BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79251_g1_i1 len=298 path=[276:0-297]

Length=298
                                                                      Score     E

ref|XP_006358135.1|  PREDICTED: probable LRR receptor-like serine...    132   2e-33   
ref|XP_010316866.1|  PREDICTED: probable LRR receptor-like serine...    132   5e-33   
ref|XP_010655575.1|  PREDICTED: probable LRR receptor-like serine...    128   9e-32   
ref|XP_010655579.1|  PREDICTED: probable leucine-rich repeat rece...    128   9e-32   
ref|XP_010655576.1|  PREDICTED: probable LRR receptor-like serine...    128   1e-31   
ref|XP_010655559.1|  PREDICTED: probable LRR receptor-like serine...    127   1e-31   
ref|XP_010655574.1|  PREDICTED: probable LRR receptor-like serine...    127   1e-31   
emb|CDO96888.1|  unnamed protein product                                127   2e-31   
ref|XP_010655560.1|  PREDICTED: probable LRR receptor-like serine...    127   2e-31   
ref|XP_010655577.1|  PREDICTED: probable LRR receptor-like serine...    127   2e-31   
emb|CBI30744.3|  unnamed protein product                                127   2e-31   
emb|CAN81177.1|  hypothetical protein VITISV_011951                     127   2e-31   Vitis vinifera
ref|XP_010655578.1|  PREDICTED: probable LRR receptor-like serine...    127   2e-31   
ref|XP_010655558.1|  PREDICTED: probable LRR receptor-like serine...    127   2e-31   
ref|XP_010655561.1|  PREDICTED: probable leucine-rich repeat rece...    126   3e-31   
emb|CBI30745.3|  unnamed protein product                                127   3e-31   
ref|XP_011102303.1|  PREDICTED: probable LRR receptor-like serine...    122   9e-31   
emb|CAN61169.1|  hypothetical protein VITISV_010446                     124   1e-30   Vitis vinifera
ref|XP_010655581.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-30   
ref|XP_010655580.1|  PREDICTED: probable LRR receptor-like serine...    124   3e-30   
gb|KDP21156.1|  hypothetical protein JCGZ_21627                         124   3e-30   
ref|XP_010655582.1|  PREDICTED: probable LRR receptor-like serine...    124   3e-30   
ref|XP_010316867.1|  PREDICTED: probable LRR receptor-like serine...    124   4e-30   
ref|XP_002528777.1|  ATP binding protein, putative                      122   1e-29   Ricinus communis
ref|XP_006358134.1|  PREDICTED: probable LRR receptor-like serine...    122   2e-29   
ref|XP_004233025.1|  PREDICTED: probable LRR receptor-like serine...    121   3e-29   
ref|XP_010088632.1|  putative LRR receptor-like serine/threonine-...    119   7e-29   
ref|XP_006358131.1|  PREDICTED: probable LRR receptor-like serine...    119   7e-29   
ref|XP_007025267.1|  Leucine-rich repeat transmembrane protein ki...    120   7e-29   
ref|XP_008347521.1|  PREDICTED: probable leucine-rich repeat rece...    119   1e-28   
ref|XP_009600347.1|  PREDICTED: probable LRR receptor-like serine...    119   1e-28   
ref|XP_007025270.1|  Leucine-rich repeat transmembrane protein ki...    119   1e-28   
ref|XP_009600352.1|  PREDICTED: probable LRR receptor-like serine...    119   1e-28   
ref|XP_009600351.1|  PREDICTED: probable LRR receptor-like serine...    119   2e-28   
ref|XP_009600348.1|  PREDICTED: probable LRR receptor-like serine...    119   2e-28   
ref|XP_002522279.1|  ATP binding protein, putative                      119   2e-28   Ricinus communis
ref|XP_009600350.1|  PREDICTED: probable LRR receptor-like serine...    118   2e-28   
ref|XP_009600349.1|  PREDICTED: probable LRR receptor-like serine...    119   2e-28   
ref|XP_009795509.1|  PREDICTED: probable LRR receptor-like serine...    118   3e-28   
ref|XP_007025268.1|  Leucine-rich repeat transmembrane protein ki...    117   3e-28   
ref|XP_006358077.1|  PREDICTED: probable LRR receptor-like serine...    117   4e-28   
ref|XP_006358075.1|  PREDICTED: probable LRR receptor-like serine...    118   4e-28   
ref|XP_006358076.1|  PREDICTED: probable LRR receptor-like serine...    117   4e-28   
ref|XP_009795508.1|  PREDICTED: probable LRR receptor-like serine...    117   4e-28   
ref|XP_009351856.1|  PREDICTED: probable LRR receptor-like serine...    117   6e-28   
emb|CBI30748.3|  unnamed protein product                                116   2e-27   
ref|XP_010655586.1|  PREDICTED: probable LRR receptor-like serine...    116   2e-27   
ref|XP_002300205.2|  hypothetical protein POPTR_0001s31610g             116   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_008377580.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-27   
ref|XP_008366034.1|  PREDICTED: probable LRR receptor-like serine...    115   3e-27   
ref|XP_007213678.1|  hypothetical protein PRUPE_ppa000939mg             115   4e-27   
ref|XP_007025266.1|  Leucine-rich repeat transmembrane protein ki...    115   4e-27   
ref|XP_008245184.1|  PREDICTED: probable leucine-rich repeat rece...    115   4e-27   
ref|XP_006370930.1|  hypothetical protein POPTR_0019s01870g             110   6e-27   
ref|XP_004296291.1|  PREDICTED: probable leucine-rich repeat rece...    114   1e-26   
ref|XP_010646293.1|  PREDICTED: probable LRR receptor-like serine...    107   2e-26   
ref|XP_010646292.1|  PREDICTED: probable LRR receptor-like serine...    107   2e-26   
ref|XP_010655563.1|  PREDICTED: probable LRR receptor-like serine...    113   2e-26   
ref|XP_010655562.1|  PREDICTED: probable LRR receptor-like serine...    112   3e-26   
ref|XP_010646287.1|  PREDICTED: probable LRR receptor-like serine...    107   3e-26   
ref|XP_006370932.1|  putative receptor-like protein kinase RLPK1        111   3e-26   
ref|XP_011046351.1|  PREDICTED: probable LRR receptor-like serine...    112   4e-26   
ref|XP_008225259.1|  PREDICTED: probable LRR receptor-like serine...    111   6e-26   
ref|XP_011045704.1|  PREDICTED: probable LRR receptor-like serine...    111   6e-26   
ref|XP_011045702.1|  PREDICTED: probable LRR receptor-like serine...    111   7e-26   
emb|CBI38985.3|  unnamed protein product                                107   8e-26   
ref|XP_008225418.1|  PREDICTED: probable LRR receptor-like serine...    111   1e-25   
ref|XP_008225417.1|  PREDICTED: probable LRR receptor-like serine...    111   1e-25   
ref|XP_006371021.1|  hypothetical protein POPTR_0019s027201g            109   1e-25   
ref|XP_010655066.1|  PREDICTED: probable leucine-rich repeat rece...    107   2e-25   
ref|XP_010655062.1|  PREDICTED: probable leucine-rich repeat rece...    107   2e-25   
ref|XP_010655064.1|  PREDICTED: probable LRR receptor-like serine...    107   2e-25   
ref|XP_003632899.2|  PREDICTED: probable leucine-rich repeat rece...    107   3e-25   
ref|XP_007214549.1|  hypothetical protein PRUPE_ppa001005mg             110   3e-25   
ref|XP_010655063.1|  PREDICTED: probable leucine-rich repeat rece...    107   3e-25   
ref|XP_010655058.1|  PREDICTED: probable leucine-rich repeat rece...    107   3e-25   
ref|XP_010655061.1|  PREDICTED: probable leucine-rich repeat rece...    106   3e-25   
ref|XP_008225419.1|  PREDICTED: probable leucine-rich repeat rece...    110   3e-25   
ref|XP_007213704.1|  hypothetical protein PRUPE_ppa000741mg             110   3e-25   
ref|XP_007214558.1|  hypothetical protein PRUPE_ppa000742mg             110   3e-25   
ref|XP_008245181.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    109   3e-25   
ref|XP_010093467.1|  hypothetical protein L484_017528                   109   3e-25   
ref|XP_006388188.1|  hypothetical protein POPTR_0294s002003g            103   4e-25   
ref|XP_011046363.1|  PREDICTED: probable leucine-rich repeat rece...    108   5e-25   
ref|XP_011046362.1|  PREDICTED: probable leucine-rich repeat rece...    109   5e-25   
ref|XP_008225434.1|  PREDICTED: probable LRR receptor-like serine...    105   5e-25   
ref|XP_011046359.1|  PREDICTED: probable leucine-rich repeat rece...    109   5e-25   
ref|XP_011046365.1|  PREDICTED: probable leucine-rich repeat rece...    109   5e-25   
ref|XP_011046364.1|  PREDICTED: probable leucine-rich repeat rece...    108   5e-25   
ref|XP_011046360.1|  PREDICTED: probable leucine-rich repeat rece...    108   5e-25   
ref|XP_004309629.1|  PREDICTED: probable LRR receptor-like serine...    108   6e-25   
ref|XP_002283578.2|  PREDICTED: probable leucine-rich repeat rece...    108   7e-25   Vitis vinifera
emb|CBI20127.3|  unnamed protein product                                108   7e-25   
ref|XP_011014227.1|  PREDICTED: probable leucine-rich repeat rece...    108   8e-25   
ref|XP_011014230.1|  PREDICTED: probable leucine-rich repeat rece...    108   8e-25   
ref|XP_011014229.1|  PREDICTED: probable leucine-rich repeat rece...    108   8e-25   
ref|XP_011014228.1|  PREDICTED: probable leucine-rich repeat rece...    108   8e-25   
ref|XP_006371027.1|  hypothetical protein POPTR_0019s02760g             108   1e-24   
ref|XP_006370933.1|  putative receptor-like protein kinase RLPK1        106   1e-24   
ref|XP_007021935.1|  Leucine-rich repeat transmembrane protein ki...    108   1e-24   
ref|XP_010088631.1|  putative leucine-rich repeat receptor-like s...    107   2e-24   
emb|CAN74151.1|  hypothetical protein VITISV_028028                     107   2e-24   Vitis vinifera
ref|XP_004295408.1|  PREDICTED: probable LRR receptor-like serine...    107   3e-24   
emb|CBI20124.3|  unnamed protein product                                107   3e-24   
ref|XP_002283596.2|  PREDICTED: probable leucine-rich repeat rece...    106   4e-24   Vitis vinifera
emb|CBI20121.3|  unnamed protein product                                105   6e-24   
ref|XP_003634703.1|  PREDICTED: probable leucine-rich repeat rece...    105   7e-24   
ref|XP_010246510.1|  PREDICTED: probable leucine-rich repeat rece...    105   9e-24   
ref|XP_006371019.1|  hypothetical protein POPTR_0019s027001g            104   1e-23   
ref|XP_011046381.1|  PREDICTED: probable leucine-rich repeat rece...    105   2e-23   
ref|XP_008225432.1|  PREDICTED: probable LRR receptor-like serine...    104   2e-23   
ref|XP_011046350.1|  PREDICTED: probable LRR receptor-like serine...    104   3e-23   
ref|XP_011046349.1|  PREDICTED: probable LRR receptor-like serine...    104   3e-23   
ref|XP_007214035.1|  hypothetical protein PRUPE_ppa017351mg             103   3e-23   
ref|XP_008345983.1|  PREDICTED: probable LRR receptor-like serine...    103   4e-23   
ref|XP_010246509.1|  PREDICTED: probable leucine-rich repeat rece...    103   5e-23   
ref|XP_008225260.1|  PREDICTED: probable leucine-rich repeat rece...    103   6e-23   
ref|XP_004295407.1|  PREDICTED: probable LRR receptor-like serine...    103   7e-23   
ref|XP_006442368.1|  hypothetical protein CICLE_v10018771mg             102   8e-23   
emb|CBI20129.3|  unnamed protein product                              99.8    1e-22   
ref|XP_007214698.1|  hypothetical protein PRUPE_ppa026371mg             102   1e-22   
gb|KHN36924.1|  Putative LRR receptor-like serine/threonine-prote...    101   1e-22   
ref|XP_006594719.1|  PREDICTED: probable leucine-rich repeat rece...    101   2e-22   
ref|XP_004295405.1|  PREDICTED: probable leucine-rich repeat rece...    101   3e-22   
ref|XP_009334012.1|  PREDICTED: probable leucine-rich repeat rece...    101   3e-22   
ref|XP_006477897.1|  PREDICTED: probable leucine-rich repeat rece...    101   3e-22   
ref|XP_002325753.2|  hypothetical protein POPTR_0019s01950g             101   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009334011.1|  PREDICTED: probable leucine-rich repeat rece...    101   3e-22   
ref|XP_009334010.1|  PREDICTED: probable leucine-rich repeat rece...    101   3e-22   
ref|XP_008371519.1|  PREDICTED: probable LRR receptor-like serine...    100   5e-22   
ref|XP_008381102.1|  PREDICTED: probable leucine-rich repeat rece...  97.1    6e-22   
ref|XP_002524514.1|  ATP binding protein, putative                      100   8e-22   Ricinus communis
ref|XP_010112408.1|  putative leucine-rich repeat receptor-like s...  99.8    9e-22   
ref|XP_008365059.1|  PREDICTED: probable LRR receptor-like serine...  93.2    1e-21   
emb|CAN70381.1|  hypothetical protein VITISV_020134                   99.4    1e-21   Vitis vinifera
ref|XP_008226375.1|  PREDICTED: probable leucine-rich repeat rece...  99.4    1e-21   
ref|XP_007211339.1|  hypothetical protein PRUPE_ppa001122mg           99.0    2e-21   
ref|XP_004295665.1|  PREDICTED: probable leucine-rich repeat rece...  99.0    3e-21   
gb|KHG25892.1|  putative leucine-rich repeat receptor-like serine...  97.1    5e-21   
ref|XP_002524511.1|  ATP binding protein, putative                    97.4    7e-21   Ricinus communis
ref|XP_009802917.1|  PREDICTED: probable LRR receptor-like serine...  97.1    9e-21   
ref|XP_009802916.1|  PREDICTED: probable LRR receptor-like serine...  97.1    1e-20   
ref|XP_009802915.1|  PREDICTED: probable LRR receptor-like serine...  97.1    1e-20   
ref|XP_009603858.1|  PREDICTED: probable LRR receptor-like serine...  97.1    1e-20   
ref|XP_009603857.1|  PREDICTED: probable LRR receptor-like serine...  96.7    1e-20   
ref|XP_010246513.1|  PREDICTED: probable leucine-rich repeat rece...  96.3    2e-20   
ref|XP_006448021.1|  hypothetical protein CICLE_v10014129mg           95.1    2e-20   
ref|XP_006448022.1|  hypothetical protein CICLE_v10014129mg           95.1    2e-20   
ref|XP_006448019.1|  hypothetical protein CICLE_v10014129mg           95.5    2e-20   
ref|XP_006448018.1|  hypothetical protein CICLE_v10014129mg           95.5    3e-20   
gb|KDO58606.1|  hypothetical protein CISIN_1g002566mg                 95.1    3e-20   
gb|KDO58609.1|  hypothetical protein CISIN_1g002566mg                 95.1    3e-20   
gb|KDO58608.1|  hypothetical protein CISIN_1g002566mg                 95.5    3e-20   
gb|KDO58607.1|  hypothetical protein CISIN_1g002566mg                 95.5    3e-20   
ref|XP_006448023.1|  hypothetical protein CICLE_v10014129mg           95.5    3e-20   
ref|XP_006477832.1|  PREDICTED: probable leucine-rich repeat rece...  95.5    3e-20   
ref|XP_004488996.1|  PREDICTED: probable leucine-rich repeat rece...  95.5    3e-20   
ref|XP_006477831.1|  PREDICTED: probable leucine-rich repeat rece...  95.5    3e-20   
ref|XP_006477830.1|  PREDICTED: probable leucine-rich repeat rece...  95.5    3e-20   
ref|XP_004488997.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    3e-20   
ref|XP_006448020.1|  hypothetical protein CICLE_v10014129mg           95.5    3e-20   
ref|XP_006492254.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  95.5    3e-20   
emb|CDP06038.1|  unnamed protein product                              95.1    4e-20   
emb|CBI20136.3|  unnamed protein product                              94.7    4e-20   
gb|KDO58604.1|  hypothetical protein CISIN_1g002566mg                 95.1    4e-20   
ref|XP_004295664.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    4e-20   
gb|KDO58605.1|  hypothetical protein CISIN_1g002566mg                 95.1    4e-20   
ref|XP_004488995.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    5e-20   
ref|XP_009386587.1|  PREDICTED: probable LRR receptor-like serine...  94.7    6e-20   
ref|XP_006348929.1|  PREDICTED: probable LRR receptor-like serine...  94.4    7e-20   
ref|XP_006442361.1|  hypothetical protein CICLE_v10019246mg           94.0    7e-20   
gb|KDO52103.1|  hypothetical protein CISIN_1g043333mg                 94.4    7e-20   
ref|XP_007214614.1|  hypothetical protein PRUPE_ppa001161mg           94.4    8e-20   
ref|XP_006442308.1|  hypothetical protein CICLE_v10024314mg           94.0    1e-19   
gb|KDO49311.1|  hypothetical protein CISIN_1g045177mg                 92.4    1e-19   
ref|XP_011098063.1|  PREDICTED: probable LRR receptor-like serine...  93.6    1e-19   
ref|XP_007214913.1|  hypothetical protein PRUPE_ppa000698mg           93.6    1e-19   
ref|XP_002306015.2|  hypothetical protein POPTR_0004s14310g           93.2    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010691210.1|  PREDICTED: probable leucine-rich repeat rece...  92.8    2e-19   
ref|XP_007149530.1|  hypothetical protein PHAVU_005G077900g           92.4    3e-19   
ref|XP_006442359.1|  hypothetical protein CICLE_v100189082mg          92.4    3e-19   
ref|XP_007149527.1|  hypothetical protein PHAVU_005G077600g           92.0    3e-19   
ref|XP_008229374.1|  PREDICTED: probable LRR receptor-like serine...  92.4    3e-19   
ref|XP_011010609.1|  PREDICTED: probable LRR receptor-like serine...  92.4    4e-19   
ref|XP_007149536.1|  hypothetical protein PHAVU_005G078400g           92.4    4e-19   
ref|XP_011010608.1|  PREDICTED: probable LRR receptor-like serine...  92.0    5e-19   
emb|CAN60698.1|  hypothetical protein VITISV_022626                   92.0    6e-19   Vitis vinifera
ref|XP_010657080.1|  PREDICTED: probable LRR receptor-like serine...  91.7    6e-19   
gb|AES66493.2|  LRR receptor-like kinase                              91.7    6e-19   
ref|XP_003596242.1|  Cysteine-rich receptor-like protein kinase       91.7    7e-19   
gb|KCW89682.1|  hypothetical protein EUGRSUZ_A01951                   91.3    7e-19   
gb|KCW89681.1|  hypothetical protein EUGRSUZ_A01951                   91.3    9e-19   
ref|XP_010053001.1|  PREDICTED: probable LRR receptor-like serine...  91.3    1e-18   
ref|XP_009396547.1|  PREDICTED: probable LRR receptor-like serine...  90.9    1e-18   
gb|KEH38570.1|  cysteine-rich RLK (receptor-like kinase) protein      90.9    1e-18   
ref|XP_010916505.1|  PREDICTED: probable LRR receptor-like serine...  90.9    1e-18   
ref|XP_003596241.1|  LRR receptor-like serine/threonine-protein k...  90.1    1e-18   
ref|XP_010916513.1|  PREDICTED: probable LRR receptor-like serine...  90.9    1e-18   
ref|XP_010272760.1|  PREDICTED: probable leucine-rich repeat rece...  90.9    1e-18   
ref|XP_006661143.1|  PREDICTED: probable LRR receptor-like serine...  90.1    2e-18   
emb|CDP06041.1|  unnamed protein product                              90.5    2e-18   
ref|XP_007149541.1|  hypothetical protein PHAVU_005G078900g           90.5    2e-18   
ref|XP_011002767.1|  PREDICTED: probable leucine-rich repeat rece...  90.5    2e-18   
gb|AES66492.2|  LRR receptor-like kinase                              90.5    2e-18   
ref|XP_006301399.1|  hypothetical protein CARUB_v10021813mg           90.1    2e-18   
ref|XP_002532988.1|  conserved hypothetical protein                   90.1    2e-18   Ricinus communis
ref|XP_008795773.1|  PREDICTED: probable LRR receptor-like serine...  90.1    2e-18   
ref|XP_008795771.1|  PREDICTED: probable LRR receptor-like serine...  90.1    2e-18   
ref|XP_010921615.1|  PREDICTED: probable LRR receptor-like serine...  90.1    2e-18   
ref|XP_007149524.1|  hypothetical protein PHAVU_005G077400g           89.7    2e-18   
ref|XP_004243241.1|  PREDICTED: probable LRR receptor-like serine...  90.1    3e-18   
ref|XP_006575671.1|  PREDICTED: probable LRR receptor-like serine...  89.0    3e-18   
ref|XP_007021949.1|  Leucine-rich repeat transmembrane protein ki...  89.7    3e-18   
emb|CDP18745.1|  unnamed protein product                              89.4    4e-18   
gb|KEH38575.1|  cysteine-rich RLK (receptor-like kinase) protein      89.4    5e-18   
gb|KHN19486.1|  Putative leucine-rich repeat receptor-like serine...  89.4    5e-18   
ref|XP_006575670.1|  PREDICTED: probable LRR receptor-like serine...  89.0    5e-18   
ref|XP_008463770.1|  PREDICTED: probable leucine-rich repeat rece...  87.4    5e-18   
gb|KHN00371.1|  Putative LRR receptor-like serine/threonine-prote...  84.3    5e-18   
ref|XP_004488998.1|  PREDICTED: probable leucine-rich repeat rece...  89.0    5e-18   
ref|XP_004305822.1|  PREDICTED: probable LRR receptor-like serine...  89.0    5e-18   
gb|KEH28296.1|  LRR receptor-like kinase                              89.0    5e-18   
dbj|BAD29102.1|  leucine-rich repeat family protein /protein kina...  88.6    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003519558.1|  PREDICTED: probable LRR receptor-like serine...  89.0    6e-18   
gb|KHN38301.1|  Putative LRR receptor-like serine/threonine-prote...  89.0    6e-18   
ref|XP_003616753.1|  Cysteine-rich receptor-like protein kinase       89.0    6e-18   
ref|XP_010247776.1|  PREDICTED: probable LRR receptor-like serine...  89.0    6e-18   
gb|AEO14875.1|  rfls6 protein                                         89.0    6e-18   
ref|XP_004162114.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  88.2    6e-18   
gb|EEE69521.1|  hypothetical protein OsJ_28982                        89.0    7e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007142243.1|  hypothetical protein PHAVU_008G264400g           89.0    7e-18   
ref|XP_008463767.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    7e-18   
ref|XP_008463769.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    7e-18   
gb|EEC84403.1|  hypothetical protein OsI_30981                        88.6    7e-18   Oryza sativa Indica Group [Indian rice]
gb|KHN19488.1|  Putative leucine-rich repeat receptor-like serine...  88.6    7e-18   
ref|NP_001237942.1|  receptor-like protein kinase                     88.2    8e-18   
ref|XP_006592942.1|  PREDICTED: probable leucine-rich repeat rece...  88.6    8e-18   
ref|XP_008463768.1|  PREDICTED: probable leucine-rich repeat rece...  87.4    9e-18   
ref|XP_007048781.1|  Leucine-rich repeat transmembrane protein ki...  88.2    1e-17   
ref|XP_010916565.1|  PREDICTED: probable LRR receptor-like serine...  88.2    1e-17   
ref|XP_008780294.1|  PREDICTED: probable LRR receptor-like serine...  85.1    1e-17   
gb|KHN11945.1|  Putative LRR receptor-like serine/threonine-prote...  88.2    1e-17   
ref|XP_007048780.1|  Leucine-rich repeat transmembrane protein ki...  88.2    1e-17   
ref|XP_006595488.1|  PREDICTED: receptor-like protein kinase isof...  88.2    1e-17   
ref|XP_007048782.1|  Leucine-rich repeat transmembrane protein ki...  87.8    1e-17   
ref|XP_010094304.1|  putative LRR receptor-like serine/threonine-...  87.4    1e-17   
