BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7928_g2_i1 len=306 path=[2823:0-305]

Length=306
                                                                      Score     E

emb|CBI40254.3|  unnamed protein product                                117   1e-29   
emb|CBI40264.3|  unnamed protein product                                116   1e-29   
gb|ACM41589.1|  UDP-glucosyltransferase 1                               118   4e-29   Capsicum annuum
ref|XP_004244752.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    118   4e-29   
emb|CBI22524.3|  unnamed protein product                                116   5e-29   
ref|XP_006355777.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    117   6e-29   
emb|CDO97225.1|  unnamed protein product                                117   8e-29   
ref|NP_001267849.1|  cinnamate beta-D-glucosyltransferase-like          115   6e-28   
gb|AEW31188.1|  glucosyltransferase                                     115   7e-28   
ref|XP_002285379.1|  PREDICTED: limonoid UDP-glucosyltransferase        115   7e-28   Vitis vinifera
gb|ABH03018.1|  resveratrol/hydroxycinnamic acid O-glucosyltransf...    115   7e-28   Vitis labrusca [Concord grape]
ref|XP_007042538.1|  UDP-Glycosyltransferase superfamily protein,...    115   7e-28   
gb|AEW31187.1|  glucosyltransferase                                     114   9e-28   
ref|XP_002274256.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    114   9e-28   Vitis vinifera
ref|XP_009614247.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    114   9e-28   
ref|XP_009757097.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    114   1e-27   
emb|CAN59771.1|  hypothetical protein VITISV_029146                     114   1e-27   Vitis vinifera
ref|XP_010028410.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    114   1e-27   
ref|XP_002518669.1|  UDP-glucosyltransferase, putative                  113   3e-27   Ricinus communis
ref|XP_002518668.1|  UDP-glucosyltransferase, putative                  113   4e-27   Ricinus communis
gb|KDP45907.1|  hypothetical protein JCGZ_15467                         111   1e-26   
ref|XP_009345415.1|  PREDICTED: putative UDP-glucose glucosyltran...    111   1e-26   
ref|XP_009370119.1|  PREDICTED: putative UDP-glucose glucosyltran...    111   1e-26   
ref|XP_008377621.1|  PREDICTED: putative UDP-glucose glucosyltran...    111   1e-26   
ref|XP_008347487.1|  PREDICTED: putative UDP-glucose glucosyltran...    111   1e-26   
ref|XP_009614127.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    111   1e-26   
ref|XP_008384481.1|  PREDICTED: putative UDP-glucose glucosyltran...    110   2e-26   
ref|XP_008366168.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    110   2e-26   
ref|XP_006342414.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    110   2e-26   
gb|AHA54051.1|  UGT84A13                                                110   3e-26   
ref|XP_010030631.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    108   3e-26   
ref|XP_006342685.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    110   5e-26   
gb|KDP45909.1|  hypothetical protein JCGZ_15469                         110   7e-26   
ref|XP_010065961.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    109   1e-25   
dbj|BAF75877.1|  glucosyltransferase                                    109   1e-25   Dianthus caryophyllus [carnation]
ref|XP_010065962.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    109   1e-25   
gb|KCW63690.1|  hypothetical protein EUGRSUZ_G01342                     108   1e-25   
ref|XP_009364139.1|  PREDICTED: putative UDP-glucose glucosyltran...    107   1e-25   
ref|XP_009790173.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    108   2e-25   
ref|XP_006346359.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    107   3e-25   
dbj|BAG80540.1|  UDP-glucose:glucosyltransferase                        107   5e-25   Lycium barbarum [goji berry]
ref|XP_004253024.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    106   1e-24   
ref|XP_008384480.1|  PREDICTED: putative UDP-glucose glucosyltran...    106   1e-24   
ref|XP_004304051.1|  PREDICTED: putative UDP-glucose glucosyltran...    105   2e-24   
dbj|BAF99688.1|  UDP-glucose:hydroxycinnamate 1-O-glucosyltransfe...    105   2e-24   Lobelia erinus
gb|EPS57614.1|  hypothetical protein M569_17203                         104   3e-24   
gb|AEM43003.1|  UDP-glucosyltransferase                                 104   4e-24   
gb|AEM43005.1|  UDP-glucosyltransferase                                 104   4e-24   
gb|AAN85566.1|  UDP-glucosyl transferase                                105   4e-24   Fragaria x ananassa
ref|XP_011016669.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    102   5e-24   
ref|XP_010691667.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    104   8e-24   
ref|XP_008454993.1|  PREDICTED: putative UDP-glucose glucosyltran...    103   1e-23   
gb|ABX46223.1|  limonoid UDP glucosyltransferase                        101   1e-23   Swinglea glutinosa [tabog]
dbj|BAG14302.1|  sinapate glucosyltransferase                           103   1e-23   Gomphrena globosa [globe-amaranth]
dbj|BAF99686.1|  UDP-glucose:hydroxycinnamate 1-O-glucosyltransfe...    103   1e-23   Lobelia erinus
dbj|BAF99689.1|  putative UDP-glucose:hydroxycinnamate 1-O-glucos...    102   2e-23   Lobelia erinus
ref|XP_008236382.1|  PREDICTED: putative UDP-glucose glucosyltran...    102   2e-23   
ref|XP_007199813.1|  hypothetical protein PRUPE_ppa005173mg             102   3e-23   
ref|XP_010524528.1|  PREDICTED: UDP-glycosyltransferase 84A1-like       102   3e-23   
ref|XP_004230732.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    102   3e-23   
ref|XP_008236381.1|  PREDICTED: putative UDP-glucose glucosyltran...    102   3e-23   
ref|XP_007199814.1|  hypothetical protein PRUPE_ppa005187mg             102   3e-23   
ref|XP_004137100.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    101   7e-23   
gb|KGN43888.1|  hypothetical protein Csa_7G072750                       101   7e-23   
ref|XP_011088205.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    100   7e-23   
dbj|BAF75884.1|  glucosyltransferase                                    101   8e-23   Dianthus caryophyllus [carnation]
gb|ABX46222.1|  limonoid UDP glucosyltransferase                      99.4    8e-23   Atalantia ceylanica
ref|XP_006486997.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    101   9e-23   
ref|XP_004304050.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    101   1e-22   
gb|ACD14144.1|  limonoid UDP-glucosyltransferase                        101   1e-22   Citrus x paradisi [grapefruit]
gb|ACD14147.1|  limonoid UDP-glucosyltransferase                        101   1e-22   Citrus sinensis [apfelsine]
ref|XP_006379179.1|  hypothetical protein POPTR_0009s09820g             100   1e-22   
ref|XP_006422922.1|  hypothetical protein CICLE_v10028247mg             101   1e-22   
gb|ABY27084.1|  limonoid UDP-glucosyltransferase                        101   1e-22   Citrus maxima [buntan]
ref|XP_010548894.1|  PREDICTED: UDP-glycosyltransferase 84A1-like       100   1e-22   
sp|Q66PF4.1|CGT_FRAAN  RecName: Full=Cinnamate beta-D-glucosyltra...    101   1e-22   Fragaria x ananassa
gb|ABX46255.1|  limonoid UDP glucosyltransferase                      98.2    2e-22   Citrus maxima [buntan]
gb|ABX46263.1|  limonoid UDP glucosyltransferase                      98.2    2e-22   Citrus trifoliata [hardy orange]
gb|ABX46254.1|  limonoid UDP glucosyltransferase                      98.2    2e-22   Citrus maxima [buntan]
gb|ABX46230.1|  limonoid UDP glucosyltransferase                      98.2    2e-22   Citrus halimii [limau kadangsa]
gb|ABX46238.1|  limonoid UDP glucosyltransferase                      98.2    2e-22   Citrus unshiu [satsuma mandarin]
gb|ABX46262.1|  limonoid UDP glucosyltransferase                      98.2    3e-22   Citrus trifoliata [hardy orange]
gb|ABX46229.1|  limonoid UDP glucosyltransferase                      98.2    3e-22   Citrus halimii [limau kadangsa]
gb|ABX46264.1|  limonoid UDP glucosyltransferase                      98.2    3e-22   Citrus japonica var. margarita [nagami kumquat]
gb|ABX46259.1|  limonoid UDP glucosyltransferase                      98.2    3e-22   Citrus cavaleriei [Ichang papeda]
gb|ABX46237.1|  limonoid UDP glucosyltransferase                      98.2    3e-22   Citrus unshiu [satsuma mandarin]
gb|ABX46260.1|  limonoid UDP glucosyltransferase                      98.2    3e-22   Citrus hanaju
gb|ABX46251.1|  limonoid UDP glucosyltransferase                      97.8    3e-22   Citrus aurantium [bitter orange]
gb|ABX46241.1|  limonoid UDP glucosyltransferase                      97.8    3e-22   Citrus amblycarpa [djerook leemo]
gb|ABX46232.1|  limonoid UDP glucosyltransferase                      97.8    3e-22   Citrus longispina [canniisan]
gb|ABX46231.1|  limonoid UDP glucosyltransferase                      97.8    3e-22   Citrus webberi
gb|ABX46246.1|  limonoid UDP glucosyltransferase                      97.8    3e-22   Citrus nippokoreana [mandarinier]
gb|ABX46247.1|  limonoid UDP glucosyltransferase                      97.8    3e-22   Citrus nippokoreana [mandarinier]
gb|ABX46256.1|  limonoid UDP glucosyltransferase                      97.8    3e-22   Citrus maxima [buntan]
ref|XP_006414503.1|  hypothetical protein EUTSA_v10024946mg           99.0    6e-22   
ref|XP_002313148.2|  hypothetical protein POPTR_0009s09800g           99.0    6e-22   Populus trichocarpa [western balsam poplar]
gb|ABX46233.1|  limonoid UDP glucosyltransferase                      97.1    6e-22   Citrus longispina [canniisan]
gb|ACD14145.1|  limonoid UDP-glucosyltransferase                      99.0    7e-22   Citrus sinensis [apfelsine]
ref|XP_004159932.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  98.2    9e-22   
gb|EPS69550.1|  hypothetical protein M569_05215                       98.2    1e-21   
gb|ABX46235.1|  limonoid UDP glucosyltransferase                      95.9    1e-21   Citrus aurantiifolia [lime]
dbj|BAF99685.1|  putative glycosyltransferase                         97.4    2e-21   Clitoria ternatea
ref|XP_006379180.1|  hypothetical protein POPTR_0009s09830g           97.4    2e-21   
gb|ABL63751.1|  putative limonoid UDP-glucosyltransferase             97.4    2e-21   Citrus hybrid cultivar
ref|NP_193283.2|  UDP-glycosyltransferase 84A1                        97.1    2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAN72025.1|  indole-3-acetate beta-glucosyltransferase like pr...  97.1    2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ABX46224.1|  limonoid UDP glucosyltransferase                      95.1    3e-21   Citrus medica [Buddha's hand]
gb|AII32448.1|  hydroxycinnamate glycosyltransferase                  97.4    3e-21   
gb|ABX46226.1|  limonoid UDP glucosyltransferase                      95.1    3e-21   Citrus medica [Buddha's hand]
gb|ABX46227.1|  limonoid UDP glucosyltransferase                      95.1    3e-21   Citrus medica [Buddha's hand]
emb|CAB10326.1|  indole-3-acetate beta-glucosyltransferase like p...  96.7    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868202.1|  UGT84A1                                          96.7    4e-21   
ref|XP_006285398.1|  hypothetical protein CARUB_v10006803mg           96.3    5e-21   
ref|XP_010943217.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  95.1    1e-20   
gb|ABX46234.1|  limonoid UDP glucosyltransferase                      93.2    1e-20   Citrus aurantiifolia [lime]
emb|CAS03347.1|  sinapate 1-glucosyltransferase                       95.1    2e-20   Brassica napus var. napus [annual rape]
ref|XP_002518670.1|  UDP-glucosyltransferase, putative                94.7    2e-20   Ricinus communis
ref|XP_009145472.1|  PREDICTED: UDP-glycosyltransferase 84A2-like     94.7    2e-20   
ref|XP_010440299.1|  PREDICTED: UDP-glycosyltransferase 84A4-like     94.4    2e-20   
gb|ACU19578.1|  unknown                                               91.7    3e-20   Glycine max [soybeans]
ref|XP_011088204.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  94.4    3e-20   
emb|CAS03352.1|  sinapate 1-glucosyltransferase                       94.4    3e-20   
ref|XP_010928523.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  94.0    3e-20   
emb|CDX90587.1|  BnaA03g41940D                                        94.0    4e-20   
gb|ABX46265.1|  limonoid UDP glucosyltransferase                      91.7    5e-20   Citrus australasica [Australian finger-lime]
ref|XP_010468794.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  92.8    8e-20   
gb|AAF98390.1|AF287143_1  UDP-glucose:sinapate glucosyltransferase    92.8    9e-20   Brassica napus [oilseed rape]
emb|CAS03350.1|  sinapate 1-glucosyltransferase                       92.8    9e-20   Brassica oleracea var. medullosa [marrow-stem kale]
ref|XP_009136698.1|  PREDICTED: UDP-glycosyltransferase 84A1          92.8    1e-19   
ref|XP_010434393.1|  PREDICTED: UDP-glycosyltransferase 84A4-like...  92.4    1e-19   
ref|XP_010488169.1|  PREDICTED: UDP-glycosyltransferase 84A2          92.4    1e-19   
ref|XP_006406256.1|  hypothetical protein EUTSA_v10020520mg           92.4    2e-19   
emb|CDY49300.1|  BnaC01g22410D                                        92.0    2e-19   
ref|XP_009147295.1|  PREDICTED: UDP-glycosyltransferase 84A3-like     92.0    2e-19   
emb|CDY22915.1|  BnaA01g18530D                                        92.0    2e-19   
emb|CDY54974.1|  BnaCnng27830D                                        91.3    2e-19   
emb|CDY19291.1|  BnaC01g31890D                                        92.0    2e-19   
emb|CDY37279.1|  BnaA01g24990D                                        92.0    2e-19   
ref|XP_009109433.1|  PREDICTED: UDP-glycosyltransferase 84A2-like     92.0    2e-19   
emb|CAS03348.1|  sinapate 1-glucosyltransferase                       92.0    2e-19   Brassica napus var. napus [annual rape]
ref|XP_003555960.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  92.0    2e-19   
ref|XP_010434402.1|  PREDICTED: UDP-glycosyltransferase 84A4-like...  91.7    2e-19   
emb|CAS03353.1|  sinapate 1-glucosyltransferase                       92.0    2e-19   
emb|CAS03351.1|  sinapate 1-glucosyltransferase                       91.7    2e-19   Brassica oleracea var. medullosa [marrow-stem kale]
ref|XP_010440301.1|  PREDICTED: UDP-glycosyltransferase 84A4          91.3    3e-19   
emb|CAJ77650.1|  hydroxycinnamate glucosyltransferase                 91.3    3e-19   Brassica napus [oilseed rape]
ref|XP_010434972.1|  PREDICTED: UDP-glycosyltransferase 84A4-like     91.3    3e-19   
ref|XP_010466403.1|  PREDICTED: UDP-glycosyltransferase 84A2-like...  91.3    4e-19   
sp|Q2V6K1.1|UGT_FRAAN  RecName: Full=Putative UDP-glucose glucosy...  90.9    4e-19   Fragaria x ananassa
emb|CDY54975.1|  BnaCnng27840D                                        90.9    4e-19   
ref|XP_008806065.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  90.9    5e-19   
ref|XP_009147653.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  90.9    5e-19   
emb|CDY09758.1|  BnaC07g33030D                                        90.9    5e-19   
ref|NP_193285.1|  UDP-glycosyltransferase 84A4                        90.5    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297509.1|  hypothetical protein CARUB_v10013531mg           90.5    6e-19   
ref|XP_010247542.1|  PREDICTED: limonoid UDP-glucosyltransferase      90.5    7e-19   
ref|XP_010434973.1|  PREDICTED: UDP-glycosyltransferase 84A4-like     89.7    1e-18   
ref|XP_006285888.1|  hypothetical protein CARUB_v10007399mg           89.7    1e-18   
ref|XP_002868199.1|  UGT84A4                                          89.7    1e-18   
ref|NP_188793.1|  sinapic acid:UDP-glucose glucosyltransferase        89.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13998.1|  putative UDP-glucose:indole-3-acetate beta-D-gluc...  89.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286013.1|  hypothetical protein CARUB_v10007541mg           89.0    2e-18   
dbj|BAQ19550.1|  UDP-glucose:flavone 6-C-glucosyltransferase          89.0    3e-18   
ref|XP_010510360.1|  PREDICTED: UDP-glycosyltransferase 84A2-like     88.6    3e-18   
ref|XP_006283666.1|  hypothetical protein CARUB_v10004723mg           88.2    5e-18   
ref|XP_010943278.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  87.8    6e-18   
ref|XP_010434978.1|  PREDICTED: UDP-glycosyltransferase 84A3          87.8    6e-18   
ref|XP_006414506.1|  hypothetical protein EUTSA_v10025072mg           87.4    7e-18   
ref|XP_007143049.1|  hypothetical protein PHAVU_007G039300g           87.4    1e-17   
ref|XP_006414502.1|  hypothetical protein EUTSA_v10025056mg           87.0    1e-17   
gb|KHN42370.1|  Limonoid UDP-glucosyltransferase                      86.7    1e-17   
ref|XP_007143048.1|  hypothetical protein PHAVU_007G039200g           86.3    2e-17   
gb|AAM64979.1|  indole-3-acetate beta-glucosyltransferase like pr...  85.9    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414498.1|  hypothetical protein EUTSA_v10025055mg           85.9    3e-17   
ref|XP_002883311.1|  UGT84A2                                          85.9    3e-17   
ref|NP_193284.1|  UDP-glycosyltransferase 84A3                        85.5    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KEH44083.1|  limonoid UDP glucosyltransferase, putative            83.2    5e-17   
gb|KFK39470.1|  hypothetical protein AALP_AA3G248400                  85.1    6e-17   
ref|XP_002449178.1|  hypothetical protein SORBIDRAFT_05g006070        81.3    7e-17   Sorghum bicolor [broomcorn]
ref|XP_002868200.1|  hypothetical protein ARALYDRAFT_493341           84.7    8e-17   
gb|KFK39632.1|  hypothetical protein AALP_AA3G268800                  84.7    9e-17   
ref|XP_010416989.1|  PREDICTED: UDP-glycosyltransferase 84A1-like     84.0    2e-16   
ref|XP_010429148.1|  PREDICTED: UDP-glycosyltransferase 84A1-like     83.6    2e-16   
gb|KFK39476.1|  sinapate 1-glucosyltransferase                        83.6    2e-16   
gb|EYU37624.1|  hypothetical protein MIMGU_mgv1a023901mg              83.6    2e-16   
ref|XP_009147306.1|  PREDICTED: UDP-glycosyltransferase 84A1-like     83.6    2e-16   
ref|XP_006283659.1|  hypothetical protein CARUB_v10004716mg           83.6    2e-16   
ref|XP_009396353.1|  PREDICTED: putative UDP-glucose glucosyltran...  82.8    4e-16   
gb|KFK39465.1|  hypothetical protein AALP_AA3G248100                  82.4    5e-16   
gb|ACD03236.1|  UDP-glycosyltransferase UGT84C2                       82.4    6e-16   Avena strigosa
ref|XP_010474427.1|  PREDICTED: UDP-glycosyltransferase 84A1-like     79.7    6e-16   
ref|XP_010429410.1|  PREDICTED: UDP-glycosyltransferase 84A1-like     82.0    6e-16   
ref|XP_010434409.1|  PREDICTED: UDP-glycosyltransferase 84A4-like...  82.0    7e-16   
gb|KEH27323.1|  limonoid UDP-glucosyltransferase-like protein         81.3    8e-16   
ref|XP_010113173.1|  Putative UDP-glucose glucosyltransferase         81.3    1e-15   
emb|CDY49298.1|  BnaC01g22430D                                        80.5    1e-15   
ref|XP_002453916.1|  hypothetical protein SORBIDRAFT_04g021390        78.6    1e-15   Sorghum bicolor [broomcorn]
ref|XP_002868201.1|  hypothetical protein ARALYDRAFT_915253           80.5    1e-15   
gb|KEH44080.1|  UDP-glucosyltransferase family protein                79.7    2e-15   
ref|NP_001147693.1|  LOC100281303                                     80.9    2e-15   Zea mays [maize]
gb|KEH44073.1|  limonoid UDP-glucosyltransferase-like protein         80.5    2e-15   
emb|CAJ77651.1|  UDP glucosyltransferase related                      80.5    2e-15   Brassica napus [oilseed rape]
ref|NP_001151310.1|  limonoid UDP-glucosyltransferase                 80.5    2e-15   Zea mays [maize]
gb|AFK47005.1|  unknown                                               80.1    2e-15   
ref|XP_008454995.1|  PREDICTED: putative UDP-glucose glucosyltran...  80.1    3e-15   
ref|XP_004171652.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  76.3    4e-15   
gb|KEH44084.1|  limonoid UDP-glucosyltransferase-like protein         79.7    5e-15   
gb|EMT28291.1|  Limonoid UDP-glucosyltransferase                      77.4    5e-15   
gb|KEH44087.1|  limonoid UDP-glucosyltransferase-like protein         79.7    5e-15   
dbj|BAJ94810.1|  predicted protein                                    79.3    7e-15   
ref|XP_008454994.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  79.0    8e-15   
gb|KHN06135.1|  Limonoid UDP-glucosyltransferase                      74.7    1e-14   
ref|XP_006282251.1|  hypothetical protein CARUB_v10028525mg           78.6    1e-14   
ref|XP_009385207.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  78.2    1e-14   
ref|XP_002453431.1|  hypothetical protein SORBIDRAFT_04g005960        78.2    2e-14   Sorghum bicolor [broomcorn]
gb|EMT28615.1|  Limonoid UDP-glucosyltransferase                      76.6    2e-14   
gb|KEH40628.1|  limonoid UDP-glucosyltransferase-like protein         77.8    3e-14   
ref|XP_003599976.1|  Limonoid UDP-glucosyltransferase                 77.4    3e-14   
gb|KEH44078.1|  limonoid UDP-glucosyltransferase-like protein         77.4    3e-14   
ref|XP_004137097.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  77.0    4e-14   
gb|KGN43884.1|  Resveratrol/hydroxycinnamic acid O-glucosyltransf...  77.0    4e-14   
gb|KGN43885.1|  hypothetical protein Csa_7G072720                     77.0    4e-14   
ref|XP_004137096.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  77.0    4e-14   
emb|CDY22912.1|  BnaA01g18500D                                        73.9    4e-14   
ref|XP_006295862.1|  hypothetical protein CARUB_v10024992mg           77.0    5e-14   
gb|KEH20034.1|  limonoid UDP-glucosyltransferase-like protein         76.6    5e-14   
gb|AFW66251.1|  limonoid UDP-glucosyltransferase                      76.6    5e-14   
gb|ABI94023.1|  (iso)flavonoid glycosyltransferase                    75.9    8e-14   Medicago truncatula
ref|XP_003571042.2|  PREDICTED: putative UDP-glucose glucosyltran...  76.3    1e-13   
dbj|BAK00383.1|  predicted protein                                    75.1    2e-13   
ref|XP_004965213.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  75.1    2e-13   
gb|EEE56467.1|  hypothetical protein OsJ_05681                        72.4    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137099.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  73.9    5e-13   
ref|XP_004496937.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  73.9    5e-13   
dbj|BAO66179.1|  UDP-glucose dependent p-hydroxybenzoic acid gluc...  72.8    1e-12   
gb|KEH20033.1|  limonoid UDP-glucosyltransferase-like protein         72.4    2e-12   
ref|XP_008649287.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  72.0    2e-12   
ref|XP_004966898.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  70.9    6e-12   
ref|NP_001046133.1|  Os02g0188000                                     70.1    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AFJ52991.1|  UDP-glycosyltransferase 1                             69.3    2e-11   
