1388  MSGFERDEELLRFA  1429
             M+ FE+D ELL+FA
Sbjct  428   MNLFEQDRELLQFA  441



>ref|XP_006493520.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=459

 Score =   233 bits (594),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 146/426 (34%), Positives = 218/426 (51%), Gaps = 30/426 (7%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALS  385
             +  R  IKP+ PTP  LR  KLSL+DQ    +Y+  +F Y  +      ++S  L+++LS
Sbjct  31    VRARESIKPAYPTPEHLRNFKLSLMDQINFPVYVSTIFLYKADGNVKADQISQCLKSSLS  90

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWA  565
             +TLT FYP AGR+ D+ ++DCND GAE+     N  L + +  PD +      P     +
Sbjct  91    KTLTKFYPLAGRVKDDFSIDCNDEGAEYVEAFANGFLFEYLQKPDQNLLRDFHPFNYAES  150

Query  566   NIHDGG--LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
              +   G  +   Q + F CGG+A++   CHK+ DG ++  F+  W    R     + P F
Sbjct  151   PVASNGGPMMRMQATFFKCGGLAITVCTCHKLIDGVSLGIFVNSWTTTARAGNKEVVPRF  210

Query  740   VSDSVFPTLPSGPLDKPMIPSKIEDDCVQ-KRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
             V+ ++FP   S       +P  +    VQ  RFVF  +K+D L+  VS  S V  PTR E
Sbjct  211   VASTIFPASES------FVPLPLHISPVQANRFVFDTKKIDRLRAEVSSAS-VPRPTRVE  263

Query  917   IVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAA  1072
              ++AL++KC   A+ S     RPS+  H  ++R    PP  LP NS GN ++      + 
Sbjct  264   ALTALIWKCARAASRSNLGYSRPSLSAHAINVRAVAEPP--LPDNSVGNSVAYLMAQASE  321

Query  1073  AGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
                  L  LV  LR+ K   +        +N+ + +I  S++     +E  ++D Y  SS
Sbjct  322   KEIETLQDLVCSLRKAKAEFRRNGLKTLLENKSIFDIPESIK---DKFEKDEIDFYTFSS  378

Query  1235  LGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             +  +P Y  ADFGWG P  ++ P   + N+  L+D   G G E LV L   DM+ FERD+
Sbjct  379   IVNFPYYEVADFGWGKPVHLTFPNYLVSNLIMLMDTNDGKGIEVLVTLSPEDMAFFERDQ  438

Query  1412  ELLRFA  1429
             ELL FA
Sbjct  439   ELLAFA  444



>ref|XP_008444410.1| PREDICTED: vinorine synthase [Cucumis melo]
Length=448

 Score =   233 bits (593),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 153/451 (34%), Positives = 238/451 (53%), Gaps = 43/451 (10%)
 Frame = +2

Query  176   MAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFY----PNNNRT  343
             MA I+   L I    +IKPSSPTPP+L  H LSL DQ     ++PLVFF+    P  + T
Sbjct  1     MARISLQHLQIVSTQIIKPSSPTPPNLNIHTLSLFDQLAPHTFVPLVFFFSHQGPGRSGT  60

Query  344   DPTRVSD---ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVN-CTLLDIIN  511
                   D   +L+ +LS TL+ +YP+AGR+ D  ++DCND G  F    +   T+  I+ 
Sbjct  61    YYHTTVDKLELLRQSLSTTLSRYYPFAGRIKDKVSIDCNDEGVTFVEAWLEGVTVSKILE  120

Query  512   HPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGH  691
             +P ++   + F  GL W +   G L   Q++ F+CGG+++   + HK+GD  T+  F+  
Sbjct  121   NPRSEIVEMLFVDGLQWKDSKMGSLLKVQITLFECGGLSIGVLLSHKLGDLATLVKFVQD  180

Query  692   WVAATRH----PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKI--EDDCVQKRFVFSGEK  853
             W   TR+     +  ++P F S  VFP       D P +   +  E +   KRFVF G K
Sbjct  181   WGLITRNNGFCEEETVNPLFFSADVFPHG-----DLPAMSGAVIEEGNFTCKRFVFEGSK  235

Query  854   LDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAA-----ASRRPSILVHYADMR----P  1006
             ++ LK+ +SE+  V+NP+R E+VSAL+YK  + A+     +  + ++L+   ++R    P
Sbjct  236   IESLKNRISEK--VQNPSRVEVVSALIYKAIISASRNNNNSQNQSTLLLQTLNLRKRVVP  293

Query  1007  PLGLPCNSAGNILSTFSTSPAAAGEM-DLARLVAELRE---------GKERLQSRDNELV  1156
             PL  P    G+++S F        E+ +L  LV  +R+          K+       EL+
Sbjct  294   PL--PETLVGSLVSFFPVGVDGEREVVELHELVGTMRKEMGEFCDRYAKKYRTKEWLELI  351

Query  1157  QEIVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLID  1336
             ++ +   R       N  L +Y CSS   +P Y  DFGWG    ++MP   MKN   ++D
Sbjct  352   KKRLNESREILSKNGNNQL-VYRCSSGCNFPIYEVDFGWGVADWITMPAFKMKNTVMMLD  410

Query  1337  NQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              ++GGG EAL+ L+  +M+ F+ +EELL FA
Sbjct  411   AKNGGGIEALISLQDGEMAAFQDNEELLAFA  441



>ref|XP_006493519.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=437

 Score =   232 bits (592),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 145/426 (34%), Positives = 217/426 (51%), Gaps = 30/426 (7%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALS  385
             +  R  IKP+ PTP  LR  KLSL+DQ     Y+  +F Y  +      ++S  L+++LS
Sbjct  9     VRARESIKPAYPTPEHLRNFKLSLMDQITFPAYVSTIFLYKADGNVKADQISQCLKSSLS  68

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWA  565
             +TLT FYP AGR+ D+ +++CND GAE+     N  L + +  PD +      P     +
Sbjct  69    KTLTKFYPLAGRVKDDFSIECNDEGAEYVEALANGFLFEYLQKPDQNLLRDFHPFNYAES  128

Query  566   NIHDGG--LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
              +   G  +   Q + F CGG+A++   CHK+ DG ++  F+  W    R     + P F
Sbjct  129   PVASNGGPMMRMQATFFKCGGLAITVCTCHKLIDGVSLGIFVNSWTTTARAGNKEVVPRF  188

Query  740   VSDSVFPTLPSGPLDKPMIPSKIEDDCVQ-KRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
             V+ ++FP   S       +P  +    VQ  RFVF  +K+D L+  VS  S V  PTR E
Sbjct  189   VASTIFPASES------FVPLPLHISPVQANRFVFDTKKIDRLRAEVSSAS-VPRPTRVE  241

Query  917   IVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAA  1072
              ++AL++KC   A+ S     RPS+  H  ++R    PP  LP NS GN ++      + 
Sbjct  242   ALTALIWKCARAASRSNLGYSRPSLSAHAINVRAVAEPP--LPDNSVGNSVAYLMAQASE  299

Query  1073  AGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
                  L  LV  LR+ K   +        +N+ + +I  S++     +E  ++D Y  SS
Sbjct  300   KEIETLQDLVCSLRKAKAEFRRNGLKTLLENKSIFDIPESIK---DKFEKDEIDFYTFSS  356

Query  1235  LGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             +  +P Y  ADFGWG P  ++ P   + N+  L+D   G G E LV L   DM+ FERD+
Sbjct  357   IVNFPYYEVADFGWGKPVHLTFPNYLVSNLIMLMDTNDGKGIEVLVTLSPEDMAFFERDQ  416

Query  1412  ELLRFA  1429
             ELL FA
Sbjct  417   ELLAFA  422



>ref|XP_002511244.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF51846.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=445

 Score =   232 bits (592),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 150/429 (35%), Positives = 233/429 (54%), Gaps = 26/429 (6%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVS---DILQN  376
             ++ R  IKPSSPTP +L+  KLSLLDQ   + Y+P++ +Y +N+  D  +     D+L+ 
Sbjct  8     VTSRETIKPSSPTPQTLKCFKLSLLDQLSPAAYVPMIIYYASNSELDEVKNQERLDLLKK  67

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPA--  550
             +LSRTLT FYP AGR+ +N  ++CND G +FF  RVNC L +I+  P+AD  N   P   
Sbjct  68    SLSRTLTQFYPLAGRVKENLFIECNDQGVDFFEARVNCPLSEILRRPEADVLNQFLPHEY  127

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
              +P A+  +  +A+ Q++ F CGGIA+  ++ HK+ DG T   FM +W +  R    +  
Sbjct  128   HVPAASSMEFQVAI-QVNTFTCGGIAIGTSISHKLVDGITFTCFMNNWASIARGSDEHSP  186

Query  731   PNFVSDSVFPTLP-SGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPT  907
             P FV    FP    SG      IP   +   + KRF+F   K+  L++ V   SG   P+
Sbjct  187   PVFVGPHFFPPKDLSGLFPVLDIP---QAKNITKRFLFDLSKVASLRERVFGGSGSNAPS  243

Query  908   RAEIVSALLYKCCVKAAA--------SRRPSILVHYADMRPPLG--LPCNSAGN-ILSTF  1054
             R EIVSAL++K  + A++        ++ PS L    ++R  +   LP ++AGN I    
Sbjct  244   RVEIVSALIWKYAMDASSRAKPSSGCNKSPSFLTQTVNLRARMNPPLPDSAAGNFIWLII  303

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYE-----NPDLDI  1219
             + +P+   +++L  LV +++   +   S   + +Q     L  GE   +     + ++DI
Sbjct  304   APAPSDFKKIELHELVYQVQNSFKNFNSEFVKKIQGEAGLLVLGETLDQIGELVSRNVDI  363

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             Y  +SL K+  Y ADFGWG P  VS      KN+  LI+ +     EA + L++  M+ F
Sbjct  364   YRFTSLRKFQLYEADFGWGVPAWVSSAGLAFKNVVVLIETRDADRIEAWITLEEEVMAIF  423

Query  1400  ERDEELLRF  1426
             E ++ELL F
Sbjct  424   EHNQELLSF  432



>emb|CBI27537.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   231 bits (588),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 154/427 (36%), Positives = 217/427 (51%), Gaps = 62/427 (15%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALS  385
             I  R  IKPSSPTP S R++KLS+ DQ    +YIP++ FY +N   +P            
Sbjct  5     IISRETIKPSSPTPHSQRWYKLSVFDQMSYGVYIPIILFYTSNGGDNP------------  52

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWA  565
                                 CND G +FF  R++C L   +NHP+ +A N+     +   
Sbjct  53    --------------------CNDKGVDFFEARMHCHLQGFLNHPEFEALNLLAQGQIQCN  92

Query  566   NIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP-KLNLSPNFV  742
             N+      + Q++ FDCGG+A+  +M HKV D  ++  F+  W    R   +  +S  F+
Sbjct  93    NLDLSSTLIVQITFFDCGGMAIGVSMSHKVADISSMSAFLNDWATMARQSGEAEISAQFI  152

Query  743   SDSVFPTLPSGPLDKP-MIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEI  919
             + S FP  P   LD P  +P KI    V +RFVF+  KLD LK + +   GV+NPTR ++
Sbjct  153   T-SFFP--PHDSLDIPEYVPRKINR--VVRRFVFNASKLDALKTLATSH-GVENPTRVQV  206

Query  920   VSALLYKCCVKAAASR------RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPA  1069
             V+ALLYKC    AASR      R S LV   ++R    PP  LP  S GN++  FS S  
Sbjct  207   VTALLYKCA--DAASRAVSDSPRASDLVQMVNLRRLVIPP--LPDKSFGNLVWCFSISAT  262

Query  1070  AAGEMDLARLVAELREGKERLQ-----SRDNELVQEIVTSLRTGEKP--YENPDLDIYFC  1228
               GE++   LVA+L+EG    +     S     +  +V+  R           ++  + C
Sbjct  263   EEGEVEFHDLVAQLKEGIAGFRLTYGISFSWYELSRLVSEFRKASASSFKRKGNMVRFTC  322

Query  1229  SSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERD  1408
             +S  + P Y  DFGWG P  +S     M N F L+D +SG G EALV L++ +M+ FE D
Sbjct  323   TSWCRSPLYQVDFGWGKPVWISC-TNVMWNTFILMDTRSGDGIEALVSLEEQNMNVFEHD  381

Query  1409  EELLRFA  1429
             EELLRFA
Sbjct  382   EELLRFA  388



>ref|XP_009359423.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Pyrus x 
bretschneideri]
Length=424

 Score =   231 bits (590),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 139/422 (33%), Positives = 214/422 (51%), Gaps = 23/422 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             L I  R +IKPSSPTP  LR       D+    MY+P+V FY           S++L+ +
Sbjct  3     LEIVSREIIKPSSPTPSHLRTFNFCYFDKMAGRMYVPVVLFYNPAAGACAVEKSNLLKKS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TL  +YP+AGR++D   +DC D G  +   +++  L +++ +PD +  ++ F   L 
Sbjct  63    LSETLALYYPFAGRVVDAEYIDCTDEGVTYLEAKIHAKLSEVLRNPDNETLDLLFADNLQ  122

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
             W + +   L   Q+S F+CGG+A+S  M HK+GD  T+  F+  W A   +   ++ P F
Sbjct  123   WEDTNLSTLLAVQVSYFECGGMAISMCMSHKLGDAATLITFIKDWAAMASNSGEHVIPLF  182

Query  740   VSDSVFPTLPSGPLDKPMIPSKIEDD---CVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
                S+FP       D   I  +  +D      +RFVF   K+  LK +V+++  V NPT+
Sbjct  183   DLTSMFPQ------DDLQIGKEHVNDKGKLATRRFVFDALKIAALKAIVAQK--VHNPTK  234

Query  911   AEIVSALLYKCCVKAAASRRPSILVHYADMRPPLGLPC--NSAGNILSTFSTSPAAA-GE  1081
              E+V+ALL+KC    +  R  ++L    ++R  L  P   N  GN+   F        GE
Sbjct  235   VEVVTALLFKCASSTSGGR--AVLCQNINLRSRLVPPMQENFVGNLAWFFPVPKLEEDGE  292

Query  1082  MDLARLVAELREGKERL------QSRDNELVQEIVTSLRTGEKPYENPDLDIYFCSSLGK  1243
             ++L   V +++E           + R  E    I   ++  ++ Y +     Y CSS  +
Sbjct  293   IELPGFVGQMKEALAEFCNTYASKFRGKEWCLSIQQHMKKAKELYGSGAAK-YICSSWCR  351

Query  1244  YPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLR  1423
              P Y  DFGWG P    +     KN+  L+D +SG G EA V L++ DM+ FER+EELL 
Sbjct  352   LPIYEVDFGWGKPVWARIGSRAGKNVSILLDTRSGDGIEAFVTLEEQDMAKFERNEELLA  411

Query  1424  FA  1429
             FA
Sbjct  412   FA  413



>ref|XP_006431933.1| hypothetical protein CICLE_v10001089mg [Citrus clementina]
 gb|ESR45173.1| hypothetical protein CICLE_v10001089mg [Citrus clementina]
Length=459

 Score =   232 bits (592),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 145/426 (34%), Positives = 218/426 (51%), Gaps = 30/426 (7%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALS  385
             +  R  IKP+ PTP  LR  KLSL+DQ    +Y+  +F Y  +      ++S  L+++LS
Sbjct  31    VRARESIKPAYPTPEHLRNFKLSLMDQINFPVYVSTIFLYKADGNVKADQISQCLKSSLS  90

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWA  565
             +TLT FYP AGR+ D+ +++CND GAE+     N  L + +  PD +      P     +
Sbjct  91    KTLTKFYPLAGRVKDDFSIECNDEGAEYVEAFANGFLFEYLQKPDQNLLRDFHPFNYAES  150

Query  566   NIHDGG--LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
              +   G  +   Q + F CGG+A++   CHK+ DG ++  F+  W    R     + P F
Sbjct  151   PVASNGGPMMRMQATFFKCGGLAITVCTCHKLIDGVSLGIFVNSWTTTARAGNKEVVPRF  210

Query  740   VSDSVFPTLPSGPLDKPMIPSKIEDDCVQ-KRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
             V+ ++FP   S       +P  +    VQ  RFVF  +K+D L+  VS  S V  PTR E
Sbjct  211   VASTIFPASES------FVPLPLHISPVQANRFVFDTKKIDRLRAEVSSAS-VPRPTRVE  263

Query  917   IVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAA  1072
              ++AL++KC   A+ S     RPS+  H  ++R    PP  LP NS GN ++      + 
Sbjct  264   ALTALIWKCARAASRSNLGYSRPSLSAHAINVRAVADPP--LPDNSVGNSVAYLMAQASE  321

Query  1073  AGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
                  L  LV  LR+ K   +        +N+ + +I  S++     +E  ++D Y  SS
Sbjct  322   KEIETLQDLVCSLRKAKAEFRRNGLKTLLENKSIFDIPESIK---DKFEKDEIDFYTFSS  378

Query  1235  LGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             +  +P Y  ADFGWG P  ++ P   + N+  L+D   G G E LV L   DM+ FERD+
Sbjct  379   IVNFPYYEAADFGWGKPVHLTFPNYSVSNLIMLMDTNDGKGIEVLVTLSPEDMAFFERDQ  438

Query  1412  ELLRFA  1429
             ELL FA
Sbjct  439   ELLAFA  444



>ref|XP_002510627.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF52814.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=440

 Score =   231 bits (588),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 151/433 (35%), Positives = 223/433 (52%), Gaps = 26/433 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  R  IKPSSPTP  L+ +KLSLLDQ + S ++P++FFY   N+TD +     L+ +
Sbjct  3     IEIMSRENIKPSSPTPSHLKTYKLSLLDQLMPSAHVPIIFFYGPINQTDMSIRLPKLKQS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS  LTSFYP+AG++ D+  +DCND G  + + +V+C L DI+  PD++      P    
Sbjct  63    LSEALTSFYPFAGKVKDDLYIDCNDEGVSYTQAKVSCCLSDILGKPDSETIFKLLPGDSY  122

Query  560   WANIHDGGL--AVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSP  733
             +      G+  A+ Q++ F CGG+A+     HK+ DG T   F+  W A  R     + P
Sbjct  123   FMESSGNGIPVAMIQVNVFKCGGVAIGTKTSHKIIDGPTSTAFLKAWAAIARGSGETVEP  182

Query  734   NFVSDSVFPTLPSGPLDK--PMIPSKIE-DDCVQKRFVFSGEKLDLLKDVVSEESGVKNP  904
              F++ S+FP     P D    + PS I+    + KRFVF    + +LK   +    V  P
Sbjct  183   CFIAPSLFPQNDCLPKDTMLAIWPSLIKFGKGITKRFVFDASSVAILKARAASSLLVHRP  242

Query  905   TRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCNSAGNILSTFSTSP  1066
             TR E VSA +++C + A+ ++    RPS L    ++R   G  LP NS GN+L       
Sbjct  243   TRVEAVSAFIWQCNMLASKAKHGCQRPSFLSLIVNLRGKKGTQLPSNSVGNLLWMTIAQC  302

Query  1067  AAAGEMDLARLVAELREGKERLQSRDNELVQ---------EIVTSLRTGEKPYENPDLDI  1219
             +A  E +L  LV  LRE   ++   D + VQ         ++   L+   + Y N   D 
Sbjct  303   SAETERELHPLVGLLRESISKI---DGDFVQKLSGEEGFSKVCECLQEFGEVYSNAGADY  359

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVS--MPKGPM-KNMFFLIDNQSGGGFEALVMLKKTDM  1390
                +SL     Y  DFGWG P  V+     GP+ +N+ FL +   G G EA + L + DM
Sbjct  360   LTFTSLCNVGIYETDFGWGRPIWVTPGGITGPVFQNLVFLNETSVGDGIEAWLTLDEQDM  419

Query  1391  SGFERDEELLRFA  1429
                ERD E+L F+
Sbjct  420   IILERDTEILSFS  432



>ref|XP_004295691.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=447

 Score =   231 bits (588),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 151/447 (34%), Positives = 225/447 (50%), Gaps = 42/447 (9%)
 Frame = +2

Query  188   ASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN---------NNR  340
             A   + +  R  I PSSP+PP L+  + SL DQ +   Y+PLV FYPN         +++
Sbjct  3     AEMKVEVISRETITPSSPSPPHLKRVEFSLFDQVILEHYVPLVLFYPNHADHHEVDTDHQ  62

Query  341   TDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPD  520
             +   + S IL+ +LS TLT FYP AG    N ++ C+D GA F   RVNC +L+I+  PD
Sbjct  63    SLIAKKSSILKASLSETLTHFYPLAGEFQYNDSICCDDRGAAFIEARVNCRVLEILKSPD  122

Query  521   ADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA  700
              +     FPA +       G L + Q++ F+CGG+A++  + HKV D  T   F+  W A
Sbjct  123   TEMLKCLFPAAVDSTQALTGYLLLVQVNFFECGGLAIAINISHKVADAFTFSRFIKSWAA  182

Query  701   AT---------RHPKLNLSPNFVSDSVFPTLPSGPLDKP-MIPSKIEDDCVQKRFVFSGE  850
             A           HP ++      + S++P      L+ P     ++ + C  +RFVF   
Sbjct  183   AVALGSKCTTDHHPIMHPIEFGAAASLYPA--QDFLNAPRKFQKRVPESCTTRRFVFDAS  240

Query  851   KLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGL  1018
              +  LK   +  + V +PTR E+VSAL++KC ++A+ S     RPS+     +MR   G 
Sbjct  241   SIADLKSKAT-SAAVPSPTRNEVVSALIWKCAMEASRSNSGSIRPSLWSQALNMRKRSGQ  299

Query  1019  PCNSAGNILSTFSTSPAAA---GEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGE  1189
                   N+L  F  S AA     E+DL  LVA  R+  E      N      VT+ +  +
Sbjct  300   EFTE--NLLGNFVWSMAAVTTESEVDLRSLVARFRKCLEAY----NVTYPNGVTAEQAYQ  353

Query  1190  KPYE-------NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSG  1348
             K  E       N  +D Y CS+  ++P Y  +FGWG P  VS+   P KN   L+D + G
Sbjct  354   KIKESAGNFLANKCMDKYSCSNWCRFPFYETNFGWGKPSWVSIRSFPYKNTVILMDAKDG  413

Query  1349  GGFEALVMLKKTDMSGFERDEELLRFA  1429
              G EA + L + DM+ FE ++EL+ +A
Sbjct  414   NGIEAHLTLLEEDMAIFESNKELIAYA  440



>ref|XP_006395599.1| hypothetical protein EUTSA_v10005565mg [Eutrema salsugineum]
 gb|ESQ32885.1| hypothetical protein EUTSA_v10005565mg [Eutrema salsugineum]
Length=458

 Score =   230 bits (587),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 155/431 (36%), Positives = 224/431 (52%), Gaps = 36/431 (8%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTL  394
             R +IKPSSPTP  L+  KLSLL+Q   +++ P+VFFY  N    PT     L+ + S TL
Sbjct  24    RDMIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMVFFYSGNKGIKPTEQLQKLKKSFSETL  83

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
             T FYP AGRL  N ++DCND+GA+F    VN  L +++  P +D      P  +      
Sbjct  84    THFYPLAGRLKGNISIDCNDSGADFLEAEVNTPLSNLLQEPSSDILQQLIPTSVDSIETR  143

Query  575   DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS--PNFVSD  748
                L + Q S F+CGG+A+   + HK+ D  ++  FM  W A +    +     P F + 
Sbjct  144   T-KLLLAQASFFECGGMAIGVCISHKLADATSISLFMKSWAAISSRGSIKTVGFPVFDTV  202

Query  749   SVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
              +FP      T P+ P+ +P I   + +  + KRFVF    +  L+   S    V  PTR
Sbjct  203   KIFPPGNFSETSPA-PVVEPEI---MMNQTLSKRFVFDSSSIQALQAKASSFE-VNQPTR  257

Query  911   AEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTFSTSPAA  1072
              E VSAL++K  +KA    + + +PSIL + A +R  +  P   NS GN++S F+ + A 
Sbjct  258   VEAVSALIWKAAMKATRTVSRTSKPSILANSACLRSRVSPPFTENSIGNLVSYFA-AKAE  316

Query  1073  AGE--MDLARLVAELREGKERLQSRDNELVQ--------EIVTS--LRTGEKPYENPDLD  1216
              GE    L  LV E+R+ K+R   RDN + +        EI+ +  +  G+    + D D
Sbjct  317   EGENQTKLRTLVFEIRKAKQRF--RDNHVSKLVGNPDATEIICNYQIEAGDM-IASGDFD  373

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
              Y  SS  ++  Y  DFGWG P  V  P    KN+  L+D +  GG EA V L + +M  
Sbjct  374   FYIFSSACRFGLYETDFGWGNPVWVGFPSVRQKNIVALLDTKEAGGIEAWVNLNEQEMKL  433

Query  1397  FERDEELLRFA  1429
             FE+D ELL FA
Sbjct  434   FEQDRELLSFA  444



>ref|XP_008226088.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=455

 Score =   230 bits (586),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 146/428 (34%), Positives = 217/428 (51%), Gaps = 29/428 (7%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN------NRTDPTRV----SDILQ  373
             IKPSSPTP  LR   LS+ DQ    MYI L+ FYPNN      N  D   +    S +L+
Sbjct  24    IKPSSPTPHHLRTSSLSVFDQLQPDMYISLLLFYPNNISDDVVNNIDHNSLFAERSKLLK  83

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG  553
              +LS  LT FYP+AG    N ++ CND GA F   +VNC +  ++  PD        P  
Sbjct  84    TSLSEALTQFYPFAGEFEYNVSISCNDHGAGFIESQVNCPIRKVLEKPDFGILEQLIPIA  143

Query  554   LPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWV------AATRHP  715
             +   ++  G L + Q++ F+CGG+ +   + HKV D  T+  F+  W       A+T   
Sbjct  144   IKSKSVEAGHLLLVQVNSFECGGLTIGVNISHKVADASTLSTFIKSWATIALGSASTASD  203

Query  716   KLNLSPNF-VSDSVFPTLPSGPLDKPM-IPSKIEDDCVQKRFVFSGEKLDLLKDVVSEES  889
             ++ L   F V+ ++FP  P    + P  I   I D C+ KRFVF   K+       +  +
Sbjct  204   QVLLPVEFGVAATLFP--PQDVFNSPQPIMELIRDSCITKRFVFDASKI-AALKSKAASA  260

Query  890   GVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPC--NSAGNILST  1051
              V NPTR E+VSAL++KC ++A+ +     +PS  V   +MR   GL    N  GN +S 
Sbjct  261   AVPNPTRVEVVSALIWKCALQASRANLGFTKPSAWVQVVNMRKRSGLATAENILGNFVSF  320

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSR-DNELVQEIVTSLRTGEKPYENPD-LDIYF  1225
             F+     +  + L  LV +LR+G +  + +  N +  E    +  G K     D ++ Y 
Sbjct  321   FTAMTMESDAVKLKSLVHKLRKGIDEFKEKYANGVSGEDAFQIIEGLKNLIMKDSIETYG  380

Query  1226  CSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
             C+S  ++    ADFGWG P  ++  +   KN   L D   G G EAL+ L++  M+ FER
Sbjct  381   CTSWCRFSFNQADFGWGKPSWMNFCRNESKNTTLLTDMSDGVGIEALLSLEEEHMAMFER  440

Query  1406  DEELLRFA  1429
             +E+LL +A
Sbjct  441   NEDLLEYA  448



>ref|XP_004301957.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=452

 Score =   229 bits (584),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 155/441 (35%), Positives = 228/441 (52%), Gaps = 49/441 (11%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN--------NRTDPTRV----SDI  367
             I PSSPTP  LRF  LS+ DQ   ++Y PL+ FYPN         N  DP  +    + +
Sbjct  15    ISPSSPTPHPLRFFSLSVFDQLTPTVYFPLLLFYPNTVQPRDRELNSIDPQSLVVERTKL  74

Query  368   LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP  547
             L+ +LS TLT FYP+AGR+ D+A++ CND GA F   +V C++  ++  PD +      P
Sbjct  75    LKTSLSETLTRFYPFAGRIHDHASICCNDQGAVFVEAKVKCSISRVLEEPDLEFLTELIP  134

Query  548   AGLPWANIHDGGLAVF--QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA-----AT  706
               L   +  + G  +   Q++ F+CGGIA+   + HK+ D  T+  F+  W A      T
Sbjct  135   K-LESTDEGETGYVLLNVQVNFFECGGIAIGFNVSHKMIDAFTLSTFVNSWAATSLGFGT  193

Query  707   RHPKLNLSPNFV-SDSVFPTLPSGPLD----KPMIPSKIEDDCVQKRFVFSGEKLDLLKD  871
                 +  S  +V + S FP     PLD     P      ++ C+ KRFVF   K+  LK 
Sbjct  194   SDHTVFPSHQYVGAASRFP-----PLDLFKSPPQFGKLAKEKCITKRFVFESSKIAYLKS  248

Query  872   VVSEESGVKNPTRAEIVSALLYKCCVKAAA----SRRPS-ILVHYADMRPPLGLPC--NS  1030
               + ++ V NPTR E+VSAL++K  +KA++    S RPS   +   +MR  L  P   N 
Sbjct  249   EAASDA-VPNPTRVEVVSALIWKTAMKASSANSDSVRPSSTWLQIVNMRNILAQPSGKNL  307

Query  1031  AGNILSTFSTSPAAAGEM--DLARLVAELREGKERLQSR------DNELVQEIVTSLRTG  1186
              GN+L  F+      GE   DL  LVA +R+G E  + +        E V +++   R  
Sbjct  308   MGNLLGFFAARSTGGGESKDDLQGLVAAMRKGFEEFKVKYGTKFVSGEDVSKLMNEYR--  365

Query  1187  EKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEAL  1366
              +  +  D++ Y  +S  ++P   ADFGWG P         +KN+  L+D   GGG EA 
Sbjct  366   -EQMQKDDIECYCSTSWCRFPFCEADFGWGKPLMSVPATVELKNLIMLMDTSDGGGVEAR  424

Query  1367  VMLKKTDMSGFERDEELLRFA  1429
             + LK+ DM+ FE++EELL FA
Sbjct  425   LTLKEEDMAKFEKNEELLAFA  445



>ref|XP_010682956.1| PREDICTED: BAHD acyltransferase At5g47980 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score =   229 bits (584),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 158/433 (36%), Positives = 221/433 (51%), Gaps = 41/433 (9%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP----NNNRTDPTRVSDILQNAL  382
             R  IKPSS T P LR  K SLLDQ   S+Y P+VFFYP    +N + D +   + L+ +L
Sbjct  17    RDYIKPSSITAPHLRNFKFSLLDQLAPSLYAPMVFFYPMQDISNIKDDTSYRVNHLKRSL  76

Query  383   SRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRV-NCTLLDIINHPDADAQNVAFPAGLP  559
             S  L  FYP+AGR+ D+ ++DCNDAG EFF  +V N  L D +  P+A+A     P  + 
Sbjct  77    SPFLNRFYPFAGRIKDHVSIDCNDAGVEFFEAKVINTRLNDFLRLPNANALKQFLPVDIE  136

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
              +N     L   Q + F+CGG+A+     HK+ DGGT   FM  W +        + P +
Sbjct  137   -SNKSMDHLVHVQTNTFECGGMALGICWSHKITDGGTASTFMKGWSSMASGLGDEVVPEY  195

Query  740   VSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEI  919
             V+ S+FP + S      +   K  D    +RFVF G K+  LKD V+ +  V  PTR E 
Sbjct  196   VASSLFPPMDSSITQHALKLDK--DRTTTRRFVFDGSKIVKLKDKVASKE-VPKPTRVEA  252

Query  920   VSALLYKCCVKAA----ASRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAAA  1075
             VS+LL++C  KA+     S+  S++    ++R    PPL  P  S GN++  +       
Sbjct  253   VSSLLWQCATKASRANSGSQALSVMSQSMNIRRRTLPPL--PDTSIGNLVGYYIAKMEEN  310

Query  1076  GE--MDLARLVAELREGK--------ERLQSRD-----NELVQEIVTSLRTGEKPYENPD  1210
              +  M L  LV + R+GK        ++LQ  D      EL +E  + LR         D
Sbjct  311   SDHIMHLEDLVTKQRQGKTEAINNYAKKLQGNDAYVVIQELFKEAGSLLR-------RDD  363

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             +  + C S      Y ADFGWG P   S+     KN F L + + GGG EA V L + DM
Sbjct  364   VAFFKCLSTCGDGLYDADFGWGKPAWQSLVSLGYKNTFALSETKEGGGIEAWVTLNEDDM  423

Query  1391  SGFERDEELLRFA  1429
             + FE D +LL+FA
Sbjct  424   AIFEHDFDLLQFA  436



>ref|XP_008437382.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis melo]
Length=437

 Score =   228 bits (581),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 145/431 (34%), Positives = 219/431 (51%), Gaps = 25/431 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDP-TRVSDILQN  376
             + I  + +IKPSSPTP  L    +SLLDQ  T+ Y+P++ F+PN+N   P    SD L+ 
Sbjct  3     VQILTKEIIKPSSPTPSHLHRFNISLLDQLSTAGYVPVILFFPNSNGATPFNERSDRLKK  62

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +L+  LT FYP AGR  +N+ +DCND GAE+   R NC L D +  P  +      P   
Sbjct  63    SLAEILTRFYPLAGRPRENSYIDCNDDGAEYVEARTNCVLSDFLKEPTPELLAQFLPIKT  122

Query  557   PWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSP  733
                   DGG + + Q++ F+CGG+A+  +  HK+ D  ++   +  W AA     + + P
Sbjct  123   EAPEAADGGRMLLVQVTLFECGGMAMGISFSHKLVDASSISVILKSWSAAALGSDM-VEP  181

Query  734   NFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRA  913
              F+  S+ P+    P+  P      +  C  +R VF+ + +  LK   + +    NPTR 
Sbjct  182   EFLQTSLVPSPEGIPIAAPPTDLGGKVKCSSRRLVFNAQSIADLKSKAASDIA-PNPTRV  240

Query  914   EIVSALLYKCCVKAAAS--RRP-------SILVHYADMRPPLGLPC--NSAGNILSTFST  1060
             E+V+AL++KC +KA AS  R+        S++    ++R  L  P    S GN++  F T
Sbjct  241   EVVTALIWKCAMKAQASTTRKTTSPSPNLSVMSQTVNLRKRLTPPSPEYSIGNLVGNFVT  300

Query  1061  SPAAAGEMDLARLVAELREGK--------ERLQSRDNELVQEIVTSLRTGEKPYENPDLD  1216
                 A E DL  LV  LR+G         +R + +D     +I   L+     +   D+ 
Sbjct  301   DAIPAWEKDLKGLVELLRDGVREFNKNGIKRYEGKD--CFMKIFEWLQQSGGLFMREDVA  358

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
              Y  SS  ++  Y  DFGWG P  VS+      N   L+D + G G EA V LK+ +M+ 
Sbjct  359   FYISSSWTRFGLYEMDFGWGKPGWVSIGSIMFLNFVVLMDTKDGEGIEAWVTLKEDEMTF  418

Query  1397  FERDEELLRFA  1429
             F+ D+ELL FA
Sbjct  419   FQSDDELLSFA  429



>ref|XP_009361769.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=446

 Score =   228 bits (581),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 145/426 (34%), Positives = 217/426 (51%), Gaps = 25/426 (6%)
 Frame = +2

Query  212   ERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRT  391
             +R  +KPSSPTP  LR  KLSLL+Q   + Y  LV FYP N+ T       IL+ +LS T
Sbjct  7     KRETLKPSSPTPQYLRNFKLSLLNQLSPAAYESLVLFYPGNDSTTNQSSLRILKKSLSET  66

Query  392   LTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANI  571
             L  FYP AGR+ DN +VDCND G ++   +VN  L   ++ PDA       P        
Sbjct  67    LVRFYPLAGRMKDNISVDCNDYGVDYVEAKVNGLLSTFLSQPDAGTLRQLLPVATESPEA  126

Query  572   HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDS  751
               G L + Q + F C G+A+   M HK+ D  ++  F+  W A        L P+F +  
Sbjct  127   SKGALLLVQANVFGCSGLAIGMCMSHKLADAASLSTFIMSWSATALGFSQALLPDFTASF  186

Query  752   VFPTLP-SGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSA  928
              FP +  S    +        ++CV KRFVF+  K+  L+   +  + V  PT+AE V+A
Sbjct  187   RFPPIDYSSSFHQSSQVGAKRENCVTKRFVFNASKISALR-TKAASTIVDQPTQAEAVTA  245

Query  929   LLYKCCVKAAASR-------RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAAA  1075
             L+++C V A+ S        + S+L    D+R    PPL    +S GN++  F+ +    
Sbjct  246   LIWRCAVAASRSSNSLQPPPKLSVLSQSVDIRKSVVPPLS--DDSIGNLMGYFA-AQTDE  302

Query  1076  GEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSSL  1237
              E++L  LVA+LR G E L +        ++ ++E VT +       ++  ++ Y  + L
Sbjct  303   NELELQGLVAQLRRGIEELSNNYAKRPGKDQAIRESVTEVHNNFVKRDDT-INFYVGTDL  361

Query  1238  GKYP-AYTADFGWGWPCKVS-MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             G Y   Y  +FGWG P  +S +P     N+ +L+  +   G EA V L + DM+ FER++
Sbjct  362   GNYKLLYEVNFGWGKPIWLSNVPAASSTNVAYLVSTRKDDGIEAWVTLSEEDMAAFERNQ  421