ref|XP_006593302.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    1e-17   
ref|XP_008812544.1|  PREDICTED: probable LRR receptor-like serine...  87.8    1e-17   
ref|XP_010665668.1|  PREDICTED: probable LRR receptor-like serine...  87.8    1e-17   
ref|XP_010665665.1|  PREDICTED: probable LRR receptor-like serine...  87.8    2e-17   
ref|XP_006370080.1|  hypothetical protein POPTR_0001s39360g           87.8    2e-17   
ref|XP_010665669.1|  PREDICTED: probable LRR receptor-like serine...  87.4    2e-17   
ref|XP_010665666.1|  PREDICTED: probable LRR receptor-like serine...  87.8    2e-17   
gb|EPS72702.1|  hypothetical protein M569_02055                       87.4    2e-17   
ref|XP_010665667.1|  PREDICTED: probable LRR receptor-like serine...  87.4    2e-17   
ref|XP_008463774.1|  PREDICTED: probable leucine-rich repeat rece...  87.0    2e-17   
ref|XP_008245552.1|  PREDICTED: probable leucine-rich repeat rece...  87.0    2e-17   
gb|KGN55040.1|  hypothetical protein Csa_4G624460                     87.0    2e-17   
ref|XP_006417782.1|  hypothetical protein EUTSA_v10006761mg           86.7    2e-17   
ref|XP_006417781.1|  hypothetical protein EUTSA_v10006761mg           87.0    2e-17   
ref|XP_008226376.1|  PREDICTED: probable leucine-rich repeat rece...  87.4    2e-17   
ref|XP_008463779.1|  PREDICTED: probable leucine-rich repeat rece...  87.0    3e-17   
ref|XP_008463778.1|  PREDICTED: probable leucine-rich repeat rece...  86.7    3e-17   
ref|XP_006370936.1|  hypothetical protein POPTR_0019s01930g           86.3    3e-17   
ref|XP_010645745.1|  PREDICTED: probable LRR receptor-like serine...  83.6    4e-17   
gb|KEH38568.1|  LRR receptor-like kinase                              86.3    4e-17   
ref|XP_010645746.1|  PREDICTED: probable LRR receptor-like serine...  83.6    4e-17   
ref|XP_010645744.1|  PREDICTED: probable LRR receptor-like serine...  83.2    4e-17   
ref|XP_010645736.1|  PREDICTED: probable LRR receptor-like serine...  83.2    4e-17   
ref|XP_002317378.1|  hypothetical protein POPTR_0011s06680g           82.0    5e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010645752.1|  PREDICTED: probable LRR receptor-like serine...  83.2    5e-17   
ref|XP_008360268.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    5e-17   
ref|XP_010418194.1|  PREDICTED: probable leucine-rich repeat rece...  86.3    5e-17   
ref|XP_008775542.1|  PREDICTED: probable LRR receptor-like serine...  86.3    5e-17   
ref|XP_010646291.1|  PREDICTED: probable LRR receptor-like serine...  82.4    5e-17   
ref|XP_010916525.1|  PREDICTED: probable LRR receptor-like serine...  86.3    5e-17   
ref|XP_010916533.1|  PREDICTED: probable LRR receptor-like serine...  86.3    5e-17   
gb|KGN55032.1|  hypothetical protein Csa_4G623400                     85.9    6e-17   
ref|XP_009359382.1|  PREDICTED: probable leucine-rich repeat rece...  86.3    6e-17   
ref|XP_010272741.1|  PREDICTED: probable LRR receptor-like serine...  85.9    6e-17   
ref|XP_008380257.1|  PREDICTED: probable LRR receptor-like serine...  85.1    6e-17   
ref|XP_008775543.1|  PREDICTED: probable LRR receptor-like serine...  85.9    6e-17   
ref|XP_004146079.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    7e-17   
ref|XP_004146082.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    7e-17   
ref|XP_004162117.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    7e-17   
ref|XP_004489067.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    7e-17   
ref|XP_008380256.1|  PREDICTED: probable LRR receptor-like serine...  85.9    7e-17   
ref|XP_010552132.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    7e-17   
ref|XP_008380254.1|  PREDICTED: probable LRR receptor-like serine...  85.9    8e-17   
emb|CDP06042.1|  unnamed protein product                              85.5    8e-17   
ref|XP_008380255.1|  PREDICTED: probable LRR receptor-like serine...  85.5    9e-17   
ref|XP_004294067.1|  PREDICTED: probable LRR receptor-like serine...  85.5    9e-17   
ref|XP_004956630.1|  PREDICTED: probable LRR receptor-like serine...  85.5    9e-17   
ref|XP_010272733.1|  PREDICTED: probable LRR receptor-like serine...  85.5    9e-17   
ref|XP_004956631.1|  PREDICTED: probable LRR receptor-like serine...  85.5    9e-17   
ref|XP_009350015.1|  PREDICTED: probable LRR receptor-like serine...  85.5    1e-16   
ref|XP_010272732.1|  PREDICTED: probable LRR receptor-like serine...  85.5    1e-16   
ref|XP_008449503.1|  PREDICTED: probable LRR receptor-like serine...  85.1    1e-16   
gb|KHN36922.1|  Putative leucine-rich repeat receptor-like serine...  85.1    1e-16   
ref|XP_010655564.1|  PREDICTED: probable LRR receptor-like serine...  85.1    1e-16   
ref|XP_010238080.1|  PREDICTED: probable LRR receptor-like serine...  84.7    1e-16   
tpg|DAA61113.1|  TPA: putative leucine-rich repeat receptor-like ...  84.7    1e-16   
ref|XP_010238078.1|  PREDICTED: probable LRR receptor-like serine...  84.7    1e-16   
ref|XP_008652586.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-16   
ref|XP_008652585.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-16   
ref|XP_008652587.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-16   
ref|XP_010248481.1|  PREDICTED: probable LRR receptor-like serine...  84.7    2e-16   
gb|EMT28011.1|  Putative LRR receptor-like serine/threonine-prote...  84.3    2e-16   
ref|XP_008775550.1|  PREDICTED: probable LRR receptor-like serine...  84.0    2e-16   
ref|NP_001237014.1|  receptor-like protein kinase 2-like precursor    84.3    2e-16   
ref|XP_008775549.1|  PREDICTED: probable LRR receptor-like serine...  84.0    2e-16   
ref|XP_008779277.1|  PREDICTED: probable LRR receptor-like serine...  84.0    2e-16   
ref|XP_010431689.1|  PREDICTED: probable leucine-rich repeat rece...  84.3    2e-16   
gb|KCW48039.1|  hypothetical protein EUGRSUZ_K01777                   81.6    3e-16   
gb|KEH28414.1|  LRR receptor-like kinase                              84.0    3e-16   
gb|KEH28415.1|  LRR receptor-like kinase                              84.0    3e-16   
ref|XP_006574177.1|  PREDICTED: probable leucine-rich repeat rece...  84.0    3e-16   
ref|XP_003628425.1|  Cysteine-rich receptor-like protein kinase       84.0    3e-16   
emb|CAN75945.1|  hypothetical protein VITISV_024236                   84.0    3e-16   
gb|AET00430.2|  LRR receptor-like kinase                              84.0    3e-16   
ref|XP_003617471.1|  BED finger-nbs resistance protein                84.0    4e-16   
ref|NP_001184930.1|  leucine-rich repeat transmembrane protein ki...  83.6    4e-16   
ref|XP_011082789.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    4e-16   
ref|NP_172244.2|  leucine-rich repeat transmembrane protein kinase    83.6    4e-16   
emb|CAN65055.1|  hypothetical protein VITISV_012378                   82.8    4e-16   
ref|XP_010273496.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    4e-16   
ref|XP_010273497.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    4e-16   
ref|XP_010273495.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    5e-16   
ref|XP_010273494.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    5e-16   
ref|XP_010273493.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    5e-16   
emb|CAN69506.1|  hypothetical protein VITISV_008510                   81.6    5e-16   
ref|XP_006370076.1|  hypothetical protein POPTR_0001s39320g           83.2    5e-16   
gb|KHG04296.1|  hypothetical protein F383_04630                       83.2    6e-16   
gb|KHG04295.1|  hypothetical protein F383_04630                       83.2    6e-16   
ref|XP_006377497.1|  hypothetical protein POPTR_0011s06460g           80.1    6e-16   
emb|CBI20149.3|  unnamed protein product                              82.8    7e-16   
ref|XP_010644094.1|  PREDICTED: probable LRR receptor-like serine...  83.2    7e-16   
ref|XP_004491065.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    7e-16   
gb|KEH38571.1|  cysteine-rich RLK (receptor-like kinase) protein      82.8    7e-16   
ref|XP_002283477.2|  PREDICTED: probable LRR receptor-like serine...  82.8    7e-16   
ref|XP_010909919.1|  PREDICTED: probable LRR receptor-like serine...  82.8    8e-16   
ref|XP_008386284.1|  PREDICTED: probable LRR receptor-like serine...  82.8    8e-16   
ref|XP_004491064.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    8e-16   
gb|KDO42406.1|  hypothetical protein CISIN_1g0044002mg                80.9    1e-15   
gb|KEH38573.1|  LRR receptor-like kinase                              82.4    1e-15   
dbj|BAJ53166.1|  JHL10I11.12                                          82.4    1e-15   
ref|XP_006573364.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    1e-15   
gb|KDO42405.1|  hypothetical protein CISIN_1g0044002mg                80.5    1e-15   
gb|KCW48038.1|  hypothetical protein EUGRSUZ_K01777                   81.3    1e-15   
gb|KDP20042.1|  hypothetical protein JCGZ_05811                       82.0    1e-15   
ref|XP_007149537.1|  hypothetical protein PHAVU_005G078500g           82.0    2e-15   
ref|XP_010248399.1|  PREDICTED: probable LRR receptor-like serine...  82.0    2e-15   
gb|KHN25992.1|  Putative leucine-rich repeat receptor-like serine...  79.0    2e-15   
gb|KEH38566.1|  LRR receptor-like kinase                              81.6    2e-15   
gb|KEH38567.1|  LRR receptor-like kinase                              81.6    2e-15   
ref|XP_007213689.1|  hypothetical protein PRUPE_ppa000854mg           81.6    2e-15   
ref|XP_010238079.1|  PREDICTED: probable LRR receptor-like serine...  81.6    2e-15   
emb|CAN78284.1|  hypothetical protein VITISV_000422                   81.6    2e-15   
ref|XP_004491355.1|  PREDICTED: probable LRR receptor-like serine...  81.3    2e-15   
gb|KCW67558.1|  hypothetical protein EUGRSUZ_F01308                   80.9    2e-15   
ref|XP_009359377.1|  PREDICTED: probable leucine-rich repeat rece...  81.3    2e-15   
ref|XP_004491354.1|  PREDICTED: probable LRR receptor-like serine...  81.3    3e-15   
ref|XP_006377499.1|  hypothetical protein POPTR_0011s06475g           80.1    3e-15   
ref|XP_008226377.1|  PREDICTED: probable LRR receptor-like serine...  81.3    3e-15   
ref|XP_008226378.1|  PREDICTED: probable LRR receptor-like serine...  81.3    3e-15   
ref|XP_010036447.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    3e-15   
ref|XP_009359369.1|  PREDICTED: probable LRR receptor-like serine...  81.3    3e-15   
ref|XP_010522063.1|  PREDICTED: probable LRR receptor-like serine...  80.9    3e-15   
ref|XP_009359381.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    3e-15   
ref|XP_009359368.1|  PREDICTED: probable LRR receptor-like serine...  80.9    3e-15   
ref|XP_010273492.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    3e-15   
gb|KCW75321.1|  hypothetical protein EUGRSUZ_E04067                   80.5    3e-15   
ref|XP_010064487.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    3e-15   
ref|XP_009359367.1|  PREDICTED: probable LRR receptor-like serine...  80.9    3e-15   
ref|XP_002892411.1|  hypothetical protein ARALYDRAFT_470791           80.9    3e-15   
ref|XP_002451829.1|  hypothetical protein SORBIDRAFT_04g008350        80.5    3e-15   
ref|XP_009406150.1|  PREDICTED: probable LRR receptor-like serine...  80.9    3e-15   
emb|CAN81226.1|  hypothetical protein VITISV_038168                   80.9    4e-15   
ref|XP_010273491.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    4e-15   
ref|XP_009406149.1|  PREDICTED: probable LRR receptor-like serine...  80.9    4e-15   
ref|XP_010273490.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    4e-15   
gb|KEH38588.1|  receptor-like kinase                                  79.7    4e-15   
ref|XP_007021941.1|  Leucine-rich repeat transmembrane protein ki...  80.5    4e-15   
ref|XP_010273485.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    4e-15   
ref|XP_010059621.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    4e-15   
ref|XP_008792302.1|  PREDICTED: probable LRR receptor-like serine...  80.9    4e-15   
ref|XP_007021942.1|  Leucine-rich repeat transmembrane protein ki...  80.5    4e-15   
ref|XP_010273489.1|  PREDICTED: probable leucine-rich repeat rece...  80.5    4e-15   
ref|XP_010273486.1|  PREDICTED: probable leucine-rich repeat rece...  80.5    4e-15   
ref|XP_009116594.1|  PREDICTED: probable leucine-rich repeat rece...  80.5    5e-15   
ref|XP_007021940.1|  Leucine-rich repeat transmembrane protein ki...  80.5    5e-15   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...  80.5    5e-15   
ref|XP_010924705.1|  PREDICTED: probable LRR receptor-like serine...  80.5    5e-15   
ref|XP_007149538.1|  hypothetical protein PHAVU_005G078600g           79.7    5e-15   
emb|CDY20088.1|  BnaA01g29140D                                        80.5    5e-15   
ref|XP_006377512.1|  hypothetical protein POPTR_0011s06580g           77.4    6e-15   
gb|KEH38587.1|  receptor-like kinase                                  80.1    6e-15   
ref|XP_003596253.1|  Receptor protein kinase-like protein             79.7    6e-15   
gb|AES66504.2|  receptor-like kinase                                  79.7    6e-15   
gb|KFK38835.1|  hypothetical protein AALP_AA3G166500                  80.1    7e-15   
ref|XP_009376743.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  80.1    7e-15   
ref|XP_006573362.1|  PREDICTED: probable leucine-rich repeat rece...  79.7    7e-15   
ref|NP_001238159.1|  receptor-like serine/threonine kinase            80.1    7e-15   
ref|XP_002317319.2|  hypothetical protein POPTR_0011s032002g          79.3    8e-15   
ref|XP_006573361.1|  PREDICTED: probable leucine-rich repeat rece...  79.7    8e-15   
ref|XP_010557120.1|  PREDICTED: probable LRR receptor-like serine...  79.7    9e-15   
ref|XP_010557103.1|  PREDICTED: probable LRR receptor-like serine...  79.7    9e-15   
ref|XP_011002049.1|  PREDICTED: probable LRR receptor-like serine...  79.7    9e-15   
ref|XP_010064491.1|  PREDICTED: probable LRR receptor-like serine...  79.3    9e-15   
ref|XP_010557111.1|  PREDICTED: probable LRR receptor-like serine...  79.7    9e-15   
ref|XP_011002044.1|  PREDICTED: probable LRR receptor-like serine...  79.7    1e-14   
ref|XP_011002050.1|  PREDICTED: probable LRR receptor-like serine...  79.7    1e-14   
ref|XP_011002045.1|  PREDICTED: probable LRR receptor-like serine...  79.7    1e-14   
ref|XP_011002046.1|  PREDICTED: probable LRR receptor-like serine...  79.7    1e-14   
ref|XP_008463771.1|  PREDICTED: probable leucine-rich repeat rece...  79.7    1e-14   
ref|XP_011002047.1|  PREDICTED: probable LRR receptor-like serine...  79.7    1e-14   
gb|KCW47999.1|  hypothetical protein EUGRSUZ_K017291                  75.9    1e-14   
emb|CDY32338.1|  BnaC01g36570D                                        79.7    1e-14   
ref|XP_011002048.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-14   
ref|XP_011039371.1|  PREDICTED: probable LRR receptor-like serine...  79.7    1e-14   
ref|XP_002317385.1|  hypothetical protein POPTR_0011s06740g           79.3    1e-14   
ref|XP_010246507.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-14   
ref|XP_010246506.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-14   
gb|KCW67597.1|  hypothetical protein EUGRSUZ_F013531                  79.0    1e-14   
ref|XP_009148012.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-14   
gb|KEH38576.1|  LRR receptor-like kinase                              79.3    1e-14   
ref|XP_002876295.1|  predicted protein                                79.3    1e-14   
emb|CDX93632.1|  BnaA06g04160D                                        79.0    2e-14   
ref|XP_003596234.1|  Leucine-rich repeat family protein /protein ...  75.9    2e-14   
gb|KCW67553.1|  hypothetical protein EUGRSUZ_F013051                  78.6    2e-14   
ref|XP_008345208.1|  PREDICTED: probable LRR receptor-like serine...  77.4    2e-14   
ref|XP_010675288.1|  PREDICTED: probable LRR receptor-like serine...  79.0    2e-14   
gb|KCW67548.1|  hypothetical protein EUGRSUZ_F01302                   78.6    2e-14   
ref|XP_010246504.1|  PREDICTED: probable LRR receptor-like serine...  79.0    2e-14   
ref|XP_010246505.1|  PREDICTED: probable LRR receptor-like serine...  79.0    2e-14   
ref|XP_004951376.1|  PREDICTED: probable LRR receptor-like serine...  79.0    2e-14   
gb|EEC72788.1|  hypothetical protein OsI_06468                        78.6    2e-14   
ref|XP_010060733.1|  PREDICTED: probable LRR receptor-like serine...  78.6    2e-14   
ref|XP_010060736.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    2e-14   
ref|XP_010644093.1|  PREDICTED: probable LRR receptor-like serine...  78.6    2e-14   
ref|XP_010644092.1|  PREDICTED: probable LRR receptor-like serine...  78.6    2e-14   
ref|XP_010064485.1|  PREDICTED: probable leucine-rich repeat rece...  78.6    3e-14   
ref|XP_002283464.2|  PREDICTED: probable LRR receptor-like serine...  78.6    3e-14   
ref|XP_004140247.1|  PREDICTED: probable LRR receptor-like serine...  78.6    3e-14   
gb|KCW67557.1|  hypothetical protein EUGRSUZ_F01307                   78.2    3e-14   
gb|KEH19464.1|  LRR receptor-like kinase                              78.2    3e-14   
gb|KHN04125.1|  Putative LRR receptor-like serine/threonine-prote...  78.2    3e-14   
ref|XP_004951374.1|  PREDICTED: probable LRR receptor-like serine...  78.2    3e-14   
gb|KGN47984.1|  hypothetical protein Csa_6G421780                     78.2    3e-14   
ref|XP_006392563.1|  hypothetical protein EUTSA_v10012222mg           78.2    3e-14   
gb|KHN04126.1|  Putative leucine-rich repeat receptor-like serine...  78.2    3e-14   
emb|CAN70496.1|  hypothetical protein VITISV_042040                   78.2    3e-14   
ref|XP_004951373.1|  PREDICTED: probable LRR receptor-like serine...  78.2    3e-14   
ref|XP_010060735.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    3e-14   
emb|CBI20153.3|  unnamed protein product                              77.8    3e-14   
gb|KEH19463.1|  LRR receptor-like kinase                              78.2    3e-14   
gb|KCW67565.1|  hypothetical protein EUGRSUZ_F01314                   77.8    3e-14   
ref|XP_009359378.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    3e-14   
ref|XP_010457957.1|  PREDICTED: probable LRR receptor-like serine...  78.2    4e-14   
ref|XP_010060734.1|  PREDICTED: probable LRR receptor-like serine...  78.2    4e-14   
ref|XP_004951375.1|  PREDICTED: probable LRR receptor-like serine...  77.8    4e-14   
ref|XP_003634705.1|  PREDICTED: probable LRR receptor-like serine...  77.8    4e-14   
gb|KGN53588.1|  hypothetical protein Csa_4G083620                     77.8    4e-14   
ref|XP_004951379.1|  PREDICTED: probable LRR receptor-like serine...  77.8    4e-14   
gb|KCW67564.1|  hypothetical protein EUGRSUZ_F01313                   77.4    4e-14   
ref|XP_003628426.1|  Receptor-like serine/threonine kinase            77.4    5e-14   
ref|XP_010064057.1|  PREDICTED: probable LRR receptor-like serine...  77.4    5e-14   
ref|XP_010064055.1|  PREDICTED: probable LRR receptor-like serine...  77.4    6e-14   
gb|ABF72026.1|  leucine-rich repeat-containing protein kinase fam...  77.4    6e-14   
ref|XP_010064056.1|  PREDICTED: probable LRR receptor-like serine...  77.4    6e-14   
ref|XP_006647102.1|  PREDICTED: probable LRR receptor-like serine...  77.0    7e-14   
ref|XP_010064054.1|  PREDICTED: probable LRR receptor-like serine...  77.0    7e-14   
ref|XP_010475531.1|  PREDICTED: probable LRR receptor-like serine...  77.0    8e-14   
gb|KCW71360.1|  hypothetical protein EUGRSUZ_F04441                   76.6    8e-14   
gb|KCW71361.1|  hypothetical protein EUGRSUZ_F04443                   76.6    8e-14   
ref|XP_010247772.1|  PREDICTED: probable leucine-rich repeat rece...  77.0    8e-14   
gb|AES66496.2|  LRR receptor-like kinase                              77.0    9e-14   
ref|XP_003596245.1|  Receptor-like protein kinase                     76.6    9e-14   
ref|XP_010475530.1|  PREDICTED: probable LRR receptor-like serine...  76.6    1e-13   
ref|XP_006442357.1|  hypothetical protein CICLE_v10018686mg           76.6    1e-13   
emb|CDY10508.1|  BnaC03g71060D                                        76.6    1e-13   
gb|KEH38578.1|  LRR receptor-like kinase                              76.6    1e-13   
emb|CDX95138.1|  BnaC05g05330D                                        76.6    1e-13   
ref|XP_011016790.1|  PREDICTED: probable LRR receptor-like serine...  75.1    1e-13   
emb|CAN73140.1|  hypothetical protein VITISV_019010                   76.3    1e-13   
gb|KEH38577.1|  LRR receptor-like kinase                              76.6    1e-13   
gb|AES66484.2|  cysteine-rich RLK (receptor-like kinase) protein      75.9    1e-13   
gb|KHN36920.1|  Putative LRR receptor-like serine/threonine-prote...  76.6    1e-13   
ref|XP_002273016.1|  PREDICTED: probable LRR receptor-like serine...  76.6    1e-13   
dbj|BAD27712.1|  disease resistance protein Cf-2.1-like               76.3    1e-13   
ref|XP_002522278.1|  kinase, putative                                 76.3    1e-13   
gb|KEH19462.1|  LRR receptor-like kinase                              76.3    1e-13   
ref|XP_008451725.1|  PREDICTED: probable LRR receptor-like serine...  76.3    1e-13   
ref|XP_004513262.1|  PREDICTED: probable LRR receptor-like serine...  76.3    1e-13   
gb|EEE56614.1|  hypothetical protein OsJ_05994                        76.3    1e-13   
emb|CBI39030.3|  unnamed protein product                              76.6    2e-13   
gb|KEH19461.1|  LRR receptor-like kinase                              76.3    2e-13   
ref|XP_007132111.1|  hypothetical protein PHAVU_011G067400g           76.3    2e-13   
gb|KDP27082.1|  hypothetical protein JCGZ_20306                       76.3    2e-13   
ref|XP_006306823.1|  hypothetical protein CARUB_v10008366mg           75.9    2e-13   