ref|XP_002438232.1|  hypothetical protein SORBIDRAFT_10g009990        68.9    2e-11   Sorghum bicolor [broomcorn]
gb|AFJ52989.1|  UDP-glycosyltransferase 1                             68.6    3e-11   
ref|XP_004496936.1|  PREDICTED: putative UDP-glucose glucosyltran...  68.2    5e-11   
emb|CAE48293.1|  glucosyltransferase 4                                68.2    5e-11   
gb|KEH44086.1|  limonoid UDP-glucosyltransferase-like protein         68.2    6e-11   
emb|CDM85855.1|  unnamed protein product                              67.8    8e-11   
ref|XP_006654752.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  67.8    8e-11   
ref|NP_001152529.1|  indole-3-acetate beta-glucosyltransferase        67.0    1e-10   Zea mays [maize]
ref|NP_001056258.2|  Os05g0552700                                     67.0    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64621.1|  hypothetical protein OsJ_19473                        66.2    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY98947.1|  hypothetical protein OsI_20902                        66.2    3e-10   Oryza sativa Indica Group [Indian rice]
gb|AAT85196.1|  unknown protein                                       66.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010247543.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     65.9    3e-10   
gb|AFJ52990.1|  UDP-glycosyltransferase 1                             65.1    5e-10   
ref|XP_002441484.1|  hypothetical protein SORBIDRAFT_09g027760        63.5    2e-09   Sorghum bicolor [broomcorn]
ref|XP_002455167.1|  hypothetical protein SORBIDRAFT_03g005340        62.4    5e-09   Sorghum bicolor [broomcorn]
ref|XP_008673722.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  62.0    7e-09   
dbj|BAJ89063.1|  predicted protein                                    61.6    9e-09   
ref|NP_001043904.1|  Os01g0686200                                     61.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA53510.1|  TPA: hypothetical protein ZEAMMB73_531581            61.2    1e-08   
ref|XP_008675174.1|  PREDICTED: UDP-glycosyltransferase 84A1-like     60.8    2e-08   
dbj|BAK00341.1|  predicted protein                                    60.1    3e-08   
ref|XP_004961303.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  60.1    4e-08   
dbj|BAO66181.1|  hypothetical protein                                 59.3    5e-08   
ref|XP_007042537.1|  UDP-glucoronosyl/UDP-glucosyltransferase         59.3    6e-08   
emb|CDM83896.1|  unnamed protein product                              59.3    6e-08   
ref|XP_002457383.1|  hypothetical protein SORBIDRAFT_03g006415        57.4    7e-08   Sorghum bicolor [broomcorn]
gb|EMT31240.1|  Limonoid UDP-glucosyltransferase                      58.9    7e-08   
gb|ABR16243.1|  unknown                                               58.9    8e-08   Picea sitchensis
gb|KCW63691.1|  hypothetical protein EUGRSUZ_G01343                   55.8    9e-08   
ref|XP_003565946.1|  PREDICTED: UDP-glycosyltransferase 84A2-like     58.5    1e-07   
ref|XP_010647893.1|  PREDICTED: UDP-glycosyltransferase 84B1          58.5    1e-07   
gb|EEC71295.1|  hypothetical protein OsI_03309                        58.5    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_004951628.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  58.5    1e-07   
ref|XP_003536615.2|  PREDICTED: UDP-glycosyltransferase 84B1-like     57.4    3e-07   
ref|XP_008779947.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     54.3    5e-07   
gb|KDP32590.1|  hypothetical protein JCGZ_13140                       56.6    5e-07   
gb|ABR17105.1|  unknown                                               56.2    6e-07   Picea sitchensis
gb|ABR16264.1|  unknown                                               56.2    7e-07   Picea sitchensis
dbj|BAG80534.1|  putative glycosyltransferase                         56.2    7e-07   
gb|KEH44090.1|  UDP-glucosyltransferase family protein                55.8    8e-07   
ref|XP_004246642.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     55.8    1e-06   
ref|XP_006370131.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  55.5    1e-06   
ref|XP_006354352.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     55.5    1e-06   
emb|CBI39402.3|  unnamed protein product                              54.7    1e-06   
ref|XP_002263498.1|  PREDICTED: crocetin glucosyltransferase, chl...  55.5    1e-06   
gb|KEH25946.1|  UDP-glucosyltransferase family protein                55.1    2e-06   
ref|XP_006447931.1|  hypothetical protein CICLE_v10015145mg           55.1    2e-06   
ref|XP_002266919.1|  PREDICTED: crocetin glucosyltransferase, chl...  55.1    2e-06   
ref|XP_011002910.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  55.1    2e-06   
ref|XP_002529824.1|  UDP-glucosyltransferase, putative                55.1    2e-06   
emb|CBI39398.3|  unnamed protein product                              55.1    2e-06   
ref|XP_011002911.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  55.1    2e-06   
ref|XP_011002951.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  55.1    2e-06   
ref|XP_004965029.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  55.1    2e-06   
ref|XP_004247895.1|  PREDICTED: crocetin glucosyltransferase, chl...  55.1    2e-06   
ref|XP_002313147.2|  putative glucosyltransferase family protein      55.1    2e-06   
ref|XP_003593141.1|  Cytokinin-O-glucosyltransferase                  54.7    2e-06   
ref|XP_011004945.1|  PREDICTED: UDP-glycosyltransferase 84B1-like     54.7    2e-06   
ref|XP_010042881.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     52.8    2e-06   
ref|XP_002310478.2|  hypothetical protein POPTR_0007s00850g           54.3    2e-06   
ref|XP_010065965.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     54.7    3e-06   
ref|XP_004969574.1|  PREDICTED: UDP-glycosyltransferase 84A1-like     54.3    3e-06   
ref|XP_006469358.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  54.3    3e-06   
ref|XP_002529823.1|  UDP-glucosyltransferase, putative                54.3    3e-06   
ref|XP_002518671.1|  UDP-glucosyltransferase, putative                54.3    3e-06   
dbj|BAG80543.1|  UDP-glucose:glucosyltransferase                      53.9    4e-06   
ref|XP_007143052.1|  hypothetical protein PHAVU_007G039600g           53.9    4e-06   
ref|XP_011047633.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     52.4    4e-06   
ref|XP_003632087.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     53.9    4e-06   
ref|XP_009399677.1|  PREDICTED: UDP-glycosyltransferase 85A7-like     52.0    4e-06   
emb|CDP00213.1|  unnamed protein product                              53.9    4e-06   
emb|CDP18343.1|  unnamed protein product                              53.9    4e-06   
ref|XP_010089824.1|  UDP-glycosyltransferase 85A1                     53.9    4e-06   
gb|EMS52500.1|  UDP-glycosyltransferase 85A3                          53.9    4e-06   
gb|EEC71291.1|  hypothetical protein OsI_03305                        53.9    5e-06   
ref|XP_002516389.1|  UDP-glucosyltransferase, putative                53.5    5e-06   
ref|NP_001043905.1|  Os01g0686300                                     53.5    5e-06   
ref|XP_002463518.1|  hypothetical protein SORBIDRAFT_01g001220        53.5    5e-06   
ref|XP_010041912.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     51.6    5e-06   
ref|XP_002323756.1|  hypothetical protein POPTR_0017s07875g           50.1    5e-06   
gb|EAY75408.1|  hypothetical protein OsI_03310                        53.5    5e-06   
ref|XP_004247894.1|  PREDICTED: crocetin glucosyltransferase, chl...  53.5    5e-06   
ref|XP_006447926.1|  hypothetical protein CICLE_v10015147mg           53.5    6e-06   
ref|XP_011081386.1|  PREDICTED: crocetin glucosyltransferase, chl...  53.5    6e-06   
ref|XP_009630995.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     53.5    6e-06   
ref|XP_009783229.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     53.1    7e-06   
ref|XP_010672483.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     53.1    7e-06   
ref|XP_011020320.1|  PREDICTED: crocetin glucosyltransferase, chl...  53.1    7e-06   
gb|KCW57502.1|  hypothetical protein EUGRSUZ_H00273                   53.1    7e-06   
gb|KCW57503.1|  hypothetical protein EUGRSUZ_H00275                   53.1    7e-06   
gb|ACS87991.1|  UDP-glucosyltransferase family 1 protein              53.1    8e-06   
ref|XP_010069228.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     53.1    8e-06   
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                  53.1    8e-06   
gb|AEO45781.1|  cyanohydrin UDP-glucosyltransferase UGT85K4           53.1    8e-06   
ref|XP_010450127.1|  PREDICTED: UDP-glycosyltransferase 75C1-like     52.8    9e-06   
ref|XP_010037076.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     52.8    9e-06   
gb|EYU34481.1|  hypothetical protein MIMGU_mgv11b016263mg             50.4    9e-06   
ref|XP_006422923.1|  hypothetical protein CICLE_v10028293mg           52.8    9e-06   
emb|CAN62622.1|  hypothetical protein VITISV_001655                   52.8    9e-06   
ref|XP_006858833.1|  hypothetical protein AMTR_s00066p00178390        50.4    9e-06   
ref|XP_010037078.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     52.8    9e-06   
ref|XP_004171568.1|  PREDICTED: putative UDP-glucose glucosyltran...  52.8    1e-05   
ref|XP_006853452.1|  hypothetical protein AMTR_s00032p00188000        52.8    1e-05   
ref|XP_002278455.1|  PREDICTED: UDP-glycosyltransferase 74F2          52.8    1e-05   
ref|XP_007143051.1|  hypothetical protein PHAVU_007G039500g           52.8    1e-05   
ref|XP_006486998.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     52.8    1e-05   
dbj|BAG80545.1|  UDP-glucose:glucosyltransferase                      52.8    1e-05   
ref|XP_011073993.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     52.8    1e-05   
ref|XP_006853257.1|  hypothetical protein AMTR_s00038p00230020        49.7    1e-05   
ref|XP_010107491.1|  UDP-glycosyltransferase 86A1                     50.4    1e-05   
dbj|BAK00666.1|  predicted protein                                    52.8    1e-05   
ref|XP_002971413.1|  hypothetical protein SELMODRAFT_172111           52.8    1e-05   
gb|EYU23397.1|  hypothetical protein MIMGU_mgv1a024506mg              52.4    1e-05   
emb|CBI24715.3|  unnamed protein product                              52.4    1e-05   
gb|ABB88580.1|  UDP-glucosyltransferase                               52.4    1e-05   
ref|XP_002308970.1|  putative glucosyltransferase family protein      52.4    1e-05   
gb|KDP45199.1|  hypothetical protein JCGZ_15064                       52.4    1e-05   
ref|XP_010069226.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     52.4    1e-05   
ref|XP_002267330.2|  PREDICTED: crocetin glucosyltransferase, chl...  52.4    1e-05   
ref|XP_006856435.1|  hypothetical protein AMTR_s00047p00226070        49.3    1e-05   
ref|XP_011091584.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     52.4    1e-05   
gb|AEW09372.1|  hypothetical protein UMN_7453_02                      50.1    1e-05   
gb|AEO45782.1|  cyanohydrin UDP-glucosyltransferase UGT85K5           52.4    1e-05   
gb|AFG54191.1|  hypothetical protein UMN_7453_02                      49.7    1e-05   
ref|XP_010069224.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     52.4    1e-05   
ref|XP_010069225.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     52.4    2e-05   
gb|KDO60213.1|  hypothetical protein CISIN_1g011789mg                 52.4    2e-05   
ref|XP_006488636.1|  PREDICTED: UDP-glycosyltransferase 86A2-like     52.4    2e-05   
ref|XP_006424499.1|  hypothetical protein CICLE_v10029902mg           52.4    2e-05   
ref|XP_002529826.1|  UDP-glucosyltransferase, putative                52.0    2e-05   
ref|XP_006373048.1|  hypothetical protein POPTR_0017s079102g          50.1    2e-05   
gb|KDP35130.1|  hypothetical protein JCGZ_10664                       52.0    2e-05   
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  52.0    2e-05   
gb|EEE55201.1|  hypothetical protein OsJ_03049                        52.0    2e-05   
gb|ADE76691.1|  unknown                                               52.0    2e-05   
ref|XP_006355935.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     52.0    2e-05   
ref|XP_007143050.1|  hypothetical protein PHAVU_007G039400g           52.0    2e-05   
ref|XP_006469357.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     52.0    2e-05   
ref|XP_006447930.1|  hypothetical protein CICLE_v10015149mg           52.0    2e-05   
gb|KDP40913.1|  hypothetical protein JCGZ_24912                       51.6    2e-05   
gb|ABB88579.1|  UDP-glucosyltransferase                               51.6    2e-05   
gb|EAY78678.1|  hypothetical protein OsI_33780                        52.0    2e-05   
dbj|BAG80544.1|  UDP-glucose:glucosyltransferase                      52.0    2e-05   
ref|XP_002529825.1|  UDP-glucosyltransferase, putative                52.0    2e-05   
gb|ABK24601.1|  unknown                                               51.2    2e-05   
gb|ACM09899.2|  glycosyltransferase                                   52.0    2e-05   
dbj|BAK02647.1|  predicted protein                                    52.0    2e-05   
ref|XP_010679007.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     51.6    2e-05   
ref|XP_011069428.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     51.2    2e-05   
ref|XP_002868314.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  51.6    2e-05   
ref|XP_004244485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     51.6    2e-05   
ref|XP_010450109.1|  PREDICTED: UDP-glycosyltransferase 75C1          51.6    2e-05   
ref|XP_006355936.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     51.6    2e-05   
ref|XP_004289188.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     51.6    2e-05   
ref|XP_002322699.1|  hypothetical protein POPTR_0016s05290g           51.6    3e-05   
gb|EYU32718.1|  hypothetical protein MIMGU_mgv1a005538mg              51.6    3e-05   
dbj|BAB88935.1|  glucosyltransferase                                  51.6    3e-05   
ref|XP_010242477.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     51.6    3e-05   
gb|EMT23576.1|  Cytokinin-O-glucosyltransferase 2                     50.8    3e-05   
dbj|BAG80541.1|  UDP-glucose:glucosyltransferase                      51.6    3e-05   
ref|XP_002520220.1|  UDP-glucosyltransferase, putative                51.6    3e-05   
ref|XP_010037080.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     51.6    3e-05   
ref|XP_006421040.1|  hypothetical protein CICLE_v10004909mg           51.6    3e-05   
ref|XP_006357101.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     51.6    3e-05   
ref|XP_006358760.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  51.2    3e-05   
ref|XP_010025339.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     51.2    3e-05   
gb|AFJ52995.1|  UDP-glycosyltransferase 1                             51.6    3e-05   
ref|XP_006858829.1|  hypothetical protein AMTR_s00066p00177490        51.2    3e-05   
ref|XP_009612652.1|  PREDICTED: crocetin glucosyltransferase, chl...  51.2    3e-05   
ref|XP_011094623.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     51.2    3e-05   
ref|XP_006368000.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  51.2    3e-05   
gb|EYU34480.1|  hypothetical protein MIMGU_mgv1a004928mg              51.2    3e-05   
ref|XP_010527436.1|  PREDICTED: UDP-glycosyltransferase 75C1 isof...  51.2    3e-05   
ref|XP_009590532.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     51.2    3e-05   
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     51.2    3e-05   
gb|AFW67573.1|  hypothetical protein ZEAMMB73_646912                  51.2    3e-05   
ref|XP_006350953.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     51.2    3e-05   
ref|XP_006858363.1|  hypothetical protein AMTR_s00064p00191380        49.7    4e-05   
ref|XP_007034187.1|  Indole-3-acetate beta-D-glucosyltransferase,...  51.2    4e-05   
gb|ABB88578.1|  UDP-glucosyltransferase                               51.2    4e-05   
ref|XP_006447240.1|  hypothetical protein CICLE_v10015138mg           51.2    4e-05   
dbj|BAG80546.1|  UDP-glucose:glucosyltransferase                      51.2    4e-05   
ref|XP_008359346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     50.4    4e-05   
emb|CDP07057.1|  unnamed protein product                              51.2    4e-05   
ref|XP_011033298.1|  PREDICTED: crocetin glucosyltransferase, chl...  51.2    4e-05   
gb|KCW82891.1|  hypothetical protein EUGRSUZ_C04261                   51.2    4e-05   
dbj|BAF75888.1|  glucosyltransferase                                  50.8    4e-05   
gb|AAL69494.1|  putative glucosyltransferase                          50.8    4e-05   
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     50.8    4e-05   
ref|XP_011094626.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     51.2    4e-05   
ref|XP_008809703.1|  PREDICTED: UDP-glycosyltransferase 86A2-like     51.2    4e-05   
ref|XP_008646498.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     50.8    4e-05   
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  50.8    4e-05   
ref|XP_011089946.1|  PREDICTED: UDP-glycosyltransferase 86A2          50.8    4e-05   
ref|XP_010673328.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.8    4e-05   
ref|XP_011082052.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     50.8    4e-05   
gb|AIE12488.1|  UGT8                                                  50.8    4e-05   
ref|XP_006447928.1|  hypothetical protein CICLE_v10017682mg           50.8    4e-05   
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                        50.8    4e-05   
ref|XP_004485548.1|  PREDICTED: UDP-glycosyltransferase 85A7-like     50.8    5e-05   
gb|KEH31480.1|  UDP-glucosyltransferase family protein                50.8    5e-05   
ref|XP_006492998.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     50.8    5e-05   
gb|ADE76226.1|  unknown                                               50.8    5e-05   
gb|AIE12476.1|  UGT7                                                  50.8    5e-05   
ref|XP_010435193.1|  PREDICTED: UDP-glycosyltransferase 75C1-like     50.8    5e-05   
ref|XP_010023603.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.8    5e-05   
gb|AIE12489.1|  UGT9                                                  50.4    5e-05   
ref|XP_010243149.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.4    5e-05   
ref|XP_010691669.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     50.8    5e-05   
gb|KFK36297.1|  hypothetical protein AALP_AA4G104100                  50.4    5e-05   
ref|XP_011094622.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     50.4    5e-05   
gb|EYU18461.1|  hypothetical protein MIMGU_mgv1a004968mg              50.8    5e-05   
ref|XP_010246531.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.4    5e-05   
ref|XP_004496938.1|  PREDICTED: UDP-glycosyltransferase 84B1-like...  50.4    6e-05   
ref|XP_002310553.1|  hypothetical protein POPTR_0007s05230g           50.4    6e-05   
ref|XP_008809704.1|  PREDICTED: UDP-glycosyltransferase 86A2-like     50.4    6e-05   
gb|KDP29702.1|  hypothetical protein JCGZ_18637                       50.4    6e-05   
ref|XP_010679010.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  50.4    6e-05   
ref|XP_007027384.1|  UDP-Glycosyltransferase superfamily protein      50.4    6e-05   
ref|XP_011091585.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     50.4    6e-05   
ref|NP_193146.1|  anthocyanin 5-O-glucosyltransferase                 50.4    6e-05   
ref|XP_009784463.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     50.4    6e-05   
dbj|BAE98677.1|  glucosyltransferase like protein                     50.4    6e-05   
gb|EYU34478.1|  hypothetical protein MIMGU_mgv1a020724mg              50.4    6e-05   
ref|XP_009613938.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     50.4    6e-05   
gb|EMT15333.1|  Cytokinin-O-glucosyltransferase 2                     50.4    6e-05   
ref|XP_006350954.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     50.4    6e-05   
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g           50.4    6e-05   
ref|XP_010030531.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     50.4    6e-05   
ref|XP_010023602.1|  PREDICTED: crocetin glucosyltransferase, chl...  50.4    6e-05   
ref|XP_004249916.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     50.4    7e-05   
ref|XP_006447924.1|  hypothetical protein CICLE_v100176652mg          47.8    7e-05   
ref|XP_004958356.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     50.4    7e-05   
ref|XP_006447932.1|  hypothetical protein CICLE_v10015140mg           50.4    7e-05   
ref|XP_006372899.1|  hypothetical protein POPTR_0017s061202g          47.4    7e-05   
ref|XP_002971739.1|  hypothetical protein SELMODRAFT_12643            50.1    7e-05   
ref|XP_003570610.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  50.4    7e-05   
gb|KCW44218.1|  hypothetical protein EUGRSUZ_L023572                  48.1    7e-05   
gb|KDO43525.1|  hypothetical protein CISIN_1g012194mg                 50.1    7e-05   
ref|XP_002991555.1|  hypothetical protein SELMODRAFT_22868            50.1    7e-05   
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  50.1    7e-05   
ref|XP_006855046.1|  hypothetical protein AMTR_s00031p00082410        50.1    7e-05   
ref|XP_009630994.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     50.1    7e-05   
dbj|BAJ89621.1|  predicted protein                                    50.1    7e-05   
gb|KDO40365.1|  hypothetical protein CISIN_1g022744mg                 49.3    7e-05   
gb|KDP31143.1|  hypothetical protein JCGZ_11519                       50.1    7e-05   
gb|AEZ01222.1|  UDP-glucosyltransferase                               50.1    8e-05   
ref|XP_010069221.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     50.1    8e-05   
gb|KCW83702.1|  hypothetical protein EUGRSUZ_B00577                   50.1    8e-05   
ref|XP_006282890.1|  hypothetical protein CARUB_v10007134mg           50.1    8e-05   
gb|AAR06920.1|  UDP-glycosyltransferase 74G1                          50.1    9e-05   
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg           50.1    9e-05   
gb|KDO40364.1|  hypothetical protein CISIN_1g022744mg                 49.3    9e-05   
ref|XP_010530731.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     50.1    9e-05   
ref|XP_009376817.1|  PREDICTED: UDP-glycosyltransferase 86A1-like     50.1    9e-05   
ref|XP_010253969.1|  PREDICTED: UDP-glycosyltransferase 86A2-like     50.1    9e-05   
gb|KHN33502.1|  UDP-glycosyltransferase 85A2                          50.1    9e-05   
ref|XP_002263700.1|  PREDICTED: crocetin glucosyltransferase, chl...  49.7    9e-05   
ref|XP_006858830.1|  hypothetical protein AMTR_s00066p00177790        49.7    9e-05   