Query  1412  ELLRFA  1429
             ELL FA
Sbjct  422   ELLAFA  427



>gb|AAO13736.1|AF253415_1 minovincinine 19-hydroxy-O-acetyltransferase [Catharanthus roseus]
Length=443

 Score =   228 bits (581),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 157/446 (35%), Positives = 233/446 (52%), Gaps = 59/446 (13%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTL  394
             + LIKPSSPTP SL  + LS  DQ +   YI   FFY N +  + + + + LQN+LS+TL
Sbjct  14    KTLIKPSSPTPQSLSHYNLSYNDQNIYPEYIFAGFFYSNPDGHEISTIREQLQNSLSKTL  73

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
              S+YP+AG+++ N  + CND G EF  VR++C + DI+  P+      ++ + L   N  
Sbjct  74    VSYYPFAGKVVKNDYIHCNDDGIEFVDVRIHCRMNDILK-PELR----SYASELIRPNRS  128

Query  575   DGG----LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL---SP  733
               G     A+ QLS FDCGG+AV+  + HKV D  T+ +F+  W A+T     +    +P
Sbjct  129   TVGSEDSTALVQLSHFDCGGVAVAFGISHKVADAATILSFIKDWAASTCDLSSSHDVSTP  188

Query  734   NFVSDSVFP--------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEES  889
               VSDS+FP          P+ P            +CV+KRF+FS E ++ LK   + E 
Sbjct  189   VLVSDSIFPRQDNIICGQFPASP------------NCVRKRFLFSPEAIERLKS-KAIEF  235

Query  890   GVKNPTRAEIVSALLYKCCV---KAAASRR------PSILVHYADMRPPLGLPCNSAGNI  1042
             G++ PTR E+++A L +C     K+AA         P  ++   ++RP L LP NS GN+
Sbjct  236   GIEKPTRVEVLTAFLCRCATVAGKSAAKNNNCGQSLPFAVIQAVNLRPLLELPKNSVGNL  295

Query  1043  L----STFSTSPAAAGEMDLARLV-AELREGKERLQSRDNE------LVQEIVTSLRTGE  1189
             +    ST   +     E +  +LV  ELR+ K++L++   E       +Q+    L+  +
Sbjct  296   ISIYFSTIKENDTVNIEQEFTKLVIGELRKAKDKLKNLSQEKLNYVARMQDFANCLKELD  355

Query  1190  KP----YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGG--  1351
                    EN D+D Y  SS  ++P Y  DFG G P  V M +   KN   L+D   G   
Sbjct  356   ISSFFDMENVDIDAYLFSSWCRFPFYDIDFGLGKPIWVCMFQPHFKNCIILMDYPFGDDY  415

Query  1352  GFEALVMLKKTDMSGFERDEELLRFA  1429
             G EAL+ L++  M  FE +E LL FA
Sbjct  416   GIEALITLEQEKMPAFENNELLLSFA  441



>ref|XP_008372178.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=447

 Score =   228 bits (580),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 153/432 (35%), Positives = 217/432 (50%), Gaps = 36/432 (8%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRT-------DPTRV---SDILQ  373
             IKPSS TPP L+  +LS+ DQ    ++IP++ FYPNN  +        P+ V   S +L+
Sbjct  15    IKPSSSTPPHLKTXQLSVFDQLXPDVFIPILLFYPNNIXSGXVDSIDHPSLVVERSKLLK  74

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG  553
              +LS  LT FYP+AG    N ++ CND G+ F   +VNC +L I+  PDA+      P G
Sbjct  75    TSLSEALTHFYPFAGEFQYNFSISCNDHGSAFIEAQVNCPILKILERPDAEILRQLLPTG  134

Query  554   LPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA--------ATR  709
             +       G L + Q   F+CGG+A+  +  H + D  T+  F+  W A         T 
Sbjct  135   IGSTQAETGYLLLIQAXFFECGGLAIGVSSSHIITDAXTLSTFIQSWAAIALASNSVTTD  194

Query  710   HPKLNLSPNF-VSDSVFPTLPSGPLDKPMIPSKI-EDDCVQKRFVFSGEKLDLLKDVVSE  883
             H  + L+P   V+ S+FP L    L+ P    K  E+ C+ KRFVF   K+  LK     
Sbjct  195   H--VLLTPKLGVAVSLFPQLDF--LNSPQPALKFDEEKCITKRFVFEASKVAALKSKAVS  250

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG---LPCNSAGNI  1042
              S V NPTR E VS L++KC    + S     RPS     A+ R  L    L  N  GN+
Sbjct  251   TS-VPNPTRVESVSXLIWKCATTVSRSNLGVVRPSEWSPVANJRKILVQQPLAENLMGNL  309

Query  1043  LSTFSTSPAA--AGEMDLARLVAELREGKERLQSR-DNELVQEIVTSLRTGEKPYENPDL  1213
             +  FS    A    ++D+  LVA+LR+G E  + +  N +  E               D+
Sbjct  310   VGMFSVKTEAIEVVDIDIPSLVAKLRKGVEEFKVKYGNGVSGEEACGFFXEFGNLMKRDV  369

Query  1214  DIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
             D Y CSS  ++P Y A+FGWG P  V    G MKN+   +D + G G EA +   + DM+
Sbjct  370   DNYNCSSWCRFPFYEANFGWGKPLWVCQSTG-MKNLIVFMDTRDGKGIEASLTFSEEDMA  428

Query  1394  GFERDEELLRFA  1429
              FE ++ELL +A
Sbjct  429   KFECNKELLAYA  440



>ref|XP_008222020.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=437

 Score =   227 bits (579),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 153/432 (35%), Positives = 220/432 (51%), Gaps = 33/432 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  R  IKPSSPTP  L+  KLSLLDQ +   YIPL+ FYP ++     +    L+ +
Sbjct  7     IGIIARQNIKPSSPTPTHLKTFKLSLLDQMVPPTYIPLLLFYPTSDHHRARQ----LKKS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP+AG + DNA ++CND GA F   +V+C L  I+N PD +      P    
Sbjct  63    LSETLTRFYPFAGTIKDNAFIECNDNGACFIEAQVSCLLSHILNEPDHEVLKQLLPINFE  122

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
                   G +   Q + F CG +A+   + HK+ D  T+  F+  W A        +    
Sbjct  123   SPEEGRGCVLHVQANYFKCGAMAIGICLSHKIADAATLTTFIKTWAATAS----GIGDES  178

Query  740   VSDSVFPTLPSGPL-DKPMIPSKIE---DDCVQKRFVFSGEKLDLLKDVVSEES---GVK  898
             V   +F  +   PL D  + P  +E      V KRFVF   K+  LK  V+  S    V+
Sbjct  179   VVVPLFNAVSMMPLKDISIAPPAVEIKQHKSVTKRFVFHSSKIAALKAKVTNNSVSAEVE  238

Query  899   NPTRAEIVSALLYKCCVKAA-----ASRRPSILVHYADMR----PPLGLPCNSAGNILST  1051
             +PT+ E ++AL++KC +KA+      S RPS L    ++R    PP  +P  S GN + +
Sbjct  239   HPTKVETLAALIWKCAMKASRANLGISTRPSALYQNVNIRSRVLPP--VPNESIGNFVGS  296

Query  1052  FSTSPAAAGEMDLARLVAELREGKERL--QSRDNELVQEIVTSLRTGEKPYE---NPDLD  1216
             F    + A E +L  LVAELR+G  +    ++   L+++I   L+   +        D+D
Sbjct  297   FIARTSEA-ETELHGLVAELRKGILQFCKNAKRVPLIEDISVILKPQIEAIGLLCRDDVD  355

Query  1217  IYFCSSLGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
              Y C+S  ++  Y  ADFGWG P  V+      KNM  L+D + G G E LV L + DM 
Sbjct  356   FYACTSWCRFQVYEAADFGWGKPMWVTSANPTCKNMVILLDTKDGDGIECLVRLTEEDMK  415

Query  1394  GFERDEELLRFA  1429
              F  D+ELL +A
Sbjct  416   VFVCDQELLAYA  427



>ref|XP_006422064.1| hypothetical protein CICLE_v10006464mg [Citrus clementina]
 gb|ESR35304.1| hypothetical protein CICLE_v10006464mg [Citrus clementina]
 gb|KDO56834.1| hypothetical protein CISIN_1g013918mg [Citrus sinensis]
Length=434

 Score =   227 bits (579),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 151/431 (35%), Positives = 222/431 (52%), Gaps = 31/431 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD------PTRVS  361
             + I  +  IKPS PTP  LR  +LS+LDQ    +YI  +F Y  N+  D        R+S
Sbjct  7     VEILSKETIKPSFPTPHQLRNFQLSILDQIALPVYISNIFLYKANDEDDGDLDAKTERIS  66

Query  362   DILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA  541
               L+++LS TL  FYP+AG++ D  +++CND G E+   R N  L + +  PD +     
Sbjct  67    QRLKSSLSETLAQFYPFAGKIKDEVSIECNDDGVEYIEARANRLLSEYLQKPDQNILKEF  126

Query  542   FPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR--HP  715
              P          G + + Q++ F CGG+A+  +  HK+ DG ++  F+  W A  R    
Sbjct  127   HPFDTENPIGSTGPILIVQVTFFKCGGVALEISSSHKLIDGMSLATFINIWAATARAQSS  186

Query  716   KLNLSPNFVSDSVFPTLPSGPLDK-PMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
             K  + P FV+ S+FP  PS      P+  S+    C Q RFVF   K++ LK  V+  S 
Sbjct  187   KAIMVPEFVTASIFP--PSEFFVAFPVHLSR----CEQIRFVFDPSKINELKAKVASAS-  239

Query  893   VKNPTRAEIVSALLYKCCVKAAASRR----PSILVHYADMR----PPLGLPCNSAGNILS  1048
             V  P+R E ++AL++KC    + S R     S+LVH  ++R    PPL  P NS GN + 
Sbjct  240   VPKPSRVEALTALIWKCARDVSGSTRGSTRASLLVHAVNLRTLVVPPL--PNNSVGNNVG  297

Query  1049  TFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEK---PYENPDLDI  1219
               S    +  E++L  LV  LR+ K        + + E  +     E      E  ++D 
Sbjct  298   YLSAQ-TSDKEIELHELVCILRKAKAEFSKNGLQNLLETKSIFNIPESIKDKLERDEIDF  356

Query  1220  YFCSSLGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             +  SS+ ++P Y  A+FGWG P  V+ P     N+F LID + G G EALV L+  DM+ 
Sbjct  357   FTFSSVLRFPFYEAAEFGWGKPLHVTFPNYVFPNLFLLIDTKDGEGIEALVTLRTEDMAL  416

Query  1397  FERDEELLRFA  1429
             FER++ELL FA
Sbjct  417   FERNQELLEFA  427



>ref|XP_002514983.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47537.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=442

 Score =   228 bits (580),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 159/437 (36%), Positives = 223/437 (51%), Gaps = 37/437 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD-------PTRV  358
             + I ++  IKPSSPTP  L+  KLSLLDQ +   Y  L+ FYP N   D        +  
Sbjct  7     VEIIQKDTIKPSSPTPHDLKILKLSLLDQFIPITYTSLLLFYPINYGDDNLDHHASTSEK  66

Query  359   SDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNV  538
             S  L+ +LS TLT F+P AGRL DN +V C+D GAEF   RVNC L +++ +PDA   + 
Sbjct  67    SLKLKKSLSETLTHFHPLAGRLRDNTSVACDDQGAEFIEARVNCLLSELLKNPDAQVLSQ  126

Query  539   AFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK  718
               PA +       G L + Q + FDCGG+AV   + HK+ D  T+  F+  W A      
Sbjct  127   FLPAPIESPEAATGNLLLVQATFFDCGGLAVGICISHKMADAATLTTFIRCWSATATDRS  186

Query  719   LNLSPNFVSDSVFP----TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEE  886
               L+P F+  S+FP    ++P  P++       ++  CV +RFVF+  K+  L+  V+  
Sbjct  187   KILNPVFMGASIFPPIDISIPRTPVE------LMQQKCVTRRFVFAAPKIAALRAKVAST  240

Query  887   SGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNI  1042
             + V +PTR E VS +L+K  V A+  R    RPSI     +MR    PP   P N AGN 
Sbjct  241   T-VPDPTRVEAVSGILWKSAVTASRIRFGYSRPSIWSISVNMRTRFVPP--FPENYAGNC  297

Query  1043  LSTFS-TSPAAAGEMDLARLVAELRE-----GKERLQSRDNE--LVQEIVTSLRTGEKPY  1198
             L   +        E +L  LV  +R+     G+  ++    E  L+     +   G    
Sbjct  298   LGHIAPILMDGECEFELKELVGRVRKEIKGFGENYVKKLQGEGALLAVCGFAKEFGNLAM  357

Query  1199  ENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLK  1378
              N D D Y C+S  KY  Y ADFGWG P  V      ++N+  L+D + G G E  + L 
Sbjct  358   SN-DNDFYICTSWCKYELYDADFGWGKPVWVGNASHKVRNVAILMDTRDGDGIEVWLTLG  416

Query  1379  KTDMSGFERDEELLRFA  1429
             + DM+ FE +EELL FA
Sbjct  417   EEDMAFFESNEELLEFA  433



>ref|XP_008372855.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=465

 Score =   228 bits (581),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 157/468 (34%), Positives = 231/468 (49%), Gaps = 42/468 (9%)
 Frame = +2

Query  110   STTFFYKYHGVEYMFLHTQETKMAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQA  289
             S   + K  GV Y  L  +E KM   +   + +  +  IKPS PTP  LR   LS+ DQ 
Sbjct  5     SVCLYMKLGGVCYETLVWRE-KMG--SEMKIQVIYKDTIKPSLPTPHHLRNLSLSVFDQL  61

Query  290   LTSMYIPLVFFYPNNN-------RTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDC  448
                +Y+PL+ FYPN+N        +     S +L+ +LS  LT FYPYAG    NA++ C
Sbjct  62    FPDIYVPLLLFYPNDNNKYFEGKHSLVAERSKLLKKSLSEALTRFYPYAGNFQHNASICC  121

Query  449   NDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIA  628
             ND GA +   RVNC +  I+N P+        P  L  +    G L + + + F+CGG+A
Sbjct  122   NDHGAAYVEARVNCPMSKILNKPELMILKQLLPTVLDSSQEDTGYLLLVKANFFECGGLA  181

Query  629   VSAAMCHKVGDGGTVRNFMGHWVAATRHPK-----LNLSPNF-VSDSVFPTLPSGPLDKP  790
             +     HKV D  T+  F   W A  R        + L   F V+ S+FP +      +P
Sbjct  182   IGVGSSHKVADAYTLSKFTSCWAAIARGSNTITDHIELPDKFGVAASLFPQVDFLNSLQP  241

Query  791   MIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR-  967
              +    ++ C+ KRFVF   K+  LK      + V+NPTR E+VSAL++KC ++A+ S  
Sbjct  242   ALEFS-QEKCITKRFVFXASKIAALKSKAGSAT-VENPTRVEVVSALIWKCAMEASRSNL  299

Query  968   ---RPSILVHYADMRPPLGLPC--NSAGNILSTFSTSPAAAGEMDLARLVAELREGKERL  1132
                RPS L  + ++R  L  P   N  GN++        A+   D+  LV + R+  E  
Sbjct  300   GVVRPSELSQFVNIRKILVSPLAENLLGNLVGLCVAKTEASEVDDVQSLVTKFRKEMEEF  359

Query  1133  QSRDNELVQEIVTSLRTGEKPYE---------NPDLDIYFCSSLGKYPAYTADFGWGWPC  1285
             +    + +        +GE+  E           D+D Y C S  ++P Y ADFGWG P 
Sbjct  360   KVXYGKGI--------SGEEACEFYKEYGHLMKRDVDNYNCXSWCRFPFYEADFGWGKPL  411

Query  1286  KVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              V    G +KN+  L+D + G G EA + LK+ DM+ FE ++ELL +A
Sbjct  412   WVPHIGG-LKNLILLMDTRDGEGIEASLTLKEEDMAKFESNKELLSYA  458



>ref|XP_006422067.1| hypothetical protein CICLE_v10004997mg [Citrus clementina]
 ref|XP_006490612.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
 gb|ESR35307.1| hypothetical protein CICLE_v10004997mg [Citrus clementina]
 gb|KDO56837.1| hypothetical protein CISIN_1g013771mg [Citrus sinensis]
Length=436

 Score =   227 bits (578),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 155/425 (36%), Positives = 212/425 (50%), Gaps = 29/425 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-NRTDPTRVSDILQN  376
             + I  R  IKPSSPTP +LR  KLSLLDQ +   Y   + FY NN +  D   +S  L+ 
Sbjct  7     VEILARETIKPSSPTPHNLRNFKLSLLDQIMPVEYTAAILFYSNNGHHADGAEMSQRLKA  66

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             AL  TL +FYP+AG + DN  V+CND GA F   R N  L +++   D        P  +
Sbjct  67    ALPETLKNFYPFAGIIKDNVLVECNDNGAVFVEARANYPLSEVLQQHDHKLLREFLPIEI  126

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP----KLN  724
                    G L + Q++ F CGG+AV   + HK+ DG         W A    P    K+N
Sbjct  127   ESTKAGSGPLLLTQVTIFKCGGVAVGNCLSHKIADGCAASFLAKSWAATVLDPGNKAKVN  186

Query  725   LSPNFVSDSVFPTLPSGPLDKPMIPSK--IEDDCVQKRFVFSGEKLDLLKDVVSEESGVK  898
                  ++ S+FP       D  + P       + + KRFVF   K+  LK  V+  S V 
Sbjct  187   TPEYVIAASLFPP------DDSLEPHADVTGQNYITKRFVFHASKIAQLKAKVTSAS-VP  239

Query  899   NPTRAEIVSALLYKCCVKAAASRRP----SILVHYADMR----PPLGLPCNSAGNILSTF  1054
              PTR E + AL++K  + A+ S R     S+  H  ++R    PP  LP N  GN +  F
Sbjct  240   KPTRVEAIVALIWKSTITASRSIRGFPRVSLTAHSMNLRRMVSPP--LPDNCVGNFVGDF  297

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
               + A   E++L  LV +LR+GK+       + + E  +SL  G    E   +D Y  S 
Sbjct  298   P-AKATQREIELQDLVHQLRKGKDEFCKNGMQNILEKKSSLMHG---VEGDAVDFYMYSD  353

Query  1235  LGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
             L + P Y  DFG G P  V++P   M NM  L+  ++G G EALV L + DM+ FERDEE
Sbjct  354   LSRLPMYDTDFGLGKPVWVTIPNY-MHNMIMLLSTRNGEGIEALVSLSEEDMALFERDEE  412

Query  1415  LLRFA  1429
             LL FA
Sbjct  413   LLAFA  417



>ref|XP_006431929.1| hypothetical protein CICLE_v10003910mg [Citrus clementina]
 gb|ESR45169.1| hypothetical protein CICLE_v10003910mg [Citrus clementina]
Length=437

 Score =   227 bits (578),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 143/426 (34%), Positives = 218/426 (51%), Gaps = 30/426 (7%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALS  385
             +  R  IKP+ PTP  LR  KLSL+DQ    +Y+  +F Y  +      ++S  L+++LS
Sbjct  9     VRARESIKPAYPTPEHLRNFKLSLMDQINFPVYVSTIFLYKADGNVKADQISQRLKSSLS  68

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWA  565
             +TLT FYP AGR+ D+ +++CND GAE+     N  L + +  PD +      P     +
Sbjct  69    KTLTKFYPLAGRVKDDFSIECNDEGAEYVEAFANGFLFEYLQKPDQNLLRDFHPFNYAES  128

Query  566   NIHDGG--LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
              +   G  +   Q + F CGG+A++   CHK+ DG ++  F+  W    R     + P F
Sbjct  129   PVASNGGPMMRIQATFFKCGGLAITVCTCHKLIDGVSLGIFVNSWTTTARAGNKEVVPRF  188

Query  740   VSDSVFPTLPSGPLDKPMIPSKIEDDCVQ-KRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
             V+ ++FP   S       +P  +    VQ  RFVF  +K+D L+  VS  S V  P+R E
Sbjct  189   VASTIFPASES------FVPLPLHISPVQANRFVFDTKKIDRLRAEVSSAS-VPRPSRVE  241

Query  917   IVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAA  1072
              ++AL++KC   A+ S     RPS+  +  ++R    PP  LP NS GN ++      + 
Sbjct  242   ALTALIWKCARAASRSNLGYSRPSLSAYAINVRAVAEPP--LPDNSVGNSVAYLMAQASE  299

Query  1073  AGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
                  L  LV  LR+ K   +        +N+ + +I  S++     +E  ++D Y  SS
Sbjct  300   KEIETLQDLVCSLRKAKAEFRRNGLKTLLENKSIFDIPESIK---DKFEKDEIDFYTFSS  356

Query  1235  LGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDE  1411
             +  +P Y  ADFGWG P  ++ P   + N+  L+D   G G E LV L   DM+ FERD+
Sbjct  357   IVNFPYYEAADFGWGKPVHLTFPNYLVSNLIMLMDTNDGKGIEVLVTLSPEDMAFFERDQ  416

Query  1412  ELLRFA  1429
             ELL FA
Sbjct  417   ELLAFA  422



>ref|XP_008372831.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
 ref|XP_008346322.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=446

 Score =   227 bits (578),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 147/432 (34%), Positives = 218/432 (50%), Gaps = 37/432 (9%)
 Frame = +2

Query  212   ERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRT  391
             +R  +KPSSPTP  LR  KLSLL+Q   + Y  LV FYP N+ T P     IL+ +LS T
Sbjct  7     KRETLKPSSPTPQYLRNFKLSLLNQLSPAAYESLVLFYPRNDXTTPQISLRILKKSLSET  66

Query  392   LTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANI  571
             L  FYP AGR+ DN +VDCND G ++   +VN  L   ++ PDA       P        
Sbjct  67    LVRFYPLAGRMKDNISVDCNDYGVDYVEAKVNGLLSTFLSQPDAGTLRQLLPVXTESPEA  126

Query  572   HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDS  751
               G L + Q + F CGG+A+   M HK+ D  ++  F+  W A        L P+F +  
Sbjct  127   GKGALLLVQANVFGCGGLAIGICMSHKLADAASLSTFIMSWSATALGFSQALLPDFTASF  186

Query  752   VFPTL-------PSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
              FP +        S P+D         ++CV KRFVF+  K+  L+   +  + V  PT+
Sbjct  187   RFPPIDYSSSFHQSSPVDAK------RENCVTKRFVFNASKISALR-TKAASTIVDQPTQ  239

Query  911   AEIVSALLYKCCVKAAASR-------RPSILVHYADMR----PPLGLPCNSAGNILSTFS  1057
             AE V+AL+++C V A+ S        + S+L    D+R    PPL    +S GN++  F+
Sbjct  240   AEAVTALIWRCAVAASRSSNSLQPPPKLSVLSQSVDIRKSVVPPLS--DDSIGNLMGYFA  297

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDI  1219
              +     E++L  LVA+LR G + L +        ++ ++E V  +       ++     
Sbjct  298   -AQTDENELELQGLVAQLRRGIKELSNNYAKRPGKDQAIRESVKEVHNNFVKRDDTT-SF  355

Query  1220  YFCSSLGKYP-AYTADFGWGWPCKVS-MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
             Y  + LG Y   Y  +FGWG P  +S +P     N+ +L+  +   G EA V L + DM+
Sbjct  356   YVGTDLGNYKLLYEVNFGWGKPIWLSNVPAASSTNVAYLVSTRKDDGIEAWVTLSEEDMA  415

Query  1394  GFERDEELLRFA  1429
              FER++ELL FA
Sbjct  416   AFERNQELLAFA  427



>ref|XP_007018004.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
 gb|EOY15229.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
Length=439

 Score =   226 bits (577),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 146/417 (35%), Positives = 221/417 (53%), Gaps = 29/417 (7%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFY-----PNNNRTDPTRVSDILQNALSR  388
             IKPS PTP  LR +KLSLLDQ + S ++P++ FY      +NN +      + L+ +LS 
Sbjct  11    IKPSCPTPHHLRTYKLSLLDQLMQSAHVPMILFYRPINCDSNNMSVVGERLERLKQSLSE  70

Query  389   TLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWAN  568
             TLTSFYP+AGR+ D   +DCN++G ++F  +++C+L +I++ PD+       P+ L    
Sbjct  71    TLTSFYPFAGRIKDGLYIDCNNSGVQYFEAKISCSLSEILSKPDSQMIRQLLPSNLSRLE  130

Query  569   IHDGGL--AVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFV  742
               + G+  A+ Q++   CGGIA+     HK+ DG T   F+  W A+ R       P+F+
Sbjct  131   TPNAGIPVAMIQVNILKCGGIAIGTQTSHKIIDGPTSTTFLKAWAASARGSGEAPRPSFI  190

Query  743   SDSVFPT---LPSGPLDKPMIPSKIE-DDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
             +  +FP    LPS  +   + PS ++   CV +RFVF    +  LK   S  S V+NPT 
Sbjct  191   APLLFPQNSLLPSDTM-LAIWPSLLKFGKCVTRRFVFDASGIATLKAKASSSSFVRNPTL  249

Query  911   AEIVSALLYKCCVKAA----ASRRPSILVHYADMR--PPLGLPCNSAGNILSTFSTSPAA  1072
              E VSA ++ C   A+     S RPS+L H  ++R      LP +S GN+L   +    A
Sbjct  250   VESVSAFIWICVTAASRIRYGSLRPSVLSHIVNLRGKTATSLPEHSIGNLLWMATAQCHA  309

Query  1073  AGEMDLARLVAELRE------GKERLQSRDNELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
                ++L  L A LR+      G+   Q +  +  Q++   L    + + N   D +  SS
Sbjct  310   VANLELQSLGALLRKSIMETSGEFVDQLQGEKGFQKVPECLTELGEVHSNGGADYFAFSS  369

Query  1235  LGKYPAYTADFGWGWPCKVSMPKG----PMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
             + K   Y ADFGWG P  VS P G      +N+ FLI+ ++G G EA V L + DM+
Sbjct  370   MCKVGIYEADFGWGKPMWVS-PGGIDGLVFQNLVFLIETRNGDGIEAWVTLDEQDMA  425



>ref|XP_004159582.1| PREDICTED: vinorine synthase-like [Cucumis sativus]
Length=429

 Score =   226 bits (575),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 150/450 (33%), Positives = 228/450 (51%), Gaps = 60/450 (13%)
 Frame = +2

Query  176   MAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT-  352
             MA+++   L I    +IKPSSPTPP+L  H LSL DQ     ++PL+FF+ ++  +  T 
Sbjct  1     MAMMSLQHLQIVSTQIIKPSSPTPPNLNIHTLSLFDQLAPHTFVPLLFFFSHHGPSSGTY  60

Query  353   ---RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVN-CTLLDIINHPD  520
                   ++L+ +LS TL+ +YP AGR+ D  ++DCND G  F   R+   T+  I+ +P 
Sbjct  61    YDHTTVELLRQSLSTTLSRYYPLAGRIKDKVSIDCNDEGVTFVEARLEGVTVSKILENPR  120

Query  521   ADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA  700
             ++     F  GL W +   G L   Q++ F+CGG+++   + HK+GD  T+         
Sbjct  121   SEIVEKLFVDGLQWKDSKMGSLLKVQITLFECGGLSIGVLLSHKLGDLATL---------  171

Query  701   ATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKI--EDDCVQKRFVFSGEKLDLLKDV  874
                  K N  P F S  +FP       D P +   +  E +   KRFVF G K++ LK+ 
Sbjct  172   ----VKRNNKPAFFSGDLFPHG-----DLPAMSGAVIEEGNFTCKRFVFEGSKIESLKNR  222

Query  875   VSEESGVKNPTRAEIVSALLYKCCVKAAASRRPS------ILVHYADMR----PPLGLPC  1024
             +SE+  V+NP+R E+VSAL+YK  + A+ +   S      +L+   ++R    PPL  P 
Sbjct  223   ISEK--VQNPSRVEVVSALIYKAIISASRTNNNSQNHPATLLLQTLNLRKRVAPPL--PD  278

Query  1025  NSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGE-----  1189
                G+++S F         +D  R V EL E    ++    E  ++     RT E     
Sbjct  279   TLVGSLVSFFPVG------VDGEREVVELHELVGTMRKEMGEFCEKYAKKYRTKEWLELI  332

Query  1190  KPYENPDLDI----------YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDN  1339
             K   N   +I          Y CSS   +P Y  DFGWG    ++MP   MKN   ++D 
Sbjct  333   KKRLNESREILSKNGNNQLVYRCSSGCNFPIYEVDFGWGAADWITMPAFKMKNTVMMLDA  392

Query  1340  QSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             ++G G EALV L+  +M+ F+ +EELL FA
Sbjct  393   KNGRGIEALVSLQDGEMAAFQDNEELLAFA  422



>ref|XP_006484024.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=450

 Score =   226 bits (577),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 164/446 (37%), Positives = 228/446 (51%), Gaps = 47/446 (11%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD-----------  346
             + I  +  IKPSSPTP  L+ +KLSLLDQ     Y  L+ FY  N   D           
Sbjct  3     VEIISKETIKPSSPTPNHLKDYKLSLLDQIAPPSYETLLLFYSFNGDDDRQHHHHISVYK  62

Query  347   PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
               ++S  L+ +LS TLT FYP AGR+ DN T+DC+D GA +   +VNC L D++  P+ D
Sbjct  63    ANKLSLQLKQSLSETLTRFYPLAGRVKDNITIDCSDHGAVYVEAQVNCLLQDLLKQPNGD  122

Query  527   AQNVAFPAGLPWANIHDGGLAVF-QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHW--V  697
             +     P  L  A     GL +F Q S F CGG+A+   + HK+ D  TV  F+  W   
Sbjct  123   SVIQLVPIQL--AEESKPGLLLFVQSSFFTCGGVAIGVCISHKIADAATVVTFIRSWAGA  180

Query  698   AATRHPKLNLSPNFVSDSVFP----TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLL  865
             AA  H ++   P++ + S+FP    T  +     P     +++ C  KRFVF G K+  L
Sbjct  181   AAGDHRRV-YYPSYNASSLFPPRDVTATAMLFLNPPFNMAMKEKCFTKRFVFYGPKIAAL  239

Query  866   KDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLP  1021
             +  +S  S     TR E V+AL++KC V A+ S     + SIL    D+R    PP  LP
Sbjct  240   EAALSAPS-----TRGEAVTALIWKCAVNASRSNSGVSKLSILSRSVDIRKITVPP--LP  292

Query  1022  CNSAGNILSTFSTSPAAAGEMDLARLVAELREG-----KERLQSRDNELVQEIVT-SLRT  1183
              NS GN++  ++ S     ++ L  LV ELR+G     K  LQ    E   E +T S + 
Sbjct  293   DNSVGNLVGYYA-SQKDESDIQLQGLVRELRKGIQDFSKSYLQKLQREDALEAITESCKD  351

Query  1184  GEKPYENPDLDIYFCSSLGKYPAYTADFGWG---WPCKVSMPKGPMKNMFFLIDNQSG-G  1351
                   + D+D+Y C+SL     Y  DFGWG   W   +S      KN+  LID+ +G G
Sbjct  352   AIAILISNDVDLYVCNSLCDVSLYDIDFGWGNPTWVTNISSNAANHKNLVGLIDSSTGDG  411

Query  1352  GFEALVMLKKTDMSGFERDEELLRFA  1429
               EA V L + DM+ FERD +LL +A
Sbjct  412   SIEAWVTLSEADMALFERDPDLLCYA  437



>ref|XP_007018014.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY15239.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=648

 Score =   231 bits (589),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 153/428 (36%), Positives = 219/428 (51%), Gaps = 32/428 (7%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD----PTRVSDILQNALSRT  391
             IKPSS TP  L+  KLSLLDQ + S Y P++ FYP +  T     P R+ ++L+ +LS T
Sbjct  212   IKPSSLTPQHLKIFKLSLLDQFIPSPYAPIILFYPTDESTSHLEIPRRL-ELLKKSLSNT  270

Query  392   LTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANI  571
             LTSFYP AG++ ++ +++C+D GA +    VNC L + +N PD     +  P  LP   I
Sbjct  271   LTSFYPLAGKIRNDLSIECSDQGAYYVEAGVNCRLNEFLNQPDL----LFLPRFLPREFI  326

Query  572   HD---GGLAV--FQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPN  736
              D    G  V   Q++ F+CGGIA+   + HK+ DG  +  F+  W A  R  K  + PN
Sbjct  327   LDEPTAGTYVTNIQVNMFECGGIAIGICISHKILDGAALSTFLKAWTATARGCKEAIYPN  386

Query  737   FVSDSVFPTLPSGPLDKPMIPSKI---EDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPT  907
             F++ S+FPT      D  ++       +   + +R +F    +  LK   +   G + PT
Sbjct  387   FIATSLFPTDDLWLRDSSLVMWGSLFRKGKSITRRMIFGTSSIAALK-AQATIPGRQCPT  445

Query  908   RAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPC-NSAGNILSTFSTSPAA  1072
             R E VSA L+KC + A+  +    RPS+L H  ++R  +  P  NS GN+L   S     
Sbjct  446   RVEAVSAFLWKCTMDASKGKNGFQRPSLLTHLVNLRRRMVQPTENSTGNLLWIASAKSKV  505

Query  1073  AGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
               + DL  LV  +RE   R+         D++    +  +LR          LD +  SS
Sbjct  506   ENKSDLPDLVGRVREAISRVDGDFLKKLGDDKGKSLMCETLREIGDLVSKEGLDHFGFSS  565

Query  1235  LGKYPAYTADFGWGWPCKVS---MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
               K+  Y ADFGWG P  VS   M      N+  L+D + G G EA V L + DM+  ER
Sbjct  566   WCKFGFYEADFGWGKPAWVSSFGMENSVYMNLIILVDTRFGDGIEAWVTLDEQDMAILER  625

Query  1406  DEELLRFA  1429
             DEELLR A
Sbjct  626   DEELLRLA  633



>ref|XP_008222013.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=435

 Score =   226 bits (575),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 154/437 (35%), Positives = 229/437 (52%), Gaps = 46/437 (11%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN--RTDPTRV-SDIL  370
             + + ER  IKPSSPTPP LR H+LS LDQ  T +++P++ FY NNN  R +  ++ SD +
Sbjct  4     IQVIERDCIKPSSPTPPHLRKHELSFLDQIATPIFMPMILFYTNNNGRRGNHVKIYSDRV  63

Query  371   QNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPA  550
             + +LS  LT +YP AGR++D+A VDCND GA + + +VNCTL D+I+ PD +  N   P 
Sbjct  64    KQSLSEILTQYYPLAGRVIDDAYVDCNDQGAHYVQAQVNCTLSDVISQPDPNQHNKLLPY  123

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
              L   N+ D  LAV Q++ FDCGG+A+   + HK+ D  +V  F+  W + +R    ++ 
Sbjct  124   DLD--NVGDLVLAV-QVNIFDCGGMAIGICISHKIVDAFSVITFLNSWASVSRG-DYDIK  179

Query  731   PNFVSDSVF-------PTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSE-E  886
              N +S  +F       P   SG   KP       ++ V KRFVFS   +  L+   +E  
Sbjct  180   NNTISPPLFDVATLFPPRSISGY--KPST-GITRENIVTKRFVFSASMVASLRSKYTENN  236

Query  887   SGVKNPTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMR----PPLGLPCNSAGNI  1042
             S    PTR E +S  ++   + +       ++   ++H  ++R    PP  LP    GN+
Sbjct  237   SNEIYPTRIEALSCFIWARFIASTQGEPNPKKIYKVLHAVNLRTRMDPP--LPEYHIGNV  294

Query  1043  LSTFSTSPAAAGEMDLA-RLVAELREGKERLQS------RDNE----LVQEIVTSLRTGE  1189
                     +  G  D   RLV ++R+  + + S      RD +     ++E V     GE
Sbjct  295   SRFAIAKLSFDGSKDTCYRLVGQMRDALKTIDSDYLSKMRDGDTHLNFLKERVAEFMKGE  354

Query  1190  KPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALV  1369
                 N        +SL ++P Y  DFGWG P  V     P KN+   +D +SGGG EA V
Sbjct  355   VVSLN-------FTSLCRFPLYGTDFGWGKPVWVGSASLPFKNLVVFMDTESGGGIEAWV  407

Query  1370  MLKKTDMSGFERDEELL  1420
              LK+ DM+ F+ DE+LL
Sbjct  408   NLKEEDMAKFQEDEQLL  424



>ref|XP_010092011.1| BAHD acyltransferase [Morus notabilis]
 gb|EXB49715.1| BAHD acyltransferase [Morus notabilis]
Length=439

 Score =   226 bits (576),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 150/439 (34%), Positives = 217/439 (49%), Gaps = 43/439 (10%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-------NRTDPTRV  358
             + I  R  I P SPT P  R  K SLLDQ +   Y  ++ FY  N       + T  + +
Sbjct  7     IEIISRKAINPFSPTSPQCRNLKFSLLDQIVPPRYTSIILFYTANTNQNIDSSSTAHSEI  66

Query  359   SDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNV  538
             S+ LQ +LS+TL  FYP+AGRL DN  ++C+D GA F   R+NC L + I  PD +  + 
Sbjct  67    SNSLQKSLSKTLVHFYPFAGRLKDNTCIECSDEGAYFIEARINCQLSEFIKEPDPNFLSH  126