>ref|XP_006358135.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=779

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG  V+IG+T YEAD+DS G AK+ S++E+W ASN+GYF  W    TA DY A
Sbjct  190  YSVHINCGGESVTIGDTVYEADRDSAGAAKFTSSKESWGASNSGYF--WDKSITAKDYLA  247

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             NIS I   DSE+Y TARLS LSLTYYGRCLANGNYTV
Sbjct  248  NNISSIKGNDSELYTTARLSALSLTYYGRCLANGNYTV  285



>ref|XP_010316866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=993

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG  V+IG+T YEAD+DS G AK+ S++E+W ASN+GYF  W    TA DY A
Sbjct  404  YSVHINCGGKSVTIGDTVYEADRDSAGAAKFTSSKESWGASNSGYF--WDKIITAKDYLA  461

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             NIS I   DSE+Y TARLS LSLTYYGRCLANGNYTV
Sbjct  462  NNISAIKGNDSELYTTARLSALSLTYYGRCLANGNYTV  499



>ref|XP_010655575.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=986

 Score =   128 bits (322),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+  YEAD D  GP+++   R+NW  S+TG+F  W  + T+ DY A
Sbjct  386  YSLHINCGGEGTTIGDVVYEADDDLAGPSEFNPIRDNWGFSSTGHF--WDQNRTSKDYIA  443

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+YK ARLSPLS TYYGRCLA+GNYTVK
Sbjct  444  QNVSMLRMNDSELYKRARLSPLSFTYYGRCLADGNYTVK  482



>ref|XP_010655579.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Vitis vinifera]
Length=844

 Score =   128 bits (321),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+  YEAD D  GP+++   R+NW  S+TG+F  W  + T+ DY A
Sbjct  408  YSLHINCGGEGTTIGDVVYEADDDLAGPSEFNPIRDNWGFSSTGHF--WDQNRTSKDYIA  465

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+YK ARLSPLS TYYGRCLA+GNYTVK
Sbjct  466  QNVSMLRMNDSELYKRARLSPLSFTYYGRCLADGNYTVK  504



>ref|XP_010655576.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=985

 Score =   128 bits (321),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+  YEAD D  GP+++   R+NW  S+TG+F  W  + T+ DY A
Sbjct  385  YSLHINCGGEGTTIGDVVYEADDDLAGPSEFNPIRDNWGFSSTGHF--WDQNRTSKDYIA  442

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+YK ARLSPLS TYYGRCLA+GNYTVK
Sbjct  443  QNVSMLRMNDSELYKRARLSPLSFTYYGRCLADGNYTVK  481



>ref|XP_010655559.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=997

 Score =   127 bits (320),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG   IG+  YEAD+D  GP+K+V  R+NW  S+TG F  W  D T  +Y A
Sbjct  406  YSLHINCGGGRTIIGDIVYEADEDLAGPSKFVPTRDNWGFSSTGDF--WDRDRTTKNYIA  463

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  464  HNVSMLGMNDSELYTRARLSPLSYTYYGRCLADGNYTVK  502



>ref|XP_010655574.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 emb|CBI30746.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score =   127 bits (320),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+  YEAD D  GP+++   R+NW  S+TG+F  W  + T+ DY A
Sbjct  408  YSLHINCGGEGTTIGDVVYEADDDLAGPSEFNPIRDNWGFSSTGHF--WDQNRTSKDYIA  465

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+YK ARLSPLS TYYGRCLA+GNYTVK
Sbjct  466  QNVSMLRMNDSELYKRARLSPLSFTYYGRCLADGNYTVK  504



>emb|CDO96888.1| unnamed protein product [Coffea canephora]
Length=1019

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS H+NCGG    IGN  +EAD+DS G AK+V ++ENW  S+TG F  W + ++  +YTA
Sbjct  428  YSLHVNCGGKSTVIGNKVFEADEDSAGAAKFVPSKENWGTSSTGDF--WDVTTSIANYTA  485

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+SV+ V DS++Y TARLSPLSLTYYGRCLANGNYTV
Sbjct  486  NNVSVLRVNDSDLYTTARLSPLSLTYYGRCLANGNYTV  523



>ref|XP_010655560.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=970

 Score =   127 bits (320),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG   IG+  YEAD+D  GP+K+V  R+NW  S+TG F  W  D T  +Y A
Sbjct  412  YSLHINCGGGRTIIGDIVYEADEDLAGPSKFVPTRDNWGFSSTGDF--WDRDRTTKNYIA  469

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+Y  ARLSPLS TYYGRCLA+G YTVK
Sbjct  470  QNVSMLGMNDSELYTRARLSPLSFTYYGRCLADGTYTVK  508



>ref|XP_010655577.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
Length=891

 Score =   127 bits (319),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+  YEAD D  GP+++   R+NW  S+TG+F  W  + T+ DY A
Sbjct  408  YSLHINCGGEGTTIGDVVYEADDDLAGPSEFNPIRDNWGFSSTGHF--WDQNRTSKDYIA  465

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+YK ARLSPLS TYYGRCLA+GNYTVK
Sbjct  466  QNVSMLRMNDSELYKRARLSPLSFTYYGRCLADGNYTVK  504



>emb|CBI30744.3| unnamed protein product [Vitis vinifera]
Length=1144

 Score =   127 bits (320),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG   IG+  YEAD+D  GP+K+V  R+NW  S+TG F  W  D T  +Y A
Sbjct  412  YSLHINCGGGRTIIGDIVYEADEDLAGPSKFVPTRDNWGFSSTGDF--WDRDRTTKNYIA  469

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+Y  ARLSPLS TYYGRCLA+G YTVK
Sbjct  470  QNVSMLGMNDSELYTRARLSPLSFTYYGRCLADGTYTVK  508



>emb|CAN81177.1| hypothetical protein VITISV_011951 [Vitis vinifera]
Length=868

 Score =   127 bits (319),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+  YEAD D  GP+++   R+NW  S+TG+F  W  + T+ DY A
Sbjct  255  YSLHINCGGEGTTIGDVVYEADDDLAGPSEFNPIRDNWGFSSTGHF--WDQNRTSKDYIA  312

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+YK ARLSPLS TYYGRCLA+GNYTVK
Sbjct  313  QNVSMLRMNDSELYKRARLSPLSFTYYGRCLADGNYTVK  351



>ref|XP_010655578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Vitis vinifera]
Length=864

 Score =   127 bits (319),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+  YEAD D  GP+++   R+NW  S+TG+F  W  + T+ DY A
Sbjct  264  YSLHINCGGEGTTIGDVVYEADDDLAGPSEFNPIRDNWGFSSTGHF--WDQNRTSKDYIA  321

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+YK ARLSPLS TYYGRCLA+GNYTVK
Sbjct  322  QNVSMLRMNDSELYKRARLSPLSFTYYGRCLADGNYTVK  360



>ref|XP_010655558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1003

 Score =   127 bits (320),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG   IG+  YEAD+D  GP+K+V  R+NW  S+TG F  W  D T  +Y A
Sbjct  412  YSLHINCGGGRTIIGDIVYEADEDLAGPSKFVPTRDNWGFSSTGDF--WDRDRTTKNYIA  469

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  470  HNVSMLGMNDSELYTRARLSPLSYTYYGRCLADGNYTVK  508



>ref|XP_010655561.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Vitis vinifera]
Length=783

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG   IG+  YEAD+D  GP+K+V  R+NW  S+TG F  W  D T  +Y A
Sbjct  412  YSLHINCGGGRTIIGDIVYEADEDLAGPSKFVPTRDNWGFSSTGDF--WDRDRTTKNYIA  469

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+Y  ARLSPLS TYYGRCLA+G YTVK
Sbjct  470  QNVSMLGMNDSELYTRARLSPLSFTYYGRCLADGTYTVK  508



>emb|CBI30745.3| unnamed protein product [Vitis vinifera]
Length=1901

 Score =   127 bits (320),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  2     YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
             YS HINCGGG   IG+  YEAD+D  GP+K+V  R+NW  S+TG F  W  D T  +Y A
Sbjct  1310  YSLHINCGGGRTIIGDIVYEADEDLAGPSKFVPTRDNWGFSSTGDF--WDRDRTTKNYIA  1367

Query  182   TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
              N+S++ + DSE+Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  1368  HNVSMLGMNDSELYTRARLSPLSYTYYGRCLADGNYTVK  1406



>ref|XP_011102303.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650, partial [Sesamum indicum]
Length=486

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YSFH+NCGG    +GN+ ++ D++S G  K+   RENW  S+TG+F  W  + T  DY A
Sbjct  52   YSFHVNCGGLTTRVGNSVFDGDEESSGSEKFAFTRENWGTSSTGFF--WDHNRTMTDYVA  109

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+SV+ V D E+Y TARLSPLSLTYYGRCL NGNYTV
Sbjct  110  KNVSVLRVNDPELYATARLSPLSLTYYGRCLGNGNYTV  147



>emb|CAN61169.1| hypothetical protein VITISV_010446 [Vitis vinifera]
Length=661

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG   IG+  YEAD+D  GP+K+V  R+NW  S+TG F  W  D T  +Y A
Sbjct  87   YSLHINCGGGRTIIGDIVYEADEDLAGPSKFVPTRDNWGFSSTGDF--WDRDRTTKNYIA  144

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+Y  ARLSPLS TYYGRCLA+G YTVK
Sbjct  145  XNVSMLGMNDSELYTRARLSPLSXTYYGRCLADGXYTVK  183



>ref|XP_010655581.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=1009

 Score =   124 bits (311),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG +   GN  YE DKD  GPAK+   ++NW  S++G+F  W  D  A+DY A
Sbjct  424  YSLHINCGGEETRSGNIVYEEDKDEGGPAKFQPKKDNWGFSSSGHF--WDGDKIASDYIA  481

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN+S++ +  SE+Y TARLSPLSLTYYGRCLA+G Y+VK
Sbjct  482  TNVSILKMNYSELYTTARLSPLSLTYYGRCLADGKYSVK  520



>ref|XP_010655580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1038

 Score =   124 bits (311),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG +   GN  YE DKD  GPAK+   ++NW  S++G+F  W  D  A+DY A
Sbjct  424  YSLHINCGGEETRSGNIVYEEDKDEGGPAKFQPKKDNWGFSSSGHF--WDGDKIASDYIA  481

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN+S++ +  SE+Y TARLSPLSLTYYGRCLA+G Y+VK
Sbjct  482  TNVSILKMNYSELYTTARLSPLSLTYYGRCLADGKYSVK  520



>gb|KDP21156.1| hypothetical protein JCGZ_21627 [Jatropha curcas]
Length=962

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG   IG+ TYEAD++    AKYV  RE+W  S+TG+F  W  + +++DYTA
Sbjct  359  YSLHINCGGGATKIGSITYEADEEPTAAAKYVPIRESWEISSTGHF--WDKNRSSSDYTA  416

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ ++DSE+Y  AR+SPLSL+YY RCLANGNY+VK
Sbjct  417  QNSSILRMEDSELYMRARVSPLSLSYYARCLANGNYSVK  455



>ref|XP_010655582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=1001

 Score =   124 bits (311),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG +   GN  YE DKD  GPAK+   ++NW  S++G+F  W  D  A+DY A
Sbjct  424  YSLHINCGGEETRSGNIVYEEDKDEGGPAKFQPKKDNWGFSSSGHF--WDGDKIASDYIA  481

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN+S++ +  SE+Y TARLSPLSLTYYGRCLA+G Y+VK
Sbjct  482  TNVSILKMNYSELYTTARLSPLSLTYYGRCLADGKYSVK  520



>ref|XP_010316867.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=998

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG  V+IG+TTYEAD+DS G AK+V  RE+W +SNTG F  W      N+Y A
Sbjct  410  YSVHINCGGESVTIGDTTYEADEDSAGAAKFVYWRESWGSSNTGDF--WDRPIALNEYKA  467

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            TN+S I  ++SE+Y TARLS LSLTYYGRCLANG YTV
Sbjct  468  TNVSSIKGQNSELYTTARLSALSLTYYGRCLANGKYTV  505



>ref|XP_002528777.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33599.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score =   122 bits (306),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 59/99 (60%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+ TYEAD++S   AKYV NRE W  SNTG F   G + +A++Y A
Sbjct  385  YSLHINCGGRPTTIGSITYEADEESGAAAKYVPNRETWEISNTGKFV--GANRSASNYIA  442

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S + + +SE+Y  ARLSPLSLTYY RCL NGNYTVK
Sbjct  443  QNFSTLKMVNSELYTRARLSPLSLTYYVRCLGNGNYTVK  481



>ref|XP_006358134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1028

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG  V+IG+ TYEAD+DS G AK+V  +E+W +SNTG F  W      N+Y A
Sbjct  437  YSVHINCGGESVTIGDITYEADEDSAGAAKFVYWKESWGSSNTGDF--WDRPIALNEYKA  494

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            TNIS I   +SE+Y TARLS LSLTYYGRCLANGNYTV
Sbjct  495  TNISSIKGHNSELYTTARLSALSLTYYGRCLANGNYTV  532



>ref|XP_004233025.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=1002

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG+V++GNTTY AD+DS G AK+V  + NW  S+TG+F  W  D + +D+ A
Sbjct  403  YSLHINCGGGNVTVGNTTYIADEDSAGAAKFVYWKGNWGTSSTGHF--WDTDVSLDDHKA  460

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S I   +S++Y TA LSPLS+TY+GRCLANGNYT+
Sbjct  461  KNVSAIKGDESQLYMTAHLSPLSMTYFGRCLANGNYTL  498



>ref|XP_010088632.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36794.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=617

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG  ++IGN  YE D+D  G AK+V N   W  S+TG F  W + S+  DY A
Sbjct  32   YSLHINCGGKQITIGNIKYEGDEDPGGAAKFVHNTATWGFSSTGDF--WDIWSSTKDYIA  89

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ + +SE+Y TARLSPLSL YY RCLANGNYTVK
Sbjct  90   NNVSVLRMNNSELYTTARLSPLSLAYYARCLANGNYTVK  128