>emb|CBI40254.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SNI+ +PTP GD
Sbjct  7    LVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKQMRKA-SNITDQPTPVGD  65

Query  274  GMIRFEFFDD  303
            GMIRFEFF+D
Sbjct  66   GMIRFEFFED  75



>emb|CBI40264.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SNI+ +PTP GD
Sbjct  7    LVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKQMRKA-SNITDQPTPVGD  65

Query  274  GMIRFEFFDD  303
            GMIRFEFF+D
Sbjct  66   GMIRFEFFED  75



>gb|ACM41589.1| UDP-glucosyltransferase 1 [Capsicum annuum]
Length=475

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGSK   G +L HA L+SFPGQGHV PL+RL KRLASKGLLVTFSAPE+ G +M+ AN  
Sbjct  1    MGSKVSEG-ALVHAFLVSFPGQGHVKPLIRLAKRLASKGLLVTFSAPESFGAEMKGANPK  59

Query  244  ISGEPTPYGDGMIRFEFFDDE  306
            IS EPTPYG GM+RF+FF+DE
Sbjct  60   ISCEPTPYGSGMMRFDFFEDE  80



>ref|XP_004244752.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   118 bits (295),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 67/82 (82%), Gaps = 6/82 (7%)
 Frame = +1

Query  64   MGSKEIAGPSLP--HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKAN  237
            MGS+   GP  P  H  LISFPGQGHVNPLLRLGKRLASKG+LVTF APE VG+DMR+AN
Sbjct  1    MGSQ---GPIDPFIHVFLISFPGQGHVNPLLRLGKRLASKGVLVTFCAPECVGKDMREAN  57

Query  238  SN-ISGEPTPYGDGMIRFEFFD  300
             N IS EPTPYGDG IRFEFF+
Sbjct  58   KNIISDEPTPYGDGFIRFEFFN  79



>emb|CBI22524.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 5/81 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+      L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTFS PE++G+ MRKA SN
Sbjct  1    MGSES----KLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFSTPESIGKQMRKA-SN  55

Query  244  ISGEPTPYGDGMIRFEFFDDE  306
            I+ +PTP G+G+IRFEFF+DE
Sbjct  56   ITDQPTPVGEGLIRFEFFEDE  76



>ref|XP_006355777.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Solanum 
tuberosum]
Length=488

 Score =   117 bits (294),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN-ISGEPTPY  267
            S  H  LISFPGQGHVNPLLRLGKRLASKG+LVTF APE VG+DMR+AN N IS EPTPY
Sbjct  9    SFIHVFLISFPGQGHVNPLLRLGKRLASKGVLVTFCAPECVGKDMREANKNIISDEPTPY  68

Query  268  GDGMIRFEFFD  300
            GDG IRFEFF+
Sbjct  69   GDGFIRFEFFN  79



>emb|CDO97225.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   117 bits (293),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS  +   SL H  L+SFPGQGHVNPLLRLGKRLA+KGLLVT SAPE +G+++RKAN  
Sbjct  1    MGSHSLPC-SLVHVFLVSFPGQGHVNPLLRLGKRLAAKGLLVTLSAPELIGKEIRKAN-Q  58

Query  244  ISGEPTPYGDGMIRFEFFDDE  306
            +S EPTP GDGMIRFEFFDDE
Sbjct  59   MSDEPTPVGDGMIRFEFFDDE  79



>ref|NP_001267849.1| cinnamate beta-D-glucosyltransferase-like [Vitis vinifera]
 emb|CAN71972.1| hypothetical protein VITISV_028318 [Vitis vinifera]
 gb|AEW31189.1| glucosyltransferase [Vitis vinifera]
Length=479

 Score =   115 bits (287),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+      L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SN
Sbjct  1    MGSES----KLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKQMRKA-SN  55

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I+ +PTP GDGMIRFEFF+D
Sbjct  56   ITDQPTPVGDGMIRFEFFED  75



>gb|AEW31188.1| glucosyltransferase [Vitis vinifera]
Length=479

 Score =   115 bits (287),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+      L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SN
Sbjct  1    MGSES----KLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKQMRKA-SN  55

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I+ +PTP GDGMIRFEFF+D
Sbjct  56   ITDQPTPVGDGMIRFEFFED  75



>ref|XP_002285379.1| PREDICTED: limonoid UDP-glucosyltransferase [Vitis vinifera]
 emb|CAN78291.1| hypothetical protein VITISV_020172 [Vitis vinifera]
Length=479

 Score =   115 bits (287),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+      L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SN
Sbjct  1    MGSES----KLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKQMRKA-SN  55

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I+ +PTP GDGMIRFEFF+D
Sbjct  56   ITDQPTPVGDGMIRFEFFED  75



>gb|ABH03018.1| resveratrol/hydroxycinnamic acid O-glucosyltransferase [Vitis 
labrusca]
Length=479

 Score =   115 bits (287),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 5/80 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+      L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SN
Sbjct  1    MGSES----KLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKQMRKA-SN  55

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I+ +PTP GDGMIRFEFF+D
Sbjct  56   ITDQPTPVGDGMIRFEFFED  75



>ref|XP_007042538.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOX98369.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=506

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTFS PE+ G+ M KAN+ I+ EPTP GD
Sbjct  6    LVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFSTPESFGKQMTKANNMITDEPTPVGD  65

Query  274  GMIRFEFFDD  303
            G IRFEFF D
Sbjct  66   GFIRFEFFKD  75



>gb|AEW31187.1| glucosyltransferase [Vitis vinifera]
Length=478

 Score =   114 bits (286),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 5/81 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+      L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTFS PE++G+ MRKA SN
Sbjct  1    MGSES----KLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFSTPESIGKQMRKA-SN  55

Query  244  ISGEPTPYGDGMIRFEFFDDE  306
            I+ +PTP G+G+IRFEFF+DE
Sbjct  56   ITDQPTPVGEGLIRFEFFEDE  76



>ref|XP_002274256.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Vitis vinifera]
Length=478

 Score =   114 bits (286),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 5/81 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+      L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTFS PE++G+ MRKA SN
Sbjct  1    MGSES----KLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFSTPESIGKQMRKA-SN  55

Query  244  ISGEPTPYGDGMIRFEFFDDE  306
            I+ +PTP G+G+IRFEFF+DE
Sbjct  56   ITDQPTPVGEGLIRFEFFEDE  76



>ref|XP_009614247.1| PREDICTED: cinnamate beta-D-glucosyltransferase {ECO:0000303|PubMed:16443693, 
ECO:0000303|PubMed:17323078}-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  +ISFPGQGHVNPLLRLGK LA+KG+LVTFS  E+ G  MRKAN NIS EPTPYG GM
Sbjct  11   HVFMISFPGQGHVNPLLRLGKLLAAKGILVTFSTTESHGAQMRKANKNISDEPTPYGSGM  70

Query  280  IRFEFFDD  303
            IRF+FFDD
Sbjct  71   IRFQFFDD  78



>ref|XP_009757097.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Nicotiana sylvestris]
Length=493

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS    G +L H  L+SFPGQGHVNPLLRLGKRLA+KGL VTFSAPE+ G +M+K+N  
Sbjct  1    MGSTVSEG-ALVHVFLVSFPGQGHVNPLLRLGKRLAAKGLFVTFSAPESCGSEMKKSNPK  59

Query  244  I-SGEPTPYGDGMIRFEFFDDE  306
            I + EP PYG+GM+RFEFFDD+
Sbjct  60   ITTSEPIPYGNGMMRFEFFDDD  81



>emb|CAN59771.1| hypothetical protein VITISV_029146 [Vitis vinifera]
Length=463

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 5/81 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+      L H  L+SFPGQGHVNPLLRLGKRLASKGLLVTFS PE++G+ MRKA SN
Sbjct  1    MGSES----KLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFSTPESIGKQMRKA-SN  55

Query  244  ISGEPTPYGDGMIRFEFFDDE  306
            I+ +PTP G+G+IRFEFF+DE
Sbjct  56   ITDQPTPVGEGLIRFEFFEDE  76



>ref|XP_010028410.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW55154.1| hypothetical protein EUGRSUZ_I01103 [Eucalyptus grandis]
Length=505

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H LL+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SNI  EP P G
Sbjct  7    SLVHVLLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKQMRKA-SNIGDEPAPVG  65

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  66   DGFIRFEFFED  76



>ref|XP_002518669.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43594.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=498

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+     SL H LLISFPGQGHVNPLLRLGK+LAS+GLLVTFS PE  GR MRK+ S 
Sbjct  1    MGSE-----SLVHVLLISFPGQGHVNPLLRLGKKLASRGLLVTFSTPEITGRQMRKSGS-  54

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            IS EPTP GDG +RFEFF+D
Sbjct  55   ISDEPTPVGDGYMRFEFFED  74



>ref|XP_002518668.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43593.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=544

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+     SL H LLISFPGQGHVNPLLRLGK+LAS+GLLVTFS PE  GR MRK+ S 
Sbjct  1    MGSE-----SLVHVLLISFPGQGHVNPLLRLGKKLASRGLLVTFSTPEITGRQMRKSGS-  54

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            IS EPTP GDG +RFEFF+D
Sbjct  55   ISDEPTPVGDGYMRFEFFED  74



>gb|KDP45907.1| hypothetical protein JCGZ_15467 [Jatropha curcas]
Length=492

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H LL+SFPGQGHVNPLLRLGKRLASKG+LVTFSAPE +G+ MRKAN+ +  E  P G
Sbjct  5    SLVHVLLLSFPGQGHVNPLLRLGKRLASKGMLVTFSAPEIIGKQMRKANNIVDYERVPIG  64

Query  271  DGMIRFEFFDD  303
            +G IRFEFF+D
Sbjct  65   EGFIRFEFFED  75



>ref|XP_009345415.1| PREDICTED: putative UDP-glucose glucosyltransferase [Pyrus x 
bretschneideri]
 ref|XP_009345416.1| PREDICTED: putative UDP-glucose glucosyltransferase [Pyrus x 
bretschneideri]
 ref|XP_009345417.1| PREDICTED: putative UDP-glucose glucosyltransferase [Pyrus x 
bretschneideri]
 ref|XP_009345418.1| PREDICTED: putative UDP-glucose glucosyltransferase [Pyrus x 
bretschneideri]
Length=473

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            LPH  L+ FP QGH+NP+LRLGKRLASKG+LV+FS  E  G++MRKAN  IS +PTP G+
Sbjct  7    LPHIFLVCFPAQGHINPMLRLGKRLASKGMLVSFSTTENYGKEMRKANDGISDQPTPVGN  66

Query  274  GMIRFEFFDD  303
            G IRFEFFDD
Sbjct  67   GFIRFEFFDD  76



>ref|XP_009370119.1| PREDICTED: putative UDP-glucose glucosyltransferase [Pyrus x 
bretschneideri]
 ref|XP_009370120.1| PREDICTED: putative UDP-glucose glucosyltransferase [Pyrus x 
bretschneideri]
Length=473

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            LPH  L+ FP QGH+NP+LRLGKRLASKG+LV+FS  E  G++MRKAN  IS +PTP G+
Sbjct  7    LPHIFLVCFPAQGHINPMLRLGKRLASKGMLVSFSTTENYGKEMRKANDGISDQPTPVGN  66

Query  274  GMIRFEFFDD  303
            G IRFEFFDD
Sbjct  67   GFIRFEFFDD  76



>ref|XP_008377621.1| PREDICTED: putative UDP-glucose glucosyltransferase [Malus domestica]
Length=473

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            LPH  L+ FP QGH+NP+LRLGKRLASKG+LV+FS  E  G++MRKAN  IS +PTP G+
Sbjct  7    LPHIFLVCFPAQGHINPMLRLGKRLASKGMLVSFSTTENYGKEMRKANDGISDQPTPVGN  66

Query  274  GMIRFEFFDD  303
            G IRFEFFDD
Sbjct  67   GFIRFEFFDD  76



>ref|XP_008347487.1| PREDICTED: putative UDP-glucose glucosyltransferase [Malus domestica]
Length=473

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            LPH  L+ FP QGH+NP+LRLGKRLASKG+LV+FS  E  G++MRKAN  IS +PTP G+
Sbjct  7    LPHIFLVCFPAQGHINPMLRLGKRLASKGMLVSFSTTENYGKEMRKANDGISDQPTPVGN  66

Query  274  GMIRFEFFDD  303
            G IRFEFFDD
Sbjct  67   GFIRFEFFDD  76



>ref|XP_009614127.1| PREDICTED: cinnamate beta-D-glucosyltransferase {ECO:0000303|PubMed:16443693, 
ECO:0000303|PubMed:17323078}-like [Nicotiana 
tomentosiformis]
Length=492

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS    G +  H  L+SFPGQGHVNPLLRLGKRLASKGLLVTFSAPE+ G +M+K+N  
Sbjct  1    MGSTVSEG-AFVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFSAPESCGSEMKKSNPK  59

Query  244  IS-GEPTPYGDGMIRFEFFDDE  306
            IS  EP PYG+G +RFEFF+D+
Sbjct  60   ISTSEPIPYGNGKMRFEFFEDD  81



>ref|XP_008384481.1| PREDICTED: putative UDP-glucose glucosyltransferase isoform X2 
[Malus domestica]
 ref|XP_008384482.1| PREDICTED: putative UDP-glucose glucosyltransferase isoform X2 
[Malus domestica]
Length=486

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H +L+ FPGQGH+NP+LRLGKRLA+KG LV+FS  E  G++MR ANS IS EPTP GDG 
Sbjct  9    HMVLVCFPGQGHINPMLRLGKRLAAKGFLVSFSTTENFGKEMRAANSGISDEPTPVGDGF  68

Query  280  IRFEFFDD  303
            IRFEFFDD
Sbjct  69   IRFEFFDD  76



>ref|XP_008366168.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucose glucosyltransferase 
[Malus domestica]
Length=472

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L+ FPGQGH+NP+LRLGKRLA+KG LV+FS  E  G++MR ANS IS EPTP GDG 
Sbjct  9    HMFLVCFPGQGHINPMLRLGKRLAAKGFLVSFSTTENFGKEMRAANSGISDEPTPVGDGF  68

Query  280  IRFEFFDD  303
            IRFEFFDD
Sbjct  69   IRFEFFDD  76



>ref|XP_006342414.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Solanum 
tuberosum]
Length=486

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN-ISGEPTPY  267
            SL H  +ISF GQG+VNP LRL KRLASKG+LVTFSAPE VG++MR A+ N I  +PTPY
Sbjct  11   SLVHVFVISFLGQGNVNPFLRLAKRLASKGMLVTFSAPELVGKEMRAADVNLIIDQPTPY  70

Query  268  GDGMIRFEFFDD  303
            GDGMIRFEFF+D
Sbjct  71   GDGMIRFEFFED  82



>gb|AHA54051.1| UGT84A13 [Quercus robur]
Length=510

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+     +L H  L+SFPGQGHVNPLLRLGKRLA+KGLLVTFS PE++G+ MRKA SN
Sbjct  1    MGSE-----ALVHVFLVSFPGQGHVNPLLRLGKRLAAKGLLVTFSTPESIGKQMRKA-SN  54

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I+ EP P G+G IRFEFF+D
Sbjct  55   ITDEPAPVGEGFIRFEFFED  74



>ref|XP_010030631.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Eucalyptus 
grandis]
Length=254

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS      SL H LL+S P QGHVNPLLRLGKRLAS GLLVTF+ PE++G+ MRKA SN
Sbjct  1    MGSD---AESLVHVLLVSLPAQGHVNPLLRLGKRLASNGLLVTFTTPESIGKQMRKA-SN  56

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I+ EP P G+G IRFEFF+D
Sbjct  57   IADEPAPVGNGFIRFEFFED  76



>ref|XP_006342685.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Solanum 
tuberosum]
Length=493

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            + S+     SL H  L++F GQG VNPLLRLGK LASKG+LVTFSAPE VG++MR  + N
Sbjct  3    LASQNTKKSSLAHVFLVAFTGQGIVNPLLRLGKCLASKGMLVTFSAPERVGKEMRAVDEN  62

Query  244  -ISGEPTPYGDGMIRFEFFDD  303
             I  +PTPYGDGMIRFEFF+D
Sbjct  63   LIIDKPTPYGDGMIRFEFFED  83



>gb|KDP45909.1| hypothetical protein JCGZ_15469 [Jatropha curcas]
Length=558

 Score =   110 bits (275),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            L H LL+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE  GR MRK+ S IS EPTP GD
Sbjct  6    LVHVLLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPEITGRQMRKSGS-ISDEPTPVGD  64

Query  274  GMIRFEFFDD  303
            G IRFEFF+D
Sbjct  65   GYIRFEFFED  74



>ref|XP_010065961.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Eucalyptus 
grandis]
Length=499

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+     +L H LL+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SN
Sbjct  1    MGSE-----ALVHVLLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKAMRKA-SN  54

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I  E +P GDG IRFEFF+D
Sbjct  55   IGEELSPVGDGFIRFEFFED  74



>dbj|BAF75877.1| glucosyltransferase [Dianthus caryophyllus]
Length=498

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
             L H L+ISFPGQGHVNPLLRLGKR+AS+G LVTF   E  G+ +RKAN +IS EP P G
Sbjct  10   QLIHVLMISFPGQGHVNPLLRLGKRMASQGFLVTFVTTEDFGQGIRKANDSISAEPVPMG  69

Query  271  DGMIRFEFFDDE  306
            DG IRFEF DDE
Sbjct  70   DGFIRFEFIDDE  81



>ref|XP_010065962.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Eucalyptus 
grandis]
Length=511

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+     +L H LL+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SN
Sbjct  1    MGSE-----ALVHVLLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKAMRKA-SN  54

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I  E +P GDG IRFEFF+D
Sbjct  55   IGEELSPVGDGFIRFEFFED  74



>gb|KCW63690.1| hypothetical protein EUGRSUZ_G01342 [Eucalyptus grandis]
Length=499

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+     +L H LL+SFPGQGHVNPLLRLGKRLASKGLLVTF+ PE++G+ MRKA SN
Sbjct  1    MGSE-----ALVHVLLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKAMRKA-SN  54