Query  539   AFPAGLP-WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP  715
               P   P  A +    + + QL+ F CGG AVS    HK+ D  ++  F+  W A  R  
Sbjct  127   LLPTSDPKGAELVGRVVLLIQLTVFKCGGTAVSVCASHKIADASSMCEFIKSWAAMARDH  186

Query  716   KLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIE---DDCVQKRFVFSGEKLDLLKDVVSEE  886
                + P F+  S+       P   P I  ++E   +  V KRFVF   KL  LK  +   
Sbjct  187   DEVVHPEFIGASMM-----RPTTDPSIEGRLEAPGESFVTKRFVFDVSKLANLKAKIG--  239

Query  887   SGVKN--PTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAG  1036
             SGV    PT  E+VSA+  +C + A  S     +PS+L    ++R    PP  +P  + G
Sbjct  240   SGVPQLVPTNVELVSAIFLRCAIAACQSTTGCLKPSLLYQTVNLRTRMVPP--VPEAAIG  297

Query  1037  NILSTFSTSPAAAGEMDLARLVAELREG--------KERLQSRDNELVQEIVTSLRTGEK  1192
             N++  F      A +M++  +V ++R+G          R +  D      +  S + GE 
Sbjct  298   NLIWGFPVVVEEASKMEVGDIVVKMRKGLIDFCNEKANRFKGEDG--YSFVFESFKVGES  355

Query  1193  PYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVM  1372
                   +++YFCSS  K+P Y  DFGWG P  ++ P   M N   L+D + G   EA V 
Sbjct  356   L--KMGMNMYFCSSWCKFPFYEVDFGWGKPTWITCPMYSM-NAITLMDTKRGERIEAWVT  412

Query  1373  LKKTDMSGFERDEELLRFA  1429
             L+K +M+ FE +EELL FA
Sbjct  413   LEKQEMAMFETNEELLAFA  431



>ref|XP_010100291.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
 gb|EXB82425.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
Length=434

 Score =   226 bits (575),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 147/437 (34%), Positives = 218/437 (50%), Gaps = 40/437 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  R +IKPSSPTP  L+  KLS LDQ + ++Y  LV FYPN N   P + S+ L+ +
Sbjct  8     VDIIGREIIKPSSPTPSHLKTFKLSFLDQIVPAVYTSLVLFYPNINVLTPDQTSNHLKKS  67

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIIN--HPDADAQNVAFPAG  553
             LS  LT FYP AGR+ DN  ++C+D GA++   + NC L   ++  H D        PA 
Sbjct  68    LSEALTLFYPLAGRVKDNTVIECHDDGAQYVEAKFNCLLSIFLDQQHKDEALIRRFLPAA  127

Query  554   LPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSP  733
             +         L + Q + FDCGG+AV   + HK+ D  T+  F+  W A T  P    + 
Sbjct  128   MESPEAGTWPLLIVQATFFDCGGVAVGVCVSHKLADAATLSVFLKTW-ANTAVPDFEAAS  186

Query  734   NFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRA  913
              ++    F   P   L+   +      + V KR VF    +  LK  +  +S VK PT+ 
Sbjct  187   YYLPRDTFSFAPPAALELKRV------EGVSKRCVFDKSTIAALKAKLVSDS-VKQPTKV  239

Query  914   EIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTF-----  1054
             E+V+ALL++C + A++S     R S++    DMR    PP     NSAGN++S F     
Sbjct  240   EVVTALLWRCLMAASSSAQVTPRYSLVTQSVDMRKRVEPPFSQ--NSAGNLVSYFALQVE  297

Query  1055  ------STSPAAAGEMDLARLVAELREG------KERLQSRDNELVQEIVTSLRTGEKPY  1198
                   ST P    E  L  LVA+LR+G      ++  + R +E +Q +V     G K  
Sbjct  298   NNIYEGSTEPL---ECQLQGLVAKLRQGIKDFTERKAKRFRGDEGLQAVVEHFMEGRKLV  354

Query  1199  ENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLK  1378
                D+  +FC+S   +  Y  D G+G P  V++P    +NM   +D + G G E +  L 
Sbjct  355   TRDDVCYFFCTSWCNFQFYEVDVGFGKPVYVTVPSNTYENMILFMDTRDGDGVEVIFTLS  414

Query  1379  KTDMSGFERDEELLRFA  1429
             K +++ FE   E+L  A
Sbjct  415   KENVALFENQLEILSLA  431



>gb|KDO82048.1| hypothetical protein CISIN_1g012688mg [Citrus sinensis]
Length=458

 Score =   226 bits (576),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 165/446 (37%), Positives = 228/446 (51%), Gaps = 47/446 (11%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD-----------  346
             + I  +  IKPSSPTP  L+ +KLSLLDQ     Y  L+ FY  N   D           
Sbjct  11    VEIISKETIKPSSPTPNHLKDYKLSLLDQIAPPSYETLLLFYSFNGDDDRQHHHHISVYK  70

Query  347   PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
               ++S  L+ +LS TLT FYP AGR+ DN T+DC+D GA +   +VNC L D++  P+ D
Sbjct  71    ANKLSLQLKQSLSETLTRFYPLAGRVKDNITIDCSDHGAVYVEAQVNCLLQDLLKQPNGD  130

Query  527   AQNVAFPAGLPWANIHDGGLAVF-QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHW--V  697
             +     P  L  A     GL +F Q S F CGG+A+   + HK+ D  TV  F+  W   
Sbjct  131   SVIQLVPIQL--AEESKPGLLLFVQSSFFTCGGVAIGVCISHKIADAATVVTFIRSWAGA  188

Query  698   AATRHPKLNLSPNFVSDSVFP----TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLL  865
             AA  H ++   P++ + S+FP    T  +     P     +++ C  KRFVF G K+  L
Sbjct  189   AAGDHRRV-YYPSYNASSLFPPRDVTATAMLFLNPPFNMAMKEKCFTKRFVFYGPKIAAL  247

Query  866   KDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLP  1021
             +  +S  S     TR E V+AL++KC V A+ S     + SIL    D+R    PP  LP
Sbjct  248   EAALSAPS-----TRGEAVTALIWKCAVNASRSNSGVSKLSILSRSVDIRKITVPP--LP  300

Query  1022  CNSAGNILSTFSTSPAAAGEMDLARLVAELREG-----KERLQSRDNELVQEIVT-SLRT  1183
              NS GN++  ++ S     ++ L  LV ELREG     K  LQ    E   E +T S + 
Sbjct  301   DNSVGNLVGYYA-SQKDESDIQLQGLVRELREGIQDFSKSYLQKLQREDALEAITESCKD  359

Query  1184  GEKPYENPDLDIYFCSSLGKYPAYTADFGWG---WPCKVSMPKGPMKNMFFLIDNQSG-G  1351
                   + D+D+Y C+SL     Y  DFGWG   W   +S      KN+  LID+ +G G
Sbjct  360   AIAILISNDVDLYVCNSLCDVSLYDIDFGWGNPTWVTNISSNAPNHKNLVGLIDSSTGDG  419

Query  1352  GFEALVMLKKTDMSGFERDEELLRFA  1429
               EA V L + DM+ FERD +LL +A
Sbjct  420   SIEAWVTLSEADMALFERDPDLLCYA  445



>ref|XP_009780612.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=418

 Score =   225 bits (573),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 148/410 (36%), Positives = 213/410 (52%), Gaps = 17/410 (4%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-NRTDPTRVSDILQN  376
             + I  + +IKPSSPT  +L+ HKLSLLDQ    ++IPL+FFY +     + +R   IL+ 
Sbjct  5     VEIISKEMIKPSSPTTCTLKTHKLSLLDQISPPVFIPLIFFYQDELGNINRSRNIQILKK  64

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS  LT FYP AGR  DN  +DCNDAGAEF   +V+  L  +I  P  +      P   
Sbjct  65    SLSDALTRFYPLAGRFNDNNFIDCNDAGAEFIEAQVHGYLSQVIETPKTEEVREFLPREA  124

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS-P  733
                  +D  LAV Q++ F+CGGIA+   M HKVGDG ++  F+  W A  R     ++ P
Sbjct  125   SEVENNDVLLAV-QVNIFNCGGIAIGVCMSHKVGDGSSIVTFINAWAAIARGNHTGIAQP  183

Query  734   NFVSDSVFPTLP-SGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
             NF   S+FP L  S    KP I  K  D  + +RFVF+ EKLD +K   S  S VK+PTR
Sbjct  184   NFNMSSIFPPLDLSKSSFKPSIGIK-NDKFLSRRFVFNKEKLDAIKKSAS-GSQVKDPTR  241

Query  911   AEIVSALLYKCCVKAAASRRPSI----LVHYADMRPPLG--LPCNSAGNILSTFST--SP  1066
              E +SA L+K  +K +   + S      VH  ++R  +   L  NS GN+ +T     SP
Sbjct  242   VEALSAFLWKNLMKVSKLNKDSTKMFAAVHVVNIRSRMNPTLSDNSFGNLWTTAPAFLSP  301

Query  1067  AAAGEMDLARLVAELREGKERLQSRDNELVQ---EIVTSLRTGEKPYENPDLDIYFCSSL  1237
              +     +  L+  LR    ++ S   E++Q   E +  +    + +   +++ Y  SS 
Sbjct  302   KSEEIFGIDDLLYHLRSAIRKINSDYTEILQNGEEFLKHISKFAELFSKEEVEFYNFSSW  361

Query  1238  GKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTD  1387
              ++P Y  DFGWG P  V     P KN+   +  + G G E  V + + D
Sbjct  362   CRFPVYEVDFGWGKPVWVCTTTFPFKNVVIFMGTKCGEGIETWVNMLEDD  411



>ref|XP_006438135.1| hypothetical protein CICLE_v10031490mg [Citrus clementina]
 gb|ESR51375.1| hypothetical protein CICLE_v10031490mg [Citrus clementina]
Length=458

 Score =   226 bits (576),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 164/446 (37%), Positives = 228/446 (51%), Gaps = 47/446 (11%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD-----------  346
             + I  +  IKPSSPTP  L+ +KLSLLDQ     Y  L+ FY  N   D           
Sbjct  11    VEIISKETIKPSSPTPNHLKDYKLSLLDQIAPPSYETLLLFYSFNGDDDRQHDHHISVYK  70

Query  347   PTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDAD  526
               ++S  L+ +LS TLT FYP AGR+ DN T+DC+D GA +   +VNC L D++  P+ D
Sbjct  71    ANKLSLQLKQSLSETLTRFYPLAGRVKDNITIDCSDHGAVYVEAQVNCLLQDLLKQPNGD  130

Query  527   AQNVAFPAGLPWANIHDGGLAVF-QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHW--V  697
             +     P  L  A     GL +F Q S F CGG+A+   + HK+ D  TV  F+  W   
Sbjct  131   SVIQLVPIQL--AEESKPGLLLFVQSSFFTCGGVAIGVCISHKIADAATVVTFIRSWAGA  188

Query  698   AATRHPKLNLSPNFVSDSVFP----TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLL  865
             AA  H ++   P++ + S+FP    T  +     P     +++ C  KRFVF G K+  L
Sbjct  189   AAGDHRRV-YYPSYNASSLFPPRDVTATAMLFLNPPFNMAMKEKCFTKRFVFYGPKIAAL  247

Query  866   KDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLP  1021
             +  +S  S     TR E V+AL++KC V A+ S     + SIL    D+R    PP  LP
Sbjct  248   EAALSAPS-----TRGEAVTALIWKCAVNASRSNSGVSKLSILSRSVDIRKITVPP--LP  300

Query  1022  CNSAGNILSTFSTSPAAAGEMDLARLVAELREG-----KERLQSRDNELVQEIVT-SLRT  1183
              NS GN++  ++ S     ++ L  LV ELR+G     K  LQ    E   E +T S + 
Sbjct  301   DNSVGNLVGYYA-SQKDESDIQLQGLVRELRKGIQDFSKSYLQKLQREDALEAITESCKD  359

Query  1184  GEKPYENPDLDIYFCSSLGKYPAYTADFGWG---WPCKVSMPKGPMKNMFFLIDNQSG-G  1351
                   + D+D+Y C+SL     Y  DFGWG   W   +S      KN+  LID+ +G G
Sbjct  360   AIAILISNDVDLYVCNSLCDVSLYDIDFGWGNPTWVTNISSNAANHKNLVGLIDSSTGDG  419

Query  1352  GFEALVMLKKTDMSGFERDEELLRFA  1429
               EA V L + DM+ FERD +LL +A
Sbjct  420   SIEAWVTLSEADMALFERDPDLLCYA  445



>emb|CDP07885.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   226 bits (575),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 146/438 (33%), Positives = 221/438 (50%), Gaps = 31/438 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYI-PLVFFYPNNNRTDPTRVSDILQN  376
             + I  R  IKP SPTP   +  K+SLLDQ L  +Y+ PLV+F+ N+ ++D ++  ++L+ 
Sbjct  6     IEIISREYIKPESPTPNDFKTFKISLLDQLLPHLYVVPLVYFFKNDGKSDISKRRELLKQ  65

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS+TL  FYP AG++ DN  VDCND G  +   RVN  L D + HP  +  +   P   
Sbjct  66    SLSKTLVHFYPLAGKVKDNLHVDCNDDGMYYVEARVNAQLSDFLGHPQQELIHGLLPFHP  125

Query  557   PWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSP  733
                 +     +A+ Q++ F+CGGIA+     HKV DG +   FM  W A        + P
Sbjct  126   SSTELFTKTYVAMVQVNIFECGGIAIGIYSSHKVMDGQSTVTFMNAWAATASGSSEEIHP  185

Query  734   NFVSDSVF---PTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS-EESGVKN  901
             +F+S S+F   P LP+        P   +     +RFVF    L++LK+  +  ES V N
Sbjct  186   SFISSSIFHPNPKLPNATSILIPPPQSEQSKSATRRFVFDASALNVLKNNANCAESNVTN  245

Query  902   PTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMR----PPLGLPCNSAGNILSTFS  1057
             P+R      L+++C +  + +    R+PSIL    ++R    PP  LP  S GNI     
Sbjct  246   PSRVTAAMGLIWQCAIATSQARFGFRKPSILTFVVNLRSRNSPP--LPPYSMGNIFWVTY  303

Query  1058  TSPAAAGEMDLARLVAELREGKERL--------QSRDNELVQEIVTSLRTGEKPYE-NPD  1210
                    ++ L  +V  +R G ++L        + +D  LV  ++  L+  E+ +  N D
Sbjct  304   AKCLVNSDLKLPSMVRRVRNGIDKLDNSFLEDIKGKDGSLVN-VMKHLKELEEVHTGNLD  362

Query  1211  LDIYFCSSLGKYPAYTADFGWG---WPC--KVSMPKGPMKNMFFLIDNQSGGGFEALVML  1375
              +    SS+     Y ADFGWG   W C     +    + N+   +D +SG G EA V L
Sbjct  363   TEYLSLSSICNGGIYNADFGWGKPIWTCIGSAGIDALGLPNLVVFMDTRSGDGIEAWVTL  422

Query  1376  KKTDMSGFERDEELLRFA  1429
             K+ DM+ FE+  ELL FA
Sbjct  423   KENDMAIFEKIPELLNFA  440



>ref|XP_006470642.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=466

 Score =   226 bits (575),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 150/425 (35%), Positives = 219/425 (52%), Gaps = 25/425 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  R +IKPS PTP  LR  +LSLLDQ   S+Y+   F Y  NN     +VS  L+++
Sbjct  30    VEIQGREIIKPSHPTPHHLRNLELSLLDQTNYSLYVCTCFLYKVNNNVKADQVSQRLKSS  89

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP+AGR+ D+ +++CND G EF   R +  L + + +PD        P G  
Sbjct  90    LSETLTKFYPFAGRVKDDFSIECNDEGVEFIDGRADGFLSEYLQNPDQKLLTEFQPFGGK  149

Query  560   WANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP-KLNLSP  733
                I   G L + Q++ F CGG+A++    HK+ D  +   F+  W A  R   +  + P
Sbjct  150   GDPIAGKGPLLILQVTFFKCGGVAITTLSSHKLIDALSSSIFISCWAAVARGEFRKAVVP  209

Query  734   NFVSDSVFPTLPS-GPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
              FV+ S+FP   S  P      P++        RFVF   KL  L+  V+  S V  P+R
Sbjct  210   EFVAASIFPPSESFVPFPTHFSPAE------SNRFVFDASKLAQLQAEVASAS-VPRPSR  262

Query  911   AEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSP  1066
              E ++AL++KC   A+ S     RPS+LV   ++R    PPL    NS GN +  F  + 
Sbjct  263   VEALTALIWKCARTASRSNRGFARPSLLVQAVNLRSVVVPPLSE--NSVGNSIG-FMPAQ  319

Query  1067  AAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEK---PYENPDLDIYFCSSL  1237
              +  EM+L  LV +LR+ K+   +   + + E  + L   E     +E  ++D +  +S+
Sbjct  320   TSEKEMELQELVCKLRKAKDEFSNNGIQTLLETKSILNVSESTRDKFERDEIDFFSFTSM  379

Query  1238  GKYPAYT-ADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
               +P +  ADFGWG P  V+ P     N+  L+  + G G EA V L   DM  FER +E
Sbjct  380   ISFPVHEGADFGWGKPIHVTFPNYTTPNVVILVSTEDGAGIEAFVYLSPEDMPIFERSQE  439

Query  1415  LLRFA  1429
             LL FA
Sbjct  440   LLSFA  444



>ref|XP_006446155.1| hypothetical protein CICLE_v10015146mg [Citrus clementina]
 gb|ESR59395.1| hypothetical protein CICLE_v10015146mg [Citrus clementina]
Length=466

 Score =   226 bits (575),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 150/425 (35%), Positives = 219/425 (52%), Gaps = 25/425 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  R +IKPS PTP  LR  +LSLLDQ   S+Y+   F Y  NN     +VS  L+++
Sbjct  30    VEIQGREIIKPSHPTPHHLRNLELSLLDQTNYSLYVCTCFLYKVNNNVKADQVSQRLKSS  89

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP+AGR+ D+ +++CND G EF   R +  L + + +PD        P G  
Sbjct  90    LSETLTKFYPFAGRVKDDFSIECNDEGVEFIDGRADGFLSEYLQNPDQKLLTEFQPFGGK  149

Query  560   WANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP-KLNLSP  733
                I   G L + Q++ F CGG+A++    HK+ D  +   F+  W A  R   +  + P
Sbjct  150   GDPIAGKGPLLILQVTFFKCGGVAITTLSSHKLIDALSSSIFISCWAAVARGEFRKAVVP  209

Query  734   NFVSDSVFPTLPS-GPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
              FV+ S+FP   S  P      P++        RFVF   KL  L+  V+  S V  P+R
Sbjct  210   EFVAASIFPPSESFVPFPTHFSPAE------SNRFVFDASKLAQLQAEVASAS-VPRPSR  262

Query  911   AEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSP  1066
              E ++AL++KC   A+ S     RPS+LV   ++R    PPL    NS GN +  F  + 
Sbjct  263   VEALTALIWKCARTASRSNRGFARPSLLVQAVNLRSVVVPPLSE--NSVGNSIG-FMPAQ  319

Query  1067  AAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEK---PYENPDLDIYFCSSL  1237
              +  EM+L  LV +LR+ K+   +   + + E  + L   E     +E  ++D +  +S+
Sbjct  320   TSEKEMELQELVCKLRKAKDEFSNNGIQTLLETKSILNVSESTRDKFERDEIDFFSFTSM  379

Query  1238  GKYPAYT-ADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
               +P +  ADFGWG P  V+ P     N+  L+  + G G EA V L   DM  FER +E
Sbjct  380   ISFPVHEGADFGWGKPIHVTFPNYTTPNVVILVSTEDGAGIEAFVYLSPEDMPIFERSQE  439

Query  1415  LLRFA  1429
             LL FA
Sbjct  440   LLSFA  444



>ref|XP_004504492.1| PREDICTED: vinorine synthase-like [Cicer arietinum]
Length=438

 Score =   225 bits (573),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 150/438 (34%), Positives = 223/438 (51%), Gaps = 42/438 (10%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  R +IKPSSPTPP L+   LS +D      Y+PL+FFY +    D T     L+N+
Sbjct  3     MEIISREIIKPSSPTPPHLKNFPLSFIDHITFRNYVPLLFFYDDTKVCDQTSKISHLKNS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS+ L+ +YP+AGR  D  +++CND G  F    +   L  I+ +P+ +  N  FP  L 
Sbjct  63    LSQILSIYYPFAGRFKDQVSIECNDQGVSFLVANIGTKLSTILQNPNQNLLNPLFPDELQ  122

Query  560   W--ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK-----  718
             W  AN  +  LA+ Q++ F CG I +S   CHK+ D  T  NF+  W    R  +     
Sbjct  123   WKTANWSESILAI-QINCFACGRIVISVCACHKIIDASTAFNFVNDWAEINREKQKSKSI  181

Query  719   LNLSPN---FVSDSVFP--TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVV--  877
             L++ P    +   ++FP  T P      P +     +  V KRFVF   K+ LLK ++  
Sbjct  182   LSILPYNALYAGGTIFPRATFPIF----PEVEFVKHEAIVCKRFVFEASKIKLLKGMMVN  237

Query  878   SEESGVKNPTRAEIVSALLYKCCVKA-AASRRPSILVHYADMRPPLGLPC--NSAGNILS  1048
             S  + VKNPTR E+V+AL+YKC V A   + + + L    D+R  +  P    S GN++ 
Sbjct  238   SHSNPVKNPTRVEVVTALIYKCAVSALGLNFKTTSLRMAVDLRRRMVPPLLDKSVGNLVW  297

Query  1049  -TFSTSPAAAGEMDLARLVAELREG----------KERLQSRDNELVQEIVTSLRTGEKP  1195
               F  +P      +L  +V ++REG          K   + +D   + E +  + T    
Sbjct  298   FLFVINP------ELHDVVCKIREGLCEFCEIYPKKFGGKEKDLSFILECLKQVTTNSNA  351

Query  1196  YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVML  1375
              EN  L IY  +S  ++P Y ADFGWG P  V+    P +N   L+D + G G EALV +
Sbjct  352   -ENQSLIIY--ASWCRFPMYEADFGWGKPIWVTTSACPARNAIVLMDTRDGDGIEALVNM  408

Query  1376  KKTDMSGFERDEELLRFA  1429
             ++ DM  F+R  EL ++A
Sbjct  409   EQNDMVIFQRHVELCQYA  426



>gb|KEH20540.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=437

 Score =   225 bits (573),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 151/436 (35%), Positives = 228/436 (52%), Gaps = 34/436 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + +  R  IKPSSPTP  L+ + LS +D  L   Y+PL++FY  N  +D       L+ +
Sbjct  3     IELISRETIKPSSPTPSHLKIYPLSFIDNILMRNYVPLLYFYKPNKDSDQNVKISQLRKS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS+ L+ +YP+AGRL D  TV+CND G  F    V   L +++ +P     N  FP  L 
Sbjct  63    LSQLLSKYYPFAGRLKDKITVECNDQGVPFLVTNVKNKLSEVLQNPIEKLLNPLFPDELQ  122

Query  560   WANIH-DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH-PK-----  718
             W  +     L   Q++ F CGG+A+S  M HK+GDG T+ NFM  W     + PK     
Sbjct  123   WKEMDWSETLIAIQINCFACGGMAISVCMSHKIGDGSTLFNFMNDWSIINENLPKEKEGE  182

Query  719   ---LNLSPNFVSD--SVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSE  883
                L L  +F+    S+FP     P+ + ++  + E++ V KRFVF    +  LK + + 
Sbjct  183   KGLLELPFHFLDGGASMFPQ-RDLPIFQELVLKR-ENNVVCKRFVFQPSMIKSLKKMAT-  239

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAA-SRRPSILVHYADMR----PPLGLPCNSAGNILS  1048
              S V +PTR ++V+A +YKC V     + + S+     D R    PPL   C   GNI  
Sbjct  240   SSSVHSPTRVQVVTAWIYKCTVSITGLNFKTSLFSMAVDFRKRMVPPLSEKC--VGNIF-  296

Query  1049  TFSTSPAAAGEMDLARLVAELREGKER--------LQSRDNELVQEIVTSLRTGEKPY-E  1201
              FS+  A   EM+L  LV +++EG              + N+ + +I   L+   + Y E
Sbjct  297   WFSSMFADKKEMELKDLVCKIKEGLSECCDVYPKIFGGKKNDNLLKISECLKQVTESYSE  356

Query  1202  NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKK  1381
             N +L I F SS  ++P Y ADFGWG P  V+     ++N   L+D + G G EA+V +++
Sbjct  357   NGNL-ISF-SSWCRFPMYEADFGWGKPIWVTTSACYVRNGIILMDTRDGDGIEAVVNMEE  414

Query  1382  TDMSGFERDEELLRFA  1429
              DM+ FE + +LL++A
Sbjct  415   NDMTKFEHEVKLLQYA  430



>ref|XP_009773462.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=418

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 148/410 (36%), Positives = 213/410 (52%), Gaps = 17/410 (4%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-NRTDPTRVSDILQN  376
             + I  + +IKPSSPT  +L+ HKLSLLDQ    ++IPL+FFY +     + +R   IL+ 
Sbjct  5     VEIISKEMIKPSSPTTCTLKTHKLSLLDQISPPVFIPLIFFYQDELGNINRSRNIQILKK  64

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS  LT FYP AGR  DN  +DCNDAGAEF   +V+  L  +I  P  +      P   
Sbjct  65    SLSDALTRFYPLAGRFNDNNFIDCNDAGAEFIEAQVHGYLSQVIETPKTEEVREFLPREA  124

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS-P  733
                  +D  LAV Q++ F+CGGIA+   M HKVGDG ++  F+  W A  R     ++ P
Sbjct  125   CEVENNDVLLAV-QVNIFNCGGIAIGVCMSHKVGDGSSIVTFINAWAAIARGNHTGIAQP  183

Query  734   NFVSDSVFPTLP-SGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
             NF   S+FP L  S    KP I  K  D  + +RFVF+ EKLD +K   S  S VK+PTR
Sbjct  184   NFHLSSIFPPLDLSKSSFKPSIGIK-NDKFLSRRFVFNKEKLDAIKKSAS-GSQVKDPTR  241

Query  911   AEIVSALLYKCCVKAAASRRPSI----LVHYADMRPPLG--LPCNSAGNILSTFST--SP  1066
              E +SA L+K  +K +   + S      VH  ++R  +   L  NS GN+ +T     SP
Sbjct  242   VEALSAFLWKNLMKVSKLNKDSTKMFAAVHVVNIRSRMNPTLSDNSFGNLWTTAPAFLSP  301

Query  1067  AAAGEMDLARLVAELREGKERLQSRDNELVQ---EIVTSLRTGEKPYENPDLDIYFCSSL  1237
              +     +  L+  LR    ++ S   E++Q   E +  +    + +   +++ Y  SS 
Sbjct  302   KSEEIFGIDDLLYHLRSAIRKINSDYTEILQNGEEFLKHISKFAELFSKEEVEFYNFSSW  361

Query  1238  GKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTD  1387
              ++P Y  DFGWG P  V     P KN+   +  + G G E  V + + D
Sbjct  362   CRFPVYEVDFGWGKPVWVCTTTFPFKNVVIFMGTKCGEGIETWVNMLEDD  411



>ref|XP_006491900.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=467

 Score =   225 bits (574),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 152/450 (34%), Positives = 226/450 (50%), Gaps = 44/450 (10%)
 Frame = +2

Query  176   MAIIASPPLS------ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN  337
             +A +A P +       +  R  IKP+ PTP  LR  KLSL+DQ    +Y+  +F Y  + 
Sbjct  15    VAKVAKPKMERALEVLVRARESIKPAYPTPEHLRNFKLSLMDQINFPVYVSTIFLYKADG  74

Query  338   RTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHP  517
                  ++S  L+++LS+TLT FYP AGR+ D+ ++DCND GAE+     N  L + +  P
Sbjct  75    NVKADQISQCLKSSLSKTLTKFYPLAGRVKDDFSIDCNDEGAEYVEAFANGFLFEYLQKP  134

Query  518   DADAQNVAFP---AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMG  688
             D +      P   A  P A+ + G +   Q + F CGG+A++   CHK+ DG ++R F+ 
Sbjct  135   DQNLLRDFHPFNYAESPVAS-NGGPMMRMQATFFKCGGLAITVCTCHKLIDGASLRIFVD  193

Query  689   HWVAATRHPKL--------NLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFS  844
              W    R             ++P FV+ ++FP   S        PS I       RFVF 
Sbjct  194   SWATTARADNQLSGSSNNKEVTPRFVTSTIFPASESF----VAAPSHI-SPVKANRFVFD  248

Query  845   GEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR---  1003
              +K+D LK  V+  + V  PTR E ++AL++KC   A+ S     RPS+ V   D+R   
Sbjct  249   AKKIDELKAKVASPT-VPRPTRVEALTALIWKCARAASRSNLGYSRPSLSVQAIDVRAVA  307

Query  1004  -PPLGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR------DNELVQE  1162
              PP  LP NS GN ++  +   +      L  LV  LR+ K   +         N+ + +
Sbjct  308   EPP--LPDNSVGNSVAYLTAQASEKETETLQDLVCSLRKAKAEFRRNGLKTLLKNKNIFD  365

Query  1163  IVTSLRTGEKPYENPDLDIYFCSSLGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDN  1339
             I  S++     +E  ++D Y  SSL  +P Y  ADFGWG P  ++MP   + N+  ++  
Sbjct  366   IPESIK---DKFEKDEIDFYTFSSLVNFPYYEAADFGWGKPVHMTMPNYWVSNLIIIMAA  422

Query  1340  QSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
               G G E  V L   DM+ FERD+ELL FA
Sbjct  423   NDGKGIEVWVTLSPEDMAFFERDQELLAFA  452



>ref|XP_008226093.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=449

 Score =   225 bits (573),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 224/454 (49%), Gaps = 51/454 (11%)
 Frame = +2

Query  182   IIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT---  352
             +++   + ++ +  IKPSSPTP  L+   LS+ DQ    +YIPL+ FYP N+R D     
Sbjct  1     MVSEMKVEVTHKETIKPSSPTPSHLQTTNLSVFDQLSPDVYIPLLLFYPKNSRDDEANNI  60

Query  353   -------RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIIN  511
                      S IL+ +LS TLT FYP+AG    N ++ CND GA FF  RVNC +  I++
Sbjct  61    DHHSSIAERSKILKTSLSETLTHFYPFAGEFEYNVSISCNDHGAAFFEARVNCPISTILD  120

Query  512   HPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGH  691
              PD        P G+       G L + Q + F+CGG+A+  +  H + D  T+  F+  
Sbjct  121   EPDFGILRKLLPTGIGSTQADTGFLLLVQANFFECGGLAIGVSSSHIITDAYTLSRFIKS  180

Query  692   WV-------AATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGE  850
             W          T H  L       + ++FP L      +P +    E+ C+ KRFVF   
Sbjct  181   WADIALMGSTTTDHHALLPKKFGAAATLFPQLDFLNSPQPALEFA-EEKCITKRFVFHAS  239

Query  851   KLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAA---------ASRRPSIL-VHYADM  1000
             K+  LK   +  +   NPTR E VSAL++KC ++ +         AS   S++ +    +
Sbjct  240   KIAALKSRAASATA-PNPTRVEAVSALIWKCAMETSRLSNSGVVRASEWSSVVNIRKILV  298

Query  1001  RPPLGLPCNSAGNILSTFSTSPAAAG--EMDLARLVAELREGKERLQSRDNELVQEIVTS  1174
             + PL    +  GN++  FS    A+   ++D+  LVA+LR+G E  + +    V      
Sbjct  299   QQPLAY--DLMGNLVGLFSVRTVASEVVDIDVQSLVAKLRKGVEEFKIKYGNGV------  350

Query  1175  LRTGEKPYE---------NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFF  1327
               +GEK  +           D+D Y CSS G++P Y  +FGWG P  V    G +KN+  
Sbjct  351   --SGEKACQFFREFGNLMTRDVDNYKCSSWGRFPFYETNFGWGKPLWVCQSTG-LKNLIV  407

Query  1328  LIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             L+D + G G E  +  K+  M+ FE ++ELL +A
Sbjct  408   LMDTRDGVGIEVSLTFKEETMAVFETNKELLAYA  441



>ref|XP_011029622.1| PREDICTED: BAHD acyltransferase At5g47980 [Populus euphratica]
Length=439

 Score =   224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 156/430 (36%), Positives = 214/430 (50%), Gaps = 35/430 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN-NNRTDPTRVSDILQN  376
             + I  R  +KPSSPTP  LR   L  LDQ       PL+  Y +   +      S+ L+ 
Sbjct  3     VEIITREAVKPSSPTPDHLREFNLCFLDQLPPVANEPLLLVYSSFQQKFTVAHKSERLKR  62

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS TL+ FYP AGR+ D+A+++CND GA F   RVNC L   +  PDA+      P G+
Sbjct  63    SLSETLSRFYPLAGRIKDDASIECNDFGAVFVEARVNCLLSKFLEKPDAEVIRKFIPTGI  122

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP-KLNLSP  733
                    G L + Q + F CGG+A+   + H V D  T   F+  W AA  H     + P
Sbjct  123   ESPEELTGSLVLVQANFFACGGLAIGVCISHMVADPVTFSTFVKAWAAAAFHSGDSTILP  182

Query  734   NFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRA  913
              F + SVFP   +  L KP     + D CV KR VF   K+  L+     ES V  PTR 
Sbjct  183   LFNAPSVFPP-QNISLSKPAALEVMRDRCVTKRVVFDASKVAALQVKAVCES-VTCPTRV  240

Query  914   EIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPA  1069
             E V+AL++KC + AA S     R SIL    ++R    PP  LP ++ GN+   F+ S A
Sbjct  241   EAVTALIWKCAMNAARSNSEHLRYSILSQSVNLRNKMVPP--LPEHTIGNLAGYFA-SCA  297

Query  1070  AAGEMDLARLVAELRE-------------GKERLQSRDNELVQEIVTSLRTGEKPYENPD  1210
                E++L  L  +LR+             GK++      E  QE  + L  G       +
Sbjct  298   TECEVELQSLARQLRKGLQDFGENYLKKLGKDKASMAICEPFQEAASMLPEG-------N  350

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             +D Y  +S  + P Y  DFGWG P  V++P G  KN+  ++D + G G EA V L + DM
Sbjct  351   VDFYVSTSFCRLPFYGIDFGWGKPTWVTIPTGAYKNVASIMDAKDGKGIEAWVTLTEDDM  410

Query  1391  SGFERDEELL  1420
             + FERD ELL
Sbjct  411   AFFERDRELL  420



>ref|XP_004295693.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=452

 Score =   224 bits (572),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 148/430 (34%), Positives = 224/430 (52%), Gaps = 33/430 (8%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRT---DPTRVSDILQNALSRTL  394
             +KPSSPTP  L+  KLSLLDQ     Y PLV FYP N+R     P + S  ++ +LS TL
Sbjct  12    VKPSSPTPHYLKHFKLSLLDQLAPVAYEPLVLFYPYNDRDVTFTPAKRSLWMKKSLSETL  71

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
             T FYP+AGR+  N +++C+D G ++ + RV+  L  ++  PDA+      P  + +    
Sbjct  72    TRFYPFAGRIKGNISIECHDDGVDYMQARVHGLLSTLLAQPDAETLKQLLPVAIEFPKAG  131

Query  575   DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSV  754
              G L + Q S FDCGG+A+   M  K+GD  ++  F+  W A+       L P+F +   
Sbjct  132   TGPLLLVQESFFDCGGLAIGVCMSRKLGDAASLGTFIMSWAASALGFSQALLPDFNASFW  191

Query  755   FPTLPSGPLDKP---MIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVS  925
             FP +            I  K  D CV KRFVF   K+  L+   +  + VK PT  E V+
Sbjct  192   FPPMDCSSGHNSSVDHIVKKRTDGCVTKRFVFDASKICALQ-TEAASANVKQPTNLEAVT  250

Query  926   ALLYKCCVKAAASR---------RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSP  1066
             AL+++C V AAA+R         + S+L    D+R    PPL    +S GN++  F+ + 
Sbjct  251   ALIWRCAV-AAATRSSSLHKSPPKVSVLSQSVDIRKRIVPPLS--DDSIGNLVGYFA-AQ  306

Query  1067  AAAGEMDLARLVAELREGKERLQSRDNELVQE-------IVTSLRTGEKPYENPDLDIYF  1225
             A   E++L  LVA+LR G + + +   ++++        + +S   G+    +  +++  
Sbjct  307   ANESELELQGLVAQLRTGLKEVSNNCAQILKGSHGSRGFVESSKEAGDFFQRDDIMNLQV  366

Query  1226  CSSLGKYPA-YTADFGWGWPCKVS-MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             C+ L  Y   Y  +FGWG P  VS  P G  +N+  L+  +   G EA V L + DM+ F
Sbjct  367   CTGLCDYKVLYEVNFGWGRPIWVSNFPSGLNRNVSSLVGTRKDDGIEAWVTLIEEDMAAF  426

Query  1400  ERDEELLRFA  1429
             E D+ELL FA
Sbjct  427   EHDQELLAFA  436