>ref|XP_006358131.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=617

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG  V+IG+T YEAD++S G AK+V  +E+W +SNTG F  W +  T+N+Y A
Sbjct  76   YSVHINCGGESVTIGDTIYEADENSAGAAKFVYWKESWGSSNTGDF--WYVPITSNEYKA  133

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            TN+S I   +SE+Y TARLS LSLTYYGRCL NGNYTV
Sbjct  134  TNVSSIKGHNSELYTTARLSALSLTYYGRCLINGNYTV  171



>ref|XP_007025267.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY27889.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1007

 Score =   120 bits (300),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG  +IG+  YE D+D+ GPAKY   +E W  S+TG F  W    +A DY A
Sbjct  415  YSVHINCGGGATTIGDINYEEDEDAGGPAKYFPIKETWETSSTGLF--WDTSVSAKDYIA  472

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S++   +S +Y TARLSPLSLTY+ RCLANGNYTV
Sbjct  473  QNVSLLRTNNSNLYTTARLSPLSLTYFVRCLANGNYTV  510



>ref|XP_008347521.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Malus domestica]
Length=783

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++G   +EAD D  GPAK+V  R  W  S TG+F  W  + T+NDY A
Sbjct  179  YSLHINCGGTATTVGGVDFEADTDLGGPAKFVPVRPMWGISTTGHF--WDANPTSNDYIA  236

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             NIS++ + +SE+Y  ARLSPLSLTYY RCL NGNYTV+
Sbjct  237  NNISILGMDNSELYTNARLSPLSLTYYARCLGNGNYTVR  275



>ref|XP_009600347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG V+IGNTT+EAD+DS G AK+V  + NW +S+TG+F  W    + NDY A
Sbjct  403  YSLHINCGGGRVTIGNTTFEADEDSAGAAKFVYWKGNWGSSSTGHF--WDRVISLNDYKA  460

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S I   +S++Y TA LSPLSLTY+ RCLANG+YT+
Sbjct  461  DNVSAITGDESQLYMTAHLSPLSLTYFARCLANGSYTL  498



>ref|XP_007025270.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27892.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=941

 Score =   119 bits (299),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +I    YEAD+D  GPAKY   +E W  S+TG F  WG    + DY A
Sbjct  362  YSVHINCGGRATTINGINYEADEDLGGPAKYFPLKEAWETSSTGLF--WGTSVGSRDYIA  419

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S++  K+SE+Y  ARLSPLSLTYY RCLANGNYTV
Sbjct  420  QNVSILRTKNSELYTRARLSPLSLTYYFRCLANGNYTV  457



>ref|XP_009600352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X6 [Nicotiana tomentosiformis]
Length=812

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMD--STANDYT  178
            S HINCGG  V+IG+TTYEAD++S G AK+   +E+W ASNTGYF  WG +    +N Y 
Sbjct  222  SVHINCGGESVTIGDTTYEADENSAGAAKFFYWKESWGASNTGYF--WGTNYAEASNYYK  279

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            ATN+S I   D+++Y TARLS LSLTYYGRCLANGNYTV
Sbjct  280  ATNVSAIKGDDADLYTTARLSALSLTYYGRCLANGNYTV  318



>ref|XP_009600351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Nicotiana tomentosiformis]
Length=856

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMD--STANDYT  178
            S HINCGG  V+IG+TTYEAD++S G AK+   +E+W ASNTGYF  WG +    +N Y 
Sbjct  266  SVHINCGGESVTIGDTTYEADENSAGAAKFFYWKESWGASNTGYF--WGTNYAEASNYYK  323

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            ATN+S I   D+++Y TARLS LSLTYYGRCLANGNYTV
Sbjct  324  ATNVSAIKGDDADLYTTARLSALSLTYYGRCLANGNYTV  362



>ref|XP_009600348.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana tomentosiformis]
Length=993

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMD--STANDYT  178
            S HINCGG  V+IG+TTYEAD++S G AK+   +E+W ASNTGYF  WG +    +N Y 
Sbjct  403  SVHINCGGESVTIGDTTYEADENSAGAAKFFYWKESWGASNTGYF--WGTNYAEASNYYK  460

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            ATN+S I   D+++Y TARLS LSLTYYGRCLANGNYTV
Sbjct  461  ATNVSAIKGDDADLYTTARLSALSLTYYGRCLANGNYTV  499



>ref|XP_002522279.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF40137.1| ATP binding protein, putative [Ricinus communis]
Length=988

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IG T YE D+ + G AKYV  +E W  S TG+F  W + ++++DY A
Sbjct  389  YSVHINCGGEETTIGRTIYEGDEVAGGGAKYVPGQEEWEVSTTGHF--WDVTTSSDDYIA  446

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +K++E+Y  ARLSPLSLTYY RCLANGNY VK
Sbjct  447  KNVSVLKMKNNELYTRARLSPLSLTYYVRCLANGNYRVK  485



>ref|XP_009600350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Nicotiana tomentosiformis]
Length=911

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMD--STANDYT  178
            S HINCGG  V+IG+TTYEAD++S G AK+   +E+W ASNTGYF  WG +    +N Y 
Sbjct  321  SVHINCGGESVTIGDTTYEADENSAGAAKFFYWKESWGASNTGYF--WGTNYAEASNYYK  378

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            ATN+S I   D+++Y TARLS LSLTYYGRCLANGNYTV
Sbjct  379  ATNVSAIKGDDADLYTTARLSALSLTYYGRCLANGNYTV  417



>ref|XP_009600349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Nicotiana tomentosiformis]
Length=993

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMD--STANDYT  178
            S HINCGG  V+IG+TTYEAD++S G AK+   +E+W ASNTGYF  WG +    +N Y 
Sbjct  403  SVHINCGGESVTIGDTTYEADENSAGAAKFFYWKESWGASNTGYF--WGTNYAEASNYYK  460

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            ATN+S I   D+++Y TARLS LSLTYYGRCLANGNYTV
Sbjct  461  ATNVSAIKGDDADLYTTARLSALSLTYYGRCLANGNYTV  499



>ref|XP_009795509.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana sylvestris]
Length=757

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG V+IGNTT+EAD+D  G AK+V  + NW +S+TG+F  W    + NDY A
Sbjct  403  YSLHINCGGGRVTIGNTTFEADEDPAGAAKFVYWKGNWGSSSTGHF--WDRVISLNDYKA  460

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             NIS I   ++++Y TA LSPLSLTY+ RCLANG+YT+
Sbjct  461  DNISAITGDEAQLYMTAHLSPLSLTYFARCLANGSYTL  498



>ref|XP_007025268.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2, partial [Theobroma cacao]
 gb|EOY27890.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
2, partial [Theobroma cacao]
Length=692

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG  +IG+  YE D+D+ GPAKY   +E W  S+TG F  W    +A DY A
Sbjct  415  YSVHINCGGGATTIGDINYEEDEDAGGPAKYFPIKETWETSSTGLF--WDTSVSAKDYIA  472

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S++   +S +Y TARLSPLSLTY+ RCLANGNYTV
Sbjct  473  QNVSLLRTNNSNLYTTARLSPLSLTYFVRCLANGNYTV  510



>ref|XP_006358077.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=932

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG+V++G+TTY AD+DS G AK+V  + NW  S+TG+F  W  + + ND+ A
Sbjct  333  YSLHINCGGGNVTVGDTTYVADEDSAGAAKFVYWKGNWGTSSTGHF--WDTNVSLNDHKA  390

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S I   + ++Y TA LSPLS+TY+GRCLANGNYT+
Sbjct  391  KNVSAIKGDEPQLYMTAHLSPLSMTYFGRCLANGNYTL  428



>ref|XP_006358075.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X1 [Solanum tuberosum]
Length=1002

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG+V++G+TTY AD+DS G AK+V  + NW  S+TG+F  W  + + ND+ A
Sbjct  403  YSLHINCGGGNVTVGDTTYVADEDSAGAAKFVYWKGNWGTSSTGHF--WDTNVSLNDHKA  460

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S I   + ++Y TA LSPLS+TY+GRCLANGNYT+
Sbjct  461  KNVSAIKGDEPQLYMTAHLSPLSMTYFGRCLANGNYTL  498



>ref|XP_006358076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X2 [Solanum tuberosum]
Length=883

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG+V++G+TTY AD+DS G AK+V  + NW  S+TG+F  W  + + ND+ A
Sbjct  284  YSLHINCGGGNVTVGDTTYVADEDSAGAAKFVYWKGNWGTSSTGHF--WDTNVSLNDHKA  341

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S I   + ++Y TA LSPLS+TY+GRCLANGNYT+
Sbjct  342  KNVSAIKGDEPQLYMTAHLSPLSMTYFGRCLANGNYTL  379



>ref|XP_009795508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana sylvestris]
Length=1003

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG V+IGNTT+EAD+D  G AK+V  + NW +S+TG+F  W    + NDY A
Sbjct  403  YSLHINCGGGRVTIGNTTFEADEDPAGAAKFVYWKGNWGSSSTGHF--WDRVISLNDYKA  460

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             NIS I   ++++Y TA LSPLSLTY+ RCLANG+YT+
Sbjct  461  DNISAITGDEAQLYMTAHLSPLSLTYFARCLANGSYTL  498



>ref|XP_009351856.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Pyrus x bretschneideri]
Length=988

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 71/100 (71%), Gaps = 4/100 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSS-WGMDSTANDYT  178
            YS H+NCGG   ++GN  YEAD  S G AK+  N  NW  S+TG F+  W   S+  DY 
Sbjct  403  YSLHLNCGGNQTTVGNIKYEADDASGGAAKFFQNSANWGFSSTGDFADVW---SSNKDYI  459

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            A NIS++ + +SE+YKTARLSPLSLTYY RCLANGNYTVK
Sbjct  460  ANNISILRMNNSELYKTARLSPLSLTYYARCLANGNYTVK  499



>emb|CBI30748.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGN  Y+ D+   G AK+    +NW  S+TG+F  W    + NDY A
Sbjct  423  YSLHINCGGAETTIGNIVYQGDQYEGGAAKFHPMSDNWGFSSTGHF--WDHSISINDYIA  480

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ + +S +Y  ARLSPLSLTYYGRCLANGNYTVK
Sbjct  481  QNVSVLRMNNSGLYTRARLSPLSLTYYGRCLANGNYTVK  519



>ref|XP_010655586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 ref|XP_010655587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
Length=1006

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGN  Y+ D+   G AK+    +NW  S+TG+F  W    + NDY A
Sbjct  412  YSLHINCGGAETTIGNIVYQGDQYEGGAAKFHPMSDNWGFSSTGHF--WDHSISINDYIA  469

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ + +S +Y  ARLSPLSLTYYGRCLANGNYTVK
Sbjct  470  QNVSVLRMNNSGLYTRARLSPLSLTYYGRCLANGNYTVK  508



>ref|XP_002300205.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
 gb|EEE85010.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
Length=1003

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G  KYV  RE W  S TG+   W +  TA+DY A
Sbjct  408  YSVHINCGGPETTIGNTIYEADDEPGGATKYVPKREVWQLSTTGHV--WDVRPTADDYMA  465

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S++Y  ARL+PLSLTY+ RCL NGNYTVK
Sbjct  466  QNKSILRMSNSQLYTNARLTPLSLTYHVRCLVNGNYTVK  504



>ref|XP_008377580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=987

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSS-WGMDSTANDYT  178
            YS H+NCGG   +IGN  YE D  S G AK+  N   W  S+TG F+  W  DS   DY 
Sbjct  403  YSLHVNCGGNQTTIGNIKYEEDDASGGAAKFFQNSAXWGFSSTGDFADVWSSDS---DYI  459

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            A NIS++ + +SE+YKTARLSPLSLTYY RCLANGNYTVK
Sbjct  460  ANNISILRMNNSELYKTARLSPLSLTYYARCLANGNYTVK  499



>ref|XP_008366034.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=980

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG  +++GN  Y+ D+ S G AK+V + ENW  S+TG F   G+ +   DY A
Sbjct  385  YSVHINCGGKQLTVGNIKYDGDEASGGGAKFVHDTENWGFSSTGDF---GLINYDQDYIA  441

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             NISV+ + +SE+Y+TAR+SPLSLTYY RCLANGNYTVK
Sbjct  442  KNISVLKMNNSELYRTARISPLSLTYYARCLANGNYTVK  480



>ref|XP_007213678.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
 gb|EMJ14877.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
Length=955

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 4/100 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSS-WGMDSTANDYT  178
            YS H+NCGG   ++GN  Y+AD+ S G AK+     NW  S+TG F+  W  D    DY 
Sbjct  368  YSLHLNCGGNQTTVGNIKYDADEASGGAAKFFQGSANWGFSSTGDFADVWSSD---KDYI  424

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            A NISV+ V +SE+Y+TARLSPLSLTYY RCLANGNYTVK
Sbjct  425  ANNISVLRVDNSELYRTARLSPLSLTYYARCLANGNYTVK  464



>ref|XP_007025266.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27888.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=988

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            +S  INCGGG   +GN  YE D D  G AKYV   +NW  S+TG+F  W  + +++DY A
Sbjct  398  FSLAINCGGGRTPVGNIVYEEDYDKGGAAKYVPGTKNWEVSSTGHF--WDGNPSSDDYVA  455

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N SV+ +KDS +Y TAR+SPLSLTYY RCL NGNYTVK
Sbjct  456  HNKSVLKIKDSALYTTARVSPLSLTYYVRCLGNGNYTVK  494



>ref|XP_008245184.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1005

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG  T+E D+D  G AK+      W  S TG+F  W   +TA DY A
Sbjct  400  YSLHINCGGKRTTIGRVTFEDDQDPGGAAKFFRQGPIWGTSTTGHF--WDFTTTATDYIA  457

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+Y +ARLSPLSLTYY RC  NGNYTVK
Sbjct  458  NNVSILKMNDSELYTSARLSPLSLTYYARCFQNGNYTVK  496



>ref|XP_006370930.1| hypothetical protein POPTR_0019s01870g, partial [Populus trichocarpa]
 gb|ERP48727.1| hypothetical protein POPTR_0019s01870g, partial [Populus trichocarpa]
Length=260

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query  8    FHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTATN  187
             HINCGG + ++GNT YEAD +  G  KYV  RE W  S TG+   W +  + +DYTA N
Sbjct  27   MHINCGGSETTVGNTIYEADDEPGGATKYVPKREVWQISTTGHV--WDVKPSEDDYTAQN  84

Query  188  ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            +S++ + +S++Y  ARL+PLSLTY+ RCL NGNY VK
Sbjct  85   MSILRMNNSQLYTKARLTPLSLTYHVRCLVNGNYNVK  121



>ref|XP_004296291.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=978

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG   +EAD+D   PA +  +  +W  S+TG+F  W +++T+ DY A
Sbjct  380  YSLHINCGGKATTIGGINFEADQDPGSPAHFAPSEPSWGFSSTGHF--WSVNTTSKDYIA  437

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             NIS++ + +SE+Y  ARLSPLSLTYYGRC  +GNYTVK
Sbjct  438  NNISILGMNNSELYTDARLSPLSLTYYGRCFGSGNYTVK  476



>ref|XP_010646293.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
 ref|XP_010646294.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
 ref|XP_010646295.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
 ref|XP_010646296.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
 ref|XP_010646297.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
 ref|XP_010646298.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
 ref|XP_010646300.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
 ref|XP_010646301.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Vitis vinifera]
Length=206

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG    +GN  YE D+   G AK+    + W  S+TG+F  W  + T NDYTA
Sbjct  106  YSLHINCGGEKSIVGNVVYEGDQYEGGAAKFHPMTDYWGFSSTGHF--WDHNRTINDYTA  163

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  164  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  202



>ref|XP_010646292.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=208

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG    +GN  YE D+   G AK+    + W  S+TG+F  W  + T NDYTA
Sbjct  108  YSLHINCGGEKSIVGNVVYEGDQYEGGAAKFHPMTDYWGFSSTGHF--WDHNRTINDYTA  165

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  166  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  204



>ref|XP_010655563.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=972

 Score =   113 bits (282),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 54/99 (55%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  382  YSLHINCGGEKSTVGNVVYEGDQYEGGSAKFHPMTDYWGFSSTGHF--WDHNRTINDYIA  439

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  SE+Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  440  QNVSVLGMNHSELYTRARLSPLSFTYYGRCLADGNYTVK  478



>ref|XP_010655562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=994

 Score =   112 bits (281),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 54/99 (55%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  404  YSLHINCGGEKSTVGNVVYEGDQYEGGSAKFHPMTDYWGFSSTGHF--WDHNRTINDYIA  461

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  SE+Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  462  QNVSVLGMNHSELYTRARLSPLSFTYYGRCLADGNYTVK  500



>ref|XP_010646287.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 ref|XP_010646289.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 ref|XP_010646290.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=231

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG    +GN  YE D+   G AK+    + W  S+TG+F  W  + T NDYTA
Sbjct  131  YSLHINCGGEKSIVGNVVYEGDQYEGGAAKFHPMTDYWGFSSTGHF--WDHNRTINDYTA  188

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  189  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  227



>ref|XP_006370932.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP48729.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=598

 Score =   111 bits (277),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y  HINCGG + ++GNT YEAD +  G  KYV  RE W  S TG+   W +  + +DY A
Sbjct  340  YWVHINCGGSETTVGNTMYEADDEPGGATKYVPKREVWQISTTGHV--WDVKPSEDDYIA  397

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + +S++Y  ARL+PLSLTY+ RCL NGNY+VK
Sbjct  398  QNMSILRMNNSQLYTKARLTPLSLTYHVRCLVNGNYSVK  436



>ref|XP_011046351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Populus euphratica]
Length=1022

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + ++GNT YEAD +  G  KYV  RE W  S TG+   W +  + +DY A
Sbjct  426  YSVHINCGGSETTVGNTIYEADDEPGGATKYVPKREVWQISTTGHV--WDVKPSEDDYIA  483

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + +S++Y  ARL+PLSLTY+ RCL NGNY VK
Sbjct  484  QNMSILRMNNSQLYTKARLTPLSLTYHVRCLVNGNYNVK  522



>ref|XP_008225259.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=883

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +I   T+E D+D  G AK+      W  S TG+F  W   +TA DY A
Sbjct  326  YSLHINCGGKRTTIEGVTFEDDQDPGGAAKFFRQGPIWGTSTTGHF--WDFTTTATDYIA  383

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ + DSE+Y +ARLSPLSLTYY RC  NGNYTVK
Sbjct  384  NNVSILKMNDSELYTSARLSPLSLTYYARCFQNGNYTVK  422



>ref|XP_011045704.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=829

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +I NT YEAD +  G  KYV  RE W  S TG+   W +  +A+DY A
Sbjct  234  YSVHINCGGPETAIRNTIYEADDEPGGATKYVPKREVWQLSTTGHV--WDVRPSADDYMA  291

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S++Y  ARL+PLSLTY+ RCL NGNYTVK
Sbjct  292  QNKSILRMSNSQLYTNARLTPLSLTYHVRCLVNGNYTVK  330



>ref|XP_011045702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
 ref|XP_011045703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1006

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +I NT YEAD +  G  KYV  RE W  S TG+   W +  +A+DY A
Sbjct  411  YSVHINCGGPETAIRNTIYEADDEPGGATKYVPKREVWQLSTTGHV--WDVRPSADDYMA  468

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S++Y  ARL+PLSLTY+ RCL NGNYTVK
Sbjct  469  QNKSILRMSNSQLYTNARLTPLSLTYHVRCLVNGNYTVK  507



>emb|CBI38985.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   107 bits (266),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  56   YSLHINCGGEKSTVGNVVYEGDQYEGGAAKFHPMIDYWGFSSTGHF--WDHNRTINDYIA  113

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  114  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  152



>ref|XP_008225418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Prunus mume]
Length=989

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSS-WGMDSTANDYT  178
            YS  +NCGG   ++GN  Y+AD+ S G AK+     NW  S+TG F+  W  D    DY 
Sbjct  402  YSLRLNCGGNQTTVGNIKYDADEASGGAAKFFQGSANWGFSSTGDFADVWSSDK---DYI  458

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            A NISV+ + +SE+Y+TARLSPLSLTYY RCLANGNYTVK
Sbjct  459  ANNISVLRMNNSELYRTARLSPLSLTYYARCLANGNYTVK  498



>ref|XP_008225417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Prunus mume]
Length=992

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSS-WGMDSTANDYT  178
            YS  +NCGG   ++GN  Y+AD+ S G AK+     NW  S+TG F+  W  D    DY 
Sbjct  405  YSLRLNCGGNQTTVGNIKYDADEASGGAAKFFQGSANWGFSSTGDFADVWSSD---KDYI  461