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I  E +P GDG IRFEFF+D
Sbjct  55   IGEELSPVGDGFIRFEFFED  74



>ref|XP_009364139.1| PREDICTED: putative UDP-glucose glucosyltransferase [Pyrus x 
bretschneideri]
Length=358

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  ++ +PGQGH+NP+LRLGKRLA+KG LV+FS  E  G++MR ANS IS EPTP GDG 
Sbjct  9    HMFIVCYPGQGHINPMLRLGKRLAAKGFLVSFSTTENFGQEMRAANSGISDEPTPVGDGF  68

Query  280  IRFEFFDD  303
            IRFEFFDD
Sbjct  69   IRFEFFDD  76



>ref|XP_009790173.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Nicotiana 
sylvestris]
Length=505

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+    P + H  +ISFPGQGHVNPLLRLGK LA+KG+LVTFS  E+ G  M+KAN N
Sbjct  1    MGSQGTLPPPI-HVFMISFPGQGHVNPLLRLGKLLAAKGILVTFSTTESHGAQMKKANKN  59

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            +S EPTPYG G +RF+FFDD
Sbjct  60   VSDEPTPYGSGKLRFQFFDD  79



>ref|XP_006346359.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Solanum 
tuberosum]
Length=487

 Score =   107 bits (268),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+    P   H  ++SFPGQGHVNPLLRLGK LA+KG+ VTFS  E+ G  MRKAN N
Sbjct  1    MGSQGNKPPI--HVFMVSFPGQGHVNPLLRLGKHLAAKGIFVTFSTAESHGAQMRKANKN  58

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            +S EPTPYG GMIRF+F DD
Sbjct  59   LSDEPTPYGSGMIRFQFIDD  78



>dbj|BAG80540.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=473

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  109  LISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIRF  288
            ++SFPGQGHVNP+LRLGKRLA+KG+LVTFS  E+ G  MRK N+N+S EPTP G GMIRF
Sbjct  1    MVSFPGQGHVNPMLRLGKRLAAKGILVTFSTAESYGCQMRKTNNNLSDEPTPCGSGMIRF  60

Query  289  EFFDD  303
            EF DD
Sbjct  61   EFIDD  65



>ref|XP_004253024.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   106 bits (264),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN-ISGEPTPY  267
            SL H  L+SF GQG+VNP LRL KRLASKG+LVTF APE VG++MR  N N I  +PTPY
Sbjct  11   SLVHVFLVSFHGQGNVNPFLRLAKRLASKGMLVTFCAPELVGKEMRAVNMNLIIDQPTPY  70

Query  268  GDGMIRFEFFDD  303
            GDGMIRFEFF+D
Sbjct  71   GDGMIRFEFFED  82



>ref|XP_008384480.1| PREDICTED: putative UDP-glucose glucosyltransferase isoform X1 
[Malus domestica]
Length=510

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L+ FPGQGH+NP+LRLGKRLA+KG+LV+FS  E  G++MR A+  I+ EPTP GDG 
Sbjct  9    HMFLVCFPGQGHINPMLRLGKRLAAKGILVSFSTTENFGKEMRAADGGINDEPTPVGDGF  68

Query  280  IRFEFFDD  303
            IRFEFFDD
Sbjct  69   IRFEFFDD  76



>ref|XP_004304051.1| PREDICTED: putative UDP-glucose glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=505

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = +1

Query  16   SSVRRHKPPHSPSSTKMGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF  195
            +S RR + P + +  +MGS    G    H  L+ +P QGH+NP+LRLGK LA+KGLLVTF
Sbjct  15   TSTRRSERPQTKTEHRMGS---VGSDNTHVFLVCYPAQGHINPMLRLGKHLAAKGLLVTF  71

Query  196  SAPETVGRDMRKANSNISGEPTPYGDGMIRFEFF  297
            S  E  G  MRKAN  +  +PTP G+G IRFEFF
Sbjct  72   STTEDYGNKMRKANGIVDNQPTPVGNGFIRFEFF  105



>dbj|BAF99688.1| UDP-glucose:hydroxycinnamate 1-O-glucosyltransferase [Lobelia 
erinus]
Length=486

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS-GEPTPY  267
            +L H  L+SFPGQGHVNPLLRLGK LASKGLLVTFSAPE VG  ++ AN  IS  E TP 
Sbjct  12   NLTHVFLVSFPGQGHVNPLLRLGKILASKGLLVTFSAPEMVGEIIKGANKYISDDELTPI  71

Query  268  GDGMIRFEFFDD  303
            GDGMIRFEFF D
Sbjct  72   GDGMIRFEFFSD  83



>gb|EPS57614.1| hypothetical protein M569_17203, partial [Genlisea aurea]
Length=466

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  ++SFPGQGHVNPLLRLGKRLAS GL VTF APE  G+ +RKAN    GE TP G GM
Sbjct  2    HVFMVSFPGQGHVNPLLRLGKRLASFGLFVTFCAPEFAGQSIRKANKIAVGEATPLGRGM  61

Query  280  IRFEFFDD  303
            +RFEFFDD
Sbjct  62   MRFEFFDD  69



>gb|AEM43003.1| UDP-glucosyltransferase [Siraitia grosvenorii]
Length=481

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFP QGHVNPLLR GK LAS G LVTF   E+ G+ MR+A  NIS  P P GDG 
Sbjct  14   HVLLVSFPAQGHVNPLLRFGKLLASNGFLVTFCTAESAGKQMRRATDNISDSPKPIGDGF  73

Query  280  IRFEFFDDE  306
            +RFEFFDDE
Sbjct  74   LRFEFFDDE  82



>gb|AEM43005.1| UDP-glucosyltransferase [Siraitia grosvenorii]
Length=481

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFP QGHVNPLLR GK LAS G LVTF   E+ G+ MR+A  NIS  P P GDG 
Sbjct  14   HVLLVSFPAQGHVNPLLRFGKLLASNGFLVTFCTAESAGKQMRRATDNISDSPKPIGDGF  73

Query  280  IRFEFFDDE  306
            +RFEFFDDE
Sbjct  74   LRFEFFDDE  82



>gb|AAN85566.1| UDP-glucosyl transferase [Fragaria x ananassa]
Length=555

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+     SL H  L+SF GQGHVNPLLRLGKRLA+KGLLVTF   E VG++MRK+N  
Sbjct  1    MGSE-----SLVHVFLVSFIGQGHVNPLLRLGKRLAAKGLLVTFCTAECVGKEMRKSN-G  54

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I+ EP P GDG  RFEFF+D
Sbjct  55   ITDEPKPVGDGFTRFEFFED  74



>ref|XP_011016669.1| PREDICTED: limonoid UDP-glucosyltransferase-like, partial [Populus 
euphratica]
Length=289

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  61   KMGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANS  240
            K   +++   SL H  LISFP QGHVNPLLRLGK LASKG LVTFS  ET+G  MRKA S
Sbjct  36   KTRKRKMVSESLGHLFLISFPAQGHVNPLLRLGKILASKGFLVTFSTTETIGEQMRKA-S  94

Query  241  NISGEPTPYGDGMIRFEFFDD  303
             I  + TP+GDG IRFEFF+D
Sbjct  95   GIIDKLTPFGDGFIRFEFFED  115



>ref|XP_010691667.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=508

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
             L H  +ISFPGQGH+NPLLRLGK +ASKGLLVTF+  E  G+ +R +N  +S +P P G
Sbjct  15   QLVHVFMISFPGQGHINPLLRLGKMIASKGLLVTFTTTENFGQGIRGSNDAVSDQPVPIG  74

Query  271  DGMIRFEFFDDE  306
            DG IRFEFFDDE
Sbjct  75   DGFIRFEFFDDE  86



>ref|XP_008454993.1| PREDICTED: putative UDP-glucose glucosyltransferase [Cucumis 
melo]
Length=490

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SLPH  L+SFPGQGH+NP+LRLGK+LA+ GLLVTFS    +G+DM+KA S IS  PTP G
Sbjct  7    SLPHVFLVSFPGQGHINPMLRLGKKLAASGLLVTFSTTAYLGQDMKKAGS-ISDTPTPLG  65

Query  271  DGMIRFEFFDD  303
             G +RFEFFDD
Sbjct  66   RGFLRFEFFDD  76



>gb|ABX46223.1| limonoid UDP glucosyltransferase, partial [Swinglea glutinosa]
Length=281

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLGK LASKG  +TF+ PE  G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGKLLASKGFFLTFTTPEIFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>dbj|BAG14302.1| sinapate glucosyltransferase [Gomphrena globosa]
Length=504

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPY  267
            P L H  +ISFPGQGH+NPLLRLGKR+ASKGLLVTF+  E  G+ +R +N  IS +P P 
Sbjct  11   PQLTHIFMISFPGQGHINPLLRLGKRVASKGLLVTFATTENFGQYIRISNDAISDQPVPV  70

Query  268  GDGMIRFEFFDDE  306
            GDG IR EFFDDE
Sbjct  71   GDGFIRLEFFDDE  83



>dbj|BAF99686.1| UDP-glucose:hydroxycinnamate 1-O-glucosyltransferase [Lobelia 
erinus]
 dbj|BAF99687.1| UDP-glucose:hydroxycinnamate 1-O-glucosyltransferase [Lobelia 
erinus]
Length=486

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS-GEPTPY  267
            +L H  L+SFPGQGHVNPLLRLGK LA KGLLVTFSAPE VG  ++ AN  IS  E TP 
Sbjct  12   NLTHVFLVSFPGQGHVNPLLRLGKILAFKGLLVTFSAPEMVGEIIKGANKYISDDELTPI  71

Query  268  GDGMIRFEFFDD  303
            GDGMIRFEFF D
Sbjct  72   GDGMIRFEFFSD  83



>dbj|BAF99689.1| putative UDP-glucose:hydroxycinnamate 1-O-glucosyltransferase 
[Lobelia erinus]
Length=484

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS-GEPTPY  267
            +L H  L+SFPGQGHVNPLLRLG  LASKGLLVTFSAPE VG  ++ AN  IS  E TP 
Sbjct  10   NLTHVFLVSFPGQGHVNPLLRLGIILASKGLLVTFSAPEMVGEIIKGANKYISDDELTPI  69

Query  268  GDGMIRFEFFDD  303
            GDGMIRFEFF D
Sbjct  70   GDGMIRFEFFSD  81



>ref|XP_008236382.1| PREDICTED: putative UDP-glucose glucosyltransferase [Prunus mume]
Length=473

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L+ FP QGH+NP+LRLGKRLA+KG+LV+FS  E  G++MRKANS+I+ + TP G G 
Sbjct  9    HIFLVCFPAQGHINPMLRLGKRLAAKGMLVSFSTTENYGKEMRKANSDINDQATPVGSGF  68

Query  280  IRFEFFDD  303
            IRFEFF D
Sbjct  69   IRFEFFQD  76



>ref|XP_007199813.1| hypothetical protein PRUPE_ppa005173mg [Prunus persica]
 gb|EMJ01012.1| hypothetical protein PRUPE_ppa005173mg [Prunus persica]
Length=473

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L+ FP QGH+NP+LRLGKRLA+KG+LV+FS  E  G++MRKANS+I+ + TP G G 
Sbjct  9    HIFLVCFPAQGHINPMLRLGKRLAAKGMLVSFSTTENYGKEMRKANSDINDQATPVGSGF  68

Query  280  IRFEFFDD  303
            IRFEFF D
Sbjct  69   IRFEFFQD  76



>ref|XP_010524528.1| PREDICTED: UDP-glycosyltransferase 84A1-like [Tarenaya hassleriana]
Length=476

 Score =   102 bits (254),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H +L+SFPGQGHVNPLLRLGK +ASKG LVTF   E  GR MR+ N  + GE  P G
Sbjct  5    SLVHVMLVSFPGQGHVNPLLRLGKLIASKGFLVTFVTTELWGRKMRRGNKIVDGELIPVG  64

Query  271  DGMIRFEFFDDE  306
             G +RFEFFDDE
Sbjct  65   KGFVRFEFFDDE  76



>ref|XP_004230732.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Solanum 
lycopersicum]
Length=487

 Score =   102 bits (254),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+   G +  H  ++SFPGQGHVNPL+RLGKRLA+KG+ VT S  E+ G  M+K N N
Sbjct  1    MGSQ--GGKAPIHVFMVSFPGQGHVNPLIRLGKRLAAKGIFVTLSTAESHGFQMKKVNKN  58

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            +S EPTPYG G IRF+F DD
Sbjct  59   LSDEPTPYGSGTIRFKFIDD  78



>ref|XP_008236381.1| PREDICTED: putative UDP-glucose glucosyltransferase [Prunus mume]
Length=473

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L+ FP QGH+NP+LRLGKRLA+KG+LVTFS  E  G++MRKAN+ IS E TP G G 
Sbjct  9    HIFLVCFPAQGHINPMLRLGKRLAAKGMLVTFSTTENYGKEMRKANNGISEEATPVGSGF  68

Query  280  IRFEFFDD  303
            IRFEFF D
Sbjct  69   IRFEFFPD  76



>ref|XP_007199814.1| hypothetical protein PRUPE_ppa005187mg [Prunus persica]
 gb|EMJ01013.1| hypothetical protein PRUPE_ppa005187mg [Prunus persica]
Length=473

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L+ FP QGH+NP+LRLGKRLA+KG+LVTFS  E  G++MRKAN+ IS E TP G G 
Sbjct  9    HIFLVCFPAQGHINPMLRLGKRLAAKGMLVTFSTTENYGKEMRKANNGISEEATPVGAGF  68

Query  280  IRFEFFDD  303
            IRFEFF D
Sbjct  69   IRFEFFPD  76



>ref|XP_004137100.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Cucumis sativus]
Length=485

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SLPH  L+SFPGQGH+NP+LRLGK LA+ GLLVTFS    +G+DM+KA S IS  PTP G
Sbjct  7    SLPHVFLVSFPGQGHINPMLRLGKILAASGLLVTFSTTAYLGQDMKKAGS-ISDTPTPLG  65

Query  271  DGMIRFEFFDD  303
             G +RFEFFDD
Sbjct  66   RGFLRFEFFDD  76



>gb|KGN43888.1| hypothetical protein Csa_7G072750 [Cucumis sativus]
Length=481

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SLPH  L+SFPGQGH+NP+LRLGK LA+ GLLVTFS    +G+DM+KA S IS  PTP G
Sbjct  3    SLPHVFLVSFPGQGHINPMLRLGKILAASGLLVTFSTTAYLGQDMKKAGS-ISDTPTPLG  61

Query  271  DGMIRFEFFDD  303
             G +RFEFFDD
Sbjct  62   RGFLRFEFFDD  72



>ref|XP_011088205.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Sesamum indicum]
Length=456

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  LISFP QGHVNPLLRLGKRLAS GL VT SAPE  G  +RKAN+    EPT  G GM
Sbjct  16   HIFLISFPAQGHVNPLLRLGKRLASFGLFVTLSAPEFAGLSIRKANTITDDEPTRLGTGM  75

Query  280  IRFEFFDD  303
            IRFEFFDD
Sbjct  76   IRFEFFDD  83



>dbj|BAF75884.1| glucosyltransferase [Dianthus caryophyllus]
Length=491

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            L H L+ISFPGQGHVNPLLRLGK +AS G L+TF   E  GR MR +N +I+ EP P GD
Sbjct  14   LIHVLMISFPGQGHVNPLLRLGKLIASHGFLITFVTYEDFGRGMRASNDSITSEPVPVGD  73

Query  274  GMIRFEFFDD  303
            G IRFEF DD
Sbjct  74   GFIRFEFIDD  83



>gb|ABX46222.1| limonoid UDP glucosyltransferase, partial [Atalantia ceylanica]
Length=281

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +TF+ PE+ G+ MRKA  N++ EP P GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTFTTPESFGKQMRKAG-NLTDEPIPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>ref|XP_006486997.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Citrus sinensis]
 sp|Q9MB73.1|LGT_CITUN RecName: Full=Limonoid UDP-glucosyltransferase; Short=LGTase; 
Short=Limonoid GTase; Short=Limonoid glucosyltransferase [Citrus 
unshiu]
 dbj|BAA93039.1| limonoid UDP-glucosyltransferase [Citrus unshiu]
 gb|ACD14143.1| limonoid UDP-glucosyltransferase [Citrus limettioides]
 gb|ACD14146.1| limonoid UDP-glucosyltransferase [Citrus aurantium]
Length=511

 Score =   101 bits (251),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP G
Sbjct  5    SLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  64   DGFIRFEFFED  74



>ref|XP_004304050.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=555

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+     SL H  L+SF GQGHVNPLLRLGKRLA+KGLLVTF   E VG++MRK+N  
Sbjct  1    MGSE-----SLVHVFLVSFIGQGHVNPLLRLGKRLAAKGLLVTFCTAECVGKEMRKSNG-  54

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I+ EP P GDG IRFEFF+D
Sbjct  55   ITDEPKPVGDGFIRFEFFED  74



>gb|ACD14144.1| limonoid UDP-glucosyltransferase [Citrus x paradisi]
 gb|AIS39474.1| limonoid UDP-glucosyltransferase 8 [Citrus x paradisi]
Length=511

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP G
Sbjct  5    SLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  64   DGFIRFEFFED  74



>gb|ACD14147.1| limonoid UDP-glucosyltransferase [Citrus sinensis]
Length=509

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP G
Sbjct  5    SLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  64   DGFIRFEFFED  74



>ref|XP_006379179.1| hypothetical protein POPTR_0009s09820g [Populus trichocarpa]
 gb|ERP56976.1| hypothetical protein POPTR_0009s09820g [Populus trichocarpa]
Length=473

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H  L+SFPGQGHVNPLLRLGK LASKG LVTFS  ET G++MR+A S+I  + TP+G
Sbjct  5    SLGHLFLVSFPGQGHVNPLLRLGKILASKGFLVTFSTTETTGKEMREA-SDIIDKLTPFG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  64   DGFIRFEFFED  74



>ref|XP_006422922.1| hypothetical protein CICLE_v10028247mg [Citrus clementina]
 gb|ESR36162.1| hypothetical protein CICLE_v10028247mg [Citrus clementina]
Length=502

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP G
Sbjct  5    SLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  64   DGFIRFEFFED  74



>gb|ABY27084.1| limonoid UDP-glucosyltransferase [Citrus maxima]
Length=511

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP G
Sbjct  5    SLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  64   DGFIRFEFFED  74



>ref|XP_010548894.1| PREDICTED: UDP-glycosyltransferase 84A1-like [Tarenaya hassleriana]
Length=478

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  76   EIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGE  255
            EI   S  H +L+SFPGQGHVNPLLRLGK +ASKGLLVTF   E  G+ MRK +  ++GE
Sbjct  2    EIEDSSRVHVMLVSFPGQGHVNPLLRLGKLIASKGLLVTFVTTELWGKKMRKTDKMVAGE  61

Query  256  PTPYGDGMIRFEFFDDE  306
             TP G G +RFEF+DDE
Sbjct  62   VTPVGKGFLRFEFYDDE  78



>sp|Q66PF4.1|CGT_FRAAN RecName: Full=Cinnamate beta-D-glucosyltransferase; AltName: 
Full=UDP-glucose:cinnamate glucosyltransferase; Short=FaGT2 
[Fragaria x ananassa]
 gb|AAU09443.1| UDP-glucose glucosyltransferase [Fragaria x ananassa]
Length=555

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 60/80 (75%), Gaps = 6/80 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS+     SL H  L+SF GQGHVNPLLRLGKRLA+KGLLVTF   E VG++MRK+N  
Sbjct  1    MGSE-----SLVHVFLVSFIGQGHVNPLLRLGKRLAAKGLLVTFCTAECVGKEMRKSNG-  54

Query  244  ISGEPTPYGDGMIRFEFFDD  303
            I+ EP P GDG IRFEFF D
Sbjct  55   ITDEPKPVGDGFIRFEFFKD  74



>gb|ABX46255.1| limonoid UDP glucosyltransferase, partial [Citrus maxima]
Length=281

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46263.1| limonoid UDP glucosyltransferase, partial [Citrus trifoliata]
Length=281

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46254.1| limonoid UDP glucosyltransferase, partial [Citrus maxima]
Length=281

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46230.1| limonoid UDP glucosyltransferase, partial [Citrus halimii]
Length=281

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46238.1| limonoid UDP glucosyltransferase, partial [Citrus unshiu]
 gb|ABX46258.1| limonoid UDP glucosyltransferase, partial [Citrus maxima]
Length=281

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46262.1| limonoid UDP glucosyltransferase, partial [Citrus trifoliata]
Length=281

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46229.1| limonoid UDP glucosyltransferase, partial [Citrus halimii]
Length=281

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46264.1| limonoid UDP glucosyltransferase, partial [Citrus japonica var. 
margarita]
Length=281

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46259.1| limonoid UDP glucosyltransferase, partial [Citrus ichangensis]
Length=281

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46237.1| limonoid UDP glucosyltransferase, partial [Citrus unshiu]
 gb|ABX46257.1| limonoid UDP glucosyltransferase, partial [Citrus maxima]
Length=281

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46260.1| limonoid UDP glucosyltransferase, partial [Citrus hanaju]
Length=281

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46251.1| limonoid UDP glucosyltransferase, partial [Citrus aurantium]
Length=281

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46241.1| limonoid UDP glucosyltransferase, partial [Citrus amblycarpa]
Length=281