>emb|CDY39174.1| BnaC09g21700D [Brassica napus]
Length=459

 Score =   225 bits (573),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 150/435 (34%), Positives = 222/435 (51%), Gaps = 34/435 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + +  R +IKPSSPTP  L+  KLSLL+Q   +++ P++FFY  NNR   T     L+ +
Sbjct  20    VEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSANNRIKQTEQLQNLKKS  79

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP AGRL  N +++CND+GA+F   +VN  L +++  P ++      P  + 
Sbjct  80    LSETLTHFYPLAGRLNGNISINCNDSGADFLEAQVNSPLSNLLQEPSSEVLEQLIPTSVD  139

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL--SP  733
                     L + Q + F CGG+A+   + HK+ D  +V  FM  W A +    +    SP
Sbjct  140   STEART-KLLLAQATFFKCGGMAIGVCVSHKLADATSVGLFMKSWSAISSRGTIKTVGSP  198

Query  734   NFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
              F +  +FP      T P+ P+ +P I     +  + KRFVF    ++ L+   S    V
Sbjct  199   VFDTLKIFPPGNFSETSPA-PVVEPEIKM---NQTLSKRFVFDSWSIEALQAKASSFE-V  253

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTFS  1057
               PTR E VSA ++K  +KA    + + +PSIL + A +R  +  P   NS GN++S F+
Sbjct  254   SQPTRVEAVSAFIWKLAMKATRTVSRTSKPSILANSASLRSRVSPPFTKNSIGNLVSYFA  313

Query  1058  TSPAAAGEMD--LARLVAELREGKERLQSRDNEL---------VQEIVTSLRTGEKPYEN  1204
              + A  GE    L  LVAE+R  K+R   RD+ +          + I    +       +
Sbjct  314   -AKAEEGEKQRKLQTLVAEIRRAKQRF--RDDHIPKLVGNGDATEVICNHQKEAGDMIAS  370

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
                D Y  +S  ++  Y  DFGWG P   + P    KN+  L+D + GGG EA V L + 
Sbjct  371   GGFDFYILTSACRFGLYEIDFGWGKPVWFAFPSVRQKNIVALLDTKEGGGIEAWVNLNEQ  430

Query  1385  DMSGFERDEELLRFA  1429
             +M  FE D ELL FA
Sbjct  431   EMKLFEEDRELLDFA  445



>ref|XP_009371383.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=441

 Score =   224 bits (571),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 146/435 (34%), Positives = 224/435 (51%), Gaps = 32/435 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN--------NNRTDPTR  355
             + I  +  IKPSSPTP  L+   LS  DQ    +Y+PL+ FYPN        ++ +   R
Sbjct  7     VEILHKETIKPSSPTPHHLKTTSLSGYDQLTPELYVPLILFYPNGGDEASLDHHASFAYR  66

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQN  535
              S +L+ +LS+TLT FYP+AG  + N ++ C+D GA     +VNC +  I++ PD     
Sbjct  67    FS-LLKKSLSKTLTHFYPFAGEFIYNVSISCSDHGAGLIEAQVNCPISKILDKPDFQIFR  125

Query  536   VAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA-----  700
                P  +       G L + Q+S F CGG+A+  ++ HKV D  T+  F+  W A     
Sbjct  126   QLIPTSMDSKQAETGHLLLVQVSSFKCGGLAIGISISHKVADASTLSAFIKSWTAIALGL  185

Query  701   --ATRHPKLNLSPNF-VSDSVFPTLPSGPLDKPMIPSKI-EDDCVQKRFVFSGEKLDLLK  868
               AT H     SP F ++ ++FP  P    +   +  +   D  + KRFVF   K+  LK
Sbjct  186   AGATDHAV--PSPEFGIAATLFP--PQDIFNSQQVTVEFPPDKGITKRFVFDASKVAALK  241

Query  869   DVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCNS  1030
                +  + V NPTR E+VSAL++KC ++A+ S     +PS+     +MR   G  L  N 
Sbjct  242   SKAASAT-VPNPTRVEVVSALIWKCAMEASRSNLGFTKPSVWSQAVNMRKRSGKTLAENI  300

Query  1031  AGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR--DNELVQEIVTSLRTGEKPYEN  1204
              GN L  F+ + +   E+DL  LVA+ R+G E  + +  ++   ++ + S++       N
Sbjct  301   LGNFLWYFA-AMSTESEVDLEILVAKFRKGIEEYKEKYPNSVSCEDALQSIKESGNVLIN  359

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
               +  Y CSS  ++P Y  +FGWG P  VS      KN   L+D   G G EAL+ + + 
Sbjct  360   DSMVTYSCSSWCRFPFYETNFGWGQPSWVSTHGSEFKNTIILMDTSDGVGVEALLTVTEE  419

Query  1385  DMSGFERDEELLRFA  1429
             DM+  E+ E+LL +A
Sbjct  420   DMAIIEKHEDLLAYA  434



>ref|XP_009371390.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=450

 Score =   224 bits (571),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 224/428 (52%), Gaps = 34/428 (8%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN---RTDPTRVSDILQNALSRTL  394
             I+PSSPTP  L+   LS+ DQ +  +Y+P + FYPNNN   R+     S IL+ +LS  L
Sbjct  15    IRPSSPTPHYLKTTNLSVFDQLIPDIYVPFLLFYPNNNTDHRSLAAERSKILKTSLSEIL  74

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
             T FYP+AG+   N ++ CND G  F   +VNC +  I++  D        PA +      
Sbjct  75    THFYPFAGKFHYNDSICCNDHGVAFLEAQVNCPISKILDKADIGMVKQLLPADMASRQAV  134

Query  575   DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA----ATRHPKLN----LS  730
              G L + Q + F+CGG+A+  ++ HKV D  T+  F+  W      +T  P  +    L 
Sbjct  135   TGYLLLVQANFFECGGMAIGVSIAHKVADASTISTFIKRWAEIALDSTSRPNTDCEAVLP  194

Query  731   PNF-VSDSVFPTLPSGPLDKPMIPSKI-EDDCVQKRFVFSGEKLDLLKDVVSEESGVKNP  904
               F V+ S+FP  P   L+ P    +  ++  + + ++F   K+  LK   S  + V  P
Sbjct  195   AEFGVAASLFP--PQDILNAPQPTLEFPKEKYITRTYLFDASKIAALKS-KSASATVPKP  251

Query  905   TRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPC--NSAGNILSTFSTSP  1066
             TR E+VSAL++KC ++A+ S+    RPS   H  +MR  L  P   N  GN++  F    
Sbjct  252   TRIEVVSALIWKCAMEASKSKFGSIRPSAWCHAVNMRNVLVRPSAENLLGNLVGKFI---  308

Query  1067  AAAGE-----MDLARLVAELREGKERLQSR-DNELVQEIVTSLRTGEKPYENPDLDIYFC  1228
             A AGE     +DL  LV +LR+G E  + +  N +  +   SL+      +  D++IY C
Sbjct  309   ARAGESEVVDLDLQSLVGKLRKGIEEFKVKYANNVTGDACESLKEYGDLLQMDDIEIYTC  368

Query  1229  SSLGKYPAYTADFGWGWPCKVSMP-KGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
             SS  ++P Y ADFGWG P  V+   +G  KN+  L+D + G G E  +   + DM+  E 
Sbjct  369   SSWCRFPFYAADFGWGKPSWVNQSLEG--KNLIVLMDVRDGDGVEVSLTFNEEDMAIIES  426

Query  1406  DEELLRFA  1429
             +++LL +A
Sbjct  427   NKKLLAYA  434



>ref|XP_004295692.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=442

 Score =   224 bits (570),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 144/436 (33%), Positives = 221/436 (51%), Gaps = 33/436 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN--------NNRTDPTR  355
             + I  +  I PSSPTPP L+   LS LDQ +  +Y+PLV FYPN        ++++    
Sbjct  7     VEIIHKETITPSSPTPPHLKSVNLSFLDQVIPEVYVPLVLFYPNHADQELNSDHQSLIAE  66

Query  356   VSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQN  535
              S IL+ +LS TLT FYP AG    N ++ C+D GA F   RVNC +LDI+  PD +   
Sbjct  67    KSSILKASLSETLTHFYPLAGEFQYNDSICCDDRGASFIEARVNCRILDILKSPDTEMLK  126

Query  536   VAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHW-------  694
               FPA +       G L + Q++ F+CGG+A++  + HKV D  T   F+  W       
Sbjct  127   YLFPAAVESTQALTGHLLLVQVNFFECGGMAIAINISHKVADAFTFSRFIKSWSAVALGS  186

Query  695   VAATRHPKLNLSPNF-VSDSVFPTLPSGPLDKPM-IPSKIEDDCVQKRFVFSGEKLDLLK  868
             ++ T H  L L   F  + S++P  P   L+ P  +    +  C  +RFVF   ++    
Sbjct  187   ISTTDH--LVLPAKFGAAVSLYP--PQDFLNSPKPLVELTQGKCTTRRFVFDASRI-AAL  241

Query  869   DVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPCNSAG  1036
                +  + V NPTR E+VSAL++KC ++A+ S+    RPS+     +MR   G       
Sbjct  242   KSKAASASVPNPTRVEVVSALIWKCTMEASRSKLGSIRPSLWCQAVNMRKRSGQAFTE--  299

Query  1037  NILSTFSTSPAA---AGEMDLARLVAELREGKERLQS--RDNELVQEIVTSLRTGEKPYE  1201
             N+L  F    AA     E+D+  LVA+ R+ K+  +   R+    ++   +++       
Sbjct  300   NLLGNFVWYLAAITVESEVDIQSLVAKFRKCKDDFKGKYRNGLTAEDAYQTIKESGNVLA  359

Query  1202  NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKK  1381
                +D Y C+S   +P Y  +FGWG P  VS+    +K+   L+D   G G EA +   +
Sbjct  360   KEGIDNYSCTSWCWFPFYETNFGWGKPSWVSVRSFQLKDTVLLMDAIDGNGIEASMSFLE  419

Query  1382  TDMSGFERDEELLRFA  1429
              DM+  E ++ELL +A
Sbjct  420   EDMAIVESNQELLAYA  435



>ref|XP_009361854.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=440

 Score =   223 bits (569),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 148/440 (34%), Positives = 223/440 (51%), Gaps = 32/440 (7%)
 Frame = +2

Query  182   IIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN---NRTDPT  352
             +++   + +  +  IKPSSPTPP LR  +LS  DQ    ++IPL+ FY N       D  
Sbjct  1     MVSEMKVQVLNKETIKPSSPTPPDLRNLRLSFFDQFEPEIFIPLLLFYRNKPCAAVADDQ  60

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
               S+ L+ +LS  LT FYP+AG    N ++ CND G  F + +VNC +  + + PD    
Sbjct  61    ERSNFLKTSLSEALTHFYPFAGEFQRNDSICCNDHGVAFLQAQVNCYMSMVFDKPDDGIL  120

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA----  700
                 P        +   L + Q + F+CGG+A+  +  HKV D  T+  F+  W A    
Sbjct  121   EQLVPTDKESTLSNTDYLLLIQANFFECGGLAIGVSFAHKVSDAFTISKFIERWAAIALG  180

Query  701   ----ATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDD-CVQKRFVFSGEKLDLL  865
                  T H  +      VS S+FP  P    + P     +  +  + +RFVF   K+  L
Sbjct  181   SASTTTDHHAVLPGEFGVSASLFP--PLDIFNSPDFAVTLSTEGSITRRFVFDASKIATL  238

Query  866   KDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRP--PLGLPCN  1027
             K   +  +   NPTR E+VSAL++KC ++A+ S+    +PS+L    +MR      L  N
Sbjct  239   KSKAA--NSTPNPTRVEVVSALIWKCAIQASRSKLGIIKPSMLCPIVNMRKRSRQALAEN  296

Query  1028  SAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGE  1189
               GN + +F+     + E++   LVA+LR+G E    +       N++++    S   G 
Sbjct  297   ILGNCVWSFAVMTVES-EIEHESLVAKLRKGIEEHTEKYPNGVSGNDIIEAAKES--GGS  353

Query  1190  KPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALV  1369
             K  ++ DLDIY CSS  ++  Y ADFGWG P  VS+ +   KN   L+D + G G EA +
Sbjct  354   KLLDSDDLDIYTCSSWCRFSFYEADFGWGKPSWVSV-RSLYKNTILLMDMRDGDGIEASL  412

Query  1370  MLKKTDMSGFERDEELLRFA  1429
              LK+ DM+ FE  EELL +A
Sbjct  413   TLKEDDMALFENSEELLAYA  432



>ref|XP_009355133.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=445

 Score =   223 bits (569),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 149/433 (34%), Positives = 221/433 (51%), Gaps = 40/433 (9%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT----------RVSDILQ  373
             IKPSSPTPP L+  +LS+ DQ    +++PL+ FYP+N  +D              S+IL+
Sbjct  15    IKPSSPTPPHLKTTQLSVFDQLAPDVFVPLLLFYPSNINSDAVDSIDHHSSVAERSNILK  74

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG  553
              +LS  LT FYP+AG    N ++ C+D G  F + +VNC +  I+  PD +      PA 
Sbjct  75    ASLSEALTHFYPFAGTFQYNVSISCDDHGVAFLQAQVNCPMSKILVKPDFEILRQLLPAS  134

Query  554   LPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAA------TRHP  715
                +    G L + Q + F+CGG+A++ +  H + DG T+  F+  W A        R  
Sbjct  135   QGSSQAETGHLLLIQANFFECGGLAIAVSSSHIIIDGYTLSTFIRSWAAVALASSTVRTE  194

Query  716   KLNLSPNF-VSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
              + L+P F  + S+FP L       P +   +E+ C+ KRFVF   K+  LK      S 
Sbjct  195   HVLLTPKFDAAVSLFPQLDFLNSPPPAM-ELVEEKCISKRFVFEASKVAALKSKAVSAS-  252

Query  893   VKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPC--NSAGNILSTF  1054
             V NPTR E VSAL++KC   A+ S     R S+    A +R  +  P   N  GN++  F
Sbjct  253   VPNPTRLESVSALIWKCATAASRSNSGVVRQSVWSTNASLRKIVQRPLAENLMGNLVGMF  312

Query  1055  STSPAAAG--EMDLARLVAELREGKERLQSRDNELV--QEIVTSLRT-GEKPYENPDLDI  1219
                  A+   ++D   +VA+LR+G E  + +    V  +E    ++  G++      +D 
Sbjct  313   VVKMEASEVVDIDYPSVVAKLRKGMEEFKEKYANGVSGEEACGFMKDFGDRIKR---VDN  369

Query  1220  YFCSSLGKYPAYTADFGWG---WPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             Y CSS  ++P Y A+FGWG   W C+       MKN+    D + G G EALV L   DM
Sbjct  370   YHCSSWCRFPFYEANFGWGKPLWVCQTIT----MKNVAMYTDTRDGEGIEALVTLSDEDM  425

Query  1391  SGFERDEELLRFA  1429
             + FE D+ELL +A
Sbjct  426   AKFECDKELLAYA  438



>ref|XP_009359305.1| PREDICTED: vinorine synthase [Pyrus x bretschneideri]
Length=435

 Score =   223 bits (568),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 148/427 (35%), Positives = 222/427 (52%), Gaps = 39/427 (9%)
 Frame = +2

Query  227   KPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTLTSFY  406
             KPSSPTP  L+ +KLSLLDQ     Y+P+V FY +    D T + D L+ +LS TLT FY
Sbjct  14    KPSSPTPNHLKSYKLSLLDQIAPIFYVPVVLFYSDPENIDDTTIVDRLKKSLSETLTCFY  73

Query  407   PYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGL  586
             P AGR+  NA+VDC D G  F + R +  L +I+  P+ D      P   P+    D  +
Sbjct  74    PLAGRIEGNASVDCEDGGVVFTKARAHIQLSEILKTPEMDLVQQLLPLD-PYNIRTDKAV  132

Query  587   AVF--QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSVFP  760
             A    QL+ FDCGG+ +   + HK+ DG T+ +F+  W   +R    N++P+  S ++FP
Sbjct  133   AAMAVQLNCFDCGGMGIGICLSHKIADGATLSSFLDAWATRSRGISENITPSLNSATMFP  192

Query  761   TLPSGPLDKPM-IPSKI--EDDCVQKRFVFSGEKLDLLKDVVSEESGV----KNPTRAEI  919
                  P DK + +PS +   ++ V KRFVF    L  LK  V    G+    + PTR E 
Sbjct  193   -----PRDKEIFMPSNLIKRENIVTKRFVFDASSLAKLK--VKASKGLCTDDRAPTRVEA  245

Query  920   VSALLYKCCVKAA----ASRRPSILV-HYADMRPPLG--LPCNSAGNILSTFSTSPAAAG  1078
             ++AL+ K  + A        RPS+ + H  ++R  +   LP +S GNI   F+ +     
Sbjct  246   LTALICKSSMNAKNGTLGKGRPSMAISHVVNLRERMAPPLPEHSFGNIWR-FAVASIMND  304

Query  1079  EM--DLARLVAELREGKERLQSRDNELVQEI---------VTSLRTGEKPYENPDLDIYF  1225
             E   +L  LV  LR+   ++   D++ V+++            L+   +     +++ + 
Sbjct  305   ESNPELHDLVVRLRKVIRKI---DDDYVRKLQGEDGFTHACEPLKETSEMVSEGEVEFFR  361

Query  1226  CSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
              SS  ++  Y  DFGWG P    +P  P+KN+  L+ + SG G EA V L + DM+ FER
Sbjct  362   VSSWIRFSLYNTDFGWGKPTWACIPSVPIKNVVILLSSSSGDGIEAWVTLDEEDMAKFER  421

Query  1406  DEELLRF  1426
             D ELL F
Sbjct  422   DHELLEF  428



>ref|XP_008372858.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=440

 Score =   223 bits (568),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 148/440 (34%), Positives = 221/440 (50%), Gaps = 32/440 (7%)
 Frame = +2

Query  182   IIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN---NRTDPT  352
             +++   + +  +  IKPSSPTPP LR  +LS  DQ    ++IPL+ FY N       D  
Sbjct  1     MVSEMKVQVLNKETIKPSSPTPPDLRNLRLSFFDQFEPEIFIPLLLFYRNKPCAAVADDQ  60

Query  353   RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
               S  L+ +LS  LT FYP+AG    N ++ CND G  F + +VNC +  + + PD    
Sbjct  61    ERSXFLKTSLSEALTXFYPFAGEFQRNDSIXCNDHGVAFLQAQVNCYMSMVFDKPDDXIL  120

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA----  700
                 P        +   L + Q + F+CGG+A+  +  HKV D  T+  F+  W A    
Sbjct  121   EQLVPTDKESTLSNTDYLLLIQANFFECGGLAIGVSFAHKVSDAFTICKFIERWAAIALG  180

Query  701   ----ATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDD-CVQKRFVFSGEKLDLL  865
                  T H  +      VS S+FP  P    + P     +  +    +RFVF   K+  L
Sbjct  181   SASTTTDHHXVLXGEFGVSASLFP--PLDIFNSPDFAVTLSTEGSXTRRFVFDASKIATL  238

Query  866   KDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRP--PLGLPCN  1027
             K   +  S   NPTR E+VSAL++KC ++A+ S+    +PS+L    +MR      L  N
Sbjct  239   KSKAA--STTPNPTRVEVVSALIWKCAIQASRSKLGIIKPSMLCPIVNMRKRSRQALAEN  296

Query  1028  SAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGE  1189
               GN + +F+ +     E++   LVA+LR+G E    +       N++++    S   G 
Sbjct  297   ILGNCVWSFA-AMTVEXEIEHESLVAKLRKGIEEHXEKYPNGVSGNDIIEAAKES--GGS  353

Query  1190  KPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALV  1369
             K  ++ D+DIY CSS  ++  Y ADFGWG P  VS+ +   KN   L+D + G G EA +
Sbjct  354   KLLDSDDIDIYTCSSWCRFSFYEADFGWGKPSWVSV-RSLYKNTILLMDMRDGDGIEASL  412

Query  1370  MLKKTDMSGFERDEELLRFA  1429
              LK+ DM+ FE  EELL +A
Sbjct  413   TLKEDDMAXFENSEELLAYA  432



>ref|XP_009361770.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=447

 Score =   223 bits (567),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 151/445 (34%), Positives = 221/445 (50%), Gaps = 48/445 (11%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQN-  376
             + I +   +KPSSPTP  LR  KL LLD  +  + I  + FYPN   T  T  +  + + 
Sbjct  8     VEIVDTQTVKPSSPTPQDLRNFKLYLLDLFMPGVDIKFLLFYPNVASTTTTHTAKAINDK  67

Query  377   ------ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNV  538
                   +L++TLT +Y +AGR+  N  V+CND GA+  +  V C+L DI   PD +    
Sbjct  68    YQHLIESLAKTLTHYYHFAGRIKSNVAVECNDDGAQVVKAHVKCSLSDIFERPDPEMLRR  127

Query  539   AFPAGLPWANIHDG--GLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
               P G        G   L   Q++ F+CGG+AV   + HK+ D  TV  F+  W A    
Sbjct  128   LLPTGAESTEAEAGPRALLYVQVNLFECGGMAVGLGVSHKIADISTVCTFIHCWAATALQ  187

Query  713   PKLNLSPNFVS-DSVFPTLPSGPLDKPMIPSKIEDDC-VQKRFVFSGEKLDLLKDVVSEE  886
                 + P F    S FP     PLD P+  S  E +  V +R+VF   K+ +L+   S  
Sbjct  188   SNNVILPQFGGVASSFP-----PLDFPLWESPSEKEKPVTRRYVFDNSKISVLQSETSS-  241

Query  887   SGVKNPTRAEIVSALLYKCCVKAAASR----------RPSILVHYADMR----PPLGLPC  1024
             S V  PTR E +SAL++KC ++A++            RPS L    ++R    PP   P 
Sbjct  242   SLVPKPTRVEAISALIWKCAIEASSKSSPNTLCSSPIRPSTLRVAVNLRKMVTPPF--PD  299

Query  1025  NSAGNILSTFSTSPAA----AGEMDLARLVAELREGKERLQSRD------NELVQEIVTS  1174
             N AGN   + S  P A    +  +DL  LV ++R G E ++         NE +Q +   
Sbjct  300   NMAGNF--SLSAIPKAEESTSNVLDLKDLVVKIRAGIEEMKEAATKVFDPNEAMQVLTEY  357

Query  1175  LRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGG  1354
             L     P ++ +++ Y+CSS  ++P Y  DFGWG P  VS+P   + NMF L+D +   G
Sbjct  358   LTI---PLKDQEIETYYCSSWCRFPFYETDFGWGKPSWVSVPSLVVNNMFHLVDKRDCKG  414

Query  1355  FEALVMLKKTDMSGFERDEELLRFA  1429
              EA + L +  M+ FE + ELL +A
Sbjct  415   IEAWLTLSEEKMALFESNMELLAYA  439



>ref|XP_009602470.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=412

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 145/410 (35%), Positives = 214/410 (52%), Gaps = 15/410 (4%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN-NRTDPTRVSDILQN  376
             + I  + +IKPSSPT  +LR HKLSL+DQ    ++IPL+FFY +     + +R   +L+ 
Sbjct  5     VEIISKEMIKPSSPTTSTLRTHKLSLVDQISPPVFIPLIFFYQDELGNINRSRKLQLLKK  64

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS  L  FYP AGR  DN  +DCNDAGAEF   +V+  L  +I  P  +      P   
Sbjct  65    SLSDALMRFYPLAGRFNDNNFIDCNDAGAEFIEAQVHGYLSQVIETPKMEDLREFLPREA  124

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPN  736
                  +D  LAV Q++ FDCGGIA+   M HKVGDG ++  F+  W A  R     + PN
Sbjct  125   CVVENNDVLLAV-QVNLFDCGGIAIGICMSHKVGDGSSIVTFINAWSAIARGDTGIVQPN  183

Query  737   FVSDSVFPTLP-SGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRA  913
             F   S+FP L  S    KP I  K  D  + +RFVF  EKLD +K   S  S VK+PTR 
Sbjct  184   FNLSSIFPPLDLSNSSFKPSIGIK-NDKLMTRRFVFDKEKLDAIKKSAS-GSQVKDPTRV  241

Query  914   EIVSALLYKCCVKAAASRRPSI----LVHYADMRPPLG--LPCNSAGNILST-FSTSPAA  1072
             E +SA ++K  ++ +   R S      VH  ++R  +   LP +S GN+ +T  +     
Sbjct  242   EALSAFVWKHLMEVSKLNRDSTKMFAAVHAVNIRSRMNPTLPDHSFGNLWTTALAFLSPE  301

Query  1073  AGEMDLARLVAELREGKERLQSRDNELV---QEIVTSLRTGEKPYENPDLDIYFCSSLGK  1243
             + E+++  L+  LR     + S   E++   QE +  +    + +   +++ Y  SS  +
Sbjct  302   SEEIEIGDLLHHLRCAIRNINSDYIEILQNGQEFLKHMSKLAELFSKEEVEFYNFSSWCR  361

Query  1244  YPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
             +P Y  DFGWG P  V     P +N    +  + G G EA V + + ++S
Sbjct  362   FPVYEVDFGWGKPVWVCTATFPYENTVIFVGTKCGEGIEAWVNMLEDEIS  411



>ref|XP_009352970.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=439

 Score =   221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 147/433 (34%), Positives = 226/433 (52%), Gaps = 28/433 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDP--TRVSDILQ  373
             + +  + +IKPSSPTP  LR+  LS+ DQ    +Y+P V FYP+++         S++L+
Sbjct  9     VEVIHKEIIKPSSPTPHHLRYLSLSVFDQFKYEIYLPHVVFYPSSSEEHSLVAEKSELLK  68

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA-DAQNVAFPA  550
              +LS  LT FYP+AG    N +++C+D GA F   +VNC +  I++     +      P 
Sbjct  69    KSLSEALTQFYPFAGEFKYNDSINCDDRGAVFLEAQVNCPMSKILDDKHGLENMGKLIPT  128

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWV------AATRH  712
              +   +   G L + Q + F+CGG+A++A+  HKV D  ++  FM  W       A+T  
Sbjct  129   PVRSKHAQGGHLLLVQANVFECGGLAIAASFFHKVVDALSISKFMESWAEIARCSASTTD  188

Query  713   PKLNLSPNF-VSDSVFPTLPSGPLDKP---MIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
               + L   F V+ ++FP  P    + P   M+P        ++RFVF   K+  LK V +
Sbjct  189   HHVVLPTEFCVAATLFP--PQEYFNSPKKLMLPLTENYMVRRRRFVFDASKIAALK-VKA  245

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPCNSAGNILS  1048
               + V +PTR E VS L++KC ++A+ S     R S   H  +MR  L  P   A N+L 
Sbjct  246   ASATVPSPTRVEAVSVLIWKCAMEASRSNLGFVRSSTWRHAVNMRKILAQPF--AENLLG  303

Query  1049  TFSTSPAAAGEM----DLARLVAELREGKERLQSRDNEL-VQEIVTSLRTGEKPYENPDL  1213
              FS    +  E     DL  LVA+LR  +E      NE+  +++V   +   +  E  D+
Sbjct  304   NFSFYAISKVEENEANDLQILVAKLRSVEELKVKHTNEIRAEDVVQFFKEYGELIEKDDM  363

Query  1214  DIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPM-KNMFFLIDNQSGGGFEALVMLKKTDM  1390
             D Y CSSL ++P  +A+FGWG P     P+  + KNMF L D   G G EA + +K+ DM
Sbjct  364   DNYTCSSLCRFPFCSANFGWGKPSCTRFPRTEVFKNMFLLSDATDGNGIEAYLSMKEEDM  423

Query  1391  SGFERDEELLRFA  1429
               FE +++LL +A
Sbjct  424   VMFETNQDLLTYA  436



>ref|XP_009114100.1| PREDICTED: vinorine synthase [Brassica rapa]
Length=459

 Score =   222 bits (565),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 149/435 (34%), Positives = 221/435 (51%), Gaps = 34/435 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + +  R +IKPSSPTP  L+  KLSLL+Q   +++ P++FFY  N R   T     L+ +
Sbjct  20    VEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSANYRIKQTEQLLNLKKS  79

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP +GRL  N +++CND+GA+F   +VN  L +++  P ++      P  + 
Sbjct  80    LSETLTHFYPLSGRLNGNTSINCNDSGADFLEAQVNSPLSNLLQEPSSEMLEQLIPTSVD  139

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL--SP  733
                     L + Q + F CGG+A+   + HK+ D  +V  FM  W A T    +    SP
Sbjct  140   SIEART-KLLLAQATFFKCGGMAIGVCVSHKLADATSVGLFMKSWSAITSQGSIKTVGSP  198

Query  734   NFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
              F +  +FP      T P+ P+ +P I     +  + KRFVF    ++ L+   S    V
Sbjct  199   VFDTLKIFPPGNFSETSPA-PVVEPEIKM---NQTLSKRFVFDSSSIEALQAKASSFE-V  253

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTFS  1057
               PTR E VSA ++K  +KA    + + +PSIL + A +R  +  P   NS GN++S F+
Sbjct  254   TQPTRVEAVSAFIWKLAMKATRTVSRTSKPSILANSASLRSRVSPPFTKNSIGNLVSYFA  313

Query  1058  TSPAAAGEMD--LARLVAELREGKERLQSRDNEL---------VQEIVTSLRTGEKPYEN  1204
              + A  GE    L  LVAE+R  K+R   RD+ +          + I    +       +
Sbjct  314   -AKAEEGEKQRKLQTLVAEIRRAKQRF--RDDHIPKLVGNGDATEVICNYQKEAGNMIAS  370

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
                D Y  +S  ++  Y  DFGWG P   + P    KN+  L+D + GGG EA V L + 
Sbjct  371   GGFDFYILTSACRFGLYEIDFGWGKPVWFAFPSVRQKNIVALVDTKEGGGIEAWVNLNEQ  430

Query  1385  DMSGFERDEELLRFA  1429
             +M  FE D ELL FA
Sbjct  431   EMKLFEEDRELLDFA  445



>emb|CDY04190.1| BnaA09g19680D [Brassica napus]
Length=459

 Score =   221 bits (564),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 147/433 (34%), Positives = 220/433 (51%), Gaps = 30/433 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + +  R +IKPSSPTP  L+  KLSLL+Q   +++ P++FFY  N R   T     L+ +
Sbjct  20    VEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSANYRIKQTEQLLNLKKS  79

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP +GRL  N +++CND+GA+F   +VN  L +++  P ++      P  + 
Sbjct  80    LSETLTHFYPLSGRLNGNTSINCNDSGADFLEAQVNSPLSNLLQEPSSEMLEQLIPTSVD  139

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL--SP  733
                     L + Q + F CGG+A+   + HK+ D  +V  FM  W A T    +    SP
Sbjct  140   SIEART-KLLLAQATFFKCGGMAIGVCVSHKLADATSVGLFMKSWSAITSQGSIKTVGSP  198

Query  734   NFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
              F +  +FP      T P+ P+ +P I     +  + KRFVF    ++ L+   S    V
Sbjct  199   VFDTLKIFPPGNFSETSPA-PVVEPDIKM---NQTLSKRFVFDSSSIEALQAKASSFE-V  253

Query  896   KNPTRAEIVSALLYKCCVKA----AASRRPSILVHYADMRPPLGLPC--NSAGNILSTFS  1057
               PTR E VSA ++K  +KA    + + +PSIL + A +R  +  P   NS GN++S F+
Sbjct  254   TQPTRVEAVSAFIWKLAMKATRTVSRTSKPSILANSASLRSRVSPPFTKNSIGNLVSYFA  313

Query  1058  TSPAAAGEMD--LARLVAELREGKERLQSR-------DNELVQEIVTSLRTGEKPYENPD  1210
              + A  GE    L  LVAE+R  K+R +         + +  + I    +       +  
Sbjct  314   -AKAEEGEKQRKLQTLVAEIRRAKQRFRDEHIPKLVGNGDATEVICNHQKEAGDMIASGG  372

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
              D Y  +S  ++  Y  DFGWG P   + P    KN+  L+D + GGG EA V L + +M
Sbjct  373   FDFYILTSACRFGLYEIDFGWGKPVWFAFPSVRQKNIVALVDTKEGGGIEAWVNLNEQEM  432

Query  1391  SGFERDEELLRFA  1429
               FE D ELL FA
Sbjct  433   KLFEEDRELLDFA  445



>ref|XP_008358908.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=459

 Score =   221 bits (564),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 149/466 (32%), Positives = 238/466 (51%), Gaps = 61/466 (13%)
 Frame = +2

Query  155   LHTQETKMAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN  334
             + T E K+ +I         +  IKPSSPTP   +  KLS+ DQ  + +Y+PL+FFY  +
Sbjct  1     MTTSEIKVEVI--------HKETIKPSSPTPRHFKTLKLSVFDQIASDLYVPLLFFYRRH  52

Query  335   NRTDPT-RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIIN  511
             N + P+  +S+IL+ +LS+TLT FYP+AG+   N ++ CND GAEF   +VNC +  I++
Sbjct  53    NSSVPSAEISNILKTSLSKTLTLFYPWAGQFQYNDSIGCNDRGAEFLEAQVNCPISKILD  112

Query  512   HPDADAQNVAFPAGLPWANI------HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTV  673
             +P  DA  + F   LP  ++        G L + Q S F+CGG+A+ A++ HKV D  T 
Sbjct  113   NP--DAHQMLFKQLLPAEHMGLARAAGSGNLILVQASFFECGGVAIGASISHKVADAITG  170

Query  674   RNFMGHWVA------------ATRHPKLNLSPN----FVSDSVFPTLPSGPLDKPMIPSK  805
               F+  W A               H ++   P      V  S+FP L       P++   
Sbjct  171   STFINTWAAFAFGSSVVSSTTTGDHQEVVKFPAPKIFGVPASLFPPLDFLNTHHPVV-EY  229

Query  806   IEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RP  973
              ++ C+ +RF+F   ++  LK   S  S V NP+  E+VS L++KC ++A+ S     +P
Sbjct  230   AKEKCMTRRFLFGASEIAALKS-KSASSTVPNPSCVEVVSVLVWKCAMEASRSNSGFMKP  288

Query  974   SILVHYADMRPPLGLPC---NSAGNILS-TFSTSPAAAGEMDLARLVAELREGKERLQSR  1141
             S+     +MR  L  P    N  G ++  + + +       DL  LVA LR+G       
Sbjct  289   SVWCQAVNMREILAKPLADKNLLGXLVGLSMTKTQLDIDNQDLLALVALLRKGI------  342

Query  1142  DNELVQEIVTSLRTGEKPYE----------NPDLDIYFCSSLGKYPAYTADFGWGWPCKV  1291
               ++ +E   +  +GE+ +E            D++ Y CSSL + P Y+ADFGWG P  V
Sbjct  343   --KVFKENFGNGISGEEAFEIFKEYGNLLRRDDIETYSCSSLCRLPFYSADFGWGKPLCV  400

Query  1292  SMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              +    +KN    +D + G G E ++  K+ D++  E ++ELL ++
Sbjct  401   FISSAHIKNAIKFMDTRDGDGMEVILTFKEEDIAKIENNKELLAYS  446



>ref|XP_008241213.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=453

 Score =   221 bits (563),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 146/435 (34%), Positives = 220/435 (51%), Gaps = 36/435 (8%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN------NRTDPTRV----SDILQ  373
             IKPSSPTP  LR   LS+ DQ    MYI L+ FYPNN      N  D   +    S +L+
Sbjct  15    IKPSSPTPHHLRTSSLSVFDQLQPDMYISLLLFYPNNISDDVVNNIDHNSLFAERSKLLK  74

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG  553
              +LS  LT FYP+AG    N ++ CND GA F   +VNC +  +++ PD        P  
Sbjct  75    TSLSEALTQFYPFAGEFEYNVSISCNDHGAGFIESKVNCPIRKVLDKPDFGILEQLIPVA  134

Query  554   LPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWV------AATRHP  715
             +   ++  G L + Q++ F+CGG+ +  ++ HKV D  T+  F+  W       A+T   
Sbjct  135   IKSKSVEAGHLLLVQVNLFECGGLTIGVSISHKVADASTLSTFIKTWATIALGSASTASD  194

Query  716   KLNLSPNF-VSDSVFPTLPSGPLDKP-----MIPSK---IEDDCVQKRFVFSGEKLDLLK  868
             ++ L   F V+ ++FP  P    + P     +I      I D+C+ KR VF   K+  LK
Sbjct  195   QVLLPVEFGVAATLFP--PQDVFNSPQPIMELIRDSCIMIRDNCITKRLVFDASKIAALK  252

Query  869   DVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPC--NS  1030
                +  + V NPTR E+VSAL++KC ++A+ S     +PS  V   ++R   GL    N 
Sbjct  253   SKAASAA-VPNPTRVEVVSALIWKCALQASRSNLGFTKPSAWVQVVNLRKRSGLAMAENI  311

Query  1031  AGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR-DNELVQEIVTSLRTGEKPYENP  1207
              GN +S F+     +  ++L  LV +LR+G +  + +  N +  E    +  G K     
Sbjct  312   LGNFVSYFTAMTMESDAVELESLVHKLRKGIDEYKEKYANGVSGEDAFQIIEGLKNLMMK  371

Query  1208  D-LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
             D ++ Y C+S  ++    ADFGWG P  ++  +   KN   L D   G G EA   L++ 
Sbjct  372   DSIETYGCTSWCRFSFNQADFGWGKPSWMNFCRNESKNTMILTDMSDGVGIEAFFSLEEE  431