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            A NISV+ + +SE+Y+TARLSPLSLTYY RCLANGNYTVK
Sbjct  462  ANNISVLRMNNSELYRTARLSPLSLTYYARCLANGNYTVK  501



>ref|XP_006371021.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
 gb|ERP48818.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
Length=620

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKYVS RE+W  S TG+   W + ++ ++Y A
Sbjct  2    YSVHINCGGPEATIGNTIYEADDEPGGAAKYVSKREDWQTSTTGHI--WDVPASLDNYIA  59

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+ RCL NG Y VK
Sbjct  60   QNKSMLRMDNSVLYTNARLTPLSLTYHVRCLVNGKYKVK  98



>ref|XP_010655066.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X8 [Vitis vinifera]
 ref|XP_010655067.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X8 [Vitis vinifera]
 ref|XP_010655068.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X8 [Vitis vinifera]
Length=334

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  128  YSLHINCGGEKSTVGNVVYEGDQYEGGAAKFHPMIDYWGFSSTGHF--WDHNRTINDYIA  185

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  186  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  224



>ref|XP_010655062.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Vitis vinifera]
Length=359

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  153  YSLHINCGGEKSTVGNVVYEGDQYEGGAAKFHPMIDYWGFSSTGHF--WDHNRTINDYIA  210

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  211  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  249



>ref|XP_010655064.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53420 isoform X7 [Vitis vinifera]
Length=353

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  147  YSLHINCGGEKSTVGNVVYEGDQYEGGAAKFHPMIDYWGFSSTGHF--WDHNRTINDYIA  204

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  205  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  243



>ref|XP_003632899.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Vitis vinifera]
 ref|XP_010655060.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Vitis vinifera]
Length=361

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  169  YSLHINCGGEKSTVGNVVYEGDQYEGGAAKFHPMIDYWGFSSTGHF--WDHNRTINDYIA  226

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  227  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  265



>ref|XP_007214549.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
 gb|EMJ15748.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
Length=935

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG   +E D D  G AK+V  R  W  S TG+F  W  + T+NDY A
Sbjct  340  YSLHINCGGKATTIGGINFEGDPDLGGAAKFVPVRPIWGISTTGHF--WDANPTSNDYIA  397

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S + + +SE+Y +ARLSPLSLTYY RC  NGNYTV+
Sbjct  398  NNASTLGMNNSELYTSARLSPLSLTYYARCFGNGNYTVR  436



>ref|XP_010655063.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Vitis vinifera]
Length=358

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  169  YSLHINCGGEKSTVGNVVYEGDQYEGGAAKFHPMIDYWGFSSTGHF--WDHNRTINDYIA  226

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  227  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  265



>ref|XP_010655058.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Vitis vinifera]
 ref|XP_010655059.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Vitis vinifera]
Length=375

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  169  YSLHINCGGEKSTVGNVVYEGDQYEGGAAKFHPMIDYWGFSSTGHF--WDHNRTINDYIA  226

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  227  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  265



>ref|XP_010655061.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Vitis vinifera]
Length=360

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   ++GN  YE D+   G AK+    + W  S+TG+F  W  + T NDY A
Sbjct  169  YSLHINCGGEKSTVGNVVYEGDQYEGGAAKFHPMIDYWGFSSTGHF--WDHNRTINDYIA  226

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+SV+ +  S +Y  ARLSPLS TYYGRCLA+GNYTVK
Sbjct  227  QNVSVLGMNHSGLYTRARLSPLSFTYYGRCLADGNYTVK  265



>ref|XP_008225419.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1017

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG   +E D D  G AK+V  R  W  S TG+F  W  + T+NDY A
Sbjct  414  YSLHINCGGKATTIGGINFEGDPDLGGAAKFVPVRPIWGISTTGHF--WDANPTSNDYIA  471

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S + + +SE+Y +ARLSPLSLTYY RC  NGNYTV+
Sbjct  472  NNASTLGMNNSELYTSARLSPLSLTYYARCFGNGNYTVR  510



>ref|XP_007213704.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
 gb|EMJ14903.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
Length=1017

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG   +E D D  G AK+V  R  W  S TG+F  W  + T+NDY A
Sbjct  414  YSLHINCGGKATTIGGINFEGDPDLGGAAKFVPVRPIWGISTTGHF--WDANPTSNDYIA  471

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S + + +SE+Y +ARLSPLSLTYY RC  NGNYTV+
Sbjct  472  NNASTLGMNNSELYTSARLSPLSLTYYARCFGNGNYTVR  510



>ref|XP_007214558.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
 gb|EMJ15757.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
Length=1017

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG   +E D D  G AK+V  R  W  S TG+F  W  + T+NDY A
Sbjct  414  YSLHINCGGKATTIGGINFEGDPDLGGAAKFVPVRPIWGISTTGHF--WDANPTSNDYIA  471

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S + + +SE+Y +ARLSPLSLTYY RC  NGNYTV+
Sbjct  472  NNASTLGMNNSELYTSARLSPLSLTYYARCFGNGNYTVR  510



>ref|XP_008245181.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840 [Prunus 
mume]
Length=1017

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG   +E D D  G AK+V  R  W  S TG+F  W  + T+NDY A
Sbjct  414  YSLHINCGGKATTIGGINFEGDPDLGGAAKFVPVRPIWGISTTGHF--WDANPTSNDYIA  471

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S + + +SE+Y +ARLSPLSLTYY RC  NGNYTV+
Sbjct  472  NNASTLGMNNSELYTSARLSPLSLTYYARCFGNGNYTVR  510



>ref|XP_010093467.1| hypothetical protein L484_017528 [Morus notabilis]
 gb|EXB54091.1| hypothetical protein L484_017528 [Morus notabilis]
Length=772

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG +V++  TT+E+D DS GP+    ++ NW  S TGYF+    DS  + YT 
Sbjct  351  YSLHINCGGKEVTVNGTTFESDTDSAGPSNLFVSKTNWAVSTTGYFAD--NDSPKDSYTT  408

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S + V + E+Y  ARLSP+SLTYY  CL NGNYTVK
Sbjct  409  GNLSSLTVANPELYMNARLSPISLTYYAFCLGNGNYTVK  447



>ref|XP_006388188.1| hypothetical protein POPTR_0294s002003g, partial [Populus trichocarpa]
 gb|ERP47102.1| hypothetical protein POPTR_0294s002003g, partial [Populus trichocarpa]
Length=187

 Score =   103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YE D +  G AKY S RE+W  S TG+   W + ++ ++Y A
Sbjct  45   YSVHINCGGPEATIGNTIYEEDNEPGGAAKYASKREDWQTSTTGHI--WDVPASLDNYIA  102

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  103  QNKSMLRMDNSVLYTNARLTPLSLTYHVLCLVNGNYKIK  141



>ref|XP_011046363.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Populus euphratica]
Length=833

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  230  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  287

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  288  QNKSMLRMDNSALYTNARLTPLSLTYHVPCLVNGNYKIK  326



>ref|XP_011046362.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=1004

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  458

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  459  QNKSMLRMDNSALYTNARLTPLSLTYHVPCLVNGNYKIK  497



>ref|XP_008225434.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53420, partial [Prunus mume]
Length=297

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +I   T+E D+D  G AK+V  R  W  SNTGYF  W    +A  Y A
Sbjct  158  YSLHINCGGKRTTIEGVTFEDDQDPGGAAKFVPQRPIWGTSNTGYF--WDSIPSATVYIA  215

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S++ +K+SE+Y  AR S +SLTYY RC  NGNYTVK
Sbjct  216  NNVSILRMKNSELYTRARRSAISLTYYARCFRNGNYTVK  254



>ref|XP_011046359.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
 ref|XP_011046361.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1004

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  458

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  459  QNKSMLRMDNSALYTNARLTPLSLTYHVPCLVNGNYKIK  497



>ref|XP_011046365.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X7 [Populus euphratica]
Length=1002

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  458

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  459  QNKSMLRMDNSALYTNARLTPLSLTYHVPCLVNGNYKIK  497



>ref|XP_011046364.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Populus euphratica]
Length=1002

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  458

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  459  QNKSMLRMDNSALYTNARLTPLSLTYHVPCLVNGNYKIK  497



>ref|XP_011046360.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  458

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  459  QNKSMLRMDNSALYTNARLTPLSLTYHVPCLVNGNYKIK  497



>ref|XP_004309629.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=710

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 67/98 (68%), Gaps = 4/98 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG  +IG   YE DKD  G AK+V  R NW  S+TG F  W  + TA DY A
Sbjct  298  YSLHINCGGG-ATIGRVNYEDDKDLGGGAKFVP-RSNWGTSSTGVF--WDTNVTAGDYIA  353

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S + +K+S++Y  ARLSPLSLTYY  CLA GNYTV
Sbjct  354  KNVSTLGMKNSQLYMNARLSPLSLTYYANCLAQGNYTV  391



>ref|XP_002283578.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1011

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V + GNTTYE DKDS GP+K+  +R NW  S+TG+F     D   + + 
Sbjct  398  YSMHINCGGKEVIVDGNTTYEDDKDSGGPSKFYQSRTNWAFSSTGHFMD--DDHPTDSFI  455

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S + +++S +Y TARLS LSLTYYG CL NGNYTVK
Sbjct  456  GTNVSRLAMENSGLYTTARLSALSLTYYGFCLENGNYTVK  495



>emb|CBI20127.3| unnamed protein product [Vitis vinifera]
Length=906

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V + GNTTYE DKDS GP+K+  +R NW  S+TG+F     D   + + 
Sbjct  398  YSMHINCGGKEVIVDGNTTYEDDKDSGGPSKFYQSRTNWAFSSTGHFMD--DDHPTDSFI  455

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S + +++S +Y TARLS LSLTYYG CL NGNYTVK
Sbjct  456  GTNVSRLAMENSGLYTTARLSALSLTYYGFCLENGNYTVK  495



>ref|XP_011014227.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
Length=1004

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  458

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  459  QNKSMLRMDNSVLYTNARLTPLSLTYHVPCLVNGNYKIK  497



>ref|XP_011014230.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=980

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  377  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  434

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  435  QNKSMLRMDNSVLYTNARLTPLSLTYHVPCLVNGNYKIK  473



>ref|XP_011014229.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1002

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  458

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  459  QNKSMLRMDNSVLYTNARLTPLSLTYHVPCLVNGNYKIK  497



>ref|XP_011014228.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  SNTG+   W + ++ ++Y A
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSNTGHI--WDVPASLDNYIA  458

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  459  QNKSMLRMDNSVLYTNARLTPLSLTYHVPCLVNGNYKIK  497



>ref|XP_006371027.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
 gb|ERP48824.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
Length=781

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  S TG+   W + ++ + Y A
Sbjct  218  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSTTGHI--WDVPASLDSYIA  275

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNYT+K
Sbjct  276  QNKSMLRMDNSVLYTNARLTPLSLTYHVPCLVNGNYTIK  314



>ref|XP_006370933.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP48730.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=540

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY   RE+W  S +G+F  W + ++ ++Y A
Sbjct  43   YSVHINCGGPEATIGNTIYEADDEPGGAAKYAFKREDWQTSTSGHF--WDVPASLDNYIA  100

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNYT+K
Sbjct  101  QNKSMLRMDNSVLYTNARLTPLSLTYHVPCLVNGNYTIK  139



>ref|XP_007021935.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY13460.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1016

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIG-NTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG  VS+G NTTYE D D  GP+++  +R NW  S+TG+F     D   + Y 
Sbjct  400  YSLHINCGGRQVSLGGNTTYEEDTDGSGPSRFFQSRSNWAFSSTGHF--LDDDRPTDTYI  457

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN S +++ DS++Y  AR+SP+SLTYYG CL NGNYTV
Sbjct  458  GTNASKLSMNDSQLYMNARISPISLTYYGFCLGNGNYTV  496



>ref|XP_010088631.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB36793.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=924

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 70/102 (69%), Gaps = 7/102 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMD--STANDY  175
            YS HINCGG   +IGN  YE D+D  G +K+V +   W  S+TG F    MD  ST  DY
Sbjct  332  YSVHINCGGKQTTIGNIKYEGDEDPGGQSKFVHSAAAWGFSSTGDF----MDVWSTTKDY  387

Query  176  TATNISVINVKDS-EIYKTARLSPLSLTYYGRCLANGNYTVK  298
             A N+SV+ + +S E+Y TARLSPLS+TYY RCLANGNYTVK
Sbjct  388  IANNVSVLRMNNSHELYTTARLSPLSITYYARCLANGNYTVK  429



>emb|CAN74151.1| hypothetical protein VITISV_028028 [Vitis vinifera]
Length=882

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V + GNTTYE D DS GP+K+  +R NW  S+TG+F     D   + + 
Sbjct  273  YSMHINCGGKEVIVDGNTTYEDDTDSGGPSKFYQSRTNWAFSSTGHF--MDDDRPMDSFI  330

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S + +++S +Y TARLS LSLTYYG CL NGNYTVK
Sbjct  331  GTNVSRLTMENSGLYTTARLSALSLTYYGFCLENGNYTVK  370



>ref|XP_004295408.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1071

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 70/101 (69%), Gaps = 5/101 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYV-SNRENWVASNTGYF-SSWGMDSTANDY  175
            +S HINCGG   +IG   YE D+ S G A +V +   NW  S+TG F  +W   S+ NDY
Sbjct  416  FSLHINCGGKQTTIGGIKYEGDEASGGAATFVQATPPNWGFSSTGDFVDAW---SSENDY  472

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             A N+S++ + +SE+YKTARLSPLSLTYY  CLANGNYTVK
Sbjct  473  IANNVSILKMNNSELYKTARLSPLSLTYYAHCLANGNYTVK  513



>emb|CBI20124.3| unnamed protein product [Vitis vinifera]
Length=1036

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V + GNTTYE D DS GP+K+  +R NW  S+TG+F     D   + + 
Sbjct  427  YSMHINCGGKEVIVDGNTTYEDDTDSGGPSKFYQSRTNWAFSSTGHFMD--DDRPTDSFI  484

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S + +++S +Y TARLS LSLTYYG CL NGNYTVK
Sbjct  485  GTNVSRLTMENSGLYTTARLSALSLTYYGFCLENGNYTVK  524



>ref|XP_002283596.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1007

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V + GNTTYE D DS GP+K+  +R NW  S+TG+F     D   + + 
Sbjct  398  YSMHINCGGKEVIVDGNTTYEDDTDSGGPSKFYQSRTNWAFSSTGHFMD--DDRPTDSFI  455

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S + +++S +Y TARLS LSLTYYG CL NGNYTVK
Sbjct  456  GTNVSRLTMENSGLYTTARLSALSLTYYGFCLENGNYTVK  495



>emb|CBI20121.3| unnamed protein product [Vitis vinifera]
Length=869

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V + GNTTYE D DS GP+K+  +R NW  S+TG+F     D   + + 
Sbjct  398  YSMHINCGGKEVIVDGNTTYEDDTDSGGPSKFYQSRTNWAFSSTGHFMD--DDRPTDSFI  455

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S + +++S +Y TARLS LSLTYYG CL NGNYTVK
Sbjct  456  GTNVSRLIMENSGLYTTARLSALSLTYYGFCLENGNYTVK  495



>ref|XP_003634703.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1007

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V + GNTTYE D DS GP+K+  +R NW  S+TG+F     D   + + 
Sbjct  398  YSMHINCGGKEVIVDGNTTYEDDTDSGGPSKFYQSRTNWAFSSTGHFMD--DDRPTDSFI  455

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S + +++S +Y TARLS LSLTYYG CL NGNYTVK
Sbjct  456  GTNVSRLIMENSGLYTTARLSALSLTYYGFCLENGNYTVK  495



>ref|XP_010246510.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1011

 Score =   105 bits (262),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            +  HINCGG +++IG+ TY+AD+++ GPA +  ++ +W  S+TGY+   G+  TA++YT 
Sbjct  399  HELHINCGGKEITIGDITYQADQEAGGPATFFQSKYDWAFSSTGYYPDDGI--TADEYTK  456

Query  182  TNIS--VINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            T  S  + N ++SE++ +ARLSPLSLTYYG CL NG+YTV+
Sbjct  457  TTTSRPLNNPENSELHMSARLSPLSLTYYGYCLLNGSYTVR  497



>ref|XP_006371019.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
 gb|ERP48816.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
Length=599

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = +2

Query  11   HINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTATNI  190
            HINCGG + +IGNT YEAD +  G AKY S RE+W  S TG+   W + ++ ++Y A N 
Sbjct  1    HINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSTTGHI--WDVPASLDNYIAQNK  58

Query  191  SVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            S++ + +S +Y  ARL+PLSLTY+ RCL NG Y VK
Sbjct  59   SMLRMDNSVLYTNARLTPLSLTYHVRCLVNGKYKVK  94



>ref|XP_011046381.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=992

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +IGNT YEAD +  G AKY S RE+W  S TG+   W + ++ + Y A
Sbjct  391  YSVHINCGGPEATIGNTIYEADNEPGGAAKYASKREDWQTSTTGHI--WDVPASLDFYIA  448

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++ + +S +Y  ARL+PLSLTY+  CL NGNY +K
Sbjct  449  KNKSMLRMDNSVLYTNARLTPLSLTYHVPCLVNGNYKIK  487



>ref|XP_008225432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=657

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+  Y+ D+ S G AK+  +  NW  S+TG F   G+ +   +Y A
Sbjct  71   YSVHINCGGKQATIGSIKYDGDEASGGGAKFFHDTGNWGFSSTGDF---GLMNYDQEYIA  127

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++N+ +SE+Y TAR+SPLSLTYY RCLANGNYTVK
Sbjct  128  RNSSILNMTNSELYSTARISPLSLTYYARCLANGNYTVK  166



>ref|XP_011046350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=1003

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRE-NWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG + +IGNT YEAD +  G AKYVS RE +   S TG+F  W ++++  +Y 
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYVSKREEDKQISTTGHF--WDVNASLVNYI  458

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            A N S++ + +S +Y  ARL+PLSLTYY  CLANGNY VK
Sbjct  459  AENTSILRMDNSVLYTNARLTPLSLTYYVPCLANGNYKVK  498



>ref|XP_011046349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1005

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRE-NWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG + +IGNT YEAD +  G AKYVS RE +   S TG+F  W ++++  +Y 
Sbjct  401  YSVHINCGGPEATIGNTIYEADNEPGGAAKYVSKREEDKQISTTGHF--WDVNASLVNYI  458

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            A N S++ + +S +Y  ARL+PLSLTYY  CLANGNY VK
Sbjct  459  AENTSILRMDNSVLYTNARLTPLSLTYYVPCLANGNYKVK  498



>ref|XP_007214035.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
 gb|EMJ15234.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
Length=876

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG+  Y+ D+ S G AK+  +  NW  S+TG F   G+ +   +Y A
Sbjct  332  YSMHINCGGKQATIGSIKYDGDEASGGGAKFFYDTGNWGFSSTGDF---GLMNYDQEYIA  388

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S++N+ +SE+Y TAR+SPLSLTYY RCLANGNYTVK
Sbjct  389  RNSSILNMTNSELYSTARISPLSLTYYARCLANGNYTVK  427



>ref|XP_008345983.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=674

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG   +EAD D  G AK+   R  W  S TG+F  W    T NDY A
Sbjct  69   YSLHINCGGKATTIGGIDFEADTDPXGAAKFNPVRALWGISTTGHF--WDSKPTFNDYIA  126

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S I   DSE+Y +ARLSPLSLTYY RCL N  YTVK
Sbjct  127  NNVS-IQRNDSELYMSARLSPLSLTYYVRCLRNEKYTVK  164



>ref|XP_010246509.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1013

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRE-NWVASNTGYFSSWGMDSTANDYT  178
            Y  HINCGG ++SIG+ TY AD+++   +K+  N + NW  S+TGYF     D T +DYT
Sbjct  402  YKLHINCGGRELSIGDITYAADQETPASSKFFQNSKYNWAFSSTGYF--LDDDKTVDDYT  459

Query  179  --ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
               T+I + N  +SE+YK+ARLSPLSLTYYG CL  GNYTVK
Sbjct  460  FSTTSIPLNNPGNSELYKSARLSPLSLTYYGYCLGKGNYTVK  501



>ref|XP_008225260.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=983

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +I   T+E D+DS G A +V +R  W  S+TG F       +A DY A
Sbjct  366  YSLHINCGGKQTTIEGVTFEDDQDSGGAASFVPHRPIWGTSSTGTFRD--SKPSAADYIA  423

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S + +K+SE+Y +ARLS LSLTYY RC  NGNYTVK
Sbjct  424  HNVSELRMKNSELYTSARLSALSLTYYARCFLNGNYTVK  462