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46232.1| limonoid UDP glucosyltransferase, partial [Citrus longispina]
 gb|ABX46240.1| limonoid UDP glucosyltransferase, partial [Citrus limon]
 gb|ABX46242.1| limonoid UDP glucosyltransferase, partial [Citrus amblycarpa]
 gb|ABX46243.1| limonoid UDP glucosyltransferase, partial [Citrus reticulata]
 gb|ABX46244.1| limonoid UDP glucosyltransferase, partial [Citrus reticulata]
 gb|ABX46245.1| limonoid UDP glucosyltransferase, partial [Citrus reticulata]
 gb|ABX46248.1| limonoid UDP glucosyltransferase, partial [Citrus reshni]
 gb|ABX46249.1| limonoid UDP glucosyltransferase, partial [Citrus aurantium]
 gb|ABX46250.1| limonoid UDP glucosyltransferase, partial [Citrus aurantium]
 gb|ABX46252.1| limonoid UDP glucosyltransferase, partial [Citrus sinensis]
 gb|ABX46253.1| limonoid UDP glucosyltransferase, partial [Citrus nobilis]
Length=281

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46231.1| limonoid UDP glucosyltransferase, partial [Citrus webberi]
Length=281

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46246.1| limonoid UDP glucosyltransferase, partial [Citrus nippokoreana]
Length=281

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46247.1| limonoid UDP glucosyltransferase, partial [Citrus nippokoreana]
 gb|ABX46261.1| limonoid UDP glucosyltransferase, partial [Citrus hanaju]
Length=281

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46256.1| limonoid UDP glucosyltransferase, partial [Citrus maxima]
Length=281

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>ref|XP_006414503.1| hypothetical protein EUTSA_v10024946mg [Eutrema salsugineum]
 gb|ESQ55956.1| hypothetical protein EUTSA_v10024946mg [Eutrema salsugineum]
Length=513

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +1

Query  10   LKSSVRRHKPPHSPSSTKMGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLV  189
            L SS+  + P    S +KM  +  +  S  H +L+SF GQGHVNPLLRLGK +ASKG+LV
Sbjct  12   LLSSIFVYPPKKMGSISKMEFESSSSSSPIHVMLVSFQGQGHVNPLLRLGKLIASKGILV  71

Query  190  TFSAPETVGRDMRKANSNISGEPTPYGDGMIRFEFFDDE  306
            TF   E  G+ MR+AN  + GE  P G G+IRFEFFD+E
Sbjct  72   TFVTTELWGKKMRQANKIVDGELKPVGSGLIRFEFFDEE  110



>ref|XP_002313148.2| hypothetical protein POPTR_0009s09800g [Populus trichocarpa]
 gb|EEE87103.2| hypothetical protein POPTR_0009s09800g [Populus trichocarpa]
Length=502

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H  L+SFPGQGHVNPLLRLGK LASKG LVTFS  ET G  MR+A S+I  + TP+G
Sbjct  5    SLGHLFLVSFPGQGHVNPLLRLGKILASKGFLVTFSTTETTGEQMRQA-SDIIDKLTPFG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF D
Sbjct  64   DGFIRFEFFAD  74



>gb|ABX46233.1| limonoid UDP glucosyltransferase, partial [Citrus longispina]
Length=281

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA S  + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAGS-FTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ACD14145.1| limonoid UDP-glucosyltransferase [Citrus sinensis]
Length=511

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP G
Sbjct  5    SLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKA-GNFTYEPTPVG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  64   DGFIRFEFFED  74



>ref|XP_004159932.1| PREDICTED: limonoid UDP-glucosyltransferase-like, partial [Cucumis 
sativus]
Length=481

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
             PH  L+SFPGQGH+NP+LRLGK LA+ GLLVTFS    +G+DM+KA S IS  PTP G 
Sbjct  7    FPHVFLVSFPGQGHINPMLRLGKILAASGLLVTFSTTAYLGQDMKKAGS-ISDTPTPLGR  65

Query  274  GMIRFEFFDD  303
            G +RFEFFDD
Sbjct  66   GFLRFEFFDD  75



>gb|EPS69550.1| hypothetical protein M569_05215, partial [Genlisea aurea]
Length=466

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  ++SFPGQGHVNPLLRLGKRLA  G+ VT  APE  G  +RKAN    G PTP G GM
Sbjct  1    HVYMVSFPGQGHVNPLLRLGKRLADFGIFVTLCAPEFAGISIRKANKITDGVPTPLGRGM  60

Query  280  IRFEFFDD  303
            I+FEFFDD
Sbjct  61   IQFEFFDD  68



>gb|ABX46235.1| limonoid UDP glucosyltransferase, partial [Citrus aurantiifolia]
Length=281

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFPG GHVNPLLRLG+ LASKG  +T + PE+ G+ MR A  N + EPTP GDG 
Sbjct  2    HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRXAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>dbj|BAF99685.1| putative glycosyltransferase [Clitoria ternatea]
Length=473

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEP-TPYGDG  276
            H L++SFP QGH+NPLLRLGK LA++GL VTF+  ET G++MR AN NI+ +  TP GDG
Sbjct  8    HVLMVSFPAQGHINPLLRLGKFLAAQGLFVTFATTETAGKNMRTANENITKKSVTPLGDG  67

Query  277  MIRFEFFDD  303
             ++F+FFDD
Sbjct  68   FLKFDFFDD  76



>ref|XP_006379180.1| hypothetical protein POPTR_0009s09830g [Populus trichocarpa]
 gb|ERP56977.1| hypothetical protein POPTR_0009s09830g [Populus trichocarpa]
Length=504

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H  L+SFP QGHVNPLLRLGK LASKG LVTFS+ E  G+ MR+A S+I  + TP+G
Sbjct  5    SLGHLFLVSFPAQGHVNPLLRLGKILASKGFLVTFSSTEITGKQMRQA-SDIIDKLTPFG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  64   DGFIRFEFFED  74



>gb|ABL63751.1| putative limonoid UDP-glucosyltransferase [Citrus hybrid cultivar]
Length=502

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H LL+SFPG GHVNPLLRLG  LASKG  +T + PE+ G+ MRKA  N + EPTP G
Sbjct  5    SLVHVLLVSFPGHGHVNPLLRLGILLASKGFFLTLTTPESFGKQMRKA-GNFTYEPTPVG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEFF+D
Sbjct  64   DGFIRFEFFED  74



>ref|NP_193283.2| UDP-glycosyltransferase 84A1 [Arabidopsis thaliana]
 sp|Q5XF20.1|U84A1_ARATH RecName: Full=UDP-glycosyltransferase 84A1; AltName: Full=Hydroxycinnamate 
glucosyltransferase 2; Short=AtHCAGT2 [Arabidopsis 
thaliana]
 gb|AAU93568.1| At4g15480 [Arabidopsis thaliana]
 gb|AEE83609.1| UDP-glycosyltransferase 84A1 [Arabidopsis thaliana]
 gb|AHL38694.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=490

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  52   SSTKMGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRK  231
            S ++M  +    P+  H +L+SF GQGHVNPLLRLGK +ASKGLLVTF   E  G+ MR+
Sbjct  3    SISEMVFETCPSPNPIHVMLVSFQGQGHVNPLLRLGKLIASKGLLVTFVTTELWGKKMRQ  62

Query  232  ANSNISGEPTPYGDGMIRFEFFDDE  306
            AN  + GE  P G G IRFEFFD+E
Sbjct  63   ANKIVDGELKPVGSGSIRFEFFDEE  87



>gb|AAN72025.1| indole-3-acetate beta-glucosyltransferase like protein [Arabidopsis 
thaliana]
Length=490

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  52   SSTKMGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRK  231
            S ++M  +    P+  H +L+SF GQGHVNPLLRLGK +ASKGLLVTF   E  G+ MR+
Sbjct  3    SISEMVFETCPSPNPIHVMLVSFQGQGHVNPLLRLGKLIASKGLLVTFVTTELWGKKMRQ  62

Query  232  ANSNISGEPTPYGDGMIRFEFFDDE  306
            AN  + GE  P G G IRFEFFD+E
Sbjct  63   ANKIVDGELKPVGSGSIRFEFFDEE  87



>gb|ABX46224.1| limonoid UDP glucosyltransferase, partial [Citrus medica]
 gb|ABX46225.1| limonoid UDP glucosyltransferase, partial [Citrus medica]
 gb|ABX46228.1| limonoid UDP glucosyltransferase, partial [Citrus medica]
 gb|ABX46236.1| limonoid UDP glucosyltransferase, partial [Citrus limettioides]
 gb|ABX46239.1| limonoid UDP glucosyltransferase, partial [Citrus limon]
Length=281

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SF G GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFAGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|AII32448.1| hydroxycinnamate glycosyltransferase [Populus fremontii x Populus 
angustifolia]
Length=502

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYG  270
            SL H  L+SFPGQGHVNPLLRLGK LASKG LVTFS  ET G  MRKA S+I  + TP+G
Sbjct  5    SLGHLFLVSFPGQGHVNPLLRLGKILASKGFLVTFSTTETTGEQMRKA-SDIIDKLTPFG  63

Query  271  DGMIRFEFFDD  303
            DG IRFEF  D
Sbjct  64   DGFIRFEFIAD  74



>gb|ABX46226.1| limonoid UDP glucosyltransferase, partial [Citrus medica]
Length=281

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SF G GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFXGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>gb|ABX46227.1| limonoid UDP glucosyltransferase, partial [Citrus medica]
Length=281

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SF G GHVNPLLRLG+ LASKG  +T + PE+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFXGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>emb|CAB10326.1| indole-3-acetate beta-glucosyltransferase like protein [Arabidopsis 
thaliana]
 emb|CAB78590.1| indole-3-acetate beta-glucosyltransferase like protein [Arabidopsis 
thaliana]
Length=484

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPY  267
            P+  H +L+SF GQGHVNPLLRLGK +ASKGLLVTF   E  G+ MR+AN  + GE  P 
Sbjct  9    PNPIHVMLVSFQGQGHVNPLLRLGKLIASKGLLVTFVTTELWGKKMRQANKIVDGELKPV  68

Query  268  GDGMIRFEFFDDE  306
            G G IRFEFFD+E
Sbjct  69   GSGSIRFEFFDEE  81



>ref|XP_002868202.1| UGT84A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44461.1| UGT84A1 [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  52   SSTKMGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRK  231
            S ++M  +    P+  H +L+SF GQGHVNPLLRLGK +ASKGLLVTF   E  G+ MR+
Sbjct  3    SISEMVFETCPSPNPVHVMLVSFQGQGHVNPLLRLGKLIASKGLLVTFVTTELWGKKMRQ  62

Query  232  ANSNISGEPTPYGDGMIRFEFFDDE  306
            AN  + GE  P G G IRFEFFD+E
Sbjct  63   ANKIVDGELKPVGSGSIRFEFFDEE  87



>ref|XP_006285398.1| hypothetical protein CARUB_v10006803mg [Capsella rubella]
 gb|EOA18296.1| hypothetical protein CARUB_v10006803mg [Capsella rubella]
Length=485

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 50/88 (57%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = +1

Query  43   HSPSSTKMGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRD  222
            HSPS+  +           H +L+SF GQGHVNPLLRLGK +ASKGLLVTF   E  G+ 
Sbjct  11   HSPSTKPV-----------HVMLVSFQGQGHVNPLLRLGKLIASKGLLVTFVTNELWGKK  59

Query  223  MRKANSNISGEPTPYGDGMIRFEFFDDE  306
            MR AN  + GE  P G G IRFEFFDDE
Sbjct  60   MRLANKIVDGELKPVGSGSIRFEFFDDE  87



>ref|XP_010943217.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Elaeis guineensis]
Length=474

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MG + +A   LPH LL+SFPGQGHVNPLLRL KRLA+KGLLVTFS+ + +GR +  A  N
Sbjct  6    MGRENLA---LPHVLLVSFPGQGHVNPLLRLAKRLAAKGLLVTFSSTDVIGRRIASATKN  62

Query  244  IS--GEPTPYGDGMIRFEFFDD  303
             +  G+  P G G +RFEF+ D
Sbjct  63   SADPGDAVPVGRGQLRFEFYRD  84



>gb|ABX46234.1| limonoid UDP glucosyltransferase, partial [Citrus aurantiifolia]
Length=281

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SF G GHVNPLLRLG+ LASKG  +T + PE+ G+ MR A  N + EPTP GDG 
Sbjct  2    HVLLVSFAGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRXAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>emb|CAS03347.1| sinapate 1-glucosyltransferase [Brassica napus var. napus]
 emb|CAS03355.1| sinapate 1-glucosyltransferase [Brassica napus var. napus]
 emb|CDY38624.1| BnaA05g19630D [Brassica napus]
Length=497

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR AN        
Sbjct  5    SSPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTANKIQDRALK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  65   PIGKGYLRFDFFDD  78



>ref|XP_002518670.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43595.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=472

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/69 (68%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +1

Query  79   IAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEP  258
            +A  S  H LL+SFP QGHVNPLLRLGKRLASKGLLVTF+APE VG+ MR AN+    E 
Sbjct  2    VASGSPVHVLLVSFPAQGHVNPLLRLGKRLASKGLLVTFAAPEIVGKQMRNANNITDHES  61

Query  259  TPYGDGMIR  285
             P GDG IR
Sbjct  62   IPVGDGFIR  70



>ref|XP_009145472.1| PREDICTED: UDP-glycosyltransferase 84A2-like [Brassica rapa]
Length=497

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR AN        
Sbjct  5    SSPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTANKIQDRALK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  65   PIGKGYLRFDFFDD  78



>ref|XP_010440299.1| PREDICTED: UDP-glycosyltransferase 84A4-like [Camelina sativa]
Length=473

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +1

Query  85   GPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPT  261
            G SL H +LISFPGQGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   
Sbjct  8    GSSLTHVMLISFPGQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMREANKIQDGVLK  67

Query  262  PYGDGMIRFEFFDD  303
            P G G +RFEFFDD
Sbjct  68   PVGLGFLRFEFFDD  81



>gb|ACU19578.1| unknown [Glycine max]
Length=230

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS E+  P   H L++S+P QGH+NPLLRLGK LA+KGL VTF+  ET G++MR AN+ 
Sbjct  1    MGS-ELEAPI--HVLMVSYPAQGHINPLLRLGKCLAAKGLFVTFTTSETAGKNMRTANNI  57

Query  244  ISGEPTPYGDGMIRFEFFDD  303
                  P GDG ++F+FF+D
Sbjct  58   TDKSVIPVGDGFLKFDFFED  77



>ref|XP_011088204.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Sesamum indicum]
Length=491

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  ++SFPGQGH+ PLLRLGKRLA+ G+ ++ + PE  G  ++KAN+    EPTP G GM
Sbjct  18   HIFMVSFPGQGHITPLLRLGKRLANFGMFISIATPELAGVSIKKANAITDDEPTPCGRGM  77

Query  280  IRFEFFDD  303
            IRFEFFDD
Sbjct  78   IRFEFFDD  85



>emb|CAS03352.1| sinapate 1-glucosyltransferase [Brassica rapa subsp. oleifera]
Length=497

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR AN        
Sbjct  5    SSPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTANKIQDRALK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  65   PIGKGYLRFDFFDD  78



>ref|XP_010928523.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Elaeis guineensis]
Length=490

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 60/85 (71%), Gaps = 7/85 (8%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKA---  234
            MG K+IA   LPH LL+SFPGQGHVNPLLRL KRLA+KGLLVTFS+   +G  +  A   
Sbjct  6    MGEKDIA---LPHVLLVSFPGQGHVNPLLRLAKRLAAKGLLVTFSSTSIIGNRITSATAA  62

Query  235  -NSNISGEPTPYGDGMIRFEFFDDE  306
             NS   G+P P G G +RFEF+ D+
Sbjct  63   KNSANPGDPLPVGRGYLRFEFYPDD  87



>emb|CDX90587.1| BnaA03g41940D [Brassica napus]
Length=490

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPY  267
            P+  H +L+SF GQGHVNPLLRLGK +ASKG LVTF   E  G+ MR+AN  + GE  P 
Sbjct  15   PTPVHVMLVSFQGQGHVNPLLRLGKLIASKGALVTFVTTELWGKKMRQANKIVDGELKPV  74

Query  268  GDGMIRFEFFDDE  306
            G G +RFEFFD+E
Sbjct  75   GSGSLRFEFFDEE  87



>gb|ABX46265.1| limonoid UDP glucosyltransferase, partial [Citrus australasica]
Length=281

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SF G GHVNPLLRLG+ LASKG  +T +  E+ G+ MRKA  N + EPTP GDG 
Sbjct  2    HVLLVSFHGHGHVNPLLRLGRLLASKGFFLTLTTTESFGKQMRKAG-NFTYEPTPVGDGF  60

Query  280  IRFEFFDD  303
            IRFEFF+D
Sbjct  61   IRFEFFED  68



>ref|XP_010468794.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 84A1-like 
[Camelina sativa]
Length=474

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPY  267
            P+  H +L+SF GQGHV+PLLRLGK +ASKGLLVTF   E  G+ MR AN  + GE  P 
Sbjct  9    PNPTHVMLVSFQGQGHVSPLLRLGKLIASKGLLVTFVTTELCGKKMRHANKIVDGELKPI  68

Query  268  GDGMIRFEFFDDE  306
            G   IRFEFFD+E
Sbjct  69   GSSSIRFEFFDEE  81



>gb|AAF98390.1|AF287143_1 UDP-glucose:sinapate glucosyltransferase [Brassica napus]
 emb|CAS03346.1| sinapate 1-glucosyltransferase [Brassica napus var. napus]
 emb|CAS03354.1| sinapate 1-glucosyltransferase [Brassica napus var. napus]
 emb|CDY44326.1| BnaC05g30670D [Brassica napus]
Length=497

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR AN        
Sbjct  5    SSPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTANKIQDRALK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FF+D
Sbjct  65   PIGKGYLRFDFFND  78



>emb|CAS03350.1| sinapate 1-glucosyltransferase [Brassica oleracea var. medullosa]
Length=497

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR AN        
Sbjct  5    SSPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTANKIQDRALK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FF+D
Sbjct  65   PIGKGYLRFDFFND  78



>ref|XP_009136698.1| PREDICTED: UDP-glycosyltransferase 84A1 [Brassica rapa]
Length=490

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H +L+SF GQGHVNPLLRLGK +ASKG LVTF   E  G+ MR+AN  + GE  P G G 
Sbjct  19   HVMLVSFQGQGHVNPLLRLGKLIASKGALVTFVTTELWGKKMRQANKIVDGELKPVGSGS  78

Query  280  IRFEFFDDE  306
            +RFEFFD+E
Sbjct  79   LRFEFFDEE  87



>ref|XP_010434393.1| PREDICTED: UDP-glycosyltransferase 84A4-like isoform X1 [Camelina 
sativa]
Length=480

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +1

Query  85   GPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPT  261
            G SL H +L+SFPGQGH+NPLLRLGK +ASKGL+VTF +  E +G+ MR+AN    G   
Sbjct  12   GSSLTHVMLVSFPGQGHINPLLRLGKLIASKGLIVTFVTTEEPLGKKMREANKIQDGVLK  71

Query  262  PYGDGMIRFEFFDD  303
            P G G +RFEFFDD
Sbjct  72   PVGLGFLRFEFFDD  85



>ref|XP_010488169.1| PREDICTED: UDP-glycosyltransferase 84A2 [Camelina sativa]
Length=500

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  76   EIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGE  255
            E + P  PH +LISFPGQGHVNPLLRLGK LASKGLL+TF   E+ G+ MR +N      
Sbjct  4    ESSPPLPPHVMLISFPGQGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRNSNKIQDRV  63

Query  256  PTPYGDGMIRFEFFDD  303
              P G G +RF+FFDD
Sbjct  64   LKPVGKGYLRFDFFDD  79



>ref|XP_006406256.1| hypothetical protein EUTSA_v10020520mg [Eutrema salsugineum]
 gb|ESQ47709.1| hypothetical protein EUTSA_v10020520mg [Eutrema salsugineum]
Length=518

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLL+TF   E+ G+ MR AN        
Sbjct  24   SSPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRTANKIQDRVLK  83

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  84   PIGKGYLRFDFFDD  97



>emb|CDY49300.1| BnaC01g22410D [Brassica napus]
Length=482

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPET-VGRDMRKANSNISGEPTP  264
            PSL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF   E   G  MR+AN    G   P
Sbjct  3    PSLEHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEQPWGEKMRQANKIQDGVLKP  62

Query  265  YGDGMIRFEFFDD  303
             G G +RFEFF+D
Sbjct  63   VGLGFLRFEFFND  75



>ref|XP_009147295.1| PREDICTED: UDP-glycosyltransferase 84A3-like [Brassica rapa]
Length=483

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPET-VGRDMRKANSNISGEPTP  264
            PSL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF   E   G  MR+AN    G   P
Sbjct  3    PSLEHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEQPWGEKMRQANKIQDGVLKP  62

Query  265  YGDGMIRFEFFDD  303
             G G +RFEFF+D
Sbjct  63   VGLGFLRFEFFND  75



>emb|CDY22915.1| BnaA01g18530D [Brassica napus]
Length=482

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPET-VGRDMRKANSNISGEPTP  264
            PSL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF   E   G  MR+AN    G   P
Sbjct  3    PSLEHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEQPWGEKMRQANKIQDGVLKP  62