Query  1385  DMSGFERDEELLRFA  1429
              M+ FER+E LL +A
Sbjct  432   HMAIFERNEYLLAYA  446



>ref|XP_008226171.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=443

 Score =   221 bits (562),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 150/444 (34%), Positives = 229/444 (52%), Gaps = 48/444 (11%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNR-----TDPTRVSD  364
             + +S    I+PSSPTP  LR   LS+ DQ    +Y+PL+ FYP+NN            S 
Sbjct  7     VDVSREETIRPSSPTPHHLRSSNLSVFDQLTPQVYVPLLLFYPSNNSDHHSPASAAERSK  66

Query  365   ILQNALSRTLTSFYPYAGRLLDN-ATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA  541
             +L+ +LS TL+ FYP+AG +  N  ++ CND GA F   RVNC +  I+  PD   Q   
Sbjct  67    LLKRSLSETLSHFYPFAGTIQSNDVSICCNDHGATFVEARVNCLMSKILEKPDLGIQKQL  126

Query  542   FPAGLPW-ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK  718
              P  L + A      L + Q + F+CGG+A+   + HK+ D  T+  F+  W A      
Sbjct  127   HPNELEFMAQSGTCHLLLVQANFFECGGVAIGLNISHKIIDAYTLCKFINSWAAIALG--  184

Query  719   LNLSPNFVSDSVFPTLPSG-------PLD-----KPMIPSKIEDDCVQKRFVFSGEKLDL  862
                S N  +D V P +  G       PLD     +P I   ++++C+ +R+VF   K+  
Sbjct  185   ---SAN--TDHVVPPVEFGAAASLFPPLDFLNSPQPSI-DFVKENCITRRYVFDASKIAA  238

Query  863   LKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRP--PLGLPC  1024
             LK   +  + V NPTR E+VSAL++KC ++A+ S     RPS+   + +MR   P     
Sbjct  239   LKS-KAVSAAVPNPTRVEVVSALIWKCVMEASRSNSDFVRPSVWCQFVNMRKILPQAPAE  297

Query  1025  NSAGNILS-TFSTSPAAAGEMDLARLVAELREGKERLQ-------SRDNELVQEIVTSLR  1180
             N +GN+L  + + +     E D+  LV++LR+G E  +       SR++   + I  S  
Sbjct  298   NLSGNLLGYSVAKTEEREVEHDVKSLVSKLRKGLEEFKVKYGNGISREDVFQRCIELSKL  357

Query  1181  TGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKG-PMKNMFFLIDNQSGGGF  1357
              G+      D+D Y  +S  ++P Y ADFGWG P  +S+P    +KNM  L+D   G G 
Sbjct  358   VGKV-----DIDTYCSTSWCRFPFYEADFGWGKPSWMSIPSTVEIKNMISLVDVSDGIGI  412

Query  1358  EALVMLKKTDMSGFERDEELLRFA  1429
             E  + LK  DM+  + ++E+L +A
Sbjct  413   EVRLTLKDEDMAIIKSNQEMLAYA  436



>ref|XP_006431841.1| hypothetical protein CICLE_v10001101mg [Citrus clementina]
 gb|ESR45081.1| hypothetical protein CICLE_v10001101mg [Citrus clementina]
Length=456

 Score =   221 bits (562),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 149/428 (35%), Positives = 221/428 (52%), Gaps = 37/428 (9%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTLTSF  403
             IKP+ PTP  LR  KLSL+DQ    +Y+  +F Y  ++     ++S  L+++LS+TLT F
Sbjct  15    IKPAYPTPHHLRNFKLSLMDQITFPIYVCTIFLYKADSSVKSYQISQRLKSSLSKTLTKF  74

Query  404   YPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP---AGLPWANIH  574
             YP+AGRL D+ ++ CND GAE+     N  L + +  PD        P   A    A I 
Sbjct  75    YPFAGRLKDDFSIICNDQGAEYVEALANGFLSEYLQKPDQKLLRDFHPFKYAESSAAGIG  134

Query  575   DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKL---------NL  727
             D  L + Q + F CGG+A++    HK+ DG +V  F+  W A  R              +
Sbjct  135   DPMLRI-QATFFKCGGLAIAVCTHHKLIDGSSVGTFVNSWTATARADSQSSSISNINKEV  193

Query  728   SPNFVSDSVFPTLPS-GPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNP  904
              P FV+ + FP   S  PL     P+++       R+VF   K+D L+  V+  + V  P
Sbjct  194   IPAFVAATFFPASESFVPLPFHNAPTEV------NRYVFDASKIDQLRAKVASAT-VPRP  246

Query  905   TRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFST  1060
             +R E+++AL++KC   A+ S     RPS+ VH  ++R    PP  LP NS GN +  + T
Sbjct  247   SRVEVLTALIWKCAKAASRSNLGYSRPSLSVHAMNVRAVAKPP--LPENSVGNSVG-YVT  303

Query  1061  SPAAAGEMDLAR-LVAELREGKERLQSRDNELVQEIVTSLRTGE---KPYENPDLDIYFC  1228
             + A+  E++  + LV  LR+ K     +  + V E        E   + +E  ++D Y  
Sbjct  304   AQASGNEIETVQDLVLSLRKAKAEYSKKGLQTVLETKNLFHIPESLQEKFEKDEIDFYTF  363

Query  1229  SSLGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
             SS   +P Y  ADFGWG P  V++    + N+F L+D   G G E LV L   D++ FER
Sbjct  364   SSTVNFPFYGLADFGWGKPVHVTISNYVISNLFVLMDTNDGKGIEVLVFLSPEDLALFER  423

Query  1406  DEELLRFA  1429
             D+ELL FA
Sbjct  424   DQELLSFA  431



>ref|XP_008226064.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   220 bits (561),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 150/431 (35%), Positives = 220/431 (51%), Gaps = 26/431 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
               I +R  IKPSSPTP  LR  KLSLLDQ     Y PLV FYP N    P +   I++ +
Sbjct  3     FEIIKRETIKPSSPTPHYLRNFKLSLLDQLGPVAYEPLVLFYPKNGIATPQKSIWIIKKS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP AGR+  N ++DCND G ++   RVN  L   ++ PDA       P    
Sbjct  63    LSETLTRFYPLAGRIKGNISIDCNDHGVDYVEARVNGLLSTFLSKPDAQTLRKLLPVDAE  122

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
                   G L + Q + FDCGG+A+   M HK+ D  ++  F+  W A        L P+F
Sbjct  123   SPEAGRGPLLLVQANVFDCGGLAIGVCMSHKLADAASLSTFILAWSATALGFSQALLPDF  182

Query  740   VSDSVF-PTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
              +   F PT  +    +  +  K   +CV KRFVF   K+  L+   +  + V  PTRAE
Sbjct  183   SASFRFPPTDHASSFQQSSVDVK-RVNCVTKRFVFYASKIAGLR-TKAASAIVDQPTRAE  240

Query  917   IVSALLYKCCVKAAA-------SRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTS  1063
              V+AL+++C V AA+       S + S+L    D+R    PPL    +S GN++  F+  
Sbjct  241   AVTALIWRCVVAAASRSSSSLQSPKLSVLSQSVDIRKRVVPPLS--DDSIGNLVGYFAAH  298

Query  1064  PAAAGEMDLARLVAELREGKERLQS------RDNELVQEIVTSLRTGEKPYENPD-LDIY  1222
                  +++L  LV +LR+G + L +      + ++ +Q +  S +  ++  +  D ++ Y
Sbjct  299   TDET-KLELQGLVVKLRKGIKELSNSYTKRLQKDQALQVVCKSFKEADEFIKRDDIINFY  357

Query  1223  FCSSLGKYP-AYTADFGWGWPCKVS-MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
               + L  Y   Y   FGWG P  +S +P     N+  L+  +  GG EA V L + DM+ 
Sbjct  358   VGTDLCNYKLLYGVSFGWGNPIWLSNVPAASNNNVASLVSTREDGGIEAWVTLSEEDMAA  417

Query  1397  FERDEELLRFA  1429
             FE+D+ELL FA
Sbjct  418   FEQDQELLAFA  428



>ref|XP_008226065.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=440

 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 150/438 (34%), Positives = 233/438 (53%), Gaps = 39/438 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN---RTDPTRVSDIL  370
             + +++  +I+PSSPTP  LR   LS+ DQ    +Y+ ++ FYP+NN    +     S IL
Sbjct  7     VEVTQEEIIRPSSPTPHHLRSSNLSVFDQLTPQVYVSVLLFYPSNNGDSHSLAAERSKIL  66

Query  371   QNALSRTLTSFYPYAGRLLD-NATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP  547
             + +LS  LT FYP+AG +   + ++ CND GA+FF  RVNC +  + + PD        P
Sbjct  67    KRSLSEVLTHFYPFAGTIQSKDVSICCNDHGAKFFEARVNCPMSQVFDKPDLGMLKQLHP  126

Query  548   AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL  727
               +  +    G L + Q + F+CGG+AV   + HK+ D  T+  F+  W A +    L+L
Sbjct  127   NAIE-SVAGTGHLLLVQANFFECGGMAVVVNISHKLIDAYTLCKFINRWSAIS----LSL  181

Query  728   SPNFVSDSVFPTLPSG-------PLDKPMIPSK------IEDDCVQKRFVFSGEKLDLLK  868
             +    +D V P +  G       PLD   + S       ++ +C+ KRFVF   K+  LK
Sbjct  182   AS---TDHVVPLVEFGAAAALFPPLD--FLSSTRASVGFVKYNCITKRFVFDASKIATLK  236

Query  869   DVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPL-GLPC-NS  1030
              + +  + V NPTR E+VSAL++KC ++A+ S     RPS+   + +MR  L  LP  N 
Sbjct  237   -LKAASATVPNPTRIEVVSALIWKCAMEASRSNSGVIRPSVWCQFVNMRKILPQLPAENL  295

Query  1031  AGNILS-TFSTSPAAAGEMDLARLVAELREGKERLQSR--DNELVQEIVTSLRTGEKPYE  1201
              GN++  + + +  +  E DL  LV +LR G E L+ +  +    +++        K   
Sbjct  296   LGNLVGYSVAKTEESEVEHDLGSLVFKLRRGFEELKVKYGNGMSSEDVFQQFNELGKLIG  355

Query  1202  NPDLDIYFCSSLGKYPAYTADFGWGWPCKVS-MPK-GPMKNMFFLIDNQSGGGFEALVML  1375
               D+D Y  +S  ++P Y ADFGWG P  +S +P    +KNM  L+D   G G EA + L
Sbjct  356   KVDIDNYCLTSWCRFPFYEADFGWGKPSWLSNIPSTAELKNMISLVDVSDGIGIEARLTL  415

Query  1376  KKTDMSGFERDEELLRFA  1429
             K+ DM+  E +EELL +A
Sbjct  416   KEEDMAVIESNEELLAYA  433



>ref|XP_009371380.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=441

 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 146/436 (33%), Positives = 220/436 (50%), Gaps = 34/436 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSD-----  364
             + I  +  IKPSSPTP  L+   LS  DQ    +Y+PL+ FYPN    D   +       
Sbjct  7     VEILHKETIKPSSPTPHHLKTCSLSGYDQLTPEIYVPLILFYPNGG--DEASIDHHALFA  64

Query  365   ----ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQ  532
                 +L+ +LS  LT FYP+AG  + N ++ C+D GA     +VNC +  I++ PD    
Sbjct  65    DRFGLLKRSLSEALTHFYPFAGEFVFNVSISCSDHGAGLIEAQVNCPISKILDKPDFQIL  124

Query  533   NVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA----  700
                 P  +       G L + Q+S F CGG+A+  ++ HKV D  T+  F+  W A    
Sbjct  125   GQLIPTSVDSKQAETGHLLLVQVSSFKCGGLAIGMSISHKVADASTLSAFIKSWTAIALG  184

Query  701   ---ATRHPKLNLSPNF-VSDSVFPTLPSGPLDKPMIPSKI-EDDCVQKRFVFSGEKLDLL  865
                AT H     SP F ++ ++FP  P   L+     ++   D  + KRFVF   K+  L
Sbjct  185   SAGATDHAV--PSPEFGIAATIFP--PQDILNSQQGTTEFPPDKGIGKRFVFDASKIAAL  240

Query  866   KDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LPCN  1027
             K   +  + V NPTR E+VSAL++KC ++A+ S     +PS+     +MR   G  L  N
Sbjct  241   KSKAASAT-VPNPTRVEVVSALIWKCAMEASRSNLGFTKPSVWSQVVNMRKRSGKTLVEN  299

Query  1028  SAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSR--DNELVQEIVTSLRTGEKPYE  1201
               GN L  F+ + +   E+DL  LVA+ R+G E  + +  ++   ++ + S++       
Sbjct  300   ILGNFLWYFA-AMSTESEVDLEILVAKFRKGIEEYKEKFPNSVGCEDALQSVKEHGNILI  358

Query  1202  NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKK  1381
             N  +  Y CSS  ++P Y  +FGWG P  VS+     KN   L+D   G G EAL+   +
Sbjct  359   NDSIVTYSCSSWCRFPFYETNFGWGQPSWVSICSSEFKNTIILMDTSDGFGVEALLTFTE  418

Query  1382  TDMSGFERDEELLRFA  1429
              DM+  ER E+LL +A
Sbjct  419   EDMAIIERHEDLLAYA  434



>ref|XP_008222012.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=434

 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 147/433 (34%), Positives = 231/433 (53%), Gaps = 38/433 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN--RTDPTRV-SDIL  370
             + + ER  IKPSSPTP  LR H+LS LDQ  T +++P++ FY NNN  R +  ++ SD +
Sbjct  3     IQVIERDCIKPSSPTPSHLRKHELSFLDQIATPIFMPMILFYTNNNGRRGNDVKIYSDRV  62

Query  371   QNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPA  550
             + +LS  LT +YP AGR++D+A VDC D GA + + +VNCTL D+I+ PD +  N   P 
Sbjct  63    KQSLSEILTQYYPLAGRVIDDAYVDCIDQGAHYVQAQVNCTLSDVISQPDPNQHNKLLPY  122

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
              L   N+ D  LAV Q++ FDCGG+A+   + HK+ D  +V  F+  W + +R    ++ 
Sbjct  123   DLD--NVGDLVLAV-QVNIFDCGGMAIGICISHKIVDAFSVITFLNSWASISRG-DCDIK  178

Query  731   PNFVSDSVF-------PTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSE-E  886
              N +S  +F       P   SG   KP       ++ V KRFVFS   +  L+   +E  
Sbjct  179   NNTISPPLFDVATLFPPRSISGY--KPST-GITRENIVTKRFVFSASMVASLRSKYTENN  235

Query  887   SGVKNPTRAEIVSALLYKCCVKAAAS----RRPSILVHYADMR----PPLGLPCNSAGNI  1042
             S  + PTR E +S  ++   + +       ++   ++H  ++R    PP  LP    GN+
Sbjct  236   SNERYPTRIEALSCFIWARFIASTQGEPNPKKIYKVLHAVNLRTRMDPP--LPEYHIGNV  293

Query  1043  LSTFSTSPAAAGEMDLAR-LVAELREGKERLQSRDNELVQEI------VTSLRTGEKPYE  1201
                   + +  G  D    LV ++R+    L++ D++ + ++      +  L+ G   + 
Sbjct  294   SRFAIATLSFDGSKDTCYGLVGQMRDA---LKTIDSDYLSKMRDGDTHLNFLKQGAAEFM  350

Query  1202  NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKK  1381
               ++     +SL ++P Y  DFGWG P  V     P KN+   +D +SGGG EA V LK+
Sbjct  351   KGEVVSLNFTSLCRFPLYETDFGWGKPVWVGSASLPFKNLVVFMDTESGGGIEAWVNLKE  410

Query  1382  TDMSGFERDEELL  1420
              DM+ F+ DE+LL
Sbjct  411   EDMAKFQEDEQLL  423



>ref|XP_003616845.1| Vinorine synthase [Medicago truncatula]
 gb|AES99803.1| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=440

 Score =   219 bits (557),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 141/430 (33%), Positives = 220/430 (51%), Gaps = 28/430 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + +  R  IKPSSPTP  L+ + LS +D  +   Y PL++FY  N   D       L+ +
Sbjct  3     IELLSRETIKPSSPTPSHLKLYPLSFIDNIIFRNYAPLLYFYNPNKSIDQNSKISQLRKS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS+ L+ +YP+AGR+ D  T++CND G  F   ++   L +I+ +P     N  FP  L 
Sbjct  63    LSQLLSKYYPFAGRIKDRITIECNDQGVLFLVTKIKNKLSEILQNPTEKLLNPLFPDELQ  122

Query  560   WANIH-DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR-----HPKL  721
             W  +         Q++ F CGG+ +S  M HK+GD  T+  FM  W    +       +L
Sbjct  123   WKEMDWRASFIAIQINWFTCGGMVISICMTHKIGDASTIFKFMNDWAIINQKIEEDKKEL  182

Query  722   NLSPNFVSDSVFPTLPSGPLDKPMIPS---KIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
              +SP  + D+     P    D P+ P    K E++ V KRFVF    +  LK +V+  S 
Sbjct  183   LVSPLSLLDAGATIFPQR--DLPIFPEMVIKKENNVVFKRFVFQPAMIKSLKAMVT-SSS  239

Query  893   VKNPTRAEIVSALLYKCCVKAAA-SRRPSILVHYADMR----PPLGLPCNSAGNILSTFS  1057
             + +PT+ ++V+A +YK  V     + + ++     D+R    PPL   C   GNI   FS
Sbjct  240   MHSPTQVQVVTAWIYKHAVSIMGLNFQTAMFSMIVDLRRRMVPPLSEHC--VGNIF-WFS  296

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSRDNELVQE-----IVTSLRTGEKPY-ENPDLDI  1219
             +  A   EM+L  LV +++EG     +   +L +E     I   L+   +PY EN +L  
Sbjct  297   SMLANKKEMELEDLVCQIKEGLSECCNVYPKLFREKENNNISECLKQVTEPYSENKNLFT  356

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             +  SS  ++P Y ADFGWG P  ++      +N+ FL+D + G G EA+V ++   M+ F
Sbjct  357   F--SSWCRFPMYEADFGWGKPIWITTTGLSSRNIIFLMDTRDGDGIEAIVNMEDNYMAKF  414

Query  1400  ERDEELLRFA  1429
             E + ELL++A
Sbjct  415   EHEFELLQYA  424



>ref|XP_008392421.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Malus domestica]
Length=455

 Score =   219 bits (558),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 156/454 (34%), Positives = 236/454 (52%), Gaps = 50/454 (11%)
 Frame = +2

Query  182   IIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALT-SMYIPLVFFYPNNNRTDPT--  352
             ++    + I  R  I+PSSPTP   +  KLSLLDQ  + ++Y  ++FFY + +  D T  
Sbjct  1     MVKEMKVEIISRKTIRPSSPTPHHHKNFKLSLLDQRHSPNLYGNMIFFYSSTSNYDHTYG  60

Query  353   -------RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIIN  511
                    ++S  LQ +LS+TL  FYP AGRL D AT++CND G  F   R++C LL+ ++
Sbjct  61    DFNPHALKMSSHLQKSLSKTLVHFYPLAGRLKDAATIECNDQGVYFVEARMDCHLLNFLS  120

Query  512   HPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGH  691
              PD+       P     A   D  + + QL+ F+CGGIA++ ++ HK+ D  ++  F+  
Sbjct  121   QPDSTLFQHFIPTSS--AEKEDVIVLLVQLTVFNCGGIAIAVSLLHKIADASSLCTFVQS  178

Query  692   WVAATR---------HPKL--NLSPNFVSDSVFP---TLPSGPLDKPMIPSKIEDDCVQK  829
             W AA+          H +    + P F+  S+ P    L +  LD P        +   +
Sbjct  179   WTAASTALDQSEFIGHDQRLGQVLPLFIGSSLLPPSEMLITRTLDIP----DPHQNFTTR  234

Query  830   RFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAA-----ASRRPSILVHYA  994
             RFVFS  K+  LK   +  +   NPT  E+VSA++ KC + AA     +S RPS+L H  
Sbjct  235   RFVFSTSKMASLKAKAAITTN--NPTNVELVSAVVVKCAIAAAQSISTSSSRPSVLFHAM  292

Query  995   DMRPPLG--LPCNSAGNILSTFSTSPAAAGEMD--LARLVAELREG-KERLQSRDNELVQ  1159
             ++R  +   LP N+ GN++  F   P    E D  L  +V +LR+G  +    + N    
Sbjct  293   NLRKRMVSPLPXNTVGNLVWAF---PVLIEESDIKLHEVVVKLRKGLTDFCNDKANRFKG  349

Query  1160  E----IVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFF  1327
             E    +V+   T E  + +  ++I+ C+SL K+P Y  DFGWG P  V+   G  KN   
Sbjct  350   EDGFAVVSEYHTKEVEFISRGVNIFRCTSLCKFPIYDMDFGWGKPTWVATSMG-FKNFIV  408

Query  1328  LIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             LID++ G   EA V L + +M+ F+RDE LL FA
Sbjct  409   LIDSKLGENIEAWVTLAEQEMAIFQRDEMLLSFA  442



>ref|XP_008226172.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=432

 Score =   218 bits (556),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 149/427 (35%), Positives = 221/427 (52%), Gaps = 38/427 (9%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTLTSF  403
             IKPSSPTP  LR   LS+ DQ  + +Y+ L+ FYP++  +D   V  +L+ +LS TLT F
Sbjct  11    IKPSSPTPHHLRISNLSVFDQVTSEVYVQLLLFYPSS--SDERSV--LLKTSLSETLTYF  66

Query  404   YPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGG  583
             YP AG    N+++ CND GA F   RVNC +  I+  PD   Q    P  +       G 
Sbjct  67    YPLAGEFKYNSSISCNDHGAAFVEARVNCPISQILGQPDLGMQKQLVPNHIE-CRTQSGK  125

Query  584   --LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSVF  757
               L + Q + F+CGG+A+   + HK GD  T+  F+  W A      + L     +D V 
Sbjct  126   CYLLLVQANFFECGGVAIGVTISHKAGDAYTLSKFINSWAA------IALGSTTTTDVVP  179

Query  758   PTL---------PSGPLDKPMIPSK-IEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPT  907
             P           P   L+ P  P + + ++CV +R VF   K+  LK   +  + V NPT
Sbjct  180   PAQFGAAASLLPPLEFLNSPQPPLEFVHENCVTRRLVFDASKIAALKSKAASTT-VPNPT  238

Query  908   RAEIVSALLYKCCVKAA----ASRRPSILVHYADMRPPLGLP--CNSAGNILSTF-STSP  1066
             R E+VSAL++KC ++A+     S RPS      +MR  + LP   +  GN    F + + 
Sbjct  239   RIEVVSALIWKCVMEASRSNLGSARPSAWCQVVNMRKIMVLPLTVDLLGNFFGYFVARTE  298

Query  1067  AAAGEMDLARLVAELREGKERLQSR-DNELVQEIVTSL--RTGEKPYENPDLDIYFCS-S  1234
              +  + D+  LVAE+R+G E  ++   N +  E V  L    GE      D D  +CS S
Sbjct  299   ESEVDHDVQSLVAEMRKGFEEFKAIFANGISGEDVLQLCKELGEL-IGKVDTDNNYCSTS  357

Query  1235  LGKYPAYTADFGWGWPCKVSMPKGP--MKNMFFLIDNQSGGGFEALVMLKKTDMSGFERD  1408
               ++P Y A+FGWG P  +S+P G   +KN+  L+D + G G E  + LK+ +M+  E +
Sbjct  358   WCRFPLYKANFGWGKPSWMSIPAGAVEIKNIISLMDERDGNGIEVRLSLKEANMALVESN  417

Query  1409  EELLRFA  1429
             +ELL +A
Sbjct  418   QELLAYA  424



>ref|XP_008386397.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
 ref|XP_008350041.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=439

 Score =   219 bits (557),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 146/430 (34%), Positives = 218/430 (51%), Gaps = 24/430 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP------NNNRTDP-TRV  358
             + +  + +IKPSSPTP  LR   LS+ DQ    +YIP++ FY       NNNR       
Sbjct  7     VEVVHKEIIKPSSPTPHHLRNLGLSVFDQFQPEIYIPVILFYRRSGDEVNNNRHCLFAEK  66

Query  359   SDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNV  538
               +L+ +LS  LT FYP+AG+   N ++ CND GA F   +VNC +  I++ P+    + 
Sbjct  67    LKLLKKSLSEALTRFYPFAGKFEYNVSISCNDHGAXFLEAQVNCPISKILDKPEFSILDQ  126

Query  539   AFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWV------A  700
               P  +       G L + Q S F+CGG+A+   +CHKV D  T   F+ HW       A
Sbjct  127   LLPTAIGSNQSEAGYLLLVQASLFECGGLAIGVRICHKVADASTFSAFIXHWTEISLGSA  186

Query  701   ATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKI-EDDCVQKRFVFSGEKLDLLKDVV  877
              +R   ++ +   V+ S+FP  P    + P     + +D CV +R+VF    +  LK   
Sbjct  187   ISRDHDVHPAEFSVAASLFP--PQDFFNSPKPTVHLPKDKCVTRRYVFDASNIAALKTKA  244

Query  878   SEESGVKNPTRAEIVSALLYKCCVKAA----ASRRPSILVHYADMRPPL-GLPCNSAGNI  1042
             +  + V  PTR E VSAL++KC ++A+     S RPS+L    ++R  L G   N  GN+
Sbjct  245   ASAT-VPKPTRVEAVSALIWKCAMEASRWNLGSIRPSVLCQAVNIRKGLSGQAENLMGNL  303

Query  1043  LSTFSTSPAAAGEMDLARLVAELREGKERLQSRD-NELVQEIVTSLRTGEKPYENPDLDI  1219
             +  F T+     E+D   LV +LR+G E  +    N +  ++V             D++ 
Sbjct  304   VWCF-TAMNLESELDYKNLVVKLRKGIEVYKEEHPNGVSGDVVMQTIKESGNLGRHDVET  362

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             Y  SS  + P Y A+FGWG P  VS+     KNM  L+D   GGG EA + LK+ DM+  
Sbjct  363   YAFSSWCRLPFYKANFGWGKPAWVSIRTIEFKNMIALMDTNDGGGIEATLTLKEDDMAMI  422

Query  1400  ERDEELLRFA  1429
               ++E L +A
Sbjct  423   GSNKEFLAYA  432



>gb|KDP36802.1| hypothetical protein JCGZ_08093 [Jatropha curcas]
Length=450

 Score =   219 bits (557),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 144/428 (34%), Positives = 216/428 (50%), Gaps = 30/428 (7%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP---NNNRTDPTRVSDILQNALSRTL  394
             +KPSSPTPP L+  KLSLLDQ + S Y P+V FYP   N N  D +    +L+ +LS+TL
Sbjct  11    VKPSSPTPPHLKIFKLSLLDQFMPSPYAPIVLFYPMIKNTNHLDVSSKLKLLKESLSQTL  70

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
             T FYP AG + D+ +++CND GA F   RV C L + +  PD    N   P         
Sbjct  71    TCFYPLAGIIKDDLSIECNDKGANFVEARVTCRLHEFLAQPDLMLINKFLPCQFVVNKST  130

Query  575   DGGLAV-FQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDS  751
              G      Q + FDC GIA+   + HK+ DG  +  F+  W  A+R     + P FV+  
Sbjct  131   VGAFVTNIQANIFDCDGIAIGICISHKILDGDALSTFLKGWTYASRGCNEAIYPKFVASF  190

Query  752   VFPT--LPSGPLDKPMIPSKI-EDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIV  922
             +FP   L        M  S + + +C+ +RFVF    ++ LK   +  SG++ PTR E V
Sbjct  191   LFPANDLWLKNSSAVMWSSLLRKGNCITRRFVFDSSAIEKLK-AQANSSGLQCPTRVETV  249

Query  923   SALLYKCCVKAAAS----RRPSILVHYADMRPPL--GLPCNSAGNILSTFSTSPAAAGEM  1084
             SA L+K  + A+A     ++PS+L H  ++R  +   L  NS GN L   +       + 
Sbjct  250   SAFLWKSIMSASAKVNGFQKPSLLTHIVNLRRRMEPSLSENSLGNFLWIAAAQYTDEAKP  309

Query  1085  DLARLVAELREGKERLQSRDNELVQEI---------VTSLR-TGEKPYENPDLDIYFCSS  1234
              L+ LV++++E   R+   D E V++I           SL+  GE        D +  SS
Sbjct  310   KLSDLVSKVKEAISRI---DEEFVKKIKGEEENSVLSESLKEIGEMDSYKNGRDCFGFSS  366

Query  1235  LGKYPAYTADFGWG---WPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
               K+  Y ADFGWG   W   + +      N+  L++ + G G EA + L + +M+  E 
Sbjct  367   WCKFGYYDADFGWGKPVWISSMGLEGSVFMNLIILVETRFGDGIEAWLTLDEQEMAILEG  426

Query  1406  DEELLRFA  1429
             +++LL+ A
Sbjct  427   NQDLLKLA  434



>ref|XP_008346587.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=445

 Score =   218 bits (555),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 149/436 (34%), Positives = 219/436 (50%), Gaps = 46/436 (11%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT----------RVSDILQ  373
             IKPSSPTP  L+  +LS+ DQ    ++ PL+ FYP+N  +D              S+IL+
Sbjct  15    IKPSSPTPSHLKTTQLSVFDQLAPDVFXPLLLFYPSNINSDAVDSIDHHSSVXERSNILK  74

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG  553
              +LS  LT FYP+AG    N ++ C+D G  F +  VNC +  I+  PD +      PA 
Sbjct  75    ASLSEALTHFYPFAGTFQYNVSISCDDHGVAFLQAHVNCPMSKILEKPDFEILRQLLPAS  134

Query  554   LPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA--------ATR  709
                +    G L + Q + F+CGG+A++ +  H + DG T+  F+  W A        +T 
Sbjct  135   QGSSQAETGHLLLIQANFFECGGLAIAVSSSHIIIDGYTLSTFIQSWAAVALASSTVSTD  194

Query  710   HPKLNLSPNF-VSDSVFPTLP--SGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
             H  + L+P F V+ S+FP L   + P   P     +E+ C+ KRFVF   K   LK    
Sbjct  195   H--VLLTPKFDVAVSLFPQLDFLNSP---PPAMELVEEKCISKRFVFEASKAAALKSKAV  249

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLGLPC--NSAGNI  1042
               S V NPTR E VSAL++KC   A+ S     R S+    A +R  +  P   N  GN+
Sbjct  250   STS-VPNPTRIESVSALIWKCATAASRSXSGVVRQSVWSTNASLRKIVQRPLAENLMGNL  308

Query  1043  LSTFSTSPAAAG--EMDLARLVAELREGKERLQSRDNELV--QEIVTSLRTGEKPYENPD  1210
             +        A+   ++D   +VA+LR+G E  + +    V  +E    ++      +   
Sbjct  309   VGMIVVKIEASEVVDIDFPSVVAKLRKGMEEFKEKYANGVSGEEACGFMKDFXDRIKR--  366

Query  1211  LDIYFCSSLGKYPAYTADFGWG---WPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKK  1381
             +D Y CSS  ++P Y A+FGWG   W C+       MKN+    D + G G EALV L +
Sbjct  367   VDNYHCSSWCRFPFYEANFGWGKPLWVCQTIT----MKNVAMFTDTRDGEGIEALVTLSE  422

Query  1382  TDMSGFERDEELLRFA  1429
              DM+ FE D+ELL +A
Sbjct  423   EDMAKFECDKELLAYA  438



>ref|XP_006435345.1| hypothetical protein CICLE_v10001106mg [Citrus clementina]
 ref|XP_006473775.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
 gb|ESR48585.1| hypothetical protein CICLE_v10001106mg [Citrus clementina]
Length=455

 Score =   218 bits (556),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 149/433 (34%), Positives = 220/433 (51%), Gaps = 38/433 (9%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRT---DPTRVSDILQNALSRTL  394
             IKPSSPTPP L+  K SLLDQ + S Y P++ FYPN+  T    P R++ +L+ +LS TL
Sbjct  13    IKPSSPTPPHLKTFKFSLLDQFIPSPYAPIILFYPNDCMTLAEIPKRLA-LLKRSLSETL  71

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
             T FYP AG++ D+ +++CND GA F   +VNC L + +  PD    +   P  L      
Sbjct  72    TRFYPLAGKIKDDLSIECNDDGAYFVEAQVNCRLDEFLTKPDLLLLHRFLPCELMKELTA  131

Query  575   DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSV  754
                L   Q++ FDCGGIA+   + HK+ DG  +  F+  W A  R  +  + PNF + S+
Sbjct  132   VTYLTNIQVNVFDCGGIAIGICISHKMLDGAALSTFLRAWSATARGCEEVIYPNFAAPSL  191

Query  755   FPTLPSGPLDKPMIPSKI---EDDCVQKRFVFSGEKLDLLKDVVSEESGVKN---PTRAE  916
             FP       D  M+       +  C+ KRFVF    +  LK VV+  S +K    PTR E
Sbjct  192   FPANDLWLRDTSMVMWGSLFKKGKCITKRFVFDASAIAALK-VVATSSKIKCPTPPTRVE  250

Query  917   IVSALLYKCCVKAA------ASRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTSP  1066
              VSA ++KC + A+       +RRP +L H  ++R    PPL   C   GN+L   +   
Sbjct  251   AVSAFIWKCIMAASKEKHGYQTRRPCVLTHLVNLRRRMTPPLSDNCT--GNLLWMAAAKC  308

Query  1067  AAAGEMDLARLVAELREGKERLQSRDNELVQEIVT---------SLRTGEKPYENPDLDI  1219
                 + +L  LV EL++   +L   D E V+++ +         SL+   +     ++D 
Sbjct  309   MTPDKPELHDLVGELKDAISKL---DGEFVKKLSSDEGNSLMCESLKQIGELCSKDEVDH  365

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVS---MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
                SS   +  Y  DFG G P  VS   +   P+ N+  L++ + G G EA + L + DM
Sbjct  366   VGFSSWCNFGFYEIDFGRGKPVWVSSYGLSGSPVMNLVILVETRYGDGIEAWMTLDEQDM  425

Query  1391  SGFERDEELLRFA  1429
             S  E   E ++FA
Sbjct  426   SNLECSSEYIKFA  438



>gb|KEH20539.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=453

 Score =   218 bits (555),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 140/433 (32%), Positives = 220/433 (51%), Gaps = 28/433 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + +  R  IKPSSPTP  LR + LS +D     +Y+P++FFY  N  +D      +L+ +
Sbjct  3     IELISRETIKPSSPTPTHLRIYPLSFIDNIFFRLYVPVIFFYNPNECSDQNSKVSLLRKS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS+ L+ +YP+AGRL D  T++CND G  F   ++   L +I+ +P     N  FP  L 
Sbjct  63    LSQLLSKYYPFAGRLKDKITIECNDQGVSFLVTKIKNKLSEILKNPTDKILNPLFPDKLQ  122

Query  560   WANIH-DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPN  736
             W ++     L   Q++ F CGG+A+S  M HK+GD  T+ NFM  W    +  +      
Sbjct  123   WKDMDWSDTLIAVQINCFACGGMAISICMSHKIGDASTIFNFMNDWSIINQKLQEEEEDK  182

Query  737   FVSDSVFPTLPSGP-----LDKPMIPSKI---EDDCVQKRFVFSGEKLDLLKDVVSEESG  892
              +    FP L  G       D  + P  +   +++ V KRFVF    +  LK + +  S 
Sbjct  183   GLLVLPFPLLDGGASVFPQRDLTIFPELVLTRKNNVVCKRFVFQPSMIKSLKAMATSSSM  242

Query  893   VKNPTRAEIVSALLYKCCVK-AAASRRPSILVHYADMR----PPLGLPCNSAGNILSTFS  1057
                P+R + V+A +YK  V     + + ++     D+R    P L   C   GNI+  FS
Sbjct  243   HSPPSRVQAVTAWIYKRAVSLMGLNFQTALFSMGVDLRKRMVPALSEKC--VGNIV-WFS  299

Query  1058  TSPAAAGEMDLARLVAELREG--------KERLQSRDNELVQEIVTSLRTGEKPY-ENPD  1210
             +  A   EM+L  LV++++EG         E   +++NE +  I   L+   +P+ EN +
Sbjct  300   SMVADKKEMELHELVSKIKEGLSQFGDFIPETFGAKENENLSLISECLKQVTEPHPENEN  359

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             L  +  SS  ++P Y  +FGWG P  V+      +N+ FL+D + G G EA+V ++   M
Sbjct  360   LFTF--SSWCRFPMYETNFGWGNPTWVTTFGCSSRNIIFLMDTKDGEGIEAIVNMEDNYM  417

Query  1391  SGFERDEELLRFA  1429
             + FE + ELLR A
Sbjct  418   TKFEHEVELLRHA  430



>ref|XP_006471129.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=456

 Score =   218 bits (554),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 145/422 (34%), Positives = 216/422 (51%), Gaps = 25/422 (6%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTLTSF  403
             IKP  PTP  LR  KLSL+DQ    +Y+  +F Y  +      ++S  L+++LS+TLT F
Sbjct  15    IKPLYPTPHHLRNFKLSLMDQITFPIYVCTIFLYKADGSVKSYQISQRLKSSLSKTLTKF  74

Query  404   YPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP---AGLPWANIH  574
             YP+AGRL D+ ++ CND GAE+     N  L + +  PD        P   A    A I 
Sbjct  75    YPFAGRLKDDFSIVCNDQGAEYVEALANGFLSEYLQKPDQKLLRDFHPFKYAESSAAGIG  134