>ref|XP_004295407.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1681

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +2

Query  2     YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
             YS HINCGG + +I + T++ D +  G A +V    NW  S+TG+F  W  D T+ DY A
Sbjct  1070  YSLHINCGGKETTIDDITFQDDTNLRGGANFVPANPNWGVSSTGFF--WDTDLTSTDYIA  1127

Query  182   TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              N+S + +++S++Y  ARL+PLSLTYY  CLA GNYTV
Sbjct  1128  NNVSALEMENSQLYTNARLTPLSLTYYANCLAEGNYTV  1165



>ref|XP_006442368.1| hypothetical protein CICLE_v10018771mg [Citrus clementina]
 gb|ESR55608.1| hypothetical protein CICLE_v10018771mg [Citrus clementina]
Length=910

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYV-SNRENWVASNTGYFSSWGMDSTANDY  175
            YS HINCGG  V++ GNTT+E D D  GP+++      NW  SNTG+F     D  A+ Y
Sbjct  297  YSVHINCGGKQVTVNGNTTFEDDTDEAGPSRFAFRGLNNWAFSNTGHF--LDDDRPADTY  354

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              TN S++ + DS++Y  AR+SP+SLTYYG CL NGNYTV
Sbjct  355  IQTNTSILLMNDSQLYTRARISPISLTYYGFCLGNGNYTV  394



>emb|CBI20129.3| unnamed protein product [Vitis vinifera]
Length=382

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS  INCGG +V + GNT YE D DS GP+K+  +R NW  S+TG+F     D   + + 
Sbjct  80   YSMRINCGGKEVIVDGNTKYEDDTDSGGPSKFYQSRTNWAFSSTGHFMD--NDRPTDSFI  137

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S   +++S +Y TARLS LSLT+YG CL NGNYTVK
Sbjct  138  GTNMSRFTMENSGLYTTARLSALSLTFYGFCLENGNYTVK  177



>ref|XP_007214698.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
 gb|EMJ15897.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
Length=936

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTAT  184
            S HINCGG   +I   T+E D+D  G AK+   R  W  S+TG+F  W   S A  Y A 
Sbjct  379  SLHINCGGKQTTIEGVTFEDDQDQGGAAKFFPQRPIWGTSSTGHF--WDSASNATAYIAN  436

Query  185  NISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            N+S++ + ++E+Y  AR++PLSLTYY RC  NGNYTVK
Sbjct  437  NVSILRMNNAELYTNARINPLSLTYYARCFRNGNYTVK  474



>gb|KHN36924.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=635

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYF---SSWGMDSTANDY  175
            S +INCGG  V +G  TY+ D DS GPA Y  +R NW  SNTG F   ++  +      Y
Sbjct  19   SLYINCGGKQVVVGGITYDEDMDSAGPAVYKQSRNNWAFSNTGQFMDNNTLAIQGKLPAY  78

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            T  N + + + D+E+YK AR+SP+SLTYYG CL NG+YTVK
Sbjct  79   TTENETRLYMTDAELYKNARISPMSLTYYGFCLENGDYTVK  119



>ref|XP_006594719.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Glycine max]
Length=1036

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYF---SSWGMDSTANDY  175
            S +INCGG  V +G  TY+ D DS GPA Y  +R NW  SNTG F   ++  +      Y
Sbjct  399  SLYINCGGKQVVVGGITYDEDMDSAGPAVYKQSRNNWAFSNTGQFMDNNTLAIQGKLPAY  458

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            T  N + + + D+E+YK AR+SP+SLTYYG CL NG+YTVK
Sbjct  459  TTENETRLYMTDAELYKNARISPMSLTYYGFCLENGDYTVK  499



>ref|XP_004295405.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=1351

 Score =   101 bits (252),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 55/98 (56%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGGG  +IG   YE D D  G AK+V  R NW  S+TG F  W  + TA DY A
Sbjct  374  YSLHINCGGGVTTIGGVNYEDDTDLGGGAKFVPVRSNWGTSSTGVF--WDTNVTAGDYIA  431

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             N+S + + +S++Y  ARLSPLSLTYY  CLA GNYTV
Sbjct  432  KNVSTLGMNNSQLYMNARLSPLSLTYYANCLAQGNYTV  469



>ref|XP_009334012.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Pyrus x bretschneideri]
Length=871

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YTA  181
            SFHINCGG +V+I NTTYE D    GP+ +  +R NW  S+TGYF     D  A D +  
Sbjct  263  SFHINCGGKEVTIENTTYEDDTVFAGPSSFYQSRTNWALSSTGYFPD---DGQATDTFIM  319

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N++ +++ D ++Y  AR+SP+SLTY+G CL NG YTVK
Sbjct  320  NNVTRLSMADPQLYMNARVSPISLTYFGFCLQNGIYTVK  358



>ref|XP_006477897.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like, partial [Citrus sinensis]
Length=932

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYV-SNRENWVASNTGYFSSWGMDSTANDY  175
            YS HINCGG  V++ GNTT+E D D  GP+++      NW  SNTG+F     D  A+ Y
Sbjct  318  YSVHINCGGKQVTVDGNTTFEDDTDEAGPSRFAFRGSNNWAFSNTGHF--LDDDRPADTY  375

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYT  292
              TN S++ + DS++Y  AR+SP+SLTYYG CL NGNYT
Sbjct  376  IQTNTSILLMNDSQLYTRARISPISLTYYGFCLGNGNYT  414



>ref|XP_002325753.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
 gb|EEF00135.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
Length=972

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRE-NWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +  IGNT YEAD +  G AKYV  +E +W  S TG+   W + ++ + Y 
Sbjct  370  YSVHINCGGPEAPIGNTIYEADNEQGGAAKYVFKKEVDWQTSTTGHI--WDVPASLDHYI  427

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            A N S++ + +S +Y  ARL+PLSLTY+  CLANGNY VK
Sbjct  428  AQNKSMLRMDNSVLYTNARLTPLSLTYHVPCLANGNYKVK  467



>ref|XP_009334011.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Pyrus x bretschneideri]
Length=959

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YTA  181
            SFHINCGG +V+I NTTYE D    GP+ +  +R NW  S+TGYF     D  A D +  
Sbjct  392  SFHINCGGKEVTIENTTYEDDTVFAGPSSFYQSRTNWALSSTGYFPD---DGQATDTFIM  448

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N++ +++ D ++Y  AR+SP+SLTY+G CL NG YTVK
Sbjct  449  NNVTRLSMADPQLYMNARVSPISLTYFGFCLQNGIYTVK  487



>ref|XP_009334010.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Pyrus x bretschneideri]
Length=1000

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YTA  181
            SFHINCGG +V+I NTTYE D    GP+ +  +R NW  S+TGYF     D  A D +  
Sbjct  392  SFHINCGGKEVTIENTTYEDDTVFAGPSSFYQSRTNWALSSTGYFPD---DGQATDTFIM  448

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N++ +++ D ++Y  AR+SP+SLTY+G CL NG YTVK
Sbjct  449  NNVTRLSMADPQLYMNARVSPISLTYFGFCLQNGIYTVK  487



>ref|XP_008371519.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=1011

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 61/99 (62%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG   +IG   +EAD    G AK+   R  W  S TG+F  W    T NDY A
Sbjct  406  YSLHINCGGKATTIGGIDFEADTXPGGAAKFXPVRALWGISTTGHF--WDSKPTFNDYIA  463

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N+S I   DSE+Y +ARLSPLSLTYY RCL N  YTVK
Sbjct  464  NNVS-IQRNDSELYMSARLSPLSLTYYVRCLRNEKYTVK  501



>ref|XP_008381102.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Malus domestica]
Length=273

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YTA  181
            SFHINCGG +V+I NTTYE D  SVGP+ +  +R NW  S+TGYF     D+ A D +  
Sbjct  81   SFHINCGGKEVTIENTTYEDDTFSVGPSSFYQSRTNWALSSTGYFPD---DNRATDNFIW  137

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            TN + + + + ++Y  ARLSP+SLTY+G CL N  YTV
Sbjct  138  TNETRLYMANPQLYMNARLSPISLTYFGFCLQNRKYTV  175



>ref|XP_002524514.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37841.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YSFHINCGG +  I   TYE D DS GP+++  +R NW  S+TG+F     D   + YT 
Sbjct  397  YSFHINCGGKEAVINRNTYEEDVDSGGPSRFYQSRTNWAFSSTGHF--LDDDRPTDSYTW  454

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            TN + ++   S +Y  ARLSPLSLTYYG C+ NGNYTV
Sbjct  455  TNTTKLSSGISALYTDARLSPLSLTYYGFCMGNGNYTV  492



>ref|XP_010112408.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC33466.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=941

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 50/100 (50%), Positives = 63/100 (63%), Gaps = 2/100 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNREN-WVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG + +IG   YE D++  G AK+   +   W  S TG F   G + T  DY 
Sbjct  322  YSLHINCGGKETTIGKLKYEEDQNQGGEAKFKPEKYGRWDKSTTGEFLDVGTNQTI-DYI  380

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            A N+S + +K+SE+Y    LS LSLTY+ RCLANGNYTVK
Sbjct  381  AKNVSTLRMKNSELYTQGSLSALSLTYFARCLANGNYTVK  420



>ref|XP_008365059.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=119

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 66/95 (69%), Gaps = 4/95 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNR-ENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG  V++G+  Y+AD+ S G AK+  +   NW  S+TG F   G+ +  + + 
Sbjct  25   YSVHINCGGKQVTVGSLKYDADEASGGGAKFFHHETRNWGFSSTGEF---GIKNFDHYFI  81

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANG  283
            A NIS++ + +SE+Y+TAR+SPLSLTYY RCL NG
Sbjct  82   AENISLLKMTNSELYRTARISPLSLTYYARCLGNG  116



>emb|CAN70381.1| hypothetical protein VITISV_020134 [Vitis vinifera]
Length=833

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS  INCGG +V + GNT YE D DS GP+K+  +R NW  S+TG+F     D   + + 
Sbjct  32   YSMRINCGGKEVIVDGNTKYEDDTDSGGPSKFYQSRTNWAFSSTGHFMD--NDRPTDSFI  89

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S   +++S +Y TARLS LSLT+YG CL NGNYTVK
Sbjct  90   GTNMSRFTMENSGLYTTARLSALSLTFYGFCLENGNYTVK  129



>ref|XP_008226375.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1016

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 5/101 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSI---GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND  172
            YS HINCGG +V+I    NTT+ +D DSVGP+ +  +  NW  S+TGYF+    D   + 
Sbjct  398  YSLHINCGGKEVTIFGEKNTTFNSDTDSVGPSSFHQSSTNWALSSTGYFTD--DDRPQDT  455

Query  173  YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            +   N S++++ + ++Y  ARLSP+SLTYYG CL NGNYTV
Sbjct  456  FIQNNESILSMANPKLYMNARLSPISLTYYGFCLGNGNYTV  496



>ref|XP_007211339.1| hypothetical protein PRUPE_ppa001122mg [Prunus persica]
 gb|EMJ12538.1| hypothetical protein PRUPE_ppa001122mg [Prunus persica]
Length=904

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 5/101 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSI---GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND  172
            YS HINCGG +V++    NTT+ +D DSVGP+ +  +  NW  S+TGYF+    D   + 
Sbjct  286  YSLHINCGGKEVTVFGEKNTTFNSDTDSVGPSSFRQSSTNWALSSTGYFTD--DDRPQDT  343

Query  173  YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            +   N S++++ + ++Y  ARLSP+SLTYYG CL NGNYTV
Sbjct  344  FIQNNESILSMANPKLYMNARLSPISLTYYGFCLGNGNYTV  384



>ref|XP_004295665.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=1979

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = +2

Query  2     YSFHINCGGGDVSIGNTT------YEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDST  163
             YSFHINCGG  +++  +T      YEAD+D  GP+++ +++ NW  S+TGYF   G+ + 
Sbjct  1362  YSFHINCGGNAITVTESTTHIPYEYEADQDPGGPSRFYNSKTNWGFSSTGYFPDDGIQND  1421

Query  164   ANDYTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             A  +   N + +++ D ++Y TAR+SP+SLTY+G CL NGNY+VK
Sbjct  1422  A--FIVDNETALSMPDPQLYMTARVSPISLTYFGFCLMNGNYSVK  1464


 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 65/105 (62%), Gaps = 9/105 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-------GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDS  160
            Y+ HINCGG +V +        N TYE D D  GP+    +R NW +S TGYF++   D 
Sbjct  405  YTLHINCGGKEVPLYENFTRPTNATYEEDTDVAGPSSVYLSRTNWASSTTGYFAN--DDR  462

Query  161  TANDYTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              N YT TN S + + + E+Y  ARLSP+SLTYYG CL NGNYTV
Sbjct  463  PTNTYTWTNSSELTMANPELYMNARLSPISLTYYGFCLGNGNYTV  507



>gb|KHG25892.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Gossypium arboreum]
Length=619

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V + GN TYE D D  G +++  +R NW  S TG+F     D   + Y 
Sbjct  5    YSLHINCGGREVDVAGNATYEDDTDGAGASRFYQSRTNWAVSTTGHF--LDDDRPTDSYI  62

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN S +++ DS +Y  ARLSP+SLTYYG C+ +GNYTV
Sbjct  63   WTNSSKLSMNDSRLYMNARLSPISLTYYGFCMISGNYTV  101



>ref|XP_002524511.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37838.1| ATP binding protein, putative [Ricinus communis]
Length=985

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YSFHINCGG +  I   TYE D DS GP+K+  +R NW  S+TG+F     D   + Y  
Sbjct  375  YSFHINCGGKEAIISGKTYEDDIDSGGPSKFYQSRTNWAFSSTGHF--LDDDRQPDSYIW  432

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            TN + +    S +Y  ARLSP+SLTYYG C+ NGNYTV
Sbjct  433  TNTTKLYAGTSALYMDARLSPISLTYYGFCMGNGNYTV  470



>ref|XP_009802917.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Nicotiana sylvestris]
Length=983

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 10/106 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGN----TTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAN  169
            YS +INCGG +VSI N     TYEAD ++ G + Y S R NW  S+TG F    +DS   
Sbjct  415  YSLYINCGGKEVSIKNGTSRKTYEADLEARGASMYYS-RHNWAFSSTGNFMDNDVDSDV-  472

Query  170  DYTATNIS-VINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             Y  TN+S ++NVK  + E+YKTAR SPLSLTYYG+CL NGNYTVK
Sbjct  473  -YIDTNVSALLNVKAPEVELYKTARASPLSLTYYGQCLMNGNYTVK  517



>ref|XP_009802916.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana sylvestris]
Length=1023

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 10/106 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGN----TTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAN  169
            YS +INCGG +VSI N     TYEAD ++ G + Y S R NW  S+TG F    +DS   
Sbjct  414  YSLYINCGGKEVSIKNGTSRKTYEADLEARGASMYYS-RHNWAFSSTGNFMDNDVDSDV-  471

Query  170  DYTATNIS-VINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             Y  TN+S ++NVK  + E+YKTAR SPLSLTYYG+CL NGNYTVK
Sbjct  472  -YIDTNVSALLNVKAPEVELYKTARASPLSLTYYGQCLMNGNYTVK  516



>ref|XP_009802915.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana sylvestris]
Length=1024

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 10/106 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGN----TTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAN  169
            YS +INCGG +VSI N     TYEAD ++ G + Y S R NW  S+TG F    +DS   
Sbjct  415  YSLYINCGGKEVSIKNGTSRKTYEADLEARGASMYYS-RHNWAFSSTGNFMDNDVDSDV-  472

Query  170  DYTATNIS-VINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             Y  TN+S ++NVK  + E+YKTAR SPLSLTYYG+CL NGNYTVK
Sbjct  473  -YIDTNVSALLNVKAPEVELYKTARASPLSLTYYGQCLMNGNYTVK  517



>ref|XP_009603858.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana tomentosiformis]
Length=1023

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 10/106 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGN----TTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAN  169
            YS +INCGG +VSI N     TYEAD ++ G + Y S R NW  S+TG F    +DS   
Sbjct  414  YSLYINCGGKEVSIKNGTSRKTYEADLEARGASMYYS-RHNWAFSSTGNFMDNDVDSDV-  471

Query  170  DYTATNIS-VINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             Y  TN+S ++NVK  + E+YKTAR SPLSLTYYG+CL NGNYTVK
Sbjct  472  -YIDTNVSALLNVKAPEVELYKTARASPLSLTYYGQCLMNGNYTVK  516



>ref|XP_009603857.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1024

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 10/106 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGN----TTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAN  169
            YS +INCGG +VSI N     TYEAD ++ G + Y S R NW  S+TG F    +DS   
Sbjct  415  YSLYINCGGKEVSIKNGTSRKTYEADLEARGASMYYS-RHNWAFSSTGNFMDNDVDSDV-  472

Query  170  DYTATNIS-VINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             Y  TN+S ++NVK  + E+YKTAR SPLSLTYYG+CL NGNYTVK
Sbjct  473  -YIDTNVSALLNVKAPEVELYKTARASPLSLTYYGQCLMNGNYTVK  517



>ref|XP_010246513.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=953

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y  +INCGG +V+IG++ Y +D+D+ GP+ +  ++ NWV S+TGYF     D   +D+  
Sbjct  344  YKLNINCGGREVTIGDSIYGSDQDTAGPSTFFQSKYNWVFSSTGYF--LDDDKNVDDFLV  401

Query  182  TNIS--VINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            T  S  + N ++SE+Y +ARLSPLSLTYYG CL  G+Y VK
Sbjct  402  TTASRPLNNPENSELYMSARLSPLSLTYYGYCLLKGSYNVK  442



>ref|XP_006448021.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61261.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=541

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  110  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKFMD--DDTDLDNYIR  167

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  168  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  209



>ref|XP_006448022.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61262.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=564

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  133  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKFMD--DDTDLDNYIR  190

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  191  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  232



>ref|XP_006448019.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61259.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=716

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  110  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKF--MDDDTDLDNYIR  167

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  168  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  209



>ref|XP_006448018.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61258.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=739

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  133  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKF--MDDDTDLDNYIR  190

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  191  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  232



>gb|KDO58606.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=626

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  133  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKFMD--DDTDLDNYIR  190

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  191  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  232



>gb|KDO58609.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=700

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  414  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKFMD--DDTDLDNYIR  471

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  472  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  513



>gb|KDO58608.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=799

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  414  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKF--MDDDTDLDNYIR  471

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  472  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  513



>gb|KDO58607.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=845

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  414  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKF--MDDDTDLDNYIR  471

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  472  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  513



>ref|XP_006448023.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61263.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=845

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  414  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKF--MDDDTDLDNYIR  471

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  472  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  513



>ref|XP_006477832.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X3 [Citrus sinensis]
Length=999

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (67%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V+  G+TT+E D    GP+ +  +R NW  S+TG+F    + +  + Y 
Sbjct  394  YSLHINCGGSEVTANGDTTFEEDTYEAGPSTFTQSRTNWGLSSTGHFLDNSIKT--DTYI  451

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN S + + DS++Y TARLS +SLTYYG CL NGNYTV
Sbjct  452  QTNTSRLLMSDSQLYTTARLSAISLTYYGFCLGNGNYTV  490



>ref|XP_004488996.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X2 [Cicer arietinum]
Length=876

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 63/99 (64%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKY-VSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG   ++  T+Y+ D DS GPA++ VS   NW  S TG F     D     Y+
Sbjct  268  YSLHINCGGKQTTVNRTSYDGDSDSSGPARFHVSPTGNWAFSTTGIFIDG--DQLGETYS  325

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              NI+ + + D+E+Y  AR+SP+SLTYYG CL NG+Y+V
Sbjct  326  PQNIATLTMVDAELYMNARVSPISLTYYGFCLENGSYSV  364



>ref|XP_006477831.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X2 [Citrus sinensis]
Length=1001

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (67%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V+  G+TT+E D    GP+ +  +R NW  S+TG+F    + +  + Y 
Sbjct  393  YSLHINCGGSEVTANGDTTFEEDTYEAGPSTFTQSRTNWGLSSTGHFLDNSIKT--DTYI  450

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN S + + DS++Y TARLS +SLTYYG CL NGNYTV
Sbjct  451  QTNTSRLLMSDSQLYTTARLSAISLTYYGFCLGNGNYTV  489



>ref|XP_006477830.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X1 [Citrus sinensis]
Length=1002

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (67%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V+  G+TT+E D    GP+ +  +R NW  S+TG+F    + +  + Y 
Sbjct  394  YSLHINCGGSEVTANGDTTFEEDTYEAGPSTFTQSRTNWGLSSTGHFLDNSIKT--DTYI  451

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN S + + DS++Y TARLS +SLTYYG CL NGNYTV
Sbjct  452  QTNTSRLLMSDSQLYTTARLSAISLTYYGFCLGNGNYTV  490