Query  265  YGDGMIRFEFFDD  303
             G G +RFEFF+D
Sbjct  63   VGLGFLRFEFFND  75



>emb|CDY54974.1| BnaCnng27830D [Brassica napus]
Length=421

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFP QGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   P 
Sbjct  4    SLTHVMLVSFPSQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMRQANEIQDGLLKPV  63

Query  268  GDGMIRFEFFDD  303
            G G +RFEFFDD
Sbjct  64   GLGFLRFEFFDD  75



>emb|CDY19291.1| BnaC01g31890D [Brassica napus]
Length=497

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR +N        
Sbjct  5    SSPLHPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTSNKIQDRILK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  65   PIGKGYLRFDFFDD  78



>emb|CDY37279.1| BnaA01g24990D [Brassica napus]
Length=497

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR +N        
Sbjct  5    SSPLHPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTSNKIQDRILK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  65   PIGKGYLRFDFFDD  78



>ref|XP_009109433.1| PREDICTED: UDP-glycosyltransferase 84A2-like [Brassica rapa]
 emb|CAS03349.1| sinapate 1-glucosyltransferase [Brassica napus var. napus]
 emb|CAS03357.1| sinapate 1-glucosyltransferase [Brassica napus var. napus]
Length=497

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR +N        
Sbjct  5    SSPLHPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTSNKIQDRILK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  65   PIGKGYLRFDFFDD  78



>emb|CAS03348.1| sinapate 1-glucosyltransferase [Brassica napus var. napus]
 emb|CAS03356.1| sinapate 1-glucosyltransferase [Brassica napus var. napus]
Length=497

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR +N        
Sbjct  5    SSPLHPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTSNKIQDRILK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  65   PIGKGYLRFDFFDD  78



>ref|XP_003555960.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Glycine max]
Length=480

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS E+  P   H L++S+P QGH+NPLLRLGK LA+KGL VTF+  ET G++MR AN+ 
Sbjct  1    MGS-ELEAPI--HVLMVSYPAQGHINPLLRLGKCLAAKGLFVTFTTSETAGKNMRTANNI  57

Query  244  ISGEPTPYGDGMIRFEFFDD  303
                  P GDG ++F+FF+D
Sbjct  58   TDKSVIPVGDGFLKFDFFED  77



>ref|XP_010434402.1| PREDICTED: UDP-glycosyltransferase 84A4-like isoform X2 [Camelina 
sativa]
Length=471

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   P 
Sbjct  5    SLTHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMREANKIQDGVLKPV  64

Query  268  GDGMIRFEFFDD  303
            G G +RFEFFDD
Sbjct  65   GLGFLRFEFFDD  76



>emb|CAS03353.1| sinapate 1-glucosyltransferase [Brassica rapa subsp. oleifera]
Length=497

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR +N        
Sbjct  5    SSPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTSNKIQDRILK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  65   PIGKGYLRFDFFDD  78



>emb|CAS03351.1| sinapate 1-glucosyltransferase [Brassica oleracea var. medullosa]
Length=497

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  82   AGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E+ G+ MR +N        
Sbjct  5    SSPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTSNKIQDRILK  64

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF+FFDD
Sbjct  65   PIGKGYLRFDFFDD  78



>ref|XP_010440301.1| PREDICTED: UDP-glycosyltransferase 84A4 [Camelina sativa]
Length=465

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   P 
Sbjct  5    SLTHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMREANKIQDGVLKPV  64

Query  268  GDGMIRFEFFDD  303
            G G +RFEFFDD
Sbjct  65   GLGFLRFEFFDD  76



>emb|CAJ77650.1| hydroxycinnamate glucosyltransferase [Brassica napus]
Length=472

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFP QGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   P 
Sbjct  4    SLTHVMLVSFPSQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMRQANEIQDGLLKPV  63

Query  268  GDGMIRFEFFDD  303
            G G +RFEFFDD
Sbjct  64   GLGFLRFEFFDD  75



>ref|XP_010434972.1| PREDICTED: UDP-glycosyltransferase 84A4-like [Camelina sativa]
Length=479

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +1

Query  85   GPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPT  261
            G SL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   
Sbjct  8    GSSLTHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMREANKIQDGVLK  67

Query  262  PYGDGMIRFEFFDD  303
            P G G +RF FFDD
Sbjct  68   PVGLGFLRFAFFDD  81



>ref|XP_010466403.1| PREDICTED: UDP-glycosyltransferase 84A2-like isoform X1 [Camelina 
sativa]
 ref|XP_010466404.1| PREDICTED: UDP-glycosyltransferase 84A2-like isoform X2 [Camelina 
sativa]
Length=496

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  76   EIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGE  255
            E + P  PH +L+SFPGQGHVNPLLRLGK LASKGLL+TF   E+ G+ MR  N      
Sbjct  4    ESSPPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRNTNKIQDCV  63

Query  256  PTPYGDGMIRFEFFDD  303
              P G G +RF+FFDD
Sbjct  64   LKPVGKGYLRFDFFDD  79



>sp|Q2V6K1.1|UGT_FRAAN RecName: Full=Putative UDP-glucose glucosyltransferase; Short=FaGT5; 
AltName: Full=Glucosyltransferase 5 [Fragaria x ananassa]
 gb|ABB92747.1| UDP-glucose glucosyltransferase [Fragaria x ananassa]
Length=475

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS    G    H  L+ +P QGH+NP+LRLGK LA+KGLLVTFS  E  G  MR AN  
Sbjct  1    MGS---VGSDNTHIFLVCYPAQGHINPMLRLGKYLAAKGLLVTFSTTEDYGNKMRNANGI  57

Query  244  ISGEPTPYGDGMIRFEFF  297
            +   PTP G+G IRFEFF
Sbjct  58   VDNHPTPVGNGFIRFEFF  75



>emb|CDY54975.1| BnaCnng27840D [Brassica napus]
Length=483

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPET-VGRDMRKANSNISGEPTPY  267
            SL H +L+SFP QGH+NPLLRLGK +ASKGLLVTF   E   G+ MR+AN    G   P 
Sbjct  17   SLTHVMLVSFPSQGHINPLLRLGKLIASKGLLVTFVTTEKPFGKKMRQANEIQDGSLKPV  76

Query  268  GDGMIRFEFFDD  303
            G G +RFEFFDD
Sbjct  77   GLGFLRFEFFDD  88



>ref|XP_008806065.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Phoenix 
dactylifera]
Length=470

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKA--N  237
            MG + +A   LPH LL+SFPGQGHVNPLLRL KRLA+KGLLVTFS+ + +GR +  A  N
Sbjct  6    MGEENLA---LPHVLLVSFPGQGHVNPLLRLAKRLAAKGLLVTFSSTDMIGRRIASAAKN  62

Query  238  SNISGEPTPYGDGMIRFEFFDD  303
            S   G+  P G G +RFEF+ D
Sbjct  63   SVDHGDGVPVGRGHLRFEFYPD  84



>ref|XP_009147653.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 84A4-like 
[Brassica rapa]
Length=512

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFP QGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   P 
Sbjct  4    SLTHVMLVSFPSQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMRQANEIQDGLLKPV  63

Query  268  GDGMIRFEFFDD  303
            G G +RFEFFDD
Sbjct  64   GLGFLRFEFFDD  75



>emb|CDY09758.1| BnaC07g33030D [Brassica napus]
Length=490

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPY  267
            P+  H +L+SF GQGHVNPLLRLGK +ASKG LVTF   E  G+ MR+AN  + GE    
Sbjct  15   PTPVHVMLVSFQGQGHVNPLLRLGKLIASKGALVTFVTTELWGKKMRQANKIVDGELKTV  74

Query  268  GDGMIRFEFFDDE  306
            G G +RFEFFD+E
Sbjct  75   GSGSLRFEFFDEE  87



>ref|NP_193285.1| UDP-glycosyltransferase 84A4 [Arabidopsis thaliana]
 sp|O23402.1|U84A4_ARATH RecName: Full=UDP-glycosyltransferase 84A4; AltName: Full=Hydroxycinnamate 
glucosyltransferase 1; Short=AtHCAGT1 [Arabidopsis 
thaliana]
 emb|CAB10328.1| indole-3-acetate beta-glucosyltransferase like protein [Arabidopsis 
thaliana]
 emb|CAB78592.1| indole-3-acetate beta-glucosyltransferase like protein [Arabidopsis 
thaliana]
 gb|AAS99717.1| At4g15500 [Arabidopsis thaliana]
 dbj|BAF01632.1| indole-3-acetate beta-glucosyltransferase like protein [Arabidopsis 
thaliana]
 gb|AEE83611.1| UDP-glycosyltransferase 84A4 [Arabidopsis thaliana]
 gb|AHL38692.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=475

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SLPH +L+SFPGQGH++PLLRLGK +ASKGL+VTF +  E +G+ MR+AN+   G   P 
Sbjct  6    SLPHVMLVSFPGQGHISPLLRLGKIIASKGLIVTFVTTEEPLGKKMRQANNIQDGVLKPV  65

Query  268  GDGMIRFEFFDD  303
            G G +RFEFF+D
Sbjct  66   GLGFLRFEFFED  77



>ref|XP_006297509.1| hypothetical protein CARUB_v10013531mg [Capsella rubella]
 gb|EOA30407.1| hypothetical protein CARUB_v10013531mg [Capsella rubella]
Length=496

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  76   EIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGE  255
            E + P  PH +L+SFPGQGHVNPLLRLGK LASKGLLVTF   E  G+ MR +N      
Sbjct  4    ESSPPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTEPWGKMMRLSNKIEDRV  63

Query  256  PTPYGDGMIRFEFFDD  303
              P G G +RFEFFDD
Sbjct  64   LKPVGKGYLRFEFFDD  79



>ref|XP_010247542.1| PREDICTED: limonoid UDP-glucosyltransferase [Nelumbo nucifera]
Length=484

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISG--EPTPY  267
            + H L++SFPGQGHVNPLLRL K LAS+GLLVTFS  E++G  M+KA +NI G    TP 
Sbjct  3    MVHVLVVSFPGQGHVNPLLRLAKLLASEGLLVTFSTTESIGHMMKKA-TNIPGTCSATPI  61

Query  268  GDGMIRFEFFDD  303
            G G +RFEFF D
Sbjct  62   GQGQLRFEFFSD  73



>ref|XP_010434973.1| PREDICTED: UDP-glycosyltransferase 84A4-like [Camelina sativa]
Length=465

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   P 
Sbjct  5    SLTHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMREANKIQDGVLKPV  64

Query  268  GDGMIRFEFFDD  303
            G G ++FEFFDD
Sbjct  65   GLGFLQFEFFDD  76



>ref|XP_006285888.1| hypothetical protein CARUB_v10007399mg [Capsella rubella]
 gb|EOA18786.1| hypothetical protein CARUB_v10007399mg [Capsella rubella]
Length=477

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +1

Query  76   EIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISG  252
            E+   SL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF +  E  G+ MR+AN+   G
Sbjct  2    EMEPSSLTHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEEPYGKKMREANNIQDG  61

Query  253  EPTPYGDGMIRFEFFD  300
               P G G I+FEFFD
Sbjct  62   ILKPVGLGFIQFEFFD  77



>ref|XP_002868199.1| UGT84A4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44458.1| UGT84A4 [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFPGQGHVNPLLRLGK +ASKGL+VTF +  E +G+ MR+AN    G   P 
Sbjct  6    SLTHVMLVSFPGQGHVNPLLRLGKLIASKGLIVTFVTTEEPLGKKMRQANKIQDGVLKPV  65

Query  268  GDGMIRFEFFDD  303
            G G +RFEFF+D
Sbjct  66   GLGFLRFEFFED  77



>ref|NP_188793.1| sinapic acid:UDP-glucose glucosyltransferase  [Arabidopsis thaliana]
 sp|Q9LVF0.1|U84A2_ARATH RecName: Full=UDP-glycosyltransferase 84A2; AltName: Full=Sinapate 
1-glucosyltransferase 1; Short=AtSGT1 [Arabidopsis thaliana]
 dbj|BAB02351.1| indole-3-acetate beta-glucosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AAN13000.1| putative UDP-glucose:indole-3-acetate beta-D-glucosyltransferase 
[Arabidopsis thaliana]
 gb|AEE76523.1| sinapic acid:UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AHL38758.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=496

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  76   EIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGE  255
            E + P  PH +L+SFPGQGHVNPLLRLGK LASKGLL+TF   E+ G+ MR +N      
Sbjct  4    ESSPPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRISNKIQDRV  63

Query  256  PTPYGDGMIRFEFFDD  303
              P G G +R++FFDD
Sbjct  64   LKPVGKGYLRYDFFDD  79



>gb|AAM13998.1| putative UDP-glucose:indole-3-acetate beta-D-glucosyltransferase 
[Arabidopsis thaliana]
Length=496

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  76   EIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGE  255
            E + P  PH +L+SFPGQGHVNPLLRLGK LASKGLL+TF   E+ G+ MR +N      
Sbjct  4    ESSPPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRISNKIQDRV  63

Query  256  PTPYGDGMIRFEFFDD  303
              P G G +R++FFDD
Sbjct  64   LKPVGKGYLRYDFFDD  79



>ref|XP_006286013.1| hypothetical protein CARUB_v10007541mg [Capsella rubella]
 gb|EOA18911.1| hypothetical protein CARUB_v10007541mg [Capsella rubella]
Length=465

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  85   GPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPT  261
            G SL H +L+SFP QGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN+   G   
Sbjct  4    GSSLTHVMLVSFPSQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMRQANNIQDGVLK  63

Query  262  PYGDGMIRFEFFD  300
            P G G +RFEFF+
Sbjct  64   PVGLGFLRFEFFN  76



>dbj|BAQ19550.1| UDP-glucose:flavone 6-C-glucosyltransferase [Gentiana triflora]
Length=477

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L+ F GQG VNP+LRLGK  ASKGLLVT SAPE VG ++RKAN+    +P   G GM
Sbjct  11   HIFLVCFIGQGVVNPMLRLGKAFASKGLLVTLSAPEIVGTEIRKANNLNDDQPIKVGSGM  70

Query  280  IRFEFFDD  303
            IRFEFFDD
Sbjct  71   IRFEFFDD  78



>ref|XP_010510360.1| PREDICTED: UDP-glycosyltransferase 84A2-like [Camelina sativa]
Length=496

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPY  267
            P  PH +L+SFPGQGHVNPLLRLGK LASKGLL+TF   E+ G+ MR +N        P 
Sbjct  8    PLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRISNKIQDRVLKPV  67

Query  268  GDGMIRFEFFDD  303
            G G +RF+FF+D
Sbjct  68   GKGYLRFDFFED  79



>ref|XP_006283666.1| hypothetical protein CARUB_v10004723mg [Capsella rubella]
 gb|EOA16564.1| hypothetical protein CARUB_v10004723mg [Capsella rubella]
Length=476

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   P 
Sbjct  7    SLTHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMRQANKIQDGVLKPV  66

Query  268  GDGMIRFEFFD  300
            G G +RFEFF+
Sbjct  67   GLGFLRFEFFN  77



>ref|XP_010943278.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Elaeis guineensis]
Length=474

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = +1

Query  55   STKMGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKA  234
            +  MG + +   SLPH LL+SFPGQGHVNPLLRL KRLA+KGL VTFS+ + +G  +  A
Sbjct  3    AVSMGEQNL---SLPHVLLVSFPGQGHVNPLLRLAKRLAAKGLFVTFSSTDIIGHRIASA  59

Query  235  NSNIS--GEPTPYGDGMIRFEFFDD  303
              N +  G+  P G G +RFEF+ D
Sbjct  60   TKNSADPGDAVPVGRGKLRFEFYPD  84



>ref|XP_010434978.1| PREDICTED: UDP-glycosyltransferase 84A3 [Camelina sativa]
Length=470

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPYG  270
            L H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   P G
Sbjct  6    LTHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMRQANKIQDGVIKPVG  65

Query  271  DGMIRFEFFDD  303
             G +RFEFF D
Sbjct  66   LGFLRFEFFSD  76



>ref|XP_006414506.1| hypothetical protein EUTSA_v10025072mg [Eutrema salsugineum]
 gb|ESQ55959.1| hypothetical protein EUTSA_v10025072mg [Eutrema salsugineum]
Length=480

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  82   AGPSLP-HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEP  258
            + P  P H +L+SF GQG V+PLLRLGK +ASKG +VTF   E  G+ MRKAN  + GE 
Sbjct  6    SSPRKPIHVMLVSFQGQGSVSPLLRLGKLIASKGTVVTFVTTEFWGKKMRKANKIVDGEL  65

Query  259  TPYGDGMIRFEFFDD  303
             P G G IRFEFFDD
Sbjct  66   KPVGSGSIRFEFFDD  80



>ref|XP_007143049.1| hypothetical protein PHAVU_007G039300g [Phaseolus vulgaris]
 gb|ESW15043.1| hypothetical protein PHAVU_007G039300g [Phaseolus vulgaris]
Length=486

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H L++SFPGQGH+NPLLRL K LA+KG  VTFS  ET G+ MR AN+      TP G+G 
Sbjct  8    HVLMVSFPGQGHINPLLRLAKILAAKGFFVTFSTAETAGKLMRTANNISHQSVTPVGEGF  67

Query  280  IRFEFFD  300
            ++F+FF+
Sbjct  68   LKFDFFE  74



>ref|XP_006414502.1| hypothetical protein EUTSA_v10025056mg [Eutrema salsugineum]
 gb|ESQ55955.1| hypothetical protein EUTSA_v10025056mg [Eutrema salsugineum]
Length=483

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = +1

Query  88   PSL-PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETV-GRDMRKANSNISGEPT  261
            PSL  H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF   E   G+ MR+AN    G   
Sbjct  3    PSLRAHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEQPWGKKMRQANKIQDGVLK  62

Query  262  PYGDGMIRFEFFDD  303
            P G G +RFEFFDD
Sbjct  63   PVGLGFLRFEFFDD  76



>gb|KHN42370.1| Limonoid UDP-glucosyltransferase [Glycine soja]
Length=468

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +1

Query  109  LISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIRF  288
            ++S+P QGH+NPLLRLGK LA+KGL VTF+  ET G++MR AN+       P GDG ++F
Sbjct  1    MVSYPAQGHINPLLRLGKCLAAKGLFVTFTTSETAGKNMRTANNITDKSVIPVGDGFLKF  60

Query  289  EFFDD  303
            +FF+D
Sbjct  61   DFFED  65



>ref|XP_007143048.1| hypothetical protein PHAVU_007G039200g [Phaseolus vulgaris]
 gb|ESW15042.1| hypothetical protein PHAVU_007G039200g [Phaseolus vulgaris]
Length=480

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEP-TPY  267
            +L H L++S+PGQGH+NPLLRL K LA+KG  VTFS  E VG+ MR AN NIS E  TP 
Sbjct  5    ALIHVLMVSYPGQGHINPLLRLAKFLAAKGFFVTFSTAEIVGKLMRTAN-NISHESVTPV  63

Query  268  GDGMIRFEFFDD  303
            G+G ++F+FF++
Sbjct  64   GEGFLKFDFFEE  75



>gb|AAM64979.1| indole-3-acetate beta-glucosyltransferase like protein [Arabidopsis 
thaliana]
Length=479

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETV-GRDMRKANSNISGEPTPYGDG  276
            H +L+SFPGQGHVNPLLRLGK +ASKGLLVTF   E   G+ MR+AN    G   P G G
Sbjct  8    HVMLVSFPGQGHVNPLLRLGKLIASKGLLVTFVTTEQPWGKKMRQANKIQDGVLKPVGLG  67

Query  277  MIRFEFFDD  303
             IRFEFF D
Sbjct  68   FIRFEFFSD  76



>ref|XP_006414498.1| hypothetical protein EUTSA_v10025055mg [Eutrema salsugineum]
 gb|ESQ55951.1| hypothetical protein EUTSA_v10025055mg [Eutrema salsugineum]
Length=484

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFPGQGH+NPLLRLGK +ASKGL+VTF +  E  G+ MR+AN    G   P 
Sbjct  4    SLTHVMLVSFPGQGHINPLLRLGKLIASKGLIVTFVTTEEPFGKKMRQANEIQDGMLKPI  63

Query  268  GDGMIRFEFFDD  303
              G +R EFFD+
Sbjct  64   ASGFLRLEFFDN  75



>ref|XP_002883311.1| UGT84A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59570.1| UGT84A2 [Arabidopsis lyrata subsp. lyrata]
Length=499

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H +L+SFPGQGHVNPLLRLGK LASKGLL+TF   E+ G+ MR +N        P G G 
Sbjct  15   HVMLVSFPGQGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRISNKIQDRVLKPVGKGY  74

Query  280  IRFEFFDD  303
            +R++FFDD
Sbjct  75   LRYDFFDD  82



>ref|NP_193284.1| UDP-glycosyltransferase 84A3 [Arabidopsis thaliana]
 sp|O23401.1|U84A3_ARATH RecName: Full=UDP-glycosyltransferase 84A3; AltName: Full=Hydroxycinnamate 
glucosyltransferase 3; Short=AtHCAGT3 [Arabidopsis 
thaliana]
 emb|CAB10327.1| indole-3-acetate beta-glucosyltransferase like protein [Arabidopsis 
thaliana]
 emb|CAB78591.1| indole-3-acetate beta-glucosyltransferase like protein [Arabidopsis 
thaliana]
 gb|AAL15277.1| AT4g15490/dl3785c [Arabidopsis thaliana]
 gb|AAL67035.1| putative indole-3-acetate beta-glucosyltransferase [Arabidopsis 
thaliana]
 gb|AAN13214.1| putative indole-3-acetate beta-glucosyltransferase [Arabidopsis 
thaliana]
 gb|AEE83610.1| putative sinapic acid:UDP-glucose glucosyltransferase [Arabidopsis 
thaliana]
 gb|AHL38693.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=479