Query  575   DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSV  754
             D  L + Q + F CGG+A++    HK+ DG +V  F+  W A  R    + S + ++  V
Sbjct  135   DPMLRI-QATFFKCGGLAIAVCTHHKLIDGSSVGTFVNSWTATARADCQSSSISNINKQV  193

Query  755   FPTLPSG---PLDKPMIPSKIEDDCVQ-KRFVFSGEKLDLLKDVVSEESGVKNPTRAEIV  922
              P   +    P  +  +P    +   +  R+VF   K+D L+  V+  S V  P+R E++
Sbjct  194   IPAFVAATFFPASESFVPLPFHNAPTEANRYVFDASKIDQLRAKVASAS-VPRPSRVEVL  252

Query  923   SALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAAAG  1078
             +AL++KC   A+ S     RPS+ VH  ++R    PP  LP NS GN +  + T+ A+  
Sbjct  253   TALIWKCAKAASRSNLGYSRPSLSVHAMNVRAVAKPP--LPENSVGNSVG-YVTAQASGN  309

Query  1079  EMDLAR-LVAELREGKERLQSRDNELVQEIVTSLRTGEK---PYENPDLDIYFCSSLGKY  1246
             E++  + LV  LR+ K     +  + V E        E     +E  ++D Y  SS   +
Sbjct  310   EIETVQDLVLSLRKAKAEYSKKGLQTVLETKNLFHIPESLQDKFEKEEIDFYTFSSTVNF  369

Query  1247  PAYT-ADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLR  1423
             P Y  ADFGWG P  V++    + N+F L+D     G E LV L   D++ FERD+ELL 
Sbjct  370   PFYELADFGWGKPVHVTISNYVISNLFVLMDTNDRKGIEVLVFLSPEDLALFERDQELLS  429

Query  1424  FA  1429
             FA
Sbjct  430   FA  431



>ref|XP_007158727.1| hypothetical protein PHAVU_002G177000g [Phaseolus vulgaris]
 gb|ESW30721.1| hypothetical protein PHAVU_002G177000g [Phaseolus vulgaris]
Length=449

 Score =   218 bits (554),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 145/440 (33%), Positives = 223/440 (51%), Gaps = 40/440 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDI--LQ  373
             + +  R  IKPS  TPP L+ + L  +D  +   YIP++ FY  N+ +     S I  L+
Sbjct  13    MELVSRETIKPSIATPPHLKIYPLCFIDNIVFRNYIPILLFYSANHHSKNHHESKISTLK  72

Query  374   NALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG  553
              +LS+ L+ +YP+AG L D  +++CND G  F      C L  I+++P+  + +  FP  
Sbjct  73    KSLSQVLSRYYPFAGMLRDQLSIECNDQGVSFLVTSFACNLSSILHNPNHASFHRLFPDQ  132

Query  554   LPWANIH-DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
             L W  +     +   Q++ F CGGI +S  MCHKV D  T+ NF+  W   +R  +    
Sbjct  133   LQWKPMEPTSTIVAIQINCFACGGIVISVCMCHKVADAATLCNFINDWAMFSRQNQDQQE  192

Query  731   P--NFVSDSVFPT-----LPSGPLDKPMIPSK--IEDDCVQKRFVFSGEKLDLLKDVVSE  883
                  +S   FP      LP   L  P+ P    +++D V +RFVF G K+D LK +VS 
Sbjct  193   EQEKLLSSLPFPVPGASFLPQENL--PVFPETAFVKNDTVCRRFVFEGAKIDSLKAMVSS  250

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYA-DMR----PPLGLPCNSAGNILS  1048
                V NPTR E+VSAL+Y   V +      ++    A ++R    PPL  P  S GN++ 
Sbjct  251   RD-VHNPTRVEVVSALIYNRAVSSLGLTFKTMPFRTAVNLRNRTVPPL--PEKSLGNLVW  307

Query  1049  TFSTSPAAAGEMDLARLVAELREGKERL----------QSRDNELVQEIV---TSLRTGE  1189
                 S     E +L  LV ++++G              +++D+  + E +   T +  G 
Sbjct  308   FLFVSNLGE-ETELQELVVKMKQGLREFRDTFGKKFGGKNKDSRFITECLEQATRVPEGG  366

Query  1190  KPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALV  1369
                E+    +  C+S  ++P Y ADFGWG P   S  + P+KN   L+D + G G EALV
Sbjct  367   GCVES----LVCCASWCRFPMYEADFGWGKPVWFSTSECPVKNSVVLMDTRDGEGIEALV  422

Query  1370  MLKKTDMSGFERDEELLRFA  1429
              +++ DM+ FERD  LL++A
Sbjct  423   NMEEHDMAKFERDFHLLQYA  442



>ref|XP_004485524.1| PREDICTED: vinorine synthase-like [Cicer arietinum]
Length=444

 Score =   217 bits (552),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 144/429 (34%), Positives = 221/429 (52%), Gaps = 38/429 (9%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPT----RVSDILQNAL  382
             R+LIKPS PTPP+L+  KLSLLDQ   + +    FFYPN N  + +      S +LQN+L
Sbjct  22    RVLIKPSKPTPPNLQTFKLSLLDQLSPNFHGNTTFFYPNYNNINHSSHFLEKSKLLQNSL  81

Query  383   SRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPW  562
             S+TLT FYP AG L D AT++CND G  F   + N TL +I+ +PD D     F   LP 
Sbjct  82    SQTLTLFYPLAGNLQDAATINCNDGGVFFIESQTNTTLSEILTNPDFD----TFECFLPS  137

Query  563   ANIHDG-GLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNF  739
              +      L + + + FDCG  A++ ++ HK+ D  T+  F+  W A        L    
Sbjct  138   TDEKQILNLLLIRFTLFDCGSTAITVSLTHKIADFNTLITFLKTWTAVCGGDTKILPDLT  197

Query  740   VSDSVFPTLPSGPLDKPMIPSKIE---DDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
              + ++FP     P + P I + ++        +RF+F   K++ LK  V       NPTR
Sbjct  198   TAVNLFP-----PREFPAISASVKTSNKKITSRRFIFEASKIEELKTRVKRTVEF-NPTR  251

Query  911   AEIVSALLYKCCVKAAASR-----RPSILVHYADMRPPL--GLPCNSAGNILSTFSTSPA  1069
              E+V AL++KC +   A++     + SIL+   ++R  +   +P N+ GN++  FS +  
Sbjct  252   VEVVLALIWKCALSTTATKTTSFFKHSILLQAVNLRTRMEPTIPENAVGNLIWPFSVTVE  311

Query  1070  AAGEMDLARLVAELREG-KERLQSRDNELVQE-----IVTSLRTGEKPYENPDLDIYFCS  1231
                 + +  +V  +R+G +E ++S+     +E     ++ SL+   K  E   L IY  S
Sbjct  312   DECHVAIDEMVKRMRKGMREFIESKVERFKEEGWFEFVMESLKERVKINEG-SLVIYRSS  370

Query  1232  SLGKYPAYTADFGWG---WPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFE  1402
             S   +P    DFGWG   W C V+     + N   L+D + G G EA V L +  M  F+
Sbjct  371   SWCNFPLLENDFGWGKPVWSCSVN---KVVSNTIALMDTKDGCGVEAFVTLDEDHMEFFQ  427

Query  1403  RDEELLRFA  1429
             +D+ELL +A
Sbjct  428   QDQELLNYA  436



>ref|XP_006491901.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=438

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 144/433 (33%), Positives = 214/433 (49%), Gaps = 36/433 (8%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALS  385
             +  R  IKP+ PTP  LR  KLSL+DQ    +Y+  +F Y  +      ++S  L+ +LS
Sbjct  9     VRARESIKPAYPTPEHLRNFKLSLMDQITFPVYVSTIFLYKADGNVKADQISQCLKLSLS  68

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWA  565
             +TLT FYP AGR+ D+ +++ ND GAE+     N  L + +  PD +      P     +
Sbjct  69    KTLTKFYPLAGRVKDDFSIESNDEGAEYVEALANGFLFEYLQKPDQNLLRDFHPFNYVES  128

Query  566   NIHDGGLAVF--QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKL------  721
              +   G  +   Q + F CGG+A++   CHK+ DG ++R F+  W    R          
Sbjct  129   PVASNGCPMLRVQATFFKCGGLAITVCTCHKLIDGASLRIFVDSWATTARADNQLSGSSN  188

Query  722   --NLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
                ++P FV+ ++FP   S        PS I       RFVF  +K+D LK  V+  + V
Sbjct  189   NKEVTPRFVTSTIFPASESF----VAAPSHI-SPVKANRFVFDAKKIDELKAKVASPT-V  242

Query  896   KNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILST  1051
               PTR E ++AL++KC   A+ S     RPS+ V   D+R    PP  LP NS GN ++ 
Sbjct  243   PRPTRVEALTALIWKCARAASRSNLGYSRPSLSVQAIDVRAVAEPP--LPDNSVGNSVAY  300

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDL  1213
              +   +      L  LV  LR+ K   +         N+ + +I  S++     +E  ++
Sbjct  301   LTAQASEKETETLQDLVCSLRKAKAEFRRNGLKTLLKNKNIFDIPESIK---DKFEKDEI  357

Query  1214  DIYFCSSLGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             D Y  SSL  +P Y  ADFGWG P  ++MP   + N+  ++    G G E  V L   DM
Sbjct  358   DFYTFSSLVNFPYYEAADFGWGKPVHMTMPNYWVSNLIIIMAANDGKGIEVWVTLSPEDM  417

Query  1391  SGFERDEELLRFA  1429
             + FE DEELL FA
Sbjct  418   AFFEGDEELLAFA  430



>ref|XP_009358370.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=459

 Score =   217 bits (552),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 144/458 (31%), Positives = 231/458 (50%), Gaps = 45/458 (10%)
 Frame = +2

Query  155   LHTQETKMAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN  334
             + T E K+ II         +  IKPSSPTP   +  KLS+ DQ  + +Y+PL+FF+ ++
Sbjct  1     MTTSEIKVEII--------HKETIKPSSPTPRHFKILKLSVFDQIASDVYVPLLFFHRHH  52

Query  335   NRTDPT-RVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIIN  511
             N + P+  +S+IL+ +LS+TLT FYP+AG+   N +  CND GAEF   +VNC +  I++
Sbjct  53    NSSVPSAEISNILKTSLSKTLTLFYPWAGQFQYNDSTGCNDRGAEFLEAQVNCPISKILD  112

Query  512   HPDADAQNVAFPAGLPWANIH------DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTV  673
             +PDA    + F   LP  ++        G L + Q S F+ GG+A+ A++ HKV D  T 
Sbjct  113   NPDA--HQMLFKQLLPAEHMGLARAAGSGNLVLVQASFFERGGVAIGASISHKVADAITG  170

Query  674   RNFMGHWVAATRHPKLNLSPNF----------------VSDSVFPTLPSGPLDKPMIPSK  805
               F+  W A      +  S                   V  S+FP         P++   
Sbjct  171   STFINTWAAFAFGSSVVSSTTTGDNQEVVKFPAPKMFGVPASLFPPPDFLNTHHPVV-EY  229

Query  806   IEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RP  973
              ++ C+ +RF+F   ++  LK   S  S V NP+R E+VSAL++KC ++A+ S     + 
Sbjct  230   AKEKCMTRRFLFGASEIAALKSK-SASSTVPNPSRIEVVSALIWKCAMEASRSNSGFMKT  288

Query  974   SILVHYADMRPPLGLPCNSA---GNILS-TFSTSPAAAGEMDLARLVAELREGKERLQSR  1141
             S+     +MR  L  P       G+++  + + +       DL  LVA LR+G E  +  
Sbjct  289   SVWCQAVNMREILAKPLADKYLLGSLVGLSMTKTQLDIDNQDLLTLVALLRKGMEEFKEN  348

Query  1142  DNELV--QEIVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMK  1315
                 +  +E     +         D++ Y CSS+ + P Y+ADFGWG P  V +    +K
Sbjct  349   FGNGISGEEAFEIFKEYGNLLRRDDIETYSCSSMCRLPFYSADFGWGKPLWVFISSADIK  408

Query  1316  NMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
             N    +D + G G E ++ LK+ D++  E ++ELL ++
Sbjct  409   NAIKFMDTRDGDGMEVILTLKEEDLAKIENNKELLAYS  446



>ref|XP_007039558.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
 gb|EOY24059.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
Length=444

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 145/432 (34%), Positives = 223/432 (52%), Gaps = 27/432 (6%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDP-----TRVSDIL  370
             I  R  IKPS+PTP  L+  KLSLLDQ   +++  + FFYP++N  D      +  S +L
Sbjct  8     IVSRQTIKPSTPTPSDLKTFKLSLLDQLSPAVHGNMTFFYPSSNTMDSIGDDFSEKSQLL  67

Query  371   QNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP-  547
             Q ++S+TL+ FYP  GRL D AT+DCND GA F   +VN  L + +N P+ +  +   P 
Sbjct  68    QESISKTLSLFYPLGGRLQDAATIDCNDEGAFFAEAKVNIQLSEFLNQPEFNLMDHFLPT  127

Query  548   AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL  727
                    + +G + + QL+ F CGG+A+S ++ HK+ D   +   +  W A  R     +
Sbjct  128   TDTKTMELSNGAMFIVQLTSFTCGGVAISLSLTHKLADVSALLTLLQSWTAVCRGLSDPV  187

Query  728   SPNFVSDSVFPTLPSGPLDKPMIPSKI-EDDCVQKRFVFSGEKLDLLKDVVSEE---SGV  895
             +P+ + +      P   L        I  +  V +RFVFS  K+  LK  V +E      
Sbjct  188   TPDLIGEKFLA--PRDELSAMSASLNIAAEKFVLRRFVFSASKIAELKAKVDQEFQNEMQ  245

Query  896   KNPTRAEIVSALLYKCCV----KAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTFS  1057
              +P+R E+V ALL+KC V    +   S  P+ L    ++R  +   LP  + GN +  F 
Sbjct  246   SHPSRVEVVLALLWKCAVACKKQKTGSFGPTALFQAVNLRKRMSPPLPETAIGNFIWPFM  305

Query  1058  TSPAAAGEMDLARLVAELREG-KERLQSRDNELVQE-----IVTSLRT-GEKPYENPDLD  1216
                    ++ L  LV ++R+   E   ++ N    E     I+ +L+  GE    N ++ 
Sbjct  306   VLAHEEKDLKLPELVIQMRKSFIEFNNTKANMFRGEAAPLAIMGALKERGEFFRNNREMT  365

Query  1217  IYFCSSLGKYPAYTADFGWGWPC-KVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
             +Y CSS  K+P Y  DFGWG P   VS+ K  + N   L D +S  G EAL+ L + +M+
Sbjct  366   VYKCSSWCKFPLYDTDFGWGKPLWHVSINK-LVSNTIALADTRSRDGIEALLTLDEEEMA  424

Query  1394  GFERDEELLRFA  1429
              FE++EELL++A
Sbjct  425   LFEQNEELLKYA  436



>ref|XP_011013913.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like, partial 
[Populus euphratica]
Length=449

 Score =   216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 153/432 (35%), Positives = 223/432 (52%), Gaps = 37/432 (9%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD------PTRVSDILQNALS  385
             +KPSSPTP  LR  KLSLLDQ +T  Y P++ FYP N +        P R+ ++L+ +LS
Sbjct  11    VKPSSPTPSPLRNFKLSLLDQLVTVPYAPILLFYPMNKKASTSYLDVPKRL-ELLKKSLS  69

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG-LPW  562
              TLT FYP AG++ D  ++DCND GA +   +VNC L + +  PD    N  FP   LP 
Sbjct  70    ETLTQFYPLAGKIKDELSIDCNDEGAYYVETQVNCHLCEFLRQPDLLLANQFFPCELLPT  129

Query  563   ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLN-LSPNF  739
              +     +A FQ++ F+C GI +   + H+V DG  +  F+  W A  +  K   + P F
Sbjct  130   ESTAVTYVANFQVNVFECCGIVIGMCISHRVVDGAALSTFLKAWSATAKGSKEAIIYPEF  189

Query  740   VSDSVFPTLPSGPLDKP--MIPSKIED-DCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
             ++ S+FP       D    M  S ++   C+ KRFVF    +  LK   +   G+K PTR
Sbjct  190   IASSLFPANDLWLRDSAIVMFGSLLKKGQCMTKRFVFDASAISNLK-AQAAILGLKCPTR  248

Query  911   AEIVSALLYKCCVKAA----ASRRPSILVHYADMRPPL--GLPCNSAGNILSTFSTSPAA  1072
              E+VS+ L+KC + A+     S+RPS+L HY ++R  +   L  NS GN L   +     
Sbjct  249   VEVVSSFLWKCLMAASEEWRGSQRPSLLTHYVNLRRKMEPKLSGNSMGNFLWLAAEKYTN  308

Query  1073  AGEMDLARLVAELREGKERLQS---------RDNELVQEIVTSLRTGEKPYENPD-LDIY  1222
               +  L  LV E+R+   ++ S         + N L+ E   SL+ G   + + D +D  
Sbjct  309   KSKPGLKDLVGEVRKAISKIDSDFVEHIKGDKGNALMDE---SLK-GIGAFGSGDGVDYL  364

Query  1223  FCSSLGKYPAYTADFGWGWPCKVS---MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
               SS  K+  Y  DFGWG P  VS   +      N+ FL+D +   G EA V L + DM+
Sbjct  365   GFSSWCKFGFYDTDFGWGKPVWVSSFGLSCSLTMNLVFLVDTRC-DGIEAFVTLDEKDMT  423

Query  1394  GFERDEELLRFA  1429
               E + ELL+ A
Sbjct  424   ILEGNPELLKSA  435



>gb|KDP36822.1| hypothetical protein JCGZ_08113 [Jatropha curcas]
Length=696

 Score =   221 bits (564),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 150/435 (34%), Positives = 222/435 (51%), Gaps = 27/435 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFY-PNNNRTDPTRVSDILQN  376
             + +  R  IKP S TP  LR +KLSLLDQ + S ++P++FFY P +    P R+   L++
Sbjct  3     IEVFSRESIKPPSLTPSHLRTYKLSLLDQLMPSAHVPIIFFYRPIDQPVIPARLQR-LKH  61

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS+ LTSFYP+AG++ D+  +DCND G  +   +V+  L DI+ HPD        P   
Sbjct  62    SLSQALTSFYPFAGKIKDDLYIDCNDDGVSYTEAKVSSFLSDILGHPDTKTIFKLLPDDS  121

Query  557   PWANIHDGG----LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHP-KL  721
                  ++ G    +A+ Q++ F CGGIA+     HK+ DG T  +F+  W A  R   +L
Sbjct  122   YLLETYNEGNGIPVAMIQVNVFKCGGIAIGTKTSHKIIDGPTSTSFLKAWAAIARGSGEL  181

Query  722   NLSPNFVSDSVFPTLPSGPLDK--PMIPSKIE-DDCVQKRFVFSGEKLDLLKDVVSEESG  892
              + P+F + S+FP   S P D    + PS ++    V KRFVF    +  LK   S  S 
Sbjct  182   VVQPSFTAPSLFPQNHSLPKDTLLAVWPSLVKFGKGVMKRFVFDSSAIATLKARASSSSF  241

Query  893   VKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR--PPLGLPCNSAGNILSTF  1054
             V+ PTR E VSA +++C + A+  R    +PS+L H  ++R    + LP +S GN+L   
Sbjct  242   VQRPTRVEAVSAFIWQCTMVASEKRNGSYKPSVLSHTVNLRGKKTVHLPESSVGNLLWMS  301

Query  1055  STSPAAAGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDLD  1216
                     E +L  LV  LRE   ++ S         E   ++   L+   + Y N   D
Sbjct  302   IAKCCTEAERELHVLVGLLRESILKIDSNFVQKLSGEEGFYKVCECLQEFSEVYSNAGAD  361

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPM----KNMFFLIDNQSGGGFEALVMLKKT  1384
                 SSL K   Y  DFGWG P  VS P G +    +N+ FL +   G G E  + L + 
Sbjct  362   YLTFSSLCKVGIYETDFGWGKPIWVS-PGGVIGPVFQNLVFLNETSGGDGIEVWLTLDEQ  420

Query  1385  DMSGFERDEELLRFA  1429
             DM+  E +  +L F+
Sbjct  421   DMAILELETHILSFS  435


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 71/265 (27%), Positives = 113/265 (43%), Gaps = 33/265 (12%)
 Frame = +2

Query  461   AEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGG-LAVFQLSEFDCGGIAVSA  637
             A +     N TL   +  PD        P  +    +  G  +A+ Q + F CGG  +  
Sbjct  446   ACYIEATSNITLSQYLAKPDLALLRKLLPDIICEYELPSGSHIALIQETTFACGGFTIGI  505

Query  638   AMCHKVGDGGTVRNFMGHWVAA-----TRHPKLNLSPNFVSDSVFP---TLPSGP--LDK  787
                H   DG ++  F+  W A      T+HP L       ++ +FP     PSG      
Sbjct  506   YASHMFCDGASLFLFLKDWAATTCKSPTKHPYL------AAEGIFPPYTAFPSGVSFFTT  559

Query  788   PMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR  967
                P   +      R VF+   +  LK   S  +   NPTR E+V+A L KC + +  ++
Sbjct  560   MYAPFVKKGKYTLNRIVFNESAITNLKAKASLNN--INPTRVEVVTAFLSKCLIASFKNK  617

Query  968   ----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAAAGEMDLARLVAELREGK  1123
                 +P  + H  ++R    PP  LP +  GNI+S F+ +     E +L  LV+ELR   
Sbjct  618   TGIDKPLAICHAVNLRRKADPP--LPESLLGNIIS-FAGAVFTTKEKELIELVSELR---  671

Query  1124  ERLQSRDNELVQEIVTSLRTGEKPY  1198
             E ++  DN+ +++I +    G   Y
Sbjct  672   EEMKKVDNDFLKKIKSGGGDGFSKY  696



>emb|CDP08574.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   215 bits (548),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 146/430 (34%), Positives = 211/430 (49%), Gaps = 31/430 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFY-PNNNRT--DPTRVSDIL  370
             L I  + +IKPSSPTP  LR   LS LDQ    +YIPL+FFY P+  +T  D  ++S +L
Sbjct  5     LEILSKEMIKPSSPTPYHLRNFTLSFLDQLAPPIYIPLIFFYQPSQLQTYKDHAQISQLL  64

Query  371   QNALSRTLTSFYPYAGRLL-DNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFP  547
             + +LS  LT FYP  GR+  D+  +D NDAGA F   +V+  LL +I  P  D      P
Sbjct  65    KQSLSNALTKFYPLGGRICSDDFAIDANDAGALFVEAQVHSNLLQVIEKPSMDEMKQYLP  124

Query  548   -------AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAAT  706
                     G+  AN     L   Q++ FDCGG+A+   M HK+ DG ++  FM  W A  
Sbjct  125   LQPNGSGHGITEANTI---LLAVQINIFDCGGLAIGVQMSHKIADGTSLVAFMNAWAANC  181

Query  707   RHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSK--IEDDCVQKRFVFSGEKLDLLKDVVS  880
             R        +    S+FP  P   L+    P+    ++    KRFVF  EKL  LK  ++
Sbjct  182   RGDAEIHQSSLDLASLFP--PKDVLNSGFKPTVGITKEKITTKRFVFDREKLAKLKQALA  239

Query  881   EESG--VKNPTRAEIVSALLYKCCVKA------AASRRPSILVHYADMRPPL--GLPCNS  1030
                G  VK+PTR E VSA  ++  ++A      + S++    VH  ++RP +   LP ++
Sbjct  240   SSPGSQVKDPTRVEAVSAFFWRHFIEATKAKMDSKSKKMVAAVHAVNLRPRMNPALPDHA  299

Query  1031  AGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQ---EIVTSLRTGEKPYE  1201
              GN+       P A GE     L  +LR     + S   + +Q   E + +L+   +   
Sbjct  300   FGNLWRHALAIPVAEGEKGYQNLAGDLRNAIRNINSNYVKTLQIGDEYLHALKKTMELVS  359

Query  1202  NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKK  1381
               D++    SS  ++P Y  D+GWG P  V     P KN+  L+    G G EA V + +
Sbjct  360   KGDIEFCNFSSWCRFPVYEVDYGWGKPTWVCTTTLPFKNVVILMSTSCGEGIEAWVNMLE  419

Query  1382  TDMSGFERDE  1411
              DM+ FE D 
Sbjct  420   EDMASFESDH  429



>ref|XP_004310025.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=428

 Score =   215 bits (547),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 145/424 (34%), Positives = 220/424 (52%), Gaps = 28/424 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN---NRTDPTRVSDIL  370
             + + ER  IKPSSPTP  LR H+LS LDQ    +++P++ FYP     N   P   S + 
Sbjct  3     VEVIERDCIKPSSPTPNHLRKHELSFLDQVAPPIFMPMLLFYPATSYGNDETPLSASRVK  62

Query  371   QNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPA  550
             Q +LS TLT FYP AGR++DNA V+CND G  F   RV C L D+++ PD +  N   P 
Sbjct  63    Q-SLSETLTQFYPLAGRIIDNAFVNCNDEGTPFVEARVKCLLSDVVSQPDPNQLNKLLPC  121

Query  551   GLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL-  727
              L    + D  LAV Q++ FDCGG+A+   + HKV D  ++  F+  W + +R    N  
Sbjct  122   DL--ECVVDFVLAV-QVNIFDCGGMAIGVCISHKVADALSLVMFLNSWASISRGDNCNYR  178

Query  728   SPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPT  907
             +P F   + FP        KP +     D  V KRFVFS   +  L+   +     + PT
Sbjct  179   APIFDLATFFPPRSISGF-KPGV-GIARDKIVTKRFVFSASNVASLRTKYTTSETERRPT  236

Query  908   RAEIVSALLYKCCVKAAASRRPSILV----HYADMRPPL--GLPCNSAGNILSTFSTSPA  1069
             R E +SA ++   + +   +  S +V    H  ++R  +   LP +  GN+ S F+T+  
Sbjct  237   RIEALSAFVWSRFLASTQGKPNSDIVYKVLHAVNLRTRMEPALPEHHFGNV-SRFATATT  295

Query  1070  A--AGEMDLARLVAELREGKERLQSRDNELVQEI------VTSLRTGEKPYENPDLDIYF  1225
             +   GE +    V ++R+    ++S D E +++I      V  L+   + +   ++  + 
Sbjct  296   SFEEGEEECYGFVGQMRDA---IKSVDGEYMRKILEGTAHVDYLKQRAEEFLKGEVVSFS  352

Query  1226  CSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFER  1405
              +SL ++P Y  DFGWG P  V       KN+   +D+ S GG EA V LK+ DM+ F+ 
Sbjct  353   FTSLCRFPLYETDFGWGKPIWVGSASLTFKNLVCFMDSGSSGGIEAWVNLKEEDMAKFQE  412

Query  1406  DEEL  1417
             DE+L
Sbjct  413   DEQL  416



>ref|XP_002267341.1| PREDICTED: vinorine synthase [Vitis vinifera]
 emb|CBI27536.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   215 bits (547),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 146/431 (34%), Positives = 220/431 (51%), Gaps = 45/431 (10%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN--RTDPTRVSDILQNALSRTLT  397
             IKPSSPTP  LR  +LS LDQ L+ ++IP++ FYP +   + D    S  L+  LS TL 
Sbjct  14    IKPSSPTPAHLRHFQLSFLDQVLSPIFIPIILFYPMDGDVKVDTIERSIWLKKTLSMTLV  73

Query  398   SFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHD  577
              FYP AGR+ DN  +DC D G  +F  +V C L + I +PD    +   P  L   +I D
Sbjct  74    QFYPLAGRVKDNLFIDCTDQGVPYFEAQVKCQLSEFICNPDPMQLSKFVPHAL--DDIVD  131

Query  578   GGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSVF  757
               LA+ Q++ F CGGIA+   + HKV D  +V  F+  W A  R     + P F   ++F
Sbjct  132   IVLAI-QVNIFKCGGIAIGVCISHKVADASSVVTFVNGWAAVARRDTHMVCPQFGLANLF  190

Query  758   PTL------PSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKN----PT  907
             P +      PS  + K  I        + KRFVFS   +  L++  +++S  ++    PT
Sbjct  191   PPINLSGFNPSTGMTKEKI--------LTKRFVFSASSVAALREKYADQSTTEDLPRRPT  242

Query  908   RAEIVSALLYKCCVKA----AASRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTS  1063
             R E +SAL++   V      A  ++   ++H  ++R    PP  LP NS GNI+    T 
Sbjct  243   RIEALSALIWSRFVAVTHGMADPKKIYTILHAVNLRTRMDPP--LPENSFGNIIWFAITR  300

Query  1064  PAAAGEMDLAR--LVAELREGKERLQSRDNELVQEI------VTSLRTGEKPYENPDLDI  1219
             P   G  +  R  LV ++RE  E++   D + ++++      +  L+   +     +++ 
Sbjct  301   PCIDGMKEGKRHALVNQMREAIEKI---DGDYIKKLPEGIKHLNFLKERAERVTKGEIES  357

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQ-SGGGFEALVMLKKTDMSG  1396
             +  +S  ++P Y ADFGWG P  V     P KN+   ID+  + GG EA + L + DM  
Sbjct  358   FRFTSFCRFPVYEADFGWGKPKWVGSGSLPFKNLVIFIDSSGTNGGIEAWINLVEEDMDK  417

Query  1397  FERDEELLRFA  1429
             F+ DEELL F 
Sbjct  418   FQGDEELLSFV  428



>ref|XP_004298096.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=439

 Score =   215 bits (547),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 142/423 (34%), Positives = 230/423 (54%), Gaps = 27/423 (6%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQAL-TSMYIPLVFFYP-NNNRTDPTRVSDI--  367
             + I  R L+KPS+PTP  L+  KL+LLDQ + +++Y  ++ FYP NNN    T VS+   
Sbjct  1     MEIVSRKLVKPSAPTP-HLKTFKLTLLDQRMPSNLYGKILLFYPGNNNNNSATLVSERSN  59

Query  368   -LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAF  544
              LQ +LS+TL SFYP AG+L D+ ++DCND GA F   ++NC++ D+++ PD +      
Sbjct  60    NLQKSLSKTLVSFYPLAGQLKDDVSIDCNDEGAYFIEAKINCSISDVLSQPDPNLLEQFV  119

Query  545   PAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLN  724
             P     A   +  + + QL+ F CGGIAV   + HK+ D  ++  F+G W A  R  ++ 
Sbjct  120   PCTND-AEALNVMITLIQLTVFKCGGIAVGTCISHKITDASSMFTFLGSWTADARG-EIG  177

Query  725   LSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLK---DVVSEESGV  895
             + P F+  S+ P  PS    +P    +   + V +RFVFS  K+  LK     + ++ G 
Sbjct  178   VLPVFIEPSLMP--PSSTPIRPTPGFRGVQNFVTRRFVFSHSKMASLKAESSTLLQKLGH  235

Query  896   KNP-TRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPL--GLPCNSAGNILSTF  1054
               P T  E+V+A+L+KC + ++ S     RPS++    ++R  +   LP N+ GN++  F
Sbjct  236   NAPSTDVELVTAILWKCAIASSQSILGRPRPSLMSQVVNLRNRMVPRLPENTMGNLIFDF  295

Query  1055  STSPAAAGEMDLARLVAELREG-KERLQSRDNELVQE-----IVTSLRTGEKPYENPDLD  1216
                   + + +L  +VA +R+G K+    + N  + E     +  SL   ++      + 
Sbjct  296   HVLIEESNK-ELPEMVANMRKGFKDFCSHKANRFIGEDAVSVLFDSLEEEDELITKMGVT  354

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             I+  +S+  +P Y  DFGWG P   +   G + N+F LID + G   EA V L++ +M+ 
Sbjct  355   IFRFASICGFPLYDMDFGWGKPIWATNRPGSLNNLFTLIDTKGGEDIEAWVNLEQQEMAI  414

Query  1397  FER  1405
             FER
Sbjct  415   FER  417



>ref|XP_010554168.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554169.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554170.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554172.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554173.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554174.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554175.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554176.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554177.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554178.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554179.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554180.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554181.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554182.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554183.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554184.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554185.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554186.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554187.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554188.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554189.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554190.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554191.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554192.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554193.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554194.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554195.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554196.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554198.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554199.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554200.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554201.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554202.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554203.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554204.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554205.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554206.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554207.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554208.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554209.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554210.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554211.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554212.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554213.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554214.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554215.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554216.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554217.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554218.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554219.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
Length=462

 Score =   215 bits (548),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 138/425 (32%), Positives = 210/425 (49%), Gaps = 27/425 (6%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTL  394
             R +I+PSSPTP  LR  KLSLL+Q   +++ P+VFFY ++      ++   L+ +LS TL
Sbjct  31    RDIIRPSSPTPDHLRHFKLSLLEQLGPTIFGPMVFFYSSSRFRQAEQLQK-LKKSLSETL  89

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL--PWAN  568
             + FYP AGRL  N ++DCND+G +F     + +L   +  P  +      P  +  P A 
Sbjct  90    SHFYPLAGRLKGNVSIDCNDSGVDFLEAEADSSLSGFLEEPYLEGLQQLIPTQVDSPEAR  149

Query  569   IHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS--PNFV  742
                  L + Q S F CGGIA+   + HK+ D  ++   M  W A +    +     P + 
Sbjct  150   TK---LLLAQASFFRCGGIALGVCLSHKIADASSIGLIMKSWAAMSARGSMKTVGFPVYN  206

Query  743   SDSVFPTLPSGPLD-KPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEI  919
             + ++FP       D  P++  +I    V KRFVF    +  L+   S  S V  PTR E 
Sbjct  207   TANLFPPGNFSDTDPAPVVEPEIMKKTVSKRFVFGASDIQSLQ-AKSASSEVSQPTRVEA  265

Query  920   VSALLYKCCVKA----AASRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAAA  1075
             VSAL++KC +KA    + + +PS++ H  ++R    PPL  P  S GN++S F+      
Sbjct  266   VSALIWKCAMKATRTVSGTPKPSVIAHATNIRRLVSPPL--PETSIGNLVSYFAARAEEE  323

Query  1076  GEMDLARLVAELREGKERLQSR-------DNELVQEIVTSLRTGEKPYENPDLDIYFCSS  1234
              +  L  LV ++R+ K+  + +       + E    I    +       + + D Y  SS
Sbjct  324   NQTKLQNLVFQIRKAKQNFRDKHVPKLIGNPEAPDIICNHQKEAGDMIASGEYDFYIFSS  383

Query  1235  LGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEE  1414
               ++  Y  DFGWG P  V +P    KNM  L D +  GG E  V L + +M  FE+D E
Sbjct  384   ACRFDLYETDFGWGKPTWVGVPSVQQKNMMVLFDTKEPGGIEVWVNLHEEEMELFEKDSE  443

Query  1415  LLRFA  1429
              + FA
Sbjct  444   FIEFA  448



>ref|XP_008389785.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=431

 Score =   214 bits (545),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 140/434 (32%), Positives = 228/434 (53%), Gaps = 43/434 (10%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + + E+  IKPS PTPP LR H+ S LDQ  T +++P++ FY N++  D    SD ++ +
Sbjct  3     IEVIEKACIKPSMPTPPHLRKHEFSFLDQIATPIFMPMILFYNNDHGNDAITYSDKVKQS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS+TLT +YP AGR+++NA V+CND GA + + RV   L D+I+ PD +  N   P  L 
Sbjct  63    LSKTLTQYYPLAGRVIENAYVNCNDQGAPYVQARVRSPLSDVISQPDPNQLNQLLPCKLD  122

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH---------  712
               N+ D  LAV Q++ FDCGG+A+   + HKV D  ++  F+  W + +R          
Sbjct  123   --NVGDLVLAV-QVNVFDCGGMAIXICISHKVADALSLIMFLNSWASISRGDCNIKNSTV  179

Query  713   --PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSE-  883
               P  +L+ +F   S+    PS  + +  I        V KRFVFS   +  L+   ++ 
Sbjct  180   SPPIFDLATHFPPRSISGFKPSTGITREKI--------VTKRFVFSASTVASLRSKYTDN  231

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASR-RPSIL---VHYADMR----PPLGLPCNSAGN  1039
             ++  + PTR E +SA ++   + +   +  P+ L   +H  ++R    PP  LP    GN
Sbjct  232   KTNERKPTRIEALSAFIWARVIASTQGKPNPNTLYKVLHAVNLRTRMDPP--LPEYHFGN  289

Query  1040  ILSTFSTSPA-AAGEMDLARLVAELREGKERLQSRDNELVQEI------VTSLRTGEKPY  1198
             +     +SP+   GE     +V ++RE    +++ D + + +I      +  L+   + +
Sbjct  290   VSRFAMSSPSFDEGEDMCYGMVGQMREA---IKTIDGDYMAKIKDGNAHLKFLKQRAEEF  346

Query  1199  ENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLK  1378
                ++  +  +SL ++P Y  DFGWG P  V+      KN+   +D  S GG E  V LK
Sbjct  347   MKGEVASFSFTSLCRFPLYETDFGWGKPVWVASASLTFKNLVVFMDAGSSGGIEVWVNLK  406