>ref|XP_004488997.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X3 [Cicer arietinum]
Length=876

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 63/99 (64%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKY-VSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG   ++  T+Y+ D DS GPA++ VS   NW  S TG F     D     Y+
Sbjct  268  YSLHINCGGKQTTVNRTSYDGDSDSSGPARFHVSPTGNWAFSTTGIFIDG--DQLGETYS  325

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              NI+ + + D+E+Y  AR+SP+SLTYYG CL NG+Y+V
Sbjct  326  PQNIATLTMVDAELYMNARVSPISLTYYGFCLENGSYSV  364



>ref|XP_006448020.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61260.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=1020

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  414  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKF--MDDDTDLDNYIR  471

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  472  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  513



>ref|XP_006492254.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Citrus sinensis]
Length=1020

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  414  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKF--MDDDTDLDNYIR  471

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  472  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  513



>emb|CDP06038.1| unnamed protein product [Coffea canephora]
Length=955

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTAT  184
            S HINCGGG+V IG+T+YE D    GP+K+  +  NW  S+TG+F    MD+ +  Y  +
Sbjct  356  SLHINCGGGEVKIGDTSYEDDSQPGGPSKFYQSGTNWGFSSTGHF----MDNESLTYVLS  411

Query  185  NISVINVKDS-EIYKTARLSPLSLTYYGRCLANGNYTVK  298
            N S  +  D+  +Y  ARLSPLSLTYYG CL NGNY VK
Sbjct  412  NGSRFSGNDANNLYSEARLSPLSLTYYGFCLLNGNYMVK  450



>emb|CBI20136.3| unnamed protein product [Vitis vinifera]
Length=710

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 64/101 (63%), Gaps = 6/101 (6%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAN--DY  175
            YS HINCGG +V + NTTYE D  S G + Y  +  NW  S+TGYF    MD + N   Y
Sbjct  102  YSVHINCGGKEVIVDNTTYEDDTYSPGASTYHKSETNWAFSSTGYF----MDDSINTDSY  157

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             A N S++ + +S +Y  ARLS LSLTYY  CL NGNYTVK
Sbjct  158  IANNKSILLMNNSALYMNARLSALSLTYYAFCLGNGNYTVK  198



>gb|KDO58604.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=907

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  414  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKFMD--DDTDLDNYIR  471

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  472  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  513



>ref|XP_004295664.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=1023

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 71/99 (72%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ +INCGG  V++  TTY+ D  + GP+ Y  +  NWV+S+TGYF     DS+ + +T+
Sbjct  413  YTLNINCGGSGVTVDGTTYDEDITANGPSSYYMSSTNWVSSSTGYFPD--DDSSTDHFTS  470

Query  182  -TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN S +++ ++++Y TARLSP+SLTYYG CL NGNYTV
Sbjct  471  STNSSRLSMANAQLYMTARLSPISLTYYGFCLLNGNYTV  509



>gb|KDO58605.1| hypothetical protein CISIN_1g002566mg [Citrus sinensis]
Length=869

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            Y+ HINCGG  ++ G+T YEAD ++ G + + S+ + W  S+TG F     D+  ++Y  
Sbjct  376  YTLHINCGGAKINTGHTKYEADMEARGASMFYSSGQYWAFSSTGKFMD--DDTDLDNYIR  433

Query  182  TN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN   +S ++  D E+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  434  TNTSTLSKVSAVDLELYRTARVSPLSLTYYGLCLGNGNYTVR  475



>ref|XP_004488995.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X1 [Cicer arietinum]
Length=1008

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 63/99 (64%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKY-VSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG   ++  T+Y+ D DS GPA++ VS   NW  S TG F     D     Y+
Sbjct  400  YSLHINCGGKQTTVNRTSYDGDSDSSGPARFHVSPTGNWAFSTTGIFIDG--DQLGETYS  457

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              NI+ + + D+E+Y  AR+SP+SLTYYG CL NG+Y+V
Sbjct  458  PQNIATLTMVDAELYMNARVSPISLTYYGFCLENGSYSV  496



>ref|XP_009386587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Musa acuminata subsp. malaccensis]
Length=1009

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 5/97 (5%)
 Frame = +2

Query  8    FHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTATN  187
              INCGG    +    +EAD + +GPA+Y S  E W  S+TG F    +D+    Y A N
Sbjct  416  LFINCGGEKAFVDGNEFEADINQLGPAQYAST-EKWAYSSTGDF----VDNRDEKYIAKN  470

Query  188  ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             S++N+ +SE+YKTARLSPLSL YYG CL  GNYTVK
Sbjct  471  ASLLNMTNSELYKTARLSPLSLKYYGLCLQEGNYTVK  507



>ref|XP_006348929.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1027

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 10/106 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGN----TTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAN  169
            YS HINCGG +V+I N    T YEAD +  G + Y S R NW  S+TG F     D  ++
Sbjct  412  YSIHINCGGKEVTIKNGTKYTNYEADLEPRGASMYYS-RHNWAFSSTGNF--MDNDVESD  468

Query  170  DYTATNISVI-NVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             Y  TN+S + NVK  + E+Y TAR+SPLSLTYYG+CL NGNYTVK
Sbjct  469  VYINTNVSALQNVKAPELELYTTARISPLSLTYYGQCLMNGNYTVK  514



>ref|XP_006442361.1| hypothetical protein CICLE_v10019246mg [Citrus clementina]
 gb|ESR55601.1| hypothetical protein CICLE_v10019246mg [Citrus clementina]
Length=644

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG  V+  GNTT+E D    GP+ +  +  NWV S+TG+F   G+      Y 
Sbjct  114  YSLHINCGGKQVTANGNTTFEEDTSEAGPSTFSQSGTNWVLSSTGHFLENGLK--LGPYI  171

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN S + + D ++Y TARLS +SLTYYG CL NG YTV
Sbjct  172  QTNTSRLLMNDYQLYTTARLSAISLTYYGFCLGNGKYTV  210



>gb|KDO52103.1| hypothetical protein CISIN_1g043333mg, partial [Citrus sinensis]
Length=809

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 67/100 (67%), Gaps = 7/100 (7%)
 Frame = +2

Query  5    SFHINCGGGDV-SIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTA--NDY  175
            S HINCGG  V + G+TT+E D D+ GP+++  +R NW  S TG+F    +D++   N Y
Sbjct  313  SLHINCGGKQVIANGSTTFEDDLDAAGPSRFFISRTNWAFSTTGHF----IDNSTRENSY  368

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
               N S + + DS++Y  AR+SP+SLTYYG C+ NGNYTV
Sbjct  369  IQINTSRLLMDDSQLYTEARISPISLTYYGYCMVNGNYTV  408



>ref|XP_007214614.1| hypothetical protein PRUPE_ppa001161mg [Prunus persica]
 gb|EMJ15813.1| hypothetical protein PRUPE_ppa001161mg [Prunus persica]
Length=893

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSI--GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDY  175
            YS HINCGG +V++     T+ +D DSVG + +  +  NW  S+TGYF+  G+    + +
Sbjct  286  YSLHINCGGKEVTVFGEKNTFNSDTDSVGHSSFRQSSTNWALSSTGYFTDDGLPQ--DTF  343

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              TN S++++ + ++Y  ARLSP+SLTY+G CL NGNYTV
Sbjct  344  IQTNKSILSMPNPQLYTEARLSPISLTYFGFCLGNGNYTV  383



>ref|XP_006442308.1| hypothetical protein CICLE_v10024314mg, partial [Citrus clementina]
 gb|ESR55548.1| hypothetical protein CICLE_v10024314mg, partial [Citrus clementina]
Length=925

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 67/100 (67%), Gaps = 7/100 (7%)
 Frame = +2

Query  5    SFHINCGGGDV-SIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTA--NDY  175
            S HINCGG  V + G+TT+E D D+ GP+++  +R NW  S TG+F    +D++   N Y
Sbjct  312  SLHINCGGKQVIANGSTTFEDDLDAAGPSRFFISRTNWAFSTTGHF----IDNSTRENAY  367

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
               N S + + DS++Y  AR+SP+SLTYYG C+ NGNYTV
Sbjct  368  IQINTSRLLMDDSQLYTEARISPISLTYYGYCMVNGNYTV  407



>gb|KDO49311.1| hypothetical protein CISIN_1g045177mg, partial [Citrus sinensis]
Length=461

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 65/100 (65%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V+  G+T +E D    GP+ +  +R NW  S+TG+F    + +  + Y 
Sbjct  272  YSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKT--DTYI  329

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN S + + DS++Y  ARLS +SLTYYG CL NGNYTVK
Sbjct  330  QTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVK  369



>ref|XP_011098063.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Sesamum indicum]
Length=1020

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 7/103 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGN-TTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YSFHINCGG +++I N T Y+AD ++ G + Y   ++NW  S+TG F    +DS  ++Y 
Sbjct  413  YSFHINCGGKELNINNKTIYDADLEARGASMYYW-KQNWAFSSTGNFMDNDIDS--DNYI  469

Query  179  ATNISV---INVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN+S+   +    SE+Y+TAR+SPLSLTYYG CL NGNYTV+
Sbjct  470  ETNVSMLYNVTAPVSELYRTARVSPLSLTYYGLCLLNGNYTVR  512



>ref|XP_007214913.1| hypothetical protein PRUPE_ppa000698mg [Prunus persica]
 gb|EMJ16112.1| hypothetical protein PRUPE_ppa000698mg [Prunus persica]
Length=1030

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG +V+IG   YEAD++  G + Y    +NW  S+TG F    +DS  + Y  
Sbjct  419  YSLHINCGGKEVNIGGNRYEADREQRGASMYYMG-QNWALSSTGNFMDNDIDS--DIYIE  475

Query  182  TNISV----INVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN S     ++V DSE+Y TAR SP+SLTYYG CL NG+YTVK
Sbjct  476  TNKSALSKNVSVLDSELYTTARGSPISLTYYGLCLINGDYTVK  518



>ref|XP_002306015.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
 gb|EEE86526.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
Length=1028

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSN-RENWVASNTGYFSSWGMDSTANDY  175
            Y+ HINCGG ++++ GNTTY+ DK+  G + + S+  + W  S+TG F     DS A+ Y
Sbjct  418  YTLHINCGGNEITVDGNTTYQDDKEPRGASMFYSHPSQEWAFSSTGNF--MDDDSEADAY  475

Query  176  TATN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            T TN   IS ++   +++Y TAR+SPLSLTYYG CL NGNYTVK
Sbjct  476  TKTNKSAISNVSATIAQLYTTARVSPLSLTYYGLCLMNGNYTVK  519



>ref|XP_010691210.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Beta vulgaris subsp. vulgaris]
Length=1000

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG +  IG TT++ D +  G AK++  +  W  S++G F  W       +Y A
Sbjct  403  YSLHINCGGQETRIGKTTFQQDDEFEGAAKFLPRKAEWGYSSSGEF--WNPRFPFANYIA  460

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             + S + + D+E+YK ARL+  SLTYY RCLA GNYTV
Sbjct  461  QDNSTLTMNDTELYKQARLAATSLTYYARCLAKGNYTV  498



>ref|XP_007149530.1| hypothetical protein PHAVU_005G077900g [Phaseolus vulgaris]
 gb|ESW21524.1| hypothetical protein PHAVU_005G077900g [Phaseolus vulgaris]
Length=678

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YT  178
            YS H+NCGG  +S GN  Y+ D    GPA++     NWV SNTG+F     DS   D YT
Sbjct  75   YSLHVNCGGKLISNGNIKYDDDSQEAGPARFRRTGSNWVFSNTGHF----FDSGRVDYYT  130

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             +N + +++ + E+Y  AR+SPLSLTYY  C+ NG+YT+
Sbjct  131  WSNTTKLDINNGELYMDARVSPLSLTYYAFCMGNGSYTI  169



>ref|XP_006442359.1| hypothetical protein CICLE_v100189082mg, partial [Citrus clementina]
 gb|ESR55599.1| hypothetical protein CICLE_v100189082mg, partial [Citrus clementina]
Length=716

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 65/100 (65%), Gaps = 3/100 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V+  G+T +E D    GP+ +  +R NW  S+TG+F    + +  + Y 
Sbjct  287  YSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKT--DTYI  344

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN S + + DS++Y  ARLS +SLTYYG CL NGNYTVK
Sbjct  345  QTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVK  384



>ref|XP_007149527.1| hypothetical protein PHAVU_005G077600g, partial [Phaseolus vulgaris]
 gb|ESW21521.1| hypothetical protein PHAVU_005G077600g, partial [Phaseolus vulgaris]
Length=670

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YT  178
            YS H+NCGG  +S GN  Y+ D    GPA++     NWV SNTG+F     DS   D YT
Sbjct  71   YSLHVNCGGKLISNGNIKYDDDSQEAGPARFRRTGSNWVFSNTGHF----FDSGRVDYYT  126

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             +N + +++ + E+Y  AR+SPLSLTYY  C+ NG+YT+
Sbjct  127  WSNTTKLDINNGELYMDARVSPLSLTYYAFCMGNGSYTI  165



>ref|XP_008229374.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=1019

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG +V+IG   YEAD++  G + Y    +NW  S+TG F    +DS  + Y  
Sbjct  421  YSLHINCGGKEVNIGGNRYEADREQRGASMYYMG-QNWALSSTGNFMDNDIDS--DIYIE  477

Query  182  TNISV----INVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN S     +++ DSE+Y TAR SP+SLTYYG CL NG+YTVK
Sbjct  478  TNKSALSKNVSLLDSELYTTARGSPISLTYYGLCLINGDYTVK  520



>ref|XP_011010609.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=879

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSN-RENWVASNTGYFSSWGMDSTANDY  175
            YS HINCGG ++++ G TTY+ DK+  G + + S+  + W  S+TG F     DS A+ Y
Sbjct  269  YSLHINCGGNEITVDGKTTYQDDKEPRGASMFYSHPSQEWAFSSTGNF--MDDDSEADAY  326

Query  176  TATN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            T TN   IS ++   +++Y TAR+SPLSLTYYG CL NGNYTVK
Sbjct  327  TKTNKSAISNVSATIAQLYTTARVSPLSLTYYGLCLMNGNYTVK  370



>ref|XP_007149536.1| hypothetical protein PHAVU_005G078400g [Phaseolus vulgaris]
 gb|ESW21530.1| hypothetical protein PHAVU_005G078400g [Phaseolus vulgaris]
Length=1034

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (61%), Gaps = 6/102 (6%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAN----D  172
            S HINCGG   +IG  TY+ D    GPA Y    +NW  SNTG+F     DS        
Sbjct  398  SLHINCGGNQTTIGGITYDEDLYPAGPAVYKQTGKNWALSNTGHFMD--NDSIPQGQFLP  455

Query  173  YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            YT  N + + + ++E+YK AR+SP+SLTYYG CLANG YTVK
Sbjct  456  YTTENETRLYMTNAELYKNARVSPMSLTYYGFCLANGVYTVK  497



>ref|XP_011010608.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1029

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSN-RENWVASNTGYFSSWGMDSTANDY  175
            YS HINCGG ++++ G TTY+ DK+  G + + S+  + W  S+TG F     DS A+ Y
Sbjct  419  YSLHINCGGNEITVDGKTTYQDDKEPRGASMFYSHPSQEWAFSSTGNF--MDDDSEADAY  476

Query  176  TATN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            T TN   IS ++   +++Y TAR+SPLSLTYYG CL NGNYTVK
Sbjct  477  TKTNKSAISNVSATIAQLYTTARVSPLSLTYYGLCLMNGNYTVK  520



>emb|CAN60698.1| hypothetical protein VITISV_022626 [Vitis vinifera]
Length=961

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDS----TA  166
            YS HINCGG + SI G+T YEAD +  G + +    +NW  S+TG F    +D      A
Sbjct  334  YSLHINCGGKETSINGSTKYEADLEPTGASMFYLG-QNWAFSSTGNFMDNDVDGDAYIEA  392

Query  167  NDYTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            N  + +N+SV++V   E+YK AR+SPLSLTYYG CL NGNYTVK
Sbjct  393  NTSSLSNVSVLDV---ELYKKARVSPLSLTYYGLCLGNGNYTVK  433



>ref|XP_010657080.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 emb|CBI22045.3| unnamed protein product [Vitis vinifera]
Length=1011

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDS----TA  166
            YS HINCGG + SI G+T YEAD +  G + +    +NW  S+TG F    +D      A
Sbjct  405  YSLHINCGGKETSINGSTKYEADLEPTGASMFYLG-QNWAFSSTGNFMDNDVDGDAYIEA  463

Query  167  NDYTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            N  + +N+SV++V   E+YK AR+SPLSLTYYG CL NGNYTVK
Sbjct  464  NTSSLSNVSVLDV---ELYKKARVSPLSLTYYGLCLGNGNYTVK  504



>gb|AES66493.2| LRR receptor-like kinase [Medicago truncatula]
Length=973

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKY-VSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS +INCGG   ++  T+Y+ D +S GPAK+ +S   NW  S TG F+    D     Y+
Sbjct  394  YSLYINCGGKQETVNKTSYDDDSESSGPAKFHLSPTGNWAFSTTGIFNE--RDQLGVTYS  451

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              NI+ + + D+E+Y TAR SP+SLTYYG CL NGNYT+
Sbjct  452  PYNITTLTMTDAELYTTARGSPISLTYYGFCLVNGNYTI  490



>ref|XP_003596242.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=1019

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKY-VSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS +INCGG   ++  T+Y+ D +S GPAK+ +S   NW  S TG F+    D     Y+
Sbjct  402  YSLYINCGGKQETVNKTSYDDDSESSGPAKFHLSPTGNWAFSTTGIFNE--RDQLGVTYS  459

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              NI+ + + D+E+Y TAR SP+SLTYYG CL NGNYT+
Sbjct  460  PYNITTLTMTDAELYTTARGSPISLTYYGFCLVNGNYTI  498



>gb|KCW89682.1| hypothetical protein EUGRSUZ_A01951 [Eucalyptus grandis]
Length=758

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNR-ENWVASNTGYFSSWGMDSTANDYTA  181
            S +INCGG + ++   TY+AD +  G + Y S + ++W  S+TG F    +DS  +DY  
Sbjct  399  SLYINCGGKETNVAGVTYQADNEQRGASMYYSGQSQSWAFSSTGNFLDNDIDS--DDYVE  456

Query  182  TNISV---INVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            +N SV   I+V DSE+Y TAR SPLSLTYYG CL NGNYTV+
Sbjct  457  SNTSVLSSISVHDSELYTTARASPLSLTYYGLCLFNGNYTVR  498



>gb|KCW89681.1| hypothetical protein EUGRSUZ_A01951 [Eucalyptus grandis]
Length=1004

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNR-ENWVASNTGYFSSWGMDSTANDYTA  181
            S +INCGG + ++   TY+AD +  G + Y S + ++W  S+TG F    +DS  +DY  
Sbjct  399  SLYINCGGKETNVAGVTYQADNEQRGASMYYSGQSQSWAFSSTGNFLDNDIDS--DDYVE  456

Query  182  TNISV---INVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            +N SV   I+V DSE+Y TAR SPLSLTYYG CL NGNYTV+
Sbjct  457  SNTSVLSSISVHDSELYTTARASPLSLTYYGLCLFNGNYTVR  498



>ref|XP_010053001.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Eucalyptus grandis]
Length=1034

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = +2

Query  5    SFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNR-ENWVASNTGYFSSWGMDSTANDYTA  181
            S +INCGG + ++   TY+AD +  G + Y S + ++W  S+TG F    +DS  +DY  
Sbjct  429  SLYINCGGKETNVAGVTYQADNEQRGASMYYSGQSQSWAFSSTGNFLDNDIDS--DDYVE  486

Query  182  TNISV---INVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            +N SV   I+V DSE+Y TAR SPLSLTYYG CL NGNYTV+
Sbjct  487  SNTSVLSSISVHDSELYTTARASPLSLTYYGLCLFNGNYTVR  528



>ref|XP_009396547.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Musa acuminata subsp. malaccensis]
 ref|XP_009396548.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Musa acuminata subsp. malaccensis]
Length=1013

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG +++I  T YEAD +  G A  +    NW  S+TG F    +D  A++Y A
Sbjct  412  YSLHINCGGKEININGTKYEADTEGRG-ASMLYLGSNWAFSSTGNFMDNDVD--ADNYIA  468

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            +NIS + + +SE+Y  ARLSPLSLTYYG C+  G+Y VK
Sbjct  469  SNISELFMPNSELYTRARLSPLSLTYYGLCMMEGSYMVK  507