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETV-GRDMRKANSNISGEPTPYGDG  276
            H +L+SFPGQGHVNPLLRLGK +ASKGLLVTF   E   G+ MR+AN    G   P G G
Sbjct  8    HVMLVSFPGQGHVNPLLRLGKLIASKGLLVTFVTTEKPWGKKMRQANKIQDGVLKPVGLG  67

Query  277  MIRFEFFDD  303
             IRFEFF D
Sbjct  68   FIRFEFFSD  76



>gb|KEH44083.1| limonoid UDP glucosyltransferase, putative [Medicago truncatula]
Length=259

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  106  LLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIR  285
            LL+SFP QGH+N L+ LGK LA+KG  V F+  ET G++MR AN+ I    TP GDG   
Sbjct  10   LLVSFPAQGHINHLVGLGKYLAAKGATVIFTTTETAGKNMRAANNIIDKLATPIGDGTFA  69

Query  286  FEFFDD  303
            FEFFDD
Sbjct  70   FEFFDD  75



>gb|KFK39470.1| hypothetical protein AALP_AA3G248400 [Arabis alpina]
Length=471

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFP  GH+NPLLRL K +ASKGLLVTF +A E  G+ MR+AN    GE  P 
Sbjct  4    SLSHVMLVSFPFLGHINPLLRLAKLIASKGLLVTFVTAEEPCGKTMRQANKIQDGELKPV  63

Query  268  GDGMIRFEFFDD  303
            G G +RFEFF D
Sbjct  64   GLGFLRFEFFHD  75



>ref|XP_002449178.1| hypothetical protein SORBIDRAFT_05g006070 [Sorghum bicolor]
 gb|EES08166.1| hypothetical protein SORBIDRAFT_05g006070 [Sorghum bicolor]
Length=148

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANS-NISGEPTPYGD  273
            PH LLI FP QGHVNP+LRL KR+A+KGLLVTFS+  TVG  +  +   +  G+    G 
Sbjct  44   PHLLLICFPDQGHVNPMLRLAKRIAAKGLLVTFSSVSTVGAKLATSRGVSAGGDGVALGR  103

Query  274  GMIRFEFFDDE  306
            G +RFEF DDE
Sbjct  104  GRVRFEFVDDE  114



>ref|XP_002868200.1| hypothetical protein ARALYDRAFT_493341 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44459.1| hypothetical protein ARALYDRAFT_493341 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETV-GRDMRKANSNISGEPTPYGDG  276
            H +L+SFPGQGHVNPLLRLGK +ASKGLLVTF   E   G+ MR+AN    G   P G G
Sbjct  8    HVMLVSFPGQGHVNPLLRLGKLIASKGLLVTFVTTEQPWGKKMRQANKIQDGVLKPVGLG  67

Query  277  MIRFEFFDD  303
             +RFEFF D
Sbjct  68   FLRFEFFSD  76



>gb|KFK39632.1| hypothetical protein AALP_AA3G268800 [Arabis alpina]
Length=495

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  76   EIAGPSLP-HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISG  252
            E+   SLP H +L+SFPG GH NPLLRLGK LASKGLL+TF   E  G+ MR  N     
Sbjct  2    ELQSSSLPPHVMLVSFPGHGHCNPLLRLGKLLASKGLLITFVTTEAWGKKMRATNRIQDR  61

Query  253  EPTPYGDGMIRFEFFDD  303
               P G G +R++FFDD
Sbjct  62   VLKPIGKGYLRYDFFDD  78



>ref|XP_010416989.1| PREDICTED: UDP-glycosyltransferase 84A1-like [Camelina sativa]
Length=492

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +1

Query  82   AGPSLP-HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEP  258
            + PS P H +L+SF GQG V+PLLRLGK +ASKG LVTF  P+     MR+AN  + GE 
Sbjct  6    SSPSSPIHVMLVSFVGQGSVSPLLRLGKLIASKGTLVTFVTPDFWASKMRQANKIVDGEL  65

Query  259  TPYGDGMIRFEFFDDE  306
             P G G IRFE FD E
Sbjct  66   QPVGSGSIRFESFDKE  81



>ref|XP_010429148.1| PREDICTED: UDP-glycosyltransferase 84A1-like [Camelina sativa]
Length=483

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  82   AGPSLP-HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEP  258
            + PS P H +L+SF GQG V+PLLRLGK +ASKG LVTF  PE     MR+AN  +  E 
Sbjct  6    SSPSSPIHVMLVSFVGQGSVSPLLRLGKLIASKGTLVTFVTPEFWASKMRQANKIVDSEL  65

Query  259  TPYGDGMIRFEFFDDE  306
             P G G IRFE FD E
Sbjct  66   QPVGSGSIRFESFDKE  81



>gb|KFK39476.1| sinapate 1-glucosyltransferase [Arabis alpina]
Length=486

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPY  267
            P+  H +L+SF GQGHVNPLLRLGK +ASKGLLVTF   E  G+ MR+AN  + GE  P 
Sbjct  11   PNQIHVMLVSFQGQGHVNPLLRLGKLIASKGLLVTFVTNELWGKKMRQANKIVDGELKPV  70

Query  268  GDGMIR  285
            G G+IR
Sbjct  71   GSGLIR  76



>gb|EYU37624.1| hypothetical protein MIMGU_mgv1a023901mg [Erythranthe guttata]
Length=468

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = +1

Query  109  LISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIRF  288
            ++SFPGQGHVNPLLRL KRLA  GL VT +APE+ G  +RK++    GEP   G G IRF
Sbjct  1    MVSFPGQGHVNPLLRLAKRLAGFGLFVTLAAPESAGVTIRKSS---DGEPVRSGRGEIRF  57

Query  289  EFFDD  303
            EFFDD
Sbjct  58   EFFDD  62



>ref|XP_009147306.1| PREDICTED: UDP-glycosyltransferase 84A1-like [Brassica rapa]
Length=476

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H +L+SF GQG V PLLR GK +ASKG +VTF   E  G+ MR+AN  + GE  P G G 
Sbjct  13   HVMLVSFHGQGSVGPLLRFGKLIASKGTVVTFVTTEYWGKKMRQANQIVEGELKPAGSGS  72

Query  280  IRFEFFDD  303
            IRFEFFDD
Sbjct  73   IRFEFFDD  80



>ref|XP_006283659.1| hypothetical protein CARUB_v10004716mg [Capsella rubella]
 gb|EOA16557.1| hypothetical protein CARUB_v10004716mg [Capsella rubella]
Length=479

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETV-GRDMRKANSNISGEPTPYG  270
            L H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF   E   G+ MR+AN    G   P G
Sbjct  6    LAHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEQPWGKKMRQANKIQEGVLKPVG  65

Query  271  DGMIRFEFFDD  303
             G IRF FF D
Sbjct  66   LGFIRFVFFSD  76



>ref|XP_009396353.1| PREDICTED: putative UDP-glucose glucosyltransferase [Musa acuminata 
subsp. malaccensis]
Length=486

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS-GEPTPYG  270
            +PH L++SFP QGH+NPLLR  KR+A+KGLLVT  +   +G  +  + +N + G P P G
Sbjct  22   MPHVLMVSFPAQGHLNPLLRFAKRIAAKGLLVTLCSTHDIGHRISSSTANSALGVPVPIG  81

Query  271  DGMIRFEFFDDE  306
             G IRFEF+ D+
Sbjct  82   RGFIRFEFYSDD  93



>gb|KFK39465.1| hypothetical protein AALP_AA3G248100 [Arabis alpina]
Length=474

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPYG  270
            + H +L+SFP QGH+NPLLRL K +ASKGLLVTF +A E  G+ MR+AN    GE    G
Sbjct  6    MSHVMLVSFPYQGHINPLLRLAKLIASKGLLVTFVTAEEPCGKKMRQANKIQDGELKSVG  65

Query  271  DGMIRFEFFDD  303
             G +RFEFF D
Sbjct  66   LGFLRFEFFQD  76



>gb|ACD03236.1| UDP-glycosyltransferase UGT84C2 [Avena strigosa]
Length=494

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAP-ETVGRDMRKANSNISGEPTPY  267
            S PH LLI FPGQGHVNP+LRL KR A+KGLLVTFS+  + V +          G+  P 
Sbjct  17   SAPHLLLICFPGQGHVNPMLRLAKRFAAKGLLVTFSSTSDVVAKITASTGVEAGGDGVPL  76

Query  268  GDGMIRFEFFDD  303
            G G IRFEF DD
Sbjct  77   GLGRIRFEFLDD  88



>ref|XP_010474427.1| PREDICTED: UDP-glycosyltransferase 84A1-like [Camelina sativa]
Length=222

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +1

Query  76   EIAGPSLP-HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISG  252
            E + PS P H +L+SF G+G V+PL RLGK +ASKG LVTF+APE     MR+AN  +  
Sbjct  4    ESSSPSNPIHVMLVSFIGEGSVSPLFRLGKLIASKGPLVTFAAPEFWLSKMRQANKIVDS  63

Query  253  EPTPYGDGMIRFEFFDDE  306
            E TP G G IRFE +D +
Sbjct  64   ELTPVGSGSIRFESYDKD  81



>ref|XP_010429410.1| PREDICTED: UDP-glycosyltransferase 84A1-like [Camelina sativa]
Length=480

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +1

Query  82   AGPSLP-HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEP  258
            + PS P H +L+++ GQG +NPLLRLGK +ASKG LVTF+ PE     MR+AN  + GE 
Sbjct  7    SSPSNPIHVMLVAYVGQGGINPLLRLGKLIASKGPLVTFAIPEYQLSKMRQANKIVDGEL  66

Query  259  TPYGDGMIRFEFFDDE  306
             P G G IRFE FD E
Sbjct  67   KPVGSGSIRFESFDKE  82



>ref|XP_010434409.1| PREDICTED: UDP-glycosyltransferase 84A4-like isoform X3 [Camelina 
sativa]
Length=477

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTF-SAPETVGRDMRKANSNISGEPTPY  267
            SL H +L+SFPGQGH+NPLLRLGK +ASKGLLVTF +  E +G+ MR+AN    G   P 
Sbjct  5    SLTHVMLVSFPGQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMREANKIQDGVLKPV  64

Query  268  GDGMIRFE  291
            G G +RFE
Sbjct  65   GLGFLRFE  72



>gb|KEH27323.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=399

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L+SFP QGHVNPLLRLGK LASKGL VTF   E+ G++MRKA      +    G G 
Sbjct  17   HVFLVSFPAQGHVNPLLRLGKLLASKGLAVTFCTLESWGKEMRKARDLEEEKEVVIGKGF  76

Query  280  IRFEFFDD  303
            IRFE+F+D
Sbjct  77   IRFEWFED  84



>ref|XP_010113173.1| Putative UDP-glucose glucosyltransferase [Morus notabilis]
 gb|EXC71323.1| Putative UDP-glucose glucosyltransferase [Morus notabilis]
Length=468

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 7/81 (9%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKA-NS  240
            MG+K I  P   H LL+SFP QGH+NP+LRLGKRL SKGLLVTF+    + +D++K  N 
Sbjct  1    MGNKNIEPPM--HVLLVSFPAQGHINPMLRLGKRLLSKGLLVTFTTTTNMAKDIQKYPND  58

Query  241  NISGEPTPYGDGMIRFEFFDD  303
            N   + TP+    I F+FFDD
Sbjct  59   NPEDKTTPF----IGFDFFDD  75



>emb|CDY49298.1| BnaC01g22430D [Brassica napus]
Length=379

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H +L+SF GQG V P LRLGK +ASKG +V+F   E  G+ MR+AN  + GE  P G   
Sbjct  13   HVMLVSFHGQGSVGPFLRLGKLIASKGTVVSFVTTEYWGKKMRQANQIVEGELKPVGSSS  72

Query  280  IRFEFFDD  303
            IRFEFFDD
Sbjct  73   IRFEFFDD  80



>ref|XP_002453916.1| hypothetical protein SORBIDRAFT_04g021390 [Sorghum bicolor]
 gb|EES06892.1| hypothetical protein SORBIDRAFT_04g021390 [Sorghum bicolor]
Length=181

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANS-NISGEPTPYGDG  276
            H LLI FPGQGHVNP+LRL KR+A+KGLLVTFS+  T G  +  +   + SG+    G G
Sbjct  86   HLLLICFPGQGHVNPMLRLVKRIAAKGLLVTFSSVSTFGVKLAASTGVSASGDGVALGRG  145

Query  277  MIRFEFFDDE  306
             +R EF DDE
Sbjct  146  RVRIEFLDDE  155



>ref|XP_002868201.1| hypothetical protein ARALYDRAFT_915253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44460.1| hypothetical protein ARALYDRAFT_915253 [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETV-GRDMRKANSNISGEPTPYG  270
            LPH +L+S+PGQGH++PLLRLG  +ASKGL+VTF   E   G+ MR+AN    G   P G
Sbjct  6    LPHVMLVSYPGQGHISPLLRLGTLIASKGLIVTFVTTEQPWGKKMRQANKIQEGVLKPVG  65

Query  271  DGMIRFEFFDD  303
             G +RFEFF D
Sbjct  66   LGFLRFEFFSD  76



>gb|KEH44080.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=363

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 48/73 (66%), Gaps = 5/73 (7%)
 Frame = +1

Query  85   GPSLP-HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPT  261
            G  +P H LL+SFP QGH+NPLLRLGK LA+KG  V F+  E  G+DMR  N       T
Sbjct  2    GSEVPLHILLVSFPAQGHINPLLRLGKCLAAKGASVIFTTTEKAGKDMRITNK----LAT  57

Query  262  PYGDGMIRFEFFD  300
            P GDG + FEFFD
Sbjct  58   PIGDGCLTFEFFD  70



>ref|NP_001147693.1| LOC100281303 [Zea mays]
 gb|ACG28399.1| limonoid UDP-glucosyltransferase [Zea mays]
Length=500

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMR-KANSNISGEPTPYGD  273
            PH LL+ FPGQGHVNP++RL KR+A+KG LVTFS+  ++G  +   A  +  G+  P G 
Sbjct  21   PHLLLVCFPGQGHVNPMVRLAKRIAAKGPLVTFSSLSSIGAKLTASAGVSAGGDGVPVGR  80

Query  274  GMIRFEFFDDE  306
            G +RFEF DDE
Sbjct  81   GRVRFEFMDDE  91



>gb|KEH44073.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=475

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  106  LLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIR  285
            LL+SFP QGH+N L+ LGK LA+KG  V F+  ET G++MR AN+ I    TP GDG   
Sbjct  10   LLVSFPAQGHINHLVGLGKYLAAKGATVIFTTTETAGKNMRAANNIIDKLATPIGDGTFA  69

Query  286  FEFFDD  303
            FEFFDD
Sbjct  70   FEFFDD  75



>emb|CAJ77651.1| UDP glucosyltransferase related [Brassica napus]
 emb|CDY22916.1| BnaA01g18540D [Brassica napus]
Length=476

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H +L+SF GQG V PLLR GK +ASKG +VTF   E  G+ MR+AN  + GE  P G G 
Sbjct  13   HVMLVSFHGQGSVGPLLRFGKLIASKGTVVTFVTTEYWGKKMRQANQIVEGELKPAGSGS  72

Query  280  IRFEFFDD  303
            IRFEFF D
Sbjct  73   IRFEFFYD  80



>ref|NP_001151310.1| limonoid UDP-glucosyltransferase [Zea mays]
 gb|ACG42342.1| limonoid UDP-glucosyltransferase [Zea mays]
 gb|AFW70532.1| limonoid UDP-glucosyltransferase [Zea mays]
Length=491

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS--GEPTPYG  270
            PH LLI FPGQGHVNP+LRL KR+A+KGLLVTFS+   VG  M  A+  +S  G+  P G
Sbjct  19   PHLLLICFPGQGHVNPMLRLAKRIAAKGLLVTFSSISRVGA-MLAASVGVSAGGDGVPVG  77

Query  271  DGMIRFEFFDDE  306
             G +RFEF DDE
Sbjct  78   RGRVRFEFMDDE  89



>gb|AFK47005.1| unknown [Medicago truncatula]
Length=404

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  106  LLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIR  285
            LL+SFP QGH+N L+ LGK LA+KG  V F+  ET G++MR AN+ I    TP GDG   
Sbjct  10   LLVSFPAQGHINHLVGLGKYLAAKGATVIFTTTETAGKNMRAANNIIDKLATPIGDGAFA  69

Query  286  FEFFDD  303
            FEFFDD
Sbjct  70   FEFFDD  75



>ref|XP_008454995.1| PREDICTED: putative UDP-glucose glucosyltransferase [Cucumis 
melo]
Length=496

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L++FPGQGH+NP +RLGK+LASKGL +T S     G  ++ A S I  +P+P G G 
Sbjct  10   HVFLVTFPGQGHMNPTIRLGKKLASKGLYITISTTSEFGLSLKNAGS-IGDQPSPVGSGF  68

Query  280  IRFEFFDD  303
            I FEF+DD
Sbjct  69   IDFEFWDD  76



>ref|XP_004171652.1| PREDICTED: limonoid UDP-glucosyltransferase-like, partial [Cucumis 
sativus]
Length=128

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L++FPGQGH+NP +RLGK+LASKG+ +T S     G  ++ A S I   P+P G G 
Sbjct  10   HVFLVTFPGQGHMNPTIRLGKKLASKGVYITISTTLEFGLSLKNAGS-IGDHPSPVGSGF  68

Query  280  IRFEFFDD  303
            I FEF+DD
Sbjct  69   IDFEFWDD  76



>gb|KEH44084.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=479

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LLIS+P QGH+NPLL L K +A+KG  V F   E  G+D+R  N+ I    TP GDG 
Sbjct  8    HVLLISYPAQGHINPLLSLAKCVAAKGASVIFITTERAGKDIRTVNNIIEKSFTPIGDGS  67

Query  280  IRFEFFDD  303
            + FEFFDD
Sbjct  68   LTFEFFDD  75



>gb|EMT28291.1| Limonoid UDP-glucosyltransferase [Aegilops tauschii]
Length=272

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS--GEPTPYG  270
            PH LLI FPGQGHVNP+LRL KR A+KGLLVTFS+   VG  +  A+S +   G+  P G
Sbjct  18   PHLLLICFPGQGHVNPMLRLAKRFAAKGLLVTFSSTSYVGGKI-TASSGVEAGGDGVPLG  76

Query  271  DGMIRFEF  294
             G IRFEF
Sbjct  77   RGRIRFEF  84



>gb|KEH44087.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=502

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +1

Query  61   KMGSKEIAGPSLP-HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKAN  237
            K   +++A    P H LL+SFP QGH+NPLLRLGK LA+KG  V F+  E  G+DM   +
Sbjct  31   KQNKRKMASNEAPIHILLVSFPAQGHINPLLRLGKCLAAKGASVIFTTTEKAGKDMGIVD  90

Query  238  SNISGEPTPYGDGMIRFEFFD  300
               +   TP GDG + FEFFD
Sbjct  91   DITNKLATPIGDGSLIFEFFD  111



>dbj|BAJ94810.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97743.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANS-NISGEPTPYGDG  276
            H LLI FPGQGHVNP+LRL KR A+KGLLVTFS+   VG  +  ++     G+  P G G
Sbjct  21   HLLLICFPGQGHVNPMLRLAKRFAAKGLLVTFSSTSYVGGKITASSGVEAGGDGVPLGRG  80

Query  277  MIRFEFFDDE  306
             IRFEF DD+
Sbjct  81   RIRFEFLDDD  90



>ref|XP_008454994.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Cucumis melo]
Length=471

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            M SK+   PS  H  L+ +PGQGH+NP LRL K+LA++GLLVT       G+ ++KA S 
Sbjct  1    MASKQ--SPS--HVFLVCYPGQGHINPTLRLAKKLAAEGLLVTLCTAAHFGQTLQKAGSI  56

Query  244  ISGEP-TPYGDGMIRFEFFDD  303
            + G+  TP G+G IRF+FF+D
Sbjct  57   LGGDQCTPVGNGFIRFQFFED  77



>gb|KHN06135.1| Limonoid UDP-glucosyltransferase [Glycine soja]
Length=109

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = +1

Query  79   IAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS---  249
            +A  +L   LL+SFP QG VNPLLRL K LA+KG  VTFS  +  G  MR A +N +   
Sbjct  1    MASKTLILVLLVSFPAQGLVNPLLRLDKHLAAKGCFVTFSTTKPTGEHMRFATNNNATID  60

Query  250  -GEPTPYGDGMIRFEFFDD  303
                TP GDG   F FFDD
Sbjct  61   ETSSTPMGDGFFAFNFFDD  79



>ref|XP_006282251.1| hypothetical protein CARUB_v10028525mg [Capsella rubella]
 gb|EOA15149.1| hypothetical protein CARUB_v10028525mg [Capsella rubella]
Length=485