Query  1379  KTDMSGFERDEELL  1420
             + DM+ F+ DE+LL
Sbjct  407   EEDMAKFQDDEQLL  420



>ref|XP_010090836.1| Vinorine synthase [Morus notabilis]
 gb|EXB40961.1| Vinorine synthase [Morus notabilis]
Length=462

 Score =   215 bits (547),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 153/464 (33%), Positives = 231/464 (50%), Gaps = 71/464 (15%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN--------------NN  337
             + I +R  IKPSSPTP  LR H+LS+LDQ    +YIP++ FYP               NN
Sbjct  8     VEIVQRERIKPSSPTPQDLRIHELSILDQLALVIYIPIILFYPRRTIDDKRHHYSNCVNN  67

Query  338   RTDPTRVSDILQNALSRTLTSFYPYAGRL-LDNATVDCNDAGAEFFRVRVNCTLLDIINH  514
               D    S  L+++LS+TLT FYP AGR+  D   V+CND GAE    RV+  + +I+  
Sbjct  68    NIDMIIYS--LKSSLSKTLTLFYPLAGRIKQDYTVVECNDEGAELTEARVDHPMSEILER  125

Query  515   --PDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMG  688
               PD +A        +      DG L   Q++ F CGG A+  ++ HKV D  T+  F+ 
Sbjct  126   PAPDPEALRKLLAVDVESKEASDGALLHVQINVFACGGTAIGVSLSHKVADASTLSMFIS  185

Query  689   HWVAATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLK  868
              W A  +   +   P F S S+FP    G     +      + C+ +R+VF    + +LK
Sbjct  186   TWAATAKLNHIEALPEFSSASLFPA-RHGHHQLGLNKELAREKCLMRRYVFDASNIAILK  244

Query  869   DVVSEESGVKNPTRAEIVSALLYKCCV---------KAAASRRPSILVHY---ADMR---  1003
                S  S V++PTR E+VSA+++KC +         K ++S   SI V +    ++R   
Sbjct  245   -AKSASSSVESPTRVEVVSAVIWKCALGVSRAKFRGKYSSSSTNSIYVQFRQDVNIRRRT  303

Query  1004  -PPLGLPCNSAGNILSTFSTSPAAAGEMDLAR-----------------LVAELREGKER  1129
              PP  LP   AGN++ +FS       + DL R                 LV+ELR+G E 
Sbjct  304   SPP--LPEILAGNLVGSFS------AKHDLLRDHIADDDHDDPDDGVQVLVSELRKGIEE  355

Query  1130  LQSRDNELV----QEIVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSM  1297
             ++   ++ +    ++++ +L+   K Y++    +  CSS   +  Y ADFGWG P  VS+
Sbjct  356   MKEDYSKGIIFGSEKMLKALKESRK-YDH----VVNCSSWCGFKFYEADFGWGLPFWVSL  410

Query  1298  PKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
                 MKN+  L+D + G G EA + L + D++  E +E L  FA
Sbjct  411   ASVAMKNIVVLLDARDGKGIEAWLTLGEDDVALLESNEVLRAFA  454



>ref|XP_011041291.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=463

 Score =   215 bits (547),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 152/429 (35%), Positives = 220/429 (51%), Gaps = 37/429 (9%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD------PTRVSDILQNALS  385
             +KPSSPTP  LR  KLSLLDQ +T  Y P++ FYP N +        P R+ ++L+ +LS
Sbjct  11    VKPSSPTPSPLRNFKLSLLDQLVTVPYAPILLFYPMNKKASTSYLDVPKRL-ELLKKSLS  69

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG-LPW  562
              TLT FYP AG++ D  ++DCND GA     +VNC L + +  PD    N  FP   LP 
Sbjct  70    ETLTQFYPLAGKIKDELSIDCNDEGAYDVETQVNCHLCEFLRQPDLLLANQFFPCELLPT  129

Query  563   ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLN-LSPNF  739
              +     +A FQ++ F+CGGI +   + H+V DG  +  F+  W A  +  K   + P F
Sbjct  130   ESTAVTYVANFQVNVFECGGIVIGMCISHRVVDGAALSTFLKAWSATAKGSKEAIIYPEF  189

Query  740   VSDSVFPTLPSGPLDKP--MIPSKIED-DCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
             ++ S+FP       D    M  S ++   C+ KRFVF    +  LK   +   G+K PTR
Sbjct  190   IASSLFPANDLWLRDSAIVMFGSLLKKGQCMTKRFVFDASAISNLK-AQAAILGLKCPTR  248

Query  911   AEIVSALLYKCCVKAA----ASRRPSILVHYADMRPPL--GLPCNSAGNILSTFSTSPAA  1072
              E+VS+ L+KC + A+     S+RPS+L HY ++R  +   L  NS GN L   +     
Sbjct  249   VEVVSSFLWKCLMAASEEWRGSQRPSLLTHYVNLRRKMEPKLSGNSMGNFLWLAAAKYTN  308

Query  1073  AGEMDLARLVAELREGKERLQS---------RDNELVQEIVTSLRTGEKPYENPD-LDIY  1222
               +  L  LV E+R+   ++ S         + N L+ E   SL+ G   + + D +D  
Sbjct  309   KSKPGLKDLVGEMRKAISKIDSDFVEHIKGDKGNALMDE---SLK-GIGAFGSGDGVDYL  364

Query  1223  FCSSLGKYPAYTADFGWGWPCKVS---MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
               SS  K+  Y  DFGWG P  VS   +      N+ FL+D +   G EA V L + DM+
Sbjct  365   GFSSWCKFGFYDTDFGWGKPVWVSSFGLSCSLTMNLVFLVDTRC-DGIEAFVTLNEKDMT  423

Query  1394  GFERDEELL  1420
               E + EL 
Sbjct  424   ILEGNLELF  432



>ref|XP_002300646.2| hypothetical protein POPTR_0002s01180g, partial [Populus trichocarpa]
 gb|EEE79919.2| hypothetical protein POPTR_0002s01180g, partial [Populus trichocarpa]
Length=451

 Score =   214 bits (546),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 146/433 (34%), Positives = 223/433 (52%), Gaps = 41/433 (9%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD------PTRVSDILQNALS  385
             ++PSSPTPP LR  KLSLLDQ +   Y PL+ +YP N+ +       P R+  +L+ +LS
Sbjct  11    VRPSSPTPPHLRNFKLSLLDQLIPVPYAPLLLYYPMNDNSGASNLDVPKRLG-VLKKSLS  69

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG-LPW  562
              TLT FYP AG++ D  ++DCND GA +   +VNC L + +  PD    N  FP   LP 
Sbjct  70    ETLTHFYPLAGKIKDELSIDCNDEGAYYVEAQVNCHLSEFLRQPDLLLVNQFFPCELLPK  129

Query  563   ANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLN-LSPNF  739
             A  H   +A FQ++ F+CGGIA+   + H + DG  +  F+  W A  +  +   + P F
Sbjct  130   AVTH---VANFQVNVFECGGIAIGICISHLILDGAALSTFLKAWSATAKGSREAIIYPEF  186

Query  740   VSDSVFPTLPSGPLDKPMIPSK---IEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTR  910
             +  S+FP       D  ++       + + V KRFVF    + +L+   +   GVK PTR
Sbjct  187   IPSSLFPANDLWLRDSAVVMFGSLFKKGNGVTKRFVFDASSISILR-AQAASLGVKCPTR  245

Query  911   AEIVSALLYKCCVKAA-----ASRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTS  1063
              E+VS+ L+KC + A+     + RRPS+L H  ++R    P LG   NS GN L   +  
Sbjct  246   VEVVSSFLWKCIMAASEEWRGSQRRPSLLTHLVNLRRKMEPKLGE--NSMGNFLWLAAAK  303

Query  1064  PAAAGEMDLARLVAELREGKERLQS---------RDNELVQEIVTSLRTGEKPYENPDLD  1216
                   ++L  LV E+R+   ++ +         + N L ++ +  +  GE   ++  +D
Sbjct  304   CMNKSRVELNDLVGEVRKAISKIDADFVEQIKGDKGNSLAEQTLKEI--GEFGSKD-GVD  360

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVS--MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
                 SS  ++  Y ADFGWG P  +S     G +     ++ +    G EA V L + DM
Sbjct  361   YLGFSSWCRFGFYDADFGWGKPVWISSFAVSGSLTMNLVILADTRCDGIEAFVTLDEKDM  420

Query  1391  SGFERDEELLRFA  1429
             +  E + ELL+FA
Sbjct  421   TILEGNPELLKFA  433



>ref|XP_006431936.1| hypothetical protein CICLE_v10001158mg [Citrus clementina]
 gb|ESR45176.1| hypothetical protein CICLE_v10001158mg [Citrus clementina]
Length=445

 Score =   214 bits (545),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 143/433 (33%), Positives = 213/433 (49%), Gaps = 36/433 (8%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALS  385
             +  R  IKP++PTP  LR  KLSL+DQ    +Y+  +F Y  +      ++S  L+ +LS
Sbjct  9     VRARESIKPANPTPEHLRNFKLSLMDQITFPVYVSTIFLYKADGNVKADQISQCLKLSLS  68

Query  386   RTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWA  565
             +TLT FYP AGR+ D+ +++ ND GAE+     N  L + +  PD +      P     +
Sbjct  69    KTLTKFYPLAGRVKDDFSIESNDEGAEYVEALANGFLFEYLQKPDQNLLRDFHPFNYVES  128

Query  566   NIHDGGLAVF--QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKL------  721
                  G  +   Q + F CGG+A++   CHK+ DG ++R F+  W    R          
Sbjct  129   PAASNGCPMLRVQATFFKCGGLAITVCTCHKLIDGASLRIFVDSWATTARADNQLSGSSN  188

Query  722   --NLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
                ++P FV+ ++FP   S        PS I       RFVF  +K+D LK  V+  + V
Sbjct  189   NKEVTPRFVTSTIFPASESF----VAAPSHI-SPVKANRFVFDAKKIDELKAKVASPT-V  242

Query  896   KNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILST  1051
               PTR E ++AL++KC   A+ S     RPS+ V   D+R    PP  LP NS GN ++ 
Sbjct  243   PRPTRVEALTALIWKCARAASRSNLGYSRPSLSVQAIDVRAVAEPP--LPDNSVGNSVAY  300

Query  1052  FSTSPAAAGEMDLARLVAELREGKERLQSR------DNELVQEIVTSLRTGEKPYENPDL  1213
              +   +      L  LV  LR+ K   +         N+ + +I  S++     +E  ++
Sbjct  301   LTAQASEKETETLQDLVCSLRKAKAEFRRNGLKTLLKNKSIFDIPESIK---DKFEKDEI  357

Query  1214  DIYFCSSLGKYPAY-TADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             D Y  SSL  +P Y  ADFGWG P  ++MP   + N+  ++      G E  V L   DM
Sbjct  358   DFYTFSSLVNFPYYEVADFGWGKPVHMTMPNYWVSNLIIIMAANDAKGIEVWVTLSPEDM  417

Query  1391  SGFERDEELLRFA  1429
             + FE DEELL FA
Sbjct  418   AFFEGDEELLAFA  430



>ref|XP_008353036.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=429

 Score =   213 bits (542),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 140/432 (32%), Positives = 222/432 (51%), Gaps = 41/432 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + + ER  IKPS PTPP L  H+ S LDQ  T +++P++FFY NN+  D    SD ++ +
Sbjct  3     IEVIERAYIKPSMPTPPHLCKHEFSFLDQIATHIFMPMIFFYNNNHVNDARTYSDKVKQS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS  LT +YP AGR+++NA +DCND GA + + RV   L D+I+  D +  N   P  L 
Sbjct  63    LSEILTQYYPLAGRIIENAFIDCNDQGAPYVQARVRSPLSDVISEADPNQLNKLLPCELD  122

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH---------  712
                + D  LA+ Q+S FDCGG+A+   + HKV D  +   F+  W + +R          
Sbjct  123   --KVGDLVLAI-QVSMFDCGGMAIGICISHKVADALSFITFLNSWASISRGDCNITNISP  179

Query  713   PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
             P  +L+  F   S+    PS  + +  I        V KRFVFS   +  L+   ++   
Sbjct  180   PIFDLATLFPPRSISGFKPSTGIAREKI--------VTKRFVFSASTIASLRSKYTDNKA  231

Query  893   VK-NPTRAEIVSALLYKCCVKAAASR-RPSIL---VHYADMR----PPLGLPCNSAGNIL  1045
              +  P+R E +SA ++   + +   +  P+ L   +H  ++R    PP  LP    GN+ 
Sbjct  232   NEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVLHTVNLRTRMDPP--LPEYHFGNVS  289

Query  1046  STFSTSPA-AAGEMDLARLVAELREGKERLQSRDNELV------QEIVTSLRTGEKPYEN  1204
                 +SP+   GE     +V+++R+    +++ D + +       E++  L+   + +  
Sbjct  290   RFVMSSPSFDEGEDTCYGIVSQMRQA---IKTIDGDYIAKIKEGNELLEFLKQRMEEFMK  346

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
              ++  +  +SL ++P Y  DFGWG P  V     P KN+   ID  S GG EA V LK+ 
Sbjct  347   GEVASFSFTSLCRFPLYETDFGWGKPVWVGSVSFPFKNLVSFIDAGSSGGIEAWVNLKEE  406

Query  1385  DMSGFERDEELL  1420
             DM+ F+ DE+LL
Sbjct  407   DMAKFQHDEQLL  418



>ref|XP_008340164.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   213 bits (542),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 145/430 (34%), Positives = 219/430 (51%), Gaps = 43/430 (10%)
 Frame = +2

Query  227   KPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTLTSFY  406
             KPSSPTP  L+ +KLSLLDQ     Y+P+V FY  +   D T + D L+ +LS TLT FY
Sbjct  14    KPSSPTPDHLKXYKLSLLDQIAPIFYVPVVLFYSASVNIDDTTIVDRLKKSLSETLTCFY  73

Query  407   PYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGL  586
             P AGR+  NA+VDC D    F + R +  L +I+  P+ D      P   P+    D  +
Sbjct  74    PLAGRIEGNASVDCEDGVVVFTKARAHIQLSEILKTPEMDLVQQLLPLD-PYNIRTDKXV  132

Query  587   AVF--QLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSVFP  760
             A    QL+ FDCGG+ +   + HK+ DG T+ +F+  W   +R    N++P+  S ++FP
Sbjct  133   AAMAVQLNXFDCGGMGIGICLSHKIADGATLSSFLDAWATRSRGISENITPSLNSATMFP  192

Query  761   TLPSGPLDKPM-IPSKI--EDDCVQKRFVFSGEKLDLLKDVVSEESGV----KNPTRAEI  919
                  P DK + +P+ +   ++ V KRFVF    L  LK  V    G+    + PTR E 
Sbjct  193   -----PRDKEIFMPTNLIKRENIVTKRFVFDASSLAKLK--VKASKGLCTDDRAPTRVEA  245

Query  920   VSALLYKCCVKAA----ASRRPSILV-HYADMR----PPLGLPCNSAGNILSTFSTSPAA  1072
             ++AL+ K  +          RPS+ + H  ++R    PP  LP +S GNI   F+ +   
Sbjct  246   LTALICKSSMNTKNGTLGKGRPSMAISHVVNLRERXAPP--LPEHSFGNIWR-FAVASIM  302

Query  1073  AGEM--DLARLVAELREGKERLQSRDNELVQEI---------VTSLRTGEKPYENPDLDI  1219
               E   +L      LR+   ++   D++ V+++            L+   +     +++ 
Sbjct  303   NDESNPELHDFXVRLRKVIRKI---DDDYVRKLQGEDGFTHACEPLKETSELVSEGEVEF  359

Query  1220  YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGF  1399
             +  SS  ++  Y  DFGWG P    +P  P+KN+  L+ + SG G EA V L + DM+ F
Sbjct  360   FRFSSWIRFSLYNTDFGWGKPTWACIPNVPIKNVVILLSSSSGDGIEAWVTLDEEDMAKF  419

Query  1400  ERDEELLRFA  1429
             ERD ELL F 
Sbjct  420   ERDHELLEFV  429



>ref|XP_008368264.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=429

 Score =   213 bits (541),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 139/432 (32%), Positives = 222/432 (51%), Gaps = 41/432 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + + ER  IKPS PTPP L  H+ S LDQ  T +++P++FFY NN+  D    SD ++ +
Sbjct  3     IEVIERAYIKPSMPTPPHLCKHEFSFLDQIATHIFMPMIFFYNNNHVNDARTYSDKVKQS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS  LT +YP AGR+++NA +DCND GA + + RV   L D+I+  + +  N   P  L 
Sbjct  63    LSEILTQYYPLAGRIIENAFIDCNDQGAPYVQARVRSPLSDVISEABPNQLNKLLPCELD  122

Query  560   WANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH---------  712
                + D  LA+ Q+S FDCGG+A+   + HKV D  +   F+  W + +R          
Sbjct  123   --KVGDLVLAI-QVSMFDCGGMAIGICISHKVADALSFITFLNSWASISRGDCNITNISP  179

Query  713   PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESG  892
             P  +L+  F   S+    PS  + +  I        V KRFVFS   +  L+   ++   
Sbjct  180   PIFDLATLFPPRSISGFKPSTGIAREKI--------VTKRFVFSASTIASLRSKYTDNKA  231

Query  893   VK-NPTRAEIVSALLYKCCVKAAASR-RPSIL---VHYADMR----PPLGLPCNSAGNIL  1045
              +  P+R E +SA ++   + +   +  P+ L   +H  ++R    PP  LP    GN+ 
Sbjct  232   NEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVLHTVNLRTRMDPP--LPEYHFGNVS  289

Query  1046  STFSTSPA-AAGEMDLARLVAELREGKERLQSRDNELV------QEIVTSLRTGEKPYEN  1204
                 +SP+   GE     +V+++R+    +++ D + +       E++  L+   + +  
Sbjct  290   RFVMSSPSFDEGEDTCYGIVSQMRQA---IKTIDGDYIAKIKEGNELLEFLKQRMEEFMK  346

Query  1205  PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKT  1384
              ++  +  +SL ++P Y  DFGWG P  V     P KN+   ID  S GG EA V LK+ 
Sbjct  347   GEVASFSFTSLCRFPLYETDFGWGKPVWVGSVSFPFKNLVSFIDAGSSGGIEAWVNLKEE  406

Query  1385  DMSGFERDEELL  1420
             DM+ F+ DE+LL
Sbjct  407   DMAKFQHDEQLL  418



>ref|XP_011034885.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=448

 Score =   213 bits (541),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 144/429 (34%), Positives = 219/429 (51%), Gaps = 34/429 (8%)
 Frame = +2

Query  224   IKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRT-----DPTRVSDILQNALSR  388
             ++PSSPTPP LR  KLSLLDQ +   Y PL+ +YP N+ +     D  R   +L+ +LS 
Sbjct  11    VRPSSPTPPHLRNFKLSLLDQLIPVPYAPLLLYYPMNDNSGASNLDVHRRLGVLKKSLSE  70

Query  389   TLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAG-LPWA  565
             TLT FYP AG++ D  ++DCND GA +   +VNC L + +  PD    +  FP   LP A
Sbjct  71    TLTHFYPLAGKIKDELSIDCNDEGAYYVEAQVNCHLSEFLRQPDLLLAHQFFPCELLPKA  130

Query  566   NIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLN-LSPNFV  742
               H   +A FQ++ F+CGGIA+   + H + DG  +  F+  W A  +  K   + P F+
Sbjct  131   VTH---VANFQVNVFECGGIAIGICISHLILDGAALSTFLKAWSATAKGSKEAIIYPEFI  187

Query  743   SDSVFPTLPSGPLDKPMIPSKI---EDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRA  913
               S+FP       D  ++       +   V KRFVF    +  L+   +   GVK PTR 
Sbjct  188   PSSLFPANDLWLRDSAVVMFGSLFKKGKGVTKRFVFDASSISSLR-AQAASLGVKCPTRV  246

Query  914   EIVSALLYKCCVKAA----ASRRPSILVHYADMRPPL--GLPCNSAGNILSTFSTSPAAA  1075
             E+VS+ L+KC + A+     S+RPS+L H  ++R  +   L  NS GN L   +      
Sbjct  247   EVVSSFLWKCIMAASEEWRGSQRPSLLTHLVNLRRKMEPNLGENSIGNFLWLAAAKCMNK  306

Query  1076  GEMDLARLVAELREGKERLQS---------RDNELVQEIVTSLRTGEKPYENPDLDIYFC  1228
               ++L  LV E+R+   ++ +         + N L ++ +  +  GE   ++  +D    
Sbjct  307   SRVELDDLVGEVRKAISKIDADFVGQIKGDKSNSLAEQTLKEI--GEFGSKD-GVDYLGF  363

Query  1229  SSLGKYPAYTADFGWGWPCKVS--MPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFE  1402
             SS  ++  Y ADFGWG P  +S     G +     ++ +    G EA V L + DM+  E
Sbjct  364   SSWCRFGFYDADFGWGKPVWISSFAVSGSLTMNLIILADTRCDGIEAFVTLDEKDMTILE  423

Query  1403  RDEELLRFA  1429
              + ELL+FA
Sbjct  424   DNPELLKFA  432



>ref|XP_007037901.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
 gb|EOY22402.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
Length=432

 Score =   212 bits (540),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 144/427 (34%), Positives = 217/427 (51%), Gaps = 23/427 (5%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  +  IKP+ PTP  LR  KLS LDQ    +YIP+V FYP     D    S +L+ +
Sbjct  6     IQIVSKETIKPAIPTPHHLRNLKLSFLDQLAPPIYIPIVLFYPAKQNVDLLERSLLLKKS  65

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS+TLT FYP AG + ++ T +CND G E+F  +V C L+D+  +PD +  N+  P   P
Sbjct  66    LSKTLTQFYPLAGTMREDFTFECNDEGVEYFETKVPCKLVDVTENPDVNVLNLFLPFE-P  124

Query  560   WANIHDGGLAV---FQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS  730
               N  +    V    Q + F CGG+A+   + H + DG +V  F+  W A +R P   + 
Sbjct  125   QQNCIESKKQVPLAIQYNIFKCGGVAIGIRLSHLIADGTSVITFVNAWAAMSREPGEVII  184

Query  731   PNFVSDSVFPTLPSGPLDKPMIPSKI---EDDCVQKRFVFSGEKLDLLKDVVSEESG--V  895
             P F + + FP     P D  M    I   ++  V KRFVF    + +L++  S   G  V
Sbjct  185   PIFEAATHFP-----PRDISMFRPSIGITKEKIVTKRFVFDKPSITVLREKASSRDGSQV  239

Query  896   KNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPL--GLPCNSAGNILSTFS  1057
             K PTR E +S+ ++   +  A ++    +    VH  ++R  +   LP +S GN      
Sbjct  240   KTPTRVEAISSFIWSRQMAIAKTKPERAKLYAAVHAVNLRERMVPSLPKHSFGNFWRMAI  299

Query  1058  TSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEKPYEN-PDLDIYFC--  1228
              +  A  E D   LV+ +R    ++ +   +++Q+    L+T +   E     ++ FC  
Sbjct  300   ATFPAEMEQDYHVLVSHMRNAISKIDNNYVKMLQDGDRYLKTMKMVSEQFSKSEVEFCNF  359

Query  1229  SSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERD  1408
             +S  ++P Y  DFGWG P     P  P KN+  L+ ++ G G EA V L + DM+ FERD
Sbjct  360   TSWCRFPVYEVDFGWGKPAWACSPSRPYKNLVILMSDKGGEGVEAWVNLLEEDMAIFERD  419

Query  1409  EELLRFA  1429
              ELL FA
Sbjct  420   PELLSFA  426



>ref|XP_007018005.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY15230.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   213 bits (541),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 145/445 (33%), Positives = 216/445 (49%), Gaps = 52/445 (12%)
 Frame = +2

Query  221   LIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDP--------TRVSDILQN  376
              IKP+SPTP  LR H++S LDQ +  +Y+P+VFFY N   + P        ++ S +L+ 
Sbjct  12    FIKPASPTPHHLRTHRISFLDQFIPLIYVPMVFFYMNQETSIPLTDIIAFNSKRSQLLKQ  71

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS TLT FYP+AGR+ D  ++DCND GA +   RV+ +L + + HPD+       PA  
Sbjct  72    SLSETLTLFYPFAGRIKDCLSIDCNDEGAYYVEARVDWSLNEFLRHPDSSFIPELLPAEA  131

Query  557   PWANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS-  730
              W     GG +A+ Q++ F CGGI +   + H + DG     F+  W A TR      + 
Sbjct  132   SWTATSAGGYVAMIQVTNFACGGIVIGTFLSHMIADGPAATTFLRCWAAVTRKSGEEAAY  191

Query  731   PNFVSDSVFPTLPSGP-------LDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEES  889
             PNF +  VFP   + P       L  P + + I   C  +R VF    +  LK   +  S
Sbjct  192   PNFDASFVFPQSEAYPKEATILALFTPFLKTGI---CWSRRIVFDASAIASLK-AKTASS  247

Query  890   GVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNIL  1045
              V +PTR E VSALL KC +    ++    +P+++ H  ++R    PP  +P NS GN L
Sbjct  248   SVPDPTRVEAVSALLCKCLMATFKAKSDFQKPTVINHAVNLRRRAVPP--VPKNSMGNFL  305

Query  1046  STFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEIV-----------TSLRTGEK  1192
                +T+     E +L  LV  LR   + ++  D + V+ +                 G+ 
Sbjct  306   -CMATALVMGEETELDDLVCHLR---KEIRKADGDFVKSLQGEGGLLKFCEHIEEMMGKA  361

Query  1193  PYENP-DLDIYFCSSLGKYPAYTADFGWGWPCKVSM-----PKGPMKNMFFLIDNQSGGG  1354
              Y    + D    +S   +  Y  DFGWG P  V+       +    N    +D + G G
Sbjct  362   SYGAAGETDFIGFTSWCNFGLYEIDFGWGKPAWVTCTASNKSETVFSNTVVFMDTRLGDG  421

Query  1355  FEALVMLKKTDMSGFERDEELLRFA  1429
              EA V L + DM+  E++EELL F 
Sbjct  422   IEAWVFLDEQDMAKLEQNEELLAFG  446



>ref|XP_011101100.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=462

 Score =   213 bits (541),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 147/443 (33%), Positives = 228/443 (51%), Gaps = 40/443 (9%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPN--NNRTDP---TRVSDIL  370
             I  R  IKPSSPTP   R +KLSLLDQ +  +Y+PLV +YPN  N   DP   ++ + IL
Sbjct  7     IISREHIKPSSPTPLEQRTYKLSLLDQIVPPIYVPLVLYYPNLENTPKDPDFISQTTQIL  66

Query  371   QNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPA  550
             + +LS TLT FYP AGR+ D  ++DCND G  F   + N  L D + +PD+       P+
Sbjct  67    RQSLSATLTRFYPLAGRIKDKLSIDCNDEGVPFVVTKFNTRLSDFLKNPDSQVCRGHIPS  126

Query  551   GLPWANIHDG-GLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNL  727
              L WA    G  +A+ Q++ FDCGGIAV +   HKV DG T+  FM  W AA R     +
Sbjct  127   PLTWAEPGPGSNVALIQVNFFDCGGIAVGSLFLHKVADGVTIGTFMKAWAAAARGSVETV  186

Query  728   SPNFVSDSVFPTLPSGPLDKPMIPSKIE----DDCVQKRFVFSGEKLDLLKDVVSEESGV  895
             SP++ + S FP   +   +  +  +  +       V +R+VF    +  L+  +S   G+
Sbjct  187   SPDYAAQSFFPQNETMKRESHLFSAMRQYFKFGKTVMRRYVFDALAISALRAKLSSTEGL  246

Query  896   KN-PTRAEIVSALLYKCCVKA---AASRRP--SILVHYADMR----PPLGLPCNSAGNIL  1045
             K  P++ E+VSALL+KC + A   +++  P  S++ H  +MR    PP   P +S GN +
Sbjct  247   KQRPSKVEVVSALLWKCFIIASNKSSNNHPTTSLVTHGVNMRRKAEPP--FPEHSFGNFV  304

Query  1046  STF-STSPAAAGEMDLARLVAELREGKERLQSRDNELVQEI------VTSLRTGEKPYEN  1204
                 ++S     + DL  L +++R     + + D E V+ +      +   +  E+ ++ 
Sbjct  305   WLVPASSTNDHTDADLENLFSKVR---NTISTVDVEFVKRMQGESGFLGYCKNLEESWKG  361

Query  1205  --PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKG------PMKNMFFLIDNQSGGGFE  1360
                + D    SS   +  Y+ DFG G P  +S          P  N+ +L+D + GGG E
Sbjct  362   FPENADYLAISSWCNFGLYSIDFGLGRPIWISKCDAGSEVDWPFINVLWLMDTRQGGGIE  421

Query  1361  ALVMLKKTDMSGFERDEELLRFA  1429
             A + L +  +  F++ +EL   A
Sbjct  422   AWLTLDEHYIEAFDKIQELRDLA  444



>ref|XP_008454499.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis melo]
Length=451

 Score =   212 bits (540),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 145/440 (33%), Positives = 221/440 (50%), Gaps = 36/440 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             L I  +  IKP S TPP L+   LSL DQ    MYI L++FY N++         +L+++
Sbjct  4     LQIVSKETIKPLSATPPQLKKLPLSLFDQQAPKMYIHLLYFYYNHD-ISSGYSRQLLKDS  62

Query  380   LSRTLTSFYPYAGRLLDNA-TVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNV---AFP  547
             LS+ LT +YP+AGRL D+  +++CND GA     ++ C + + +N+ + + + +      
Sbjct  63    LSKALTFYYPFAGRLRDDGNSINCNDVGAIVSEAKLRCPMSEFMNNFNLEREEILKLTLS  122

Query  548   AGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH-----  712
               +   +     L   QL++F+CGG  +     HKV D  ++ NF+  W    R      
Sbjct  123   DDINGKDQRLNPLLCVQLTQFECGGEVMYVLCSHKVADLASLTNFINDWAFIARSSRDGN  182

Query  713   --PKLNLSPNFVSDSVFP--TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVS  880
               P LN  P F   S FP   L SG         + E+    KRFVF   K+  LK +V 
Sbjct  183   DPPTLNCPPQFNGASFFPPTKLESGGELNSRTERQYENGVSTKRFVFKSSKIASLKGMVC  242

Query  881   EESGVKNPTRAEIVSALLYKCCVKAAASRRPS----ILVHYADMR----PPLGLPCNSAG  1036
             E+  V+NPTR +I++A +YK  V A  S   S    IL+   ++R    PPL  P   +G
Sbjct  243   EK--VENPTRVQILTAFIYKAAVSAKESVTGSVPATILLQTINLRNRVDPPL--PATLSG  298

Query  1037  NILSTFS--TSPAAAGEMDLARLVAELREGKERL--------QSRDNELVQEIVTSLRTG  1186
             N++S F   +      EM+L  LV + +   E          +S +  L+Q +       
Sbjct  299   NVISWFIGLSRTQEKREMELWNLVGDTKRNFEEYCKTFPTDYRSEEWGLLQRLHAKESME  358

Query  1187  EKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEAL  1366
             ++     D  +Y CSS  K+P Y ADFG G P  +S+P+ P KNM  L+D++ G G EA+
Sbjct  359   DRMINEEDRSLYTCSSWCKFPIYEADFGRGKPGWISVPEFPWKNMILLMDSKDGEGIEAI  418

Query  1367  VMLKKTDMSGFERDEELLRF  1426
             V L K +M  F ++++LL F
Sbjct  419   VSLDKKEMEVFLQNQQLLSF  438



>ref|XP_003616843.1| Salutaridinol 7-O-acetyltransferase [Medicago truncatula]
 gb|AES99801.1| transferase family protein [Medicago truncatula]
Length=439

 Score =   211 bits (538),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 140/434 (32%), Positives = 216/434 (50%), Gaps = 37/434 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFY-PNNNRTDPTRVSDILQN  376
             + +  R  IKPSSPTP  L+ + LS +D  + S Y+PL++FY PN NR   ++ S  L+ 
Sbjct  3     IELLSRETIKPSSPTPSHLKLYPLSFIDNIVCSNYLPLLYFYNPNGNRDQNSKTSQ-LRK  61

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS+ L+ +Y +AGR+ D  T++CND G  F   +V   L +I+ +P     N  FP  L
Sbjct  62    SLSQLLSKYYHFAGRIKDKITIECNDQGVLFLVTKVKNKLSEIVQNPTEKLLNPLFPDEL  121

Query  557   PWANIH-DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH----PKL  721
              W  +         Q++ F CGG+ +S  + HK+GD  T+ NFM  W    +      K 
Sbjct  122   QWKEMDWRASFIAIQVNWFACGGMVISICISHKIGDAATIFNFMNDWAIIYQKFDEDEKD  181

Query  722   NLSPNFVSDSVFPTLPSGPLDKPMIPSKI---EDDCVQKRFVFSGEKLDLLKDVVSEESG  892
              LS      ++FP       D P+ P  +   E++   KRFVF    +  LK +V+  S 
Sbjct  182   LLSLLDAGGTIFPQ-----RDLPIFPENVLKRENNVEFKRFVFQPAMIKSLKAMVT-SSS  235

Query  893   VKNPTRAEIVSALLYKCCVKAAASRRPSILVHYA-----DMRPPLGLPCNSAGNILSTFS  1057
             + +PTR ++V A +YK  V        +   +        M PPL   C   GNIL   S
Sbjct  236   MPSPTRVQVVIAWIYKHAVSIMGLNFQTASFYMVVNLRKRMVPPLSEKC--VGNILWFSS  293

Query  1058  TSPAAAGEMDLARLVAELREGKE----------RLQSRDNELVQEIVTSLRTGEKPYENP  1207
                    EM L  LV +++EG            R   ++N L+ E    L+   +P ++ 
Sbjct  294   MMMTNKKEMKLEELVCKIKEGLSECCDVYPKMFREIGKNNLLISE---CLKQATEP-QSE  349

Query  1208  DLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTD  1387
             + +++  SS  ++P Y ADFGWG P  ++      KN   L+D + G G EA+V +++  
Sbjct  350   NKNVFGFSSWCRFPMYEADFGWGKPIWITTTGCSSKNNILLMDTRDGDGIEAVVNMEEKY  409

Query  1388  MSGFERDEELLRFA  1429
             M+ FE D ELL++A
Sbjct  410   MAKFEHDFELLQYA  423



>gb|KDP30966.1| hypothetical protein JCGZ_11342 [Jatropha curcas]
Length=454

 Score =   212 bits (539),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 147/446 (33%), Positives = 233/446 (52%), Gaps = 54/446 (12%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP---NNNRTDPTRVSDILQN  376
             I  R  IKPSSPTP +L+  KLSLLDQ   + Y+P++ +Y    ++   +  R+ ++L+ 
Sbjct  8     IVSRETIKPSSPTPQNLKCFKLSLLDQLAPAAYVPMILYYAPTADSIVKNQERI-NLLKK  66

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADA------QNV  538
             +LS+TLT FYP AGR+  N  ++CND G +F   ++NC+L DI+  P+A        Q  
Sbjct  67    SLSQTLTKFYPLAGRVKQNLFIECNDQGIDFIEAKLNCSLSDILRRPEAHILDRFLPQEY  126

Query  539   AFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPK  718
              F            G+   Q++ F CGG+A+  ++ HK+ DG T  +F+  W A  R   
Sbjct  127   HFHVSSSSTKCSQMGI---QVNSFSCGGMAIGTSISHKLVDGITFTSFINTWAAMARGSN  183

Query  719   LN-LSPNFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVV  877
              N LSP FV   +FP       LP   LD P   +        KRFVF   K+ LL++ +
Sbjct  184   DNLLSPIFVGPHIFPPKDIYGLLPV--LDIPKAKN------TTKRFVFDLSKIGLLRERL  235

Query  878   -----------SEESGVKNPTRAEIVSALLYKCCVKAAASRRPSILVHYADMR----PPL  1012
                        +  +    P+R EIVSAL++KC + A+ +++PS      ++R    PP 
Sbjct  236   FGNGNSSVNNKNNNNNNNLPSRVEIVSALIWKCAIDASRTKKPSFSTQTVNLRARMDPP-  294

Query  1013  GLPCNSAGNILSTFSTSPA---AAGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRT  1183
              LP ++AGN+L   + +PA    + ++++  LV ++R   ++  +   + +Q    SL  
Sbjct  295   -LPESAAGNLL-WLAIAPAPSDGSSKIEIQDLVYQVRNALKKFDTDYVKKLQGENGSLVL  352

Query  1184  GEKPYENPDL-----DIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSG  1348
              E   +  +L     DIY  +SL K+  Y  DFGWG P  +S      KN+  LI++++G
Sbjct  353   EETLKQITELALKHVDIYRFTSLRKFQLYEGDFGWGKPVWISSAGLTFKNVVVLIESRAG  412

Query  1349  GGFEALVMLKKTDMSGFERDEELLRF  1426
                EA V L + +M+ FE ++E+L F
Sbjct  413   DRVEAWVTLDQQEMAVFECNQEILSF  438



>gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa]
Length=424

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 147/436 (34%), Positives = 216/436 (50%), Gaps = 52/436 (12%)
 Frame = +2

Query  206   ISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNN---NRTDPTRVSDILQN  376
             +S R +IKPSSPTP  L+    SL DQ  ++ Y+ ++ FY      +R   T  SD L+ 
Sbjct  5     VSSREIIKPSSPTPNHLKKLNFSLNDQ-YSTHYVSVLLFYSAQGDVDRFKQTNTSDRLKK  63

Query  377   ALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL  556
             +LS  LT FYP AGR+++N  +DCND G E+   RV C L  ++  P AD  N   P   
Sbjct  64    SLSEILTQFYPLAGRIINNECIDCNDDGLEYLEARVPCPLSQLLGCPKADELNQLIP---  120

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPN  736
                      L+  Q+S FDCGGIA+   + H  GD  ++  F+  W A  +     + P 
Sbjct  121   -----FSQKLSAVQVSLFDCGGIAIGVTISHTAGDASSLTAFINSWAATAKGANEIVPPK  175

Query  737   FVSDSVFP-------TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
             F  D +FP       +   G +D   +P       V KRF+F   KL  LK   ++   V
Sbjct  176   FGFDYLFPPRDVPTVSFGGGAVDYTQLPR-----FVGKRFIFDSSKLAALKSACAD---V  227

Query  896   KNPTRAEIVSALLYKCCVKAAASR--RPSILVHYADMR----PPLGLPCNSAGNILSTFS  1057
             + PTR E+V+A +YKC +    SR  +PS+L    ++R    PP  LP +S GN+    +
Sbjct  228   ERPTRVEVVTAFIYKCFLNTIRSRSSKPSVLSMPINLRGRMNPP--LPPHSFGNLAIRLT  285

Query  1058  TSP-AAAGEMDLARLVAELREG--------KERLQSRDNELVQEIVTSLRTGEKPYENPD  1210
             + P  A  E +L  LV +LRE          E+LQ+ + EL+ E     + G +     D
Sbjct  286   SQPWPAEKEPELNCLVKQLRETIRKVNGGFVEKLQADNAELLFEHWKDWKKGIELSLTGD  345

Query  1211  LDIYFCSSLGKYPAYTADFGWG---WPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKK  1381
             L++       ++P Y ADFGWG   W  +V++          L+D + G G EA V L +
Sbjct  346   LNVLMVLICCRFPFYEADFGWGKPAWATRVNLYPS-----VSLVDTKDGEGVEAWVTLAE  400

Query  1382  TDMSGFERDEELLRFA  1429
              DM+ F  + +LL F+
Sbjct  401   GDMTRFCSEPDLLDFS  416



>ref|XP_011042323.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   211 bits (537),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 144/431 (33%), Positives = 213/431 (49%), Gaps = 47/431 (11%)
 Frame = +2

Query  221   LIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDI--LQNALSRTL  394
             +IKPSSPTP  LR ++LS LDQ     Y P++ FYP +       +  +  ++ +LS  L
Sbjct  12    IIKPSSPTPDHLRHYQLSFLDQISPPTYNPMLLFYPADGDVKINNIEKLNQIKQSLSEVL  71

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIH  574
               ++P AGR+ DN  V+CND G  FF+  V C L  ++  P+    N   P  L  A   
Sbjct  72    NLYHPLAGRIKDNLFVECNDEGIPFFQAEVKCRLPQVVEDPEPSELNKLIPFALDDAEEL  131

Query  575   DGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLS-PNFVSDS  751
               G+   Q + F+CGGI +   + HKVGD  ++  F+ +W A  R    ++S P F+S +
Sbjct  132   PLGI---QYNIFECGGIVIGLCISHKVGDASSLFTFIKYWAATARGEADHISRPEFISAT  188

Query  752   VFPTL------PSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV----KN  901
             +FP +      PS  + K        +D V KRFVF    ++LLK+  S  SG     + 
Sbjct  189   LFPPINISGFKPSTGITK--------EDVVTKRFVFRSSSIELLKEKCSTASGSLENQRP  240

Query  902   PTRAEIVSALLYKCCVKAA-ASRRPS---ILVHYADMRPPLG--LPCNSAGNILSTFSTS  1063
             P+R E +S  +++    A     RP     +VH  ++RP +   LP  S GN      T 
Sbjct  241   PSRVEALSVFIWQRFTAATKVESRPERIYSMVHAVNLRPRMEPPLPEYSFGNYYRIAFTI  300

Query  1064  PAAAGEMDLARLVAELRE--GK------ERLQSRDNEL--VQEIVTSLRTGEKPYENPDL  1213
             P+     +   LV+++R+  GK      ++LQ     L  ++E       GE    N   
Sbjct  301   PSIDTGEENYNLVSQIRDSIGKIDKEYVKKLQKGSQHLGFIKEQAARFLKGEVVSLN---  357

Query  1214  DIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMS  1393
                  +SL ++P Y ADFGW  P  V  P    KN+   +D  SG G EALV LK+ DM+
Sbjct  358   ----FTSLCRFPLYEADFGWAKPIWVGSPSLTFKNLVVFMDTASGDGIEALVHLKEEDMA  413

Query  1394  GFERDEELLRF  1426
              F+ DEELL++
Sbjct  414   KFQEDEELLQY  424



>gb|KDO61210.1| hypothetical protein CISIN_1g015205mg [Citrus sinensis]
Length=411

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 141/423 (33%), Positives = 204/423 (48%), Gaps = 53/423 (13%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + I  R +IKPS PTP  LR  +LSLLDQ   S+Y+   F Y  NN     +VS  L+++
Sbjct  7     VEIQGREIIKPSHPTPHHLRNLELSLLDQTNYSLYVCTCFLYKVNNNVKADQVSQRLKSS  66

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLP  559
             LS TLT FYP+AGR+ D+ +++CND G EF   R +  L + + +PD        P G  
Sbjct  67    LSETLTKFYPFAGRVKDDFSIECNDEGVEFIDGRADGFLSEYLQNPDQKLLTEFQPFGGK  126

Query  560   WANIHDGG-LAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPN  736
                I   G L + Q++ F CGG+A++    HK+ D  +   F+  W A  R         
Sbjct  127   GDPIAGKGPLLILQVTFFKCGGVAITTLSSHKLIDALSSSIFISCWAAVAR---------  177

Query  737   FVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAE  916
                                            RFVF   KL  L+  V+  S V  P+R E
Sbjct  178   ---------------------------AESNRFVFDASKLAQLQAEVASAS-VPRPSRVE  209

Query  917   IVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILSTFSTSPAA  1072
              ++AL++KC   A+ S     RPS+LV   ++R    PPL    NS GN +  F  +  +
Sbjct  210   ALTALIWKCARTASRSNRGFARPSLLVQAVNLRSVVVPPLSE--NSVGNSIG-FMPAQTS  266

Query  1073  AGEMDLARLVAELREGKERLQSRDNELVQEIVTSLRTGEK---PYENPDLDIYFCSSLGK  1243
               EM+L  LV +LR+ K+   +   + + E  + L   E     +E  ++D +  +S+  
Sbjct  267   EKEMELQELVCKLRKAKDEFSNNGIQTLLETKSILNVSESTRDKFERDEIDFFSFTSMIS  326

Query  1244  YPAYT-ADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFERDEELL  1420
             +P +  ADFGWG P  V+ P     N+  L+  + G G EA V L   DM  FER +ELL
Sbjct  327   FPVHEGADFGWGKPIHVTFPNYTTPNVVILVSTEDGAGIEAFVYLSPEDMPIFERSQELL  386

Query  1421  RFA  1429
              FA
Sbjct  387   SFA  389



>ref|XP_008390114.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   211 bits (536),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/428 (34%), Positives = 213/428 (50%), Gaps = 41/428 (10%)
 Frame = +2

Query  227   KPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNALSRTLTSFY  406
             KPSSP P  L+ +KLSLL+Q     Y+P++ FY      D T + D L N+LS TLT FY
Sbjct  14    KPSSPIPDHLKSYKLSLLEQIAPMFYVPVILFYSAPENIDDTTIVDKLNNSLSETLTGFY  73

Query  407   PYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGLPWANIHDGGL  586
             P AGR+  NA+VDC D    F R R N  L +I+  P+ D      P   P+    D  +
Sbjct  74    PLAGRIEGNASVDCEDGAVXFARARANIQLSEILKIPEMDLVQQLLPLD-PYNIRMDKAV  132

Query  587   A--VFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPNFVSDSVFP  760
             A    QL+ FDCGG+ +   + HK+ DG T+ +F+  W   +R    N++P+  S ++FP
Sbjct  133   AAMAIQLNFFDCGGMGIVICLSHKIADGATLSSFLDAWATRSRGVFENITPSLNSANIFP  192

Query  761   TLPSGPLDKPM-IPSKI--EDDCVQKRFVFSGEKLDLLKDVVSEESGV----KNPTRAEI  919
                  P DK + +PS +   +  V KRFVF    L  LK  V    G+    + PTR E 
Sbjct  193   -----PRDKQIFMPSNLIKREKFVTKRFVFDASSLAKLK--VKASKGLCTDGRAPTRVEA  245

Query  920   VSALLYKCCVKAAASR----RPSILVHYAD-----MRPPLGLPCNSAGNILSTFSTSPAA  1072
             ++AL+ K  + A        RPS+ + +       M PP  LP +S GNI      S   
Sbjct  246   LTALICKSSMNAKIGTLGRGRPSMAISHVGYLRERMAPP--LPEHSFGNIWRVAVASIMK  303

Query  1073  -AGEMDLARLVAELREGKERLQSRDNELVQEI---------VTSLRTGEKPYENPDLDIY  1222
                + +L   V +LR+   ++   D++ V+++            L+   +     +++ +
Sbjct  304   DESKPELHDFVVQLRKVIRKI---DDDCVRKLQGEDGFSHACEPLKETSELVSEGEVEFF  360

Query  1223  FCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFE  1402
               SS  ++  Y  DFGWG P    +   P+KN+  L+ + SG G EA V L + DM+ FE
Sbjct  361   RFSSWIRFSLYNTDFGWGKPTWACISNVPIKNVVILLSSSSGDGIEAWVTLDEEDMAKFE  420

Query  1403  RDEELLRF  1426
              D ELL F
Sbjct  421   SDHELLEF  428



>ref|XP_008360182.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=443

 Score =   211 bits (536),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 147/431 (34%), Positives = 221/431 (51%), Gaps = 39/431 (9%)
 Frame = +2

Query  221   LIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDP--TRVSDILQNALSRTL  394
             +I+PSSPTP  LR ++ S LDQ    +Y PL+ FY  N +  P  T +S+ L+N+LS  L
Sbjct  12    IIRPSSPTPGHLRHYQFSFLDQMAPQVYNPLLLFYEYNAKMHPNITEISNHLKNSLSEAL  71

Query  395   TSFYPYAGRLLDNATVDCNDAGAEFFRVRV-NCTLLDIINHPDADAQNVAFPAGLPWANI  571
             + FYP AGR+ DN  + CND G  +   RV NCTL D++++P+ D  N   P  L   +I
Sbjct  72    SLFYPLAGRIKDNCFIHCNDEGIPYIEARVLNCTLSDVLSNPNPDELNKFMPFELD--DI  129

Query  572   HDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSP-NFVSD  748
              +      QL+ F CGG A+   + HK+ DG +   F   W A  R  + N+ P  FVS 
Sbjct  130   TNPLPFGVQLNIFQCGGFAIGQCVSHKIADGLSYFTFSKIWAAIARGEQANIDPPQFVSA  189

Query  749   SVFP--TLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLL-----KDVVSEESGVKNPT  907
             ++FP     +G  D  +    I  D V KRFVF+  K+  L     KD+ S +  +K+PT
Sbjct  190   TLFPPKEFNTG-FDGGV---GITKDRVTKRFVFNASKIKTLQAKYEKDMKSLQ--LKHPT  243

Query  908   RAEIVSALL---YKCCVKAAASRRPSILVHYADMRPPLG--LPCNSAGNILSTFSTSP--  1066
             R E +SA +   Y    K     +  +++H  ++RP     LP +S GN+     TSP  
Sbjct  244   RVETLSAFIWSRYVAATKDCTVNKLYMVIHAVNLRPRFSPPLPQHSFGNLFRVAMTSPLR  303

Query  1067  -AAAGEMDL-ARLVAELREGKERLQSRDNELVQEI-------VTSLRTGEKPYENPDL-D  1216
              +  GE +    ++ E+RE   ++   DNE V+++       +  ++     ++  D+  
Sbjct  304   ISNGGEEECDGVVIGEVREAISKI---DNEYVKQLQGQGDEHLGLMKKAADSFKRGDMVA  360

Query  1217  IYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSG  1396
             +   SS  ++P Y  DFGWG P  V  P    KN+   +D + G G EA V L++  M  
Sbjct  361   VLSFSSYCRFPLYENDFGWGKPAWVGSPALTYKNLVLFMDTKEGDGIEAYVSLEERVMVK  420

Query  1397  FERDEELLRFA  1429
             FE D ELL + 
Sbjct  421   FECDSELLSYV  431



>ref|XP_002271612.1| PREDICTED: vinorine synthase-like [Vitis vinifera]
Length=433

 Score =   210 bits (534),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 144/453 (32%), Positives = 220/453 (49%), Gaps = 61/453 (13%)
 Frame = +2

Query  167   ETKMAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN---  337
             E K+ I+++ P        IKPSSPTP  LR  K+SLLDQ     Y+P++  +  ++   
Sbjct  2     EMKIDILSTQP--------IKPSSPTPNHLRSFKISLLDQLAPPFYVPVILLFSADDFDC  53

Query  338   -RTDPTRVSDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINH  514
                D   + D+L+ +LS+TL+ FYP AG+L  N +VDC+D GA F   R N  L +I+  
Sbjct  54    EAVDHVTICDLLKRSLSQTLSRFYPLAGKLKGNDSVDCSDDGAVFMEARANVELSEILRD  113

Query  515   PDADAQNVAFPAGLPWA---NIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFM  685
             P+ D      P   P++      D  +   Q + F+CGGI +   M HKV DG T+  F+
Sbjct  114   PEIDLLQKLLPCE-PYSVGSESSDRAITAIQATIFECGGIGIGVCMSHKVADGATLATFL  172

Query  686   GHWVAATRHPKLNLSPNFVSDSVFP------TLPSGPLDKPMIPSKIEDDCVQKRFVFSG  847
               W A        ++P   S S+FP       L SG +             + +RF+F  
Sbjct  173   TAWSATAMGTDDGITPFLDSASLFPPRDINTVLSSGVIS--------HGKTLTRRFLFDA  224

Query  848   EKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASRR-----PSILVHYADMR---  1003
               L  L      +S   N TR E V++L++K  +  A  +       SI+ H  ++R   
Sbjct  225   ASLARL------QSKASNSTRVEAVTSLIWKSAMDVAREKSGKDTISSIVTHVVNLRGKT  278

Query  1004  -PPLGLPCNSAGNILS-TFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEI----  1165
              PPL     S GN+     +T     G+++L  LV  LR   +++   D E V+EI    
Sbjct  279   EPPLS--DRSLGNLWQQAVATVTEQEGKVELDDLVGRLRRAIKKV---DKEYVKEIQGEE  333

Query  1166  -----VTSLRTGEKP-YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFF  1327
                    +++  +K      ++++Y  SS  ++P Y  DFG+G P  V     P+KN+  
Sbjct  334   GLSKACGAMKEVQKMIMSKGEMELYRFSSWSRFPFYETDFGFGRPIWVCTITAPIKNVII  393

Query  1328  LIDNQSGGGFEALVMLKKTDMSGFERDEELLRF  1426
             L+D +SGGG EA V + + DM+ F+R  ELL F
Sbjct  394   LMDTKSGGGIEAWVTMVEEDMTKFQRHYELLEF  426



>ref|XP_008385235.1| PREDICTED: uncharacterized protein LOC103447811 [Malus domestica]
Length=939

 Score =   218 bits (554),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 146/453 (32%), Positives = 221/453 (49%), Gaps = 41/453 (9%)
 Frame = +2

Query  167   ETKMAIIASPPLSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTD  346
             E KMA  +   + +  +  IKP  PTP  LR   LS+ DQ    +YIPL+ FYPNNN +D
Sbjct  489   EQKMA--SEIKVEVIHKETIKPFYPTPDHLRSLSLSVFDQYQPEVYIPLLIFYPNNNNSD  546

Query  347   PTRVSD------------ILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNC  490
              ++V +            +L+ +LS  LT FYP+AG    N +++CND GA F   +VNC
Sbjct  547   NSQVKNSDHRSLFAERSILLKKSLSEALTRFYPFAGEFKYNVSINCNDHGAAFLEAQVNC  606

Query  491   TLLDIINHPDADAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGT  670
              +  I+ +PD +      P          G L + Q + F+CGG+A+  ++ HK  D  T
Sbjct  607   PVSKILKNPDFEILKQLLPTDCMSTQAETGYLVLVQANLFECGGLAIGISIYHKAADAFT  666

Query  671   VRNFMGHWVA--------ATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIE-DDCV  823
                F+  W A         T H  L      V+ S+ P+  S   D P  P     +   
Sbjct  667   TTTFIKCWAALAFGSASSTTDHHVLLPEEFGVAASLAPSHDS--FDSPGAPVTFSTEKLT  724

Query  824   QKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHY  991
              +RFVF   K+  LK   +  + V NPTR E+VSA+++K  ++A+ S+    +PS     
Sbjct  725   TRRFVFDASKISALK-FKAASATVPNPTRVEVVSAVIWKSLIQASRSKFGFMKPSTWCAM  783

Query  992   ADMRPPLGLPCNSAGNILSTFSTSPAA-----AGEMDLARLVAELREGKERLQSRDNELV  1156
              ++R   G       NI   F    AA       E++L  LV +LR+G    + +    V
Sbjct  784   LNLRKRSGQAVTE--NIQGNFVWFAAALTTEEQSEVELESLVGKLRKGIAEYKEKHPNGV  841

Query  1157  --QEIVTSLRTGEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFL  1330
               +E+  +++     +   DL+IY CSS  ++P Y  +FGWG P  V+    P  ++FFL
Sbjct  842   SGEEVFQTIKAFVSLFLRGDLEIYTCSSWCRFPLYETNFGWGKPTWVT--SQPFNDLFFL  899

Query  1331  IDNQSGGGFEALVMLKKTDMSGFERDEELLRFA  1429
              D + G G E  + LK+  M+ FE  E+LL +A
Sbjct  900   TDTRDGDGIELSLSLKEDVMTIFESSEDLLTYA  932


 Score =   207 bits (528),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 135/438 (31%), Positives = 210/438 (48%), Gaps = 32/438 (7%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRV-------  358
             + +  +  IKP SPTP  L+    S+ DQ     YIPL+FFYPNNN +D   V       
Sbjct  7     IEVIHKETIKPLSPTPDHLKSLSFSVFDQYQPETYIPLLFFYPNNNNSDNGGVKNNDHHS  66

Query  359   -----SDILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDA  523
                  S++L+ +LS  LT FYP+AG    N ++ CND GA F   +VNC    I+ +PD 
Sbjct  67    LFAERSNLLKKSLSEALTRFYPFAGEFKYNVSISCNDHGAAFLEAQVNCPASKILENPDF  126

Query  524   DAQNVAFPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA-  700
             +      P          G L + Q + F+CGG+A+   +CHK  D  T   F+  W A 
Sbjct  127   EILKQLLPTDCMSTQAETGYLVLVQANSFECGGLAIGVCICHKAADAFTATTFIECWAAL  186

Query  701   -------ATRHPKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLD  859
                     T H  L      ++ S+ P+L S       +  + E     +RFVF   K+ 
Sbjct  187   ALGSASSTTDHHVLLPEEFGIAASLSPSLDSFNSPGAHVTIRTEKS-TTRRFVFDASKIS  245

Query  860   LLKDVVSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG--LP  1021
              LK   +  + V NPTR E+VSAL++K  ++A+ S+    +        ++R   G  + 
Sbjct  246   ALKSKAA-STVVPNPTRVEVVSALIWKSLIQASRSKLSLTKAFTWFAALNLRKRWGQAMT  304

Query  1022  CNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELV--QEIVTSLRTGEKP  1195
              N  GN +   +    A GE++L  LV +LR+  E  + +    V  +E+  +++     
Sbjct  305   ENILGNFVWYTAALTTAEGEVELESLVGKLRKAVEEYKEKHPNGVSGEEVFQTIKASASR  364

Query  1196  YENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVML  1375
                  +++Y C+S  + P Y  +FGWG P   +    P+  +F L D + G G EA + L
Sbjct  365   SLGGVVEMYGCTSWCRLPLYETNFGWGKPSWAT--SVPINGLFCLSDTRDGDGIEAALSL  422

Query  1376  KKTDMSGFERDEELLRFA  1429
             K+  M+  E  E+LL++A
Sbjct  423   KEDVMAIIESSEDLLQYA  440



>ref|XP_004301806.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=423

 Score =   209 bits (532),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 145/428 (34%), Positives = 225/428 (53%), Gaps = 46/428 (11%)
 Frame = +2

Query  215   RLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDP--TRVSDILQNALSR  388
             + +IKP+SPTP  LR ++ S LDQ    +Y PL+ FY  N +  P  T +S+ L+ +L++
Sbjct  10    KHIIKPASPTPDHLRHYQFSFLDQISPPVYSPLLLFYEFNAKIQPNITEISNHLKTSLAK  69

Query  389   TLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPAGL-PWA  565
              L+ +YP AGR  DN  VDCND G  +  V+VNC L D++N+P     N   P  L   A
Sbjct  70    VLSLYYPLAGRFKDNQYVDCNDNGVPYLEVQVNCKLSDVLNNPIPGELNKLMPFELDDVA  129

Query  566   NIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATR-HPKLNLSPNFV  742
             N +  G+   QL+ F CGG A++  + HK+ DG +   F   W A  R  PK+   P F+
Sbjct  130   NKYPLGV---QLNIFQCGGFAIAQCLTHKLADGLSYFTFSKTWAATARGEPKIE-HPQFI  185

Query  743   SDSVFPTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVKNPTRAEIV  922
             S ++FP       D     + I  + V KRFVFS   ++ L++V + ++  + P+R E +
Sbjct  186   SATLFPPRNLSGFDA---RTGITRNKVSKRFVFSASDIEELREVQANKASAR-PSRVEAL  241

Query  923   SALLYKCCVKA----AASRRPSILVHYADMR----PPLGLPCNSAGNILSTFSTSP--AA  1072
             S+ +    V+A     +  +   +VH  ++R    PP  LP +S GN+     T+P   +
Sbjct  242   SSFILSRFVEATKDIGSPDKFYRVVHAVNLRSRFEPP--LPHHSFGNLYRVAMTAPLRIS  299

Query  1073  AGE------MDLARL----VAELREGKERLQSRDNELVQEIVTSLRTGEKPYENPDLDIY  1222
             +GE       +++++    V +L++G E L S     ++ I  S   GE+      + I 
Sbjct  300   SGEPFHGIREEISKIDNAYVRKLQKGDEHLSS-----IKTIAKSFAKGEQ------VTIS  348

Query  1223  FCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDMSGFE  1402
             F SS  ++P Y  DFGWG P  V  P    KN+   +D + GGG EA + L++  M+ FE
Sbjct  349   F-SSYCRFPLYDNDFGWGRPTWVGSPALTFKNLVNFMDTREGGGIEAYISLEEEVMTKFE  407

Query  1403  RDEELLRF  1426
              D ELL +
Sbjct  408   SDVELLAY  415



>ref|XP_009359286.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=432

 Score =   209 bits (533),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 142/430 (33%), Positives = 218/430 (51%), Gaps = 34/430 (8%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDILQNA  379
             + + ER  IKPS PTPP L  H+ S LDQ  T +++P++FFY N++  D    SD ++ +
Sbjct  3     IEVIERAYIKPSMPTPPHLCKHEFSFLDQIATQIFMPMIFFYNNHHVNDARTYSDRVKQS  62

Query  380   LSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNC-TLLDIINHPDADAQNVAFPAGL  556
             LS  LT +YP+AGR+++NA +DCND GA + + RV    L D+I+ PD +  N   P  L
Sbjct  63    LSEALTQYYPFAGRIVENAFIDCNDQGAPYVQARVRSPPLSDVISEPDPNQLNKLLPCEL  122

Query  557   PWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKLNLSPN  736
                N+ D   A+ Q++ FDCGG+A+     HKV D  +   F+  W + +R    N+  +
Sbjct  123   --DNVGDLVFAI-QVNMFDCGGMAIGICFSHKVADALSFITFLNSWASISRG-DCNIKNS  178

Query  737   FVSDSVF-------PTLPSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGV  895
              VS  +F       P   SG   KP +  K  +  V KRFVFS   +  L+   ++    
Sbjct  179   TVSRPIFDLATLFPPRSISG--FKPSV-EKAREKIVTKRFVFSASTIASLRSRYTDNKAN  235

Query  896   K-NPTRAEIVSALLYKCCVKAAASR-RPSILVHYAD-------MRPPLGLPCNSAGNILS  1048
             +  P+R E +SA ++   + +   +  P+ L   A        M PP  LP    GN+  
Sbjct  236   EIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVAHAVNLRTRMDPP--LPEYHFGNVSR  293

Query  1049  TFSTSPAAAGEMDLARLVAELREGKERLQSRDNELVQEI------VTSLRTGEKPYENPD  1210
                +SP+     D       +R+ ++ +++ D + V +I      V  L+   +     +
Sbjct  294   FVMSSPSFDEREDTC--YGMVRQMRQAIKTIDGDYVAKIKEGNEHVEFLKQLAEESMKRE  351

Query  1211  LDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKKTDM  1390
             +  +  SSL ++P Y  D GWG P  V     P KN+   ID  S GG EA V LK+ DM
Sbjct  352   VASFSFSSLCRFPYYETDLGWGKPVWVGSASFPFKNLVCFIDAGSSGGIEAWVNLKEEDM  411

Query  1391  SGFERDEELL  1420
             + F+ DE+LL
Sbjct  412   AKFQHDEQLL  421



>ref|XP_009361771.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=467

 Score =   210 bits (535),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 150/442 (34%), Positives = 210/442 (48%), Gaps = 50/442 (11%)
 Frame = +2

Query  224   IKPSSPTPPSLRF-HKLSLLDQALTSMYIPLVFFYPNNNRTDPTRVSDI-----------  367
             I PS PTPP L+  + LS  D  +  +YIPL+ FYP  N  D   V DI           
Sbjct  20    ISPSCPTPPHLKTTNSLSFFDLLVPPIYIPLLLFYPICNNGDDFEVHDIDHRSLVAERSE  79

Query  368   -LQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAF  544
              L+ +LS  LT FYP+AG    N ++ CND GA F   +VNC +  I + PD        
Sbjct  80    LLKTSLSEALTLFYPFAGSFQFNDSICCNDQGAVFLEAQVNCPISKIFDKPDLGMLGQLL  139

Query  545   PAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA-ATRHPK-  718
             P      N H   L   Q + F+CGG+A+   + HKV D  T+  F+  W A A   P+ 
Sbjct  140   P------NDHTSHLLQVQANFFECGGLAIGVNISHKVADASTLSKFINRWAAIALGSPRT  193

Query  719   LNLSPNFV---SDSVFPTL-----PSGPLDKPMIPSKIEDDCVQKRFVFSGEKLDLLKDV  874
             +++ P      + S+FP L     P  P     +   I++ C  +RFVF G K+  LK  
Sbjct  194   IDVVPLVAFGAASSLFPPLDFLNSPPAPTPTRDMKFDIKERCTTRRFVFDGSKIAALKSE  253

Query  875   VSEESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPPLG-------LP  1021
              +  S V NPTR E+VSAL++KC  +A+ S     RPS      +MR  L        L 
Sbjct  254   AASAS-VPNPTRVEVVSALIWKCAKEASRSNLGSVRPSSWCQTVNMRKVLAQTLADKDLL  312

Query  1022  CNSAGNILSTFSTSPAAAGEMDLARLVAELREGKERLQS------RDNELVQEIVTSLRT  1183
              N  G + +    S + A + DL  LV  LR+G E  +       R  E  Q  + ++  
Sbjct  313   GNVVGLVAAKTEESSSEAHDHDLRSLVTILRKGIEEFKEKYRNGVRGEEFCQLFMENVNL  372

Query  1184  GEKPYENPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEA  1363
               K     D D Y  +S  ++P Y ++FGWG P  V +     KN   L+D + G G EA
Sbjct  373   IMK---KDDTDSYSSTSWCRFPHYESNFGWGKPSWVFISSVGSKNSIVLLDARDGDGIEA  429

Query  1364  LVMLKKTDMSGFERDEELLRFA  1429
              +   + DM+ FE +EELL +A
Sbjct  430   SLTFNEEDMTIFESNEELLEYA  451



>ref|XP_003538872.1| PREDICTED: vinorine synthase-like [Glycine max]
 gb|KHN41919.1| Vinorine synthase [Glycine soja]
Length=433

 Score =   209 bits (532),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 144/434 (33%), Positives = 222/434 (51%), Gaps = 41/434 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYPNNN------RTDPTRVS  361
             + +  + L+KPSSPTP  LR + LSLLD     +   +V+F+  NN       T     S
Sbjct  5     VEVISKELVKPSSPTPNHLRHYNLSLLDHLTPQLNNSMVYFFAANNVSNQFLNTCTENAS  64

Query  362   DILQNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVA  541
             + L+ +LS  LT +YP AGRL+D A ++CND GA +   +V C L D++  P  +     
Sbjct  65    NHLKKSLSEALTHYYPLAGRLVDKAFIECNDEGALYLEAKVRCKLNDVVESPIPNEVTNL  124

Query  542   FPAGLPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRHPKL  721
              P G+   +I D  L V QL+ F+CGGIA+ A M HK+ D  +   F+  W A  R    
Sbjct  125   LPFGMD--DIVDTPLGV-QLNVFECGGIAIGACMSHKIADAMSFFVFIQTWAAIARDYN-  180

Query  722   NLSPNFVSDSVFPTLPSGPLDKPMI-PSKI--EDDCVQKRFVFSGEKLDLLKDVVSEESG  892
              +  +FVS S+FP     P D P   P+K   + + V + FVF    +D LK   +E+  
Sbjct  181   EIKTHFVSASLFP-----PRDIPWYDPNKTITKPNTVSRIFVFDASVIDGLKAKYAEKMA  235

Query  893   V-KNPTRAEIVSALLY-----KCCVKAAASRRPSILVHYADMR----PPLGLPCNSAGNI  1042
             + K P+R E +S  ++        V A+ S +  ++ H  ++R    PPL  P ++ GN 
Sbjct  236   LQKPPSRVEALSTFIWTRFMASTQVAASESSKFYVVAHTVNLRSRMDPPL--PAHAFGNY  293

Query  1043  LSTFSTSPAAAGEMDLARLVAELREGKERLQSRDNELV------QEIVTSLRTGEKPYEN  1204
                    P+   + +   LV +LRE    ++  DNE +       E ++SLR   + +EN
Sbjct  294   YRAVKAFPSLDDKGECYELVEKLRE---EIRKIDNEYILKLQEGSEYLSSLREDLRRFEN  350

Query  1205  PDLDI--YFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLK  1378
                +I  +  ++L ++P Y ADFGWG P     P   +KN+    D + GGG EA + + 
Sbjct  351   IKGEIVPFTFTALCRFPVYDADFGWGKPIWACPPAWKVKNVVVFTDTKFGGGIEAHISMM  410

Query  1379  KTDMSGFERDEELL  1420
             + DM+ F+ D+ELL
Sbjct  411   EEDMARFQNDKELL  424



>ref|XP_007028226.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY08728.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=442

 Score =   209 bits (532),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 148/436 (34%), Positives = 225/436 (52%), Gaps = 38/436 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSM-YIPLVFFYPNNN--RTDPTRVSDIL  370
             + ++ R  IKPS PTP  LR   LSLLDQ + ++ Y  +VFFYP++N  R+  ++ S  L
Sbjct  6     VEVTSRKTIKPSIPTPHHLRTFNLSLLDQDVPAIHYGSVVFFYPSDNTARSSISQKSQSL  65

Query  371   QNALSRTLTSFYPYAGRLLDNATVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAFPA  550
             +N+LSR L  FYP AG++ D  T++CND GA F   R  C L D + HPD        P+
Sbjct  66    KNSLSRILLHFYPLAGQVKDAVTIECNDQGACFIEARTGCQLNDFLTHPDPGFLKELVPS  125

Query  551   GLPWANIHD-GGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVA-ATRHPKLN  724
               P A       + + QL+ F CGG AV+  + HK  D  ++  F+  W A ++R     
Sbjct  126   TDPKAIRSTLACILLVQLTSFTCGGTAVAVCVSHKFADASSLCTFIQSWTAMSSREYGRV  185

Query  725   LSPNFVSDSVFPTLPSGPLDKPM--IPSKIEDDCVQKRFVFSGEKLDLLKDVVSEESGVK  898
             + P  V  S+ P     P+ K +   P     +C  KRFVF   ++  LK  V+   G +
Sbjct  186   VVPKLVGASLLP-----PIHKLITSTPPPTTRNCATKRFVFHKSQIANLKAKVAATMGKQ  240

Query  899   N-PTRAEIVSALLYKCCVKAAASR----RPSILVHYADMR----PPLGLPCNSAGNILST  1051
               P   EIV A++ +C   A+ S+    R S L++  ++R    PP  LP N+ GN++ T
Sbjct  241   QRPANVEIVLAIVLRCASAASQSKYGSSRQSALLNVVNLRKRMVPP--LPGNTIGNLIWT  298

Query  1052  FSTSPAAAGEMD--LARLVAELREG-----KERLQSRDNELVQEIVTSLRTGEKPYEN--  1204
             +   P    E D  L ++VA++++       ++L++  ++     V   R       N  
Sbjct  299   Y---PVLFQESDVQLHQIVAKMKDAFTNVCNDKLKTIKSKKGHTEVQESRKQIAQLLNGK  355

Query  1205  -PDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGPMKNMFFLIDNQSGGGFEALVMLKK  1381
               D + Y C++L  YP +  DFGWG P  V+ P    KN+  L+D++  G  EA V L +
Sbjct  356   LVDTNTYTCTNLCSYPLHEMDFGWGKPLWVTSPSN-FKNLIVLLDSK-WGDIEAWVTLDE  413

Query  1382  TDMSGFERDEELLRFA  1429
              +M+ FERD+ELL  A
Sbjct  414   LEMATFERDQELLAVA  429



>ref|XP_002284817.2| PREDICTED: vinorine synthase-like [Vitis vinifera]
Length=445

 Score =   209 bits (532),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 147/439 (33%), Positives = 212/439 (48%), Gaps = 40/439 (9%)
 Frame = +2

Query  200   LSISERLLIKPSSPTPPSLRFHKLSLLDQALTSMYIPLVFFYP----NNNRTDPTRVSDI  367
             ++I  R  IKPSSPTP  LR  KLSLLDQ +   Y  ++ FY     +    + + +S  
Sbjct  3     VTIISRETIKPSSPTPHHLRAFKLSLLDQLVPCCYTQVLLFYLIDGFHGQSIETSHISTR  62

Query  368   LQNALSRTLTSFYPYAGRLLDNA-TVDCNDAGAEFFRVRVNCTLLDIINHPDADAQNVAF  544
             L+++LS TLT FYP AG + D+   +DCND G  +F  RV+C L + +  P+ +  N  F
Sbjct  63    LKDSLSETLTHFYPLAGSIGDDELQIDCNDEGVPYFEARVDCNLSEFLQEPELELLNQFF  122

Query  545   PAG----LPWANIHDGGLAVFQLSEFDCGGIAVSAAMCHKVGDGGTVRNFMGHWVAATRH  712
             P       P A +H   LA+ Q++ F+ GGIA+   + HK+ DG ++  F+  W A  R 
Sbjct  123   PCDPLNTPPMAKLH---LAMIQVNIFNRGGIAIGVCLSHKIADGVSISAFLKAWAAIARG  179

Query  713   PKLNLSPNFVSDSVFPTLPSGPLDKPMIPSKI---EDDCVQKRFVFSGEKLDLLKDVVSE  883
                   P+F + S+FP   S P D  M+  K       CV KR VF    +  LK   S 
Sbjct  180   C-FEEYPSFEAKSLFPQNESLPQDYSMVLGKCLIRTGKCVTKRVVFDASAIAALKAKASV  238

Query  884   ESGVKNPTRAEIVSALLYKCCVKAAASR----RPSILVHYADMRPP--LGLPCNSAGNIL  1045
             +      TR E+VSA ++K  + AA  +    R SIL H  ++R    L LP +S GN+ 
Sbjct  239   DC-----TRVEVVSAFIWKRAMAAAKQKLGFQRSSILTHAVNLRKKTILSLPESSMGNLF  293

Query  1046  STFSTSPAAAGEMDLARLVAELREG--------KERLQSRDNELVQEIVTSLRTGEKPYE  1201
                 T      E +L  LV + R+          ++LQ  +   V      ++  +  +E
Sbjct  294   WIAITEGRVDDEAELDLLVDKTRKAISKISCDFAKKLQGEEGFAVA--FEHVKEVKAAFE  351

Query  1202  NPDLDIYFCSSLGKYPAYTADFGWGWPCKVSMPKGP---MKNMFFLIDNQSGGGFEALVM  1372
                +D Y  SS  K+  Y  DFGWG P  VS   G     KN+ F +D + G G E  V 
Sbjct  352   EDGVDFYGFSSWCKFEVYEGDFGWGRPIWVSSFSGKGSVYKNLIFFMDTRCGNGIEEWVT  411

Query  1373  LKKTDMSGFERDEELLRFA  1429
             L + ++   E D E L F 
Sbjct  412   LDEEELGILECDPEFLSFG  430



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5368531198704