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  82   AGPSLP-HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEP  258
            + PS P H +++SF GQG V PL RLGK +ASKG +VTF +PE   + MR+AN  +  E 
Sbjct  6    SSPSKPIHVMMVSFMGQGSVTPLFRLGKLIASKGTVVTFVSPEFWAKKMREANKIVDSEL  65

Query  259  TPYGDGMIRFEFFDDE  306
             P G G IRFE +D E
Sbjct  66   KPVGAGAIRFESYDKE  81



>ref|XP_009385207.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=474

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS-GEPTPY  267
            S+PH L++SF GQGH+NPLLR  KR+A+KGLLVT  + + +G  +  + ++ + G P P 
Sbjct  12   SIPHVLMVSFAGQGHLNPLLRFAKRIAAKGLLVTLCSTDDIGYRISSSTADSALGVPKPV  71

Query  268  GDGMIRFEFFDD  303
            G G +RFEFF D
Sbjct  72   GRGFVRFEFFSD  83



>ref|XP_002453431.1| hypothetical protein SORBIDRAFT_04g005960 [Sorghum bicolor]
 gb|EES06407.1| hypothetical protein SORBIDRAFT_04g005960 [Sorghum bicolor]
Length=497

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDM-RKANSNISGEPTPYGDG  276
            H LLI FPGQGHVNP+LRL KR+A+KGLLVTFS+  TVG  +   A  +  G+    G G
Sbjct  25   HLLLICFPGQGHVNPMLRLAKRIAAKGLLVTFSSVSTVGAKLAASAGVSAGGDGVAVGRG  84

Query  277  MIRFEFFDDE  306
             +RFEF DDE
Sbjct  85   RVRFEFLDDE  94



>gb|EMT28615.1| Limonoid UDP-glucosyltransferase [Aegilops tauschii]
Length=336

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS--GEPTP  264
            S PH L+I  P QG++NP+LRLGKRLA+KGLLVTFS+   VG  +  A+S +   G+  P
Sbjct  18   SAPHLLIICNPSQGNINPMLRLGKRLAAKGLLVTFSSTADVGAKI-TASSGVEDGGDGVP  76

Query  265  YGDGMIRFEFFDD  303
             G G IRFEF DD
Sbjct  77   LGLGRIRFEFLDD  89



>gb|KEH40628.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=478

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +1

Query  76   EIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGE  255
            E   P   H LLISFPGQGH+NPLLRL K LA+KG  V F   +  G+D++  N+ +   
Sbjct  2    ESEAPIHIHILLISFPGQGHINPLLRLAKCLAAKGASVIFITTKKAGKDIQTVNNIVEKS  61

Query  256  PTPYGDGMIRFEFFDD  303
             T  G+G + FEFFDD
Sbjct  62   VTSIGNGSLTFEFFDD  77



>ref|XP_003599976.1| Limonoid UDP-glucosyltransferase [Medicago truncatula]
 gb|AES70227.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=480

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            MGS E    +  H LLIS+P QGH+NPLLRL K LA+KG  V F   E  G+DM+  N+ 
Sbjct  1    MGSSE----APIHILLISYPAQGHINPLLRLAKCLAAKGSSVIFITTEKAGKDMQTVNNI  56

Query  244  ISGEPTPYGDGMIRFEFFDD  303
                 TP GDG + F FFDD
Sbjct  57   THKSLTPIGDGSLIFHFFDD  76



>gb|KEH44078.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=485

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LLIS+P QGH+NPLLRL K LA+KG  V F   E  G+D+R  N+ I    T  GDG 
Sbjct  8    HILLISYPAQGHINPLLRLAKCLAAKGASVIFITTEKAGKDIRTVNNIIEKSLTSIGDGS  67

Query  280  IRFEFFDD  303
            + FEF DD
Sbjct  68   LTFEFLDD  75



>ref|XP_004137097.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Cucumis sativus]
Length=496

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L++FPGQGH+NP +RLGK+LASKG+ +T S     G  ++ A S I   P+P G G 
Sbjct  10   HVFLVTFPGQGHMNPTIRLGKKLASKGVYITISTTLEFGLSLKNAGS-IGDHPSPVGSGF  68

Query  280  IRFEFFDD  303
            I FEF+DD
Sbjct  69   IDFEFWDD  76



>gb|KGN43884.1| Resveratrol/hydroxycinnamic acid O-glucosyltransferase [Cucumis 
sativus]
Length=497

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L++FPGQGH+NP +RLGK+LASKG+ +T S     G  ++ A S I   P+P G G 
Sbjct  10   HVFLVTFPGQGHMNPTIRLGKKLASKGVYITISTTLEFGLSLKNAGS-IGDHPSPVGSGF  68

Query  280  IRFEFFDD  303
            I FEF+DD
Sbjct  69   IDFEFWDD  76



>gb|KGN43885.1| hypothetical protein Csa_7G072720 [Cucumis sativus]
Length=496

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L++FPGQGH+NP +RLGK+LASKG+ +T S     G  ++ A S I   P+P G G 
Sbjct  10   HVFLVTFPGQGHMNPTIRLGKKLASKGVYITISTTLEFGLSLKNAGS-IGDHPSPVGSGF  68

Query  280  IRFEFFDD  303
            I FEF+DD
Sbjct  69   IDFEFWDD  76



>ref|XP_004137096.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Cucumis sativus]
Length=497

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H  L++FPGQGH+NP +RLGK+LASKG+ +T S     G  ++ A S I   P+P G G 
Sbjct  10   HVFLVTFPGQGHMNPTIRLGKKLASKGVYITISTTLEFGLSLKNAGS-IGDHPSPVGSGF  68

Query  280  IRFEFFDD  303
            I FEF+DD
Sbjct  69   IDFEFWDD  76



>emb|CDY22912.1| BnaA01g18500D [Brassica napus]
Length=146

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  91   SLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPET-VGRDMRKANSNISGEPTPY  267
            SL H +L+SFP QGH+NPLLRLGK +ASKGLLVTF   E  +G+ MR+AN    G   P+
Sbjct  4    SLTHVMLVSFPSQGHINPLLRLGKLIASKGLLVTFVTTEEPLGKKMRQANEIQDGLLKPF  63

Query  268  GD  273
             D
Sbjct  64   FD  65



>ref|XP_006295862.1| hypothetical protein CARUB_v10024992mg [Capsella rubella]
 gb|EOA28760.1| hypothetical protein CARUB_v10024992mg [Capsella rubella]
Length=486

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H +L+SF GQG V+PLL LGK +ASKG LVTF  PE     MR+AN  +  E  P G G 
Sbjct  13   HVMLVSFIGQGSVSPLLCLGKLMASKGTLVTFVTPEYWASKMRQANKIVDSELKPVGSGA  72

Query  280  IRFEFFDDE  306
            IRFE FD +
Sbjct  73   IRFESFDKK  81



>gb|KEH20034.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=486

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  106  LLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIR  285
            LL+S+P QGH+NP+LRLGK LASKG  V F   E  GR++R  N+ I     P G+G + 
Sbjct  11   LLVSYPAQGHINPMLRLGKCLASKGSSVIFITTEKAGRELRTVNNIIDKSVIPVGNGSLA  70

Query  286  FEFFDD  303
            FEFF+D
Sbjct  71   FEFFED  76



>gb|AFW66251.1| limonoid UDP-glucosyltransferase [Zea mays]
Length=500

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +1

Query  85   GPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMR-KANSNISGEPT  261
            G + PH LL+ FPGQGHVNP++RL KR+A+KG LVTFS+  ++G  +   A  +  G+  
Sbjct  17   GNAPPHLLLVCFPGQGHVNPMVRLAKRIAAKGPLVTFSSLSSIGAKLTASAGVSAGGDGV  76

Query  262  PYGDGMIRFEFFDDE  306
            P G G +RFEF DDE
Sbjct  77   PVGRGRVRFEFMDDE  91



>gb|ABI94023.1| (iso)flavonoid glycosyltransferase [Medicago truncatula]
 gb|KEH44089.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=459

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFP QGH+NPLLRLGK LA+KG  V F   E  G++MR  N       TP GDG 
Sbjct  8    HILLVSFPAQGHINPLLRLGKCLAAKGASVIFITTEKGGKNMRITNK----LATPIGDGS  63

Query  280  IRFEFFDD  303
            + F+FFDD
Sbjct  64   LMFQFFDD  71



>ref|XP_003571042.2| PREDICTED: putative UDP-glucose glucosyltransferase [Brachypodium 
distachyon]
Length=572

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANS-NISGEPTPYGD  273
            PH LLI FPGQGHVNP+LRL KR A+KGLLVTFS+   VG  +  ++     G+    G 
Sbjct  104  PHLLLICFPGQGHVNPMLRLAKRFAAKGLLVTFSSTSDVGAKITASSGVEAGGDGVALGL  163

Query  274  GMIRFEFFDD  303
            G IRFEF DD
Sbjct  164  GRIRFEFLDD  173



>dbj|BAK00383.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS--GEPTPYG  270
            PH L+I  P QG+VNP+LRLGKR A+KGLLVTFS+   VG  +  A+S +   G+  P G
Sbjct  20   PHLLIICNPSQGNVNPMLRLGKRFAAKGLLVTFSSTSDVGAKI-TASSRVESGGDGVPLG  78

Query  271  DGMIRFEFFDD  303
             G IRFEF DD
Sbjct  79   LGRIRFEFLDD  89



>ref|XP_004965213.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Setaria 
italica]
Length=475

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 3/77 (4%)
 Frame = +1

Query  79   IAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS--G  252
            +A  + PH LLI +PGQGH+NP+LRL KR+A+KGLLVT S    V R+   A S +S  G
Sbjct  1    MAEEAAPHVLLICYPGQGHINPMLRLAKRIAAKGLLVTCSTFSFV-RNKLSAASGVSAGG  59

Query  253  EPTPYGDGMIRFEFFDD  303
            +  P G G IRF+F DD
Sbjct  60   DGVPVGRGRIRFDFLDD  76



>gb|EEE56467.1| hypothetical protein OsJ_05681 [Oryza sativa Japonica Group]
Length=280

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANS-NISGEPTPYGD  273
            PH LLI FPGQGHVNP+LRL KR+A+KGL+VTFS+   +G  + +++  ++ G+  P G 
Sbjct  23   PHLLLICFPGQGHVNPMLRLAKRIAAKGLVVTFSSTSAIGAKLVESSGVSVGGDGVPLGG  82

Query  274  GMIRFEFFDD  303
            G IRFEF +D
Sbjct  83   GRIRFEFLED  92



>ref|XP_004137099.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Cucumis sativus]
 gb|KGN43887.1| hypothetical protein Csa_7G072740 [Cucumis sativus]
Length=472

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +1

Query  64   MGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSN  243
            M SK+   PS  H  L+ +PGQGH+NP LRL K+LA +GLLVT          ++KA S 
Sbjct  1    MASKQF--PS--HVFLVCYPGQGHINPTLRLAKKLAVEGLLVTLCTAAHFRETLQKAGSI  56

Query  244  ISGEP-TPYGDGMIRFEFFDD  303
              G+  TP G+G IRFEFF+D
Sbjct  57   RGGDQLTPVGNGFIRFEFFED  77



>ref|XP_004496937.1| PREDICTED: limonoid UDP-glucosyltransferase-like [Cicer arietinum]
 gb|AGU14110.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+S+P QGH+NPLLRL K LA+KG  V F+  +  G+DM+   +      TP GDG 
Sbjct  8    HILLVSYPAQGHINPLLRLAKCLAAKGSSVIFTTTKKAGKDMQTGCNITDKTVTPIGDGS  67

Query  280  IRFEFFDD  303
            + F FFDD
Sbjct  68   LTFNFFDD  75



>dbj|BAO66179.1| UDP-glucose dependent p-hydroxybenzoic acid glucosyltransferase 
[Delphinium grandiflorum]
Length=486

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+SFP QGHVNPLLRL K LASKGLL TFS+   +   + K+  ++  +P   G G 
Sbjct  11   HVLLVSFPSQGHVNPLLRLAKHLASKGLLATFSSTHHIIHKIHKSTGHV--QPIDIGGGR  68

Query  280  IRFEFFDD  303
            +RFE F D
Sbjct  69   LRFESFTD  76



>gb|KEH20033.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=484

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  106  LLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIR  285
            LL+S+P QGH+NP+LRLGK LASKG  V F   E  G+++R  N+       P G+G + 
Sbjct  13   LLVSYPAQGHINPMLRLGKCLASKGSSVIFITTEKAGKELRTVNNITEKLVIPVGNGSLT  72

Query  286  FEFFDD  303
            F+FFDD
Sbjct  73   FQFFDD  78



>ref|XP_008649287.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Zea mays]
 gb|AFW76898.1| hypothetical protein ZEAMMB73_044928 [Zea mays]
Length=469

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +1

Query  88   PSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANS-NISGEPTP  264
            P   H LLI +P QGH+NP+LRL KR+A+KG+LVT S+   V  D+  A+  +  G+  P
Sbjct  7    PHNIHILLICYPSQGHINPMLRLAKRIAAKGILVTCSSSSVVRDDLAAASGVSAGGDGVP  66

Query  265  YGDGMIRFEFFDD  303
            +G G +RF+F DD
Sbjct  67   FGAGRLRFDFLDD  79



>ref|XP_004966898.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Setaria 
italica]
Length=462

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 3/77 (4%)
 Frame = +1

Query  79   IAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS--G  252
            +A  + PH L++ +PGQG+++P+LRL KR+A+KGLLVT  +   V RD   A S +S  G
Sbjct  1    MAEEATPHILVVCYPGQGNIDPMLRLAKRIAAKGLLVTCCSSSIV-RDKLAAASGVSAGG  59

Query  253  EPTPYGDGMIRFEFFDD  303
            +  P G G +RF+F DD
Sbjct  60   DGVPAGRGRVRFDFLDD  76



>ref|NP_001046133.1| Os02g0188000 [Oryza sativa Japonica Group]
 dbj|BAD15522.1| putative Limonoid UDP-glucosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF08047.1| Os02g0188000 [Oryza sativa Japonica Group]
Length=428

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANS-NISGEPTPYGD  273
            PH LLI FPGQGHVNP+LRL KR+A+KGL+VTFS+   +G  + +++  ++ G+  P G 
Sbjct  23   PHLLLICFPGQGHVNPMLRLAKRIAAKGLVVTFSSTSAIGAKLVESSGVSVGGDGVPLGG  82

Query  274  GMIRFEFFDD  303
            G IRFEF +D
Sbjct  83   GRIRFEFLED  92



>gb|AFJ52991.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=468

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGM  279
            H LL+ FPGQGH+NP LRL   LAS GLLVTF   +T G  M+   +N+  +  P     
Sbjct  11   HVLLVCFPGQGHINPFLRLANLLASHGLLVTFCINKTTGGQMKIPKNNLPSDNKP----T  66

Query  280  IRFEFFDD  303
            I+F+FFD+
Sbjct  67   IQFDFFDE  74



>ref|XP_002438232.1| hypothetical protein SORBIDRAFT_10g009990 [Sorghum bicolor]
 gb|EER89599.1| hypothetical protein SORBIDRAFT_10g009990 [Sorghum bicolor]
Length=472

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +1

Query  100  HALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANS-NISGEPTPYGDG  276
            H LLI +P QGH+NP+LRL KR+A+KG+LVT S+   +  D+  A+  +  G+  P+G G
Sbjct  10   HVLLICYPSQGHINPMLRLAKRIAAKGVLVTCSSSSVIRDDLAAASGVSAGGDGVPFGAG  69

Query  277  MIRFEFFDD  303
             IRF+F  D
Sbjct  70   RIRFDFLGD  78



>gb|AFJ52989.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=457

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 10/70 (14%)
 Frame = +1

Query  94   LPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGD  273
            +PH LL+ FPGQGH+NP LRL   LAS GLLVTF   +T G  M+  ++N S        
Sbjct  8    VPHVLLVCFPGQGHINPFLRLANLLASHGLLVTFCINKTTGTKMKPPDNNTS--------  59

Query  274  GMIRFEFFDD  303
              I+F+FFD+
Sbjct  60   --IQFDFFDE  67



>ref|XP_004496936.1| PREDICTED: putative UDP-glucose glucosyltransferase-like [Cicer 
arietinum]
 gb|AGU14109.1| UDP-glycosyltransferase [Cicer arietinum]
Length=479

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  106  LLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIR  285
            LL+S+P QGH+NPLLRL K LA+KG  V F+  E  G+ M    +  +   TP GDG + 
Sbjct  10   LLVSYPAQGHINPLLRLAKSLAAKGSSVIFTTTEQAGKSMLTVKNITNKTVTPIGDGSLT  69

Query  286  FEFFDD  303
            FE F D
Sbjct  70   FELFHD  75



>emb|CAE48293.1| glucosyltransferase 4 [Crocus sativus]
Length=481

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = +1

Query  76   EIAGPSLPHALLISFPGQGHVNPLLRLGKRLAS-KGLLVTFSAPETVGRDMRKANSNISG  252
            E   P  PH LL+SFP +GH+NPLL L KRLAS +G  VT    E+ G+ MR   S  SG
Sbjct  2    EPENPDAPHILLVSFPARGHLNPLLHLAKRLASCQGNHVTVCTCESHGKKMRTNASTNSG  61

Query  253  EPTPYGDGMIRFEFFDD  303
               P G+G +R ++F+D
Sbjct  62   LADPVGEGFLR-DYFND  77



>gb|KEH44086.1| limonoid UDP-glucosyltransferase-like protein [Medicago truncatula]
Length=472

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  106  LLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDGMIR  285
            LL+S+P  GH+N LL+LGK LA+KG  V F+  +  G+DM  AN+  +   TP G G + 
Sbjct  11   LLVSYPSYGHINSLLKLGKCLAAKGSSVIFTTTQKAGKDMETANNITNKTTTPIGKGFLT  70

Query  286  FEFFDD  303
            F+ FDD
Sbjct  71   FDLFDD  76



>emb|CDM85855.1| unnamed protein product [Triticum aestivum]
Length=478

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = +1

Query  109  LISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNIS--GEPTPYGDGMI  282
            +I  P QG+VNP+LRLGKRLA+KGLL+TFS+   VG  +  A+S +   G+    G G I
Sbjct  24   IICNPSQGNVNPMLRLGKRLAAKGLLITFSSTSDVGAKI-TASSGVEDGGDGVSLGLGRI  82

Query  283  RFEFFDD  303
            RFEF DD
Sbjct  83   RFEFLDD  89



>ref|XP_006654752.1| PREDICTED: cinnamate beta-D-glucosyltransferase-like [Oryza brachyantha]
Length=479

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 46/70 (66%), Gaps = 6/70 (9%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVG-RDMRKANSNISGEPTPYGD  273
            PH LL+SFP QGHVNPLLRLG+RLA++GLLVTFS     G RD+ +      G     G 
Sbjct  3    PHVLLVSFPMQGHVNPLLRLGRRLAARGLLVTFSTVRLPGLRDVPE-----DGACADVGL  57

Query  274  GMIRFEFFDD  303
            G +RFE+  D
Sbjct  58   GRLRFEYMRD  67



>ref|NP_001152529.1| indole-3-acetate beta-glucosyltransferase [Zea mays]
 gb|ACG48048.1| indole-3-acetate beta-glucosyltransferase [Zea mays]
 gb|AFW81019.1| indole-3-acetate beta-glucosyltransferase [Zea mays]
Length=465

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 5/71 (7%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVG-RDMRKANSNISGEPTPYGD  273
            PH LL+SFP QGHVNPLLRLG RLA+KGLLVTF+     G R +R+  + ++      G 
Sbjct  6    PHVLLVSFPLQGHVNPLLRLGARLAAKGLLVTFTTFRHAGIRALREDGACVAAA----GR  61

Query  274  GMIRFEFFDDE  306
            G +RF++  D+
Sbjct  62   GRLRFDYLRDD  72



>ref|NP_001056258.2| Os05g0552700 [Oryza sativa Japonica Group]
 dbj|BAF18172.2| Os05g0552700, partial [Oryza sativa Japonica Group]
Length=522

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +1

Query  55   STKMGSKEIAGPSLPHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKA  234
            +T+ G  +      PH LL+SFP QGHVNPLLRLG+RLA+ GLLVTF+         R  
Sbjct  21   TTRAGGNKALRSMEPHVLLVSFPMQGHVNPLLRLGRRLAATGLLVTFTTVRLAAGGGRLR  80

Query  235  NSNISGEPTPYGDGMIRFEFF  297
            +    G     G G +RFE+ 
Sbjct  81   DVPEDGACADVGLGRLRFEYL  101



>gb|EEE64621.1| hypothetical protein OsJ_19473 [Oryza sativa Japonica Group]
Length=447

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +1

Query  97   PHALLISFPGQGHVNPLLRLGKRLASKGLLVTFSAPETVGRDMRKANSNISGEPTPYGDG  276
            PH LL+SFP QGHVNPLLRLG+RLA+ GLLVTF+         R  +    G     G G
Sbjct  3    PHVLLVSFPMQGHVNPLLRLGRRLAATGLLVTFTTVRLAAGGGRLRDVPEDGACADVGLG  62

Query  277  MIRFEFF  297
             +RFE+ 
Sbjct  63   RLRFEYL  69



Lambda      K        H        a         alpha
   0.315    0.136    0.404    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515610070954