>gb|KEH38570.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=777

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNT-TYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS  INCGG  ++   + TY+ D   VGPA +     NW  SNTG+F     DS A+ YT
Sbjct  166  YSLRINCGGKKITSNESLTYDDDSSQVGPASFQRTGSNWALSNTGHF----FDSLADYYT  221

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             +N + + ++++E+Y  AR+SPLSLTYYG CL NGNYTV
Sbjct  222  WSNKTNLAMENAELYMDARVSPLSLTYYGFCLGNGNYTV  260



>ref|XP_010916505.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Elaeis guineensis]
Length=1009

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 63/99 (64%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            +S HINCGG +  I  T YEAD +  G + +     NW  S+TG F     D+ A++Y A
Sbjct  409  HSLHINCGGQETIIKRTKYEADTEERGASTFYLG-PNWAFSSTGDF--MDNDANADNYIA  465

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN S++ +   E+Y  ARLSP+SLTYYG C+ NG+YTVK
Sbjct  466  TNTSILTMLHPELYTKARLSPVSLTYYGLCMMNGSYTVK  504



>ref|XP_003596241.1| LRR receptor-like serine/threonine-protein kinase FEI [Medicago 
truncatula]
Length=558

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAK-YVSNRENWVASNTG-YFSSWGMDSTANDY  175
            YS +INCGG    +  T+Y+ D DS GPA+ Y S   NW  S TG Y  S   D    +Y
Sbjct  360  YSLYINCGGSRAKVNKTSYDDDSDSPGPARFYRSPTGNWALSTTGIYIDS---DQLQINY  416

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            +  NI+ + + D+E+Y  AR+SP+SLTYYG CLANG YTV
Sbjct  417  SPKNITRLTMVDAELYTNARVSPISLTYYGFCLANGRYTV  456



>ref|XP_010916513.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Elaeis guineensis]
Length=962

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 63/99 (64%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            +S HINCGG +  I  T YEAD +  G + +     NW  S+TG F     D+ A++Y A
Sbjct  361  HSLHINCGGQETIIKRTKYEADTEERGASTFYLG-PNWAFSSTGDF--MDNDANADNYIA  417

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN S++ +   E+Y  ARLSP+SLTYYG C+ NG+YTVK
Sbjct  418  TNTSILTMLHPELYTKARLSPVSLTYYGLCMMNGSYTVK  456



>ref|XP_010272760.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Nelumbo nucifera]
Length=983

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 5/97 (5%)
 Frame = +2

Query  8    FHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTATN  187
             HINCGGG V +G+TTYE+D +    A +  ++  W  SNTG F    +D    +   TN
Sbjct  382  LHINCGGGKVILGDTTYESDDEKSSAAIFWESKNGWALSNTGRF----LDGKNAEKYLTN  437

Query  188  ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             S I + + E+Y TARLSPLSLTYYG CL NG+YTVK
Sbjct  438  ASKI-LDNYELYMTARLSPLSLTYYGYCLQNGSYTVK  473



>ref|XP_006661143.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like, partial [Oryza brachyantha]
Length=726

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 65/100 (65%), Gaps = 7/100 (7%)
 Frame = +2

Query  8    FHINCGGGDVSIGNTTYEADKDSVGPAK-YVSNRENWVASNTGYFSSWGMDSTAND--YT  178
             HINCG  +++I  T YEAD +  G +  Y+S   NW  S+TG F    MD+  +D  Y 
Sbjct  123  LHINCGDKELTINGTKYEADVEPKGASLLYLSPASNWAFSSTGNF----MDNNISDDSYI  178

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            ATN S + + DSE+Y  ARLSPLSLTYYG C+ +G+YTVK
Sbjct  179  ATNTSKLTMADSELYARARLSPLSLTYYGLCMHDGSYTVK  218



>emb|CDP06041.1| unnamed protein product [Coffea canephora]
Length=1026

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIG-NTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG +V +  NT+Y+ D DS G +K+  +R NW  S+TG F     D   + YT
Sbjct  420  YSLHINCGGREVKVDDNTSYDDDIDSGGASKFFQSRSNWAFSSTGNF--LDDDRPRDSYT  477

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN + I+  +S +Y  ARLSPLSLTYYG C+ NGNYTV
Sbjct  478  WTNNASISGTNSGLYMDARLSPLSLTYYGFCMLNGNYTV  516



>ref|XP_007149541.1| hypothetical protein PHAVU_005G078900g [Phaseolus vulgaris]
 gb|ESW21535.1| hypothetical protein PHAVU_005G078900g [Phaseolus vulgaris]
Length=982

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 6/103 (6%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYV-SNRENWVASNTGYFSSWGMDSTAND--  172
            YS +INCGG +V+I  T YE D D+   A+++     NWV S TG F + G +S  ND  
Sbjct  384  YSLYINCGGEEVTINETRYEDDSDAGRAARFILKGMRNWVVSTTGNFMNNG-NSPNNDGG  442

Query  173  --YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              Y  +  S+ + KD+ +Y+TAR SP+SLTYYG CLANGNYTV
Sbjct  443  GKYLPSTNSLPSTKDAALYRTARASPISLTYYGFCLANGNYTV  485



>ref|XP_011002767.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
 ref|XP_011002768.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
 ref|XP_011002769.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=1007

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 62/100 (62%), Gaps = 6/100 (6%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMD--STANDY  175
            YS HINCGG   +I    YE D D  GP+++  +R NW  S TG+F    MD   +++ Y
Sbjct  399  YSLHINCGGKGATIEGNIYEDDTDPAGPSRFYQSRTNWAVSTTGHF----MDDARSSDSY  454

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            T TN + ++   S +Y  ARLSP SLTYYG C+ +G+YTV
Sbjct  455  TWTNATKLSANTSALYMDARLSPTSLTYYGFCMGSGSYTV  494



>gb|AES66492.2| LRR receptor-like kinase [Medicago truncatula]
Length=977

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAK-YVSNRENWVASNTG-YFSSWGMDSTANDY  175
            YS +INCGG    +  T+Y+ D DS GPA+ Y S   NW  S TG Y  S   D    +Y
Sbjct  372  YSLYINCGGSRAKVNKTSYDDDSDSPGPARFYRSPTGNWALSTTGIYIDS---DQLQINY  428

Query  176  TATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            +  NI+ + + D+E+Y  AR+SP+SLTYYG CLANG YTV
Sbjct  429  SPKNITRLTMVDAELYTNARVSPISLTYYGFCLANGRYTV  468



>ref|XP_006301399.1| hypothetical protein CARUB_v10021813mg [Capsella rubella]
 gb|EOA34297.1| hypothetical protein CARUB_v10021813mg [Capsella rubella]
Length=972

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 64/102 (63%), Gaps = 10/102 (10%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADK-DSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND--  172
            Y  HINCGG D++I  T Y+AD  D+ G   +  +R  WVASNTG+F     D  +ND  
Sbjct  364  YGLHINCGGNDIAINATKYDADTWDTPG---FYDSRNGWVASNTGHFLG---DDGSNDGK  417

Query  173  -YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             + A N SV+ + DS +Y  ARLS +SLTYY  CL NGNYT+
Sbjct  418  TFRAMNTSVLELPDSMLYTQARLSAISLTYYALCLGNGNYTI  459



>ref|XP_002532988.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29396.1| conserved hypothetical protein [Ricinus communis]
Length=941

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIG-NTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            Y+ HINCGG ++  G N TY AD ++ G + Y S+ +NW  S+TG F    +D  A+ Y 
Sbjct  321  YALHINCGGKEIIAGSNITYNADLEARGASMYYSS-QNWAFSSTGNFMDNDID--ADPYI  377

Query  179  ATN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
              N   IS ++  D+++YKTAR+SPLSL+YYG CL NGNYTVK
Sbjct  378  QINTSAISNVSALDAQLYKTARVSPLSLSYYGLCLINGNYTVK  420



>ref|XP_008795773.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Phoenix dactylifera]
Length=1024

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/98 (48%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = +2

Query  14   INCGGGDVSIGNTTYEADKDSVGPAKY-VSNRENWVASNTGYFSSWGMDSTAND---YTA  181
            INCGG  V   +  YE D   +GP+++ ++N   W  S+TG       D   ND   Y A
Sbjct  424  INCGGRKVIFDDHEYEDDPSQMGPSRFAIANSNKWAYSSTG-------DFVGNDRARYVA  476

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            TN+SV+N+ D E+Y TARL+PLSL YYG CL  GNYTV
Sbjct  477  TNVSVLNITDPELYMTARLNPLSLRYYGLCLQKGNYTV  514



>ref|XP_008795771.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Phoenix dactylifera]
Length=1025

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/98 (48%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = +2

Query  14   INCGGGDVSIGNTTYEADKDSVGPAKY-VSNRENWVASNTGYFSSWGMDSTAND---YTA  181
            INCGG  V   +  YE D   +GP+++ ++N   W  S+TG       D   ND   Y A
Sbjct  424  INCGGRKVIFDDHEYEDDPSQMGPSRFAIANSNKWAYSSTG-------DFVGNDRARYVA  476

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            TN+SV+N+ D E+Y TARL+PLSL YYG CL  GNYTV
Sbjct  477  TNVSVLNITDPELYMTARLNPLSLRYYGLCLQKGNYTV  514



>ref|XP_010921615.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Elaeis guineensis]
Length=1018

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/102 (48%), Positives = 62/102 (61%), Gaps = 11/102 (11%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKY-VSNRENWVASNTGYFSSWGMDSTAND--  172
            Y+  INCGG  V I +  YEAD   +GP+++ V+  + W  S+TG       D   ND  
Sbjct  420  YNLFINCGGRKVIIDDDEYEADLSQLGPSRFAVAYSKKWAYSSTG-------DFVGNDKA  472

Query  173  -YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             Y ATN+SV+N+   E+Y TARLSPLSL YYG CL  G YTV
Sbjct  473  RYVATNVSVLNMTSPELYMTARLSPLSLRYYGLCLQKGTYTV  514



>ref|XP_007149524.1| hypothetical protein PHAVU_005G077400g, partial [Phaseolus vulgaris]
 gb|ESW21518.1| hypothetical protein PHAVU_005G077400g, partial [Phaseolus vulgaris]
Length=673

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YT  178
            YS H+NCGG  +S GN  Y+ D    GPA++     NWV SNTG+F     DS   D YT
Sbjct  71   YSLHVNCGGKLISNGNIKYDDDSQEAGPARFRRTGSNWVFSNTGHF----FDSGRVDYYT  126

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             +N + ++  + E+Y  AR+SPLSLTYY  C+ NG+YT+
Sbjct  127  WSNTTKLDNNNDELYMDARVSPLSLTYYAFCMGNGSYTI  165



>ref|XP_004243241.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=1027

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 70/106 (66%), Gaps = 10/106 (9%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGN----TTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAN  169
            YS +INCGG +V+I +    T YEAD +  G + Y S R NW  S+TG F    ++S   
Sbjct  412  YSMYINCGGKEVTIKDGTKYTNYEADLEPRGASMYYS-RHNWAFSSTGNFMDNDVESDV-  469

Query  170  DYTATNISVI-NVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             Y  TN+S + NVK  + E+Y TAR+SPLSLTYYG+CL NGNYTVK
Sbjct  470  -YINTNVSALQNVKAPELELYTTARISPLSLTYYGQCLMNGNYTVK  514



>ref|XP_006575671.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X3 [Glycine max]
Length=544

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS +INCGG + +I    YEAD++  G A      ++W  S+TG F    +DS  + Y  
Sbjct  418  YSMNINCGGNEANISGQIYEADREQKGAAMLYYTGQDWALSSTGNFMDNDIDS--DPYVV  475

Query  182  TNISVINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S +NV   +S++Y TAR+SPL+LTYYG CL NGNYTVK
Sbjct  476  ANTSRLNVSALNSQLYTTARVSPLALTYYGLCLINGNYTVK  516



>ref|XP_007021949.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY13474.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=785

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = +2

Query  8    FHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFS-SWGMDSTANDYTAT  184
             HINCGG  + + NTTYE D     P ++     NW  S+TGYF       +  ND    
Sbjct  45   LHINCGGKQIPVSNTTYEGDSTEASPLRFFKGGNNWAFSSTGYFEDDAEQPNQQNDKLII  104

Query  185  NISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              + ++++D E+Y TARLSP+SLTYY  CL NG Y V
Sbjct  105  ENTQLSMRDHELYTTARLSPISLTYYAFCLVNGTYNV  141



>emb|CDP18745.1| unnamed protein product [Coffea canephora]
Length=1022

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 70/103 (68%), Gaps = 7/103 (7%)
 Frame = +2

Query  2    YSFHINCGGGD-VSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG D ++  NT +EAD ++ G + + +  +NW  S+TG F    +DS  + Y 
Sbjct  413  YSLHINCGGKDFIATNNTKFEADLEARGASMFYAG-QNWAFSSTGNFMDNDIDS--DIYI  469

Query  179  ATNISVI-NVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             TN S + NV   +S++Y TAR+SPLSLTYYG+CL NGNYTVK
Sbjct  470  HTNTSALQNVSSAESQLYTTARVSPLSLTYYGQCLINGNYTVK  512



>gb|KEH38575.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=973

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = +2

Query  2    YSFHINCGGGDV-SIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG  + S  + TY+ D + VGPA +  +  NW  SNTG+F      S  ++YT
Sbjct  366  YSLHINCGGKVITSKESLTYDDDSNEVGPASFHRSGSNWALSNTGHFFD---SSLVDNYT  422

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             +N + + + + E+Y  AR+SPLSLTYYG CL NGNYTV
Sbjct  423  WSNKTNLAMDNGELYMDARVSPLSLTYYGFCLGNGNYTV  461



>gb|KHN19486.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=1004

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 62/99 (63%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YT  178
            YS HINCGG  +S GN  Y+ D    GPA++     NWV SNTG+F     DS+  D YT
Sbjct  400  YSLHINCGGKLISNGNMKYDDDSQEAGPARFRRTGSNWVFSNTGHF----FDSSRLDYYT  455

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             +N + + + + E+Y  AR+S LSLTYY  C+ NG+YTV
Sbjct  456  WSNTTKLAMDNGELYMDARVSALSLTYYAFCMGNGSYTV  494



>ref|XP_006575670.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X2 [Glycine max]
Length=939

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS +INCGG + +I    YEAD++  G A      ++W  S+TG F    +DS  + Y  
Sbjct  332  YSMNINCGGNEANISGQIYEADREQKGAAMLYYTGQDWALSSTGNFMDNDIDS--DPYVV  389

Query  182  TNISVINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S +NV   +S++Y TAR+SPL+LTYYG CL NGNYTVK
Sbjct  390  ANTSRLNVSALNSQLYTTARVSPLALTYYGLCLINGNYTVK  430



>ref|XP_008463770.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Cucumis melo]
Length=438

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDS-TANDYT  178
            YS HINCGG +V+I  TT+E D D   P+ +VS++ NW  SNTG F     D+  + DY 
Sbjct  238  YSLHINCGGKEVTISGTTFEGDVDPGEPSVFVSSKTNWGFSNTGLFL---YDTGVSVDYI  294

Query  179  ATNISV-INVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              N S+      SE+Y++AR+SP+SLTYY  CL NGNY +
Sbjct  295  ELNHSLNFPTPYSELYESARVSPISLTYYAYCLGNGNYRI  334



>gb|KHN00371.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=160

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = +2

Query  32   DVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYF---SSWGMDSTANDYTATNISVIN  202
             V +G+ TY+ D DS GP  +  +R NW  SNTG+F    +         Y   N + + 
Sbjct  65   QVVVGDITYDEDMDSAGPTVFKQSRNNWTFSNTGHFVVNDTLAKQGKLPAYATENETRLY  124

Query  203  VKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            + D+E+YK AR+SP+SLTYYG CL NG+YTVK
Sbjct  125  MTDAELYKNARISPISLTYYGFCLENGDYTVK  156



>ref|XP_004488998.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cicer arietinum]
Length=1007

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKY-VSNRENWVASNTGYFSSWGMDSTA--ND  172
            YS +INCGG   ++    Y++D DS GPA++ V +  NW  S TG +    MDS      
Sbjct  400  YSLYINCGGMQATVNRKVYDSDSDSPGPARFHVGSTGNWAFSTTGIY----MDSNQLRET  455

Query  173  YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            Y   NI+ + + DSE+Y   R+SP+SLTYYG CLANG+YTV
Sbjct  456  YPPQNIATLTMVDSELYTNGRVSPISLTYYGFCLANGSYTV  496



>ref|XP_004305822.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1031

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 66/104 (63%), Gaps = 8/104 (8%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSN-RENWVASNTGYFSSWGMDS----TA  166
            +S HINCGG +++IG   YEAD +  G + Y S+  E W  S+TG F    +D+     +
Sbjct  420  HSLHINCGGREINIGEVKYEADTEQKGASYYYSSPSEKWAFSSTGNFMDNDVDADIYIKS  479

Query  167  NDYTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            N    +N+SVI   DSE+Y TAR S +SLTYYG CL NGNYTVK
Sbjct  480  NTSALSNVSVI---DSELYTTARASAISLTYYGLCLMNGNYTVK  520



>gb|KEH28296.1| LRR receptor-like kinase [Medicago truncatula]
Length=864

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDY-T  178
            Y+  INCGG  V++  +TY+ D D+  PA++  +  NW  S TG F    MD+   DY T
Sbjct  268  YALRINCGGKSVTVNGSTYDDDSDTAAPARFHQSGTNWGFSTTGNF----MDNDGGDYYT  323

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             +N S +++ ++E+Y  AR+SP SLTYYG C+ANGNYTV
Sbjct  324  WSNRSKLSIANAELYTNARVSPTSLTYYGFCMANGNYTV  362



>dbj|BAD29102.1| leucine-rich repeat family protein /protein kinase family protein-like 
[Oryza sativa Japonica Group]
Length=706

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 7/102 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAK-YVSNRENWVASNTGYFSSWGMDSTAND--  172
            YS +INCG  +V+I  T YE D +  G +  Y S   NW  S+TG F    MD+  ND  
Sbjct  416  YSLNINCGDKEVTINGTKYETDVEPKGASLLYQSPGSNWAFSSTGNF----MDNNINDDS  471

Query  173  YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            Y AT+ S + V +SE+Y  ARLSPLSLTYYG C+ NG+YTVK
Sbjct  472  YIATSASKLTVPNSELYAKARLSPLSLTYYGLCMHNGSYTVK  513



>ref|XP_003519558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X1 [Glycine max]
Length=1025

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS +INCGG + +I    YEAD++  G A      ++W  S+TG F    +DS  + Y  
Sbjct  418  YSMNINCGGNEANISGQIYEADREQKGAAMLYYTGQDWALSSTGNFMDNDIDS--DPYVV  475

Query  182  TNISVINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S +NV   +S++Y TAR+SPL+LTYYG CL NGNYTVK
Sbjct  476  ANTSRLNVSALNSQLYTTARVSPLALTYYGLCLINGNYTVK  516



>gb|KHN38301.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1004

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS +INCGG + +I    YEAD++  G A      ++W  S+TG F    +DS  + Y  
Sbjct  430  YSMNINCGGNEANISGQIYEADREQKGAAMLYYTGQDWALSSTGNFMDNDIDS--DPYVV  487

Query  182  TNISVINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S +NV   +S++Y TAR+SPL+LTYYG CL NGNYTVK
Sbjct  488  ANTSRLNVSALNSQLYTTARVSPLALTYYGLCLINGNYTVK  528



>ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES99711.1| LRR receptor-like kinase [Medicago truncatula]
Length=996

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDY-T  178
            Y+  INCGG  V++  +TY+ D D+  PA++  +  NW  S TG F    MD+   DY T
Sbjct  400  YALRINCGGKSVTVNGSTYDDDSDTAAPARFHQSGTNWGFSTTGNF----MDNDGGDYYT  455

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             +N S +++ ++E+Y  AR+SP SLTYYG C+ANGNYTV
Sbjct  456  WSNRSKLSIANAELYTNARVSPTSLTYYGFCMANGNYTV  494



>ref|XP_010247776.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Nelumbo nucifera]
Length=978

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEA-----DKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTA  166
            Y  HINCGGG+ +IG+ TY A     D  S+      S+++ W  SNTGYF   G ++  
Sbjct  363  YQLHINCGGGEETIGHITYAAEVPNKDGPSISYPMTSSSKDVWALSNTGYFID-GTENIK  421

Query  167  NDYTATNISVI--NVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            N +TAT+   +  N +DS +YK+AR+SP+SLTYYG C+ NG+Y VK
Sbjct  422  NTFTATDTYSLLNNSQDSLLYKSARISPISLTYYGYCMKNGSYKVK  467



>gb|AEO14875.1| rfls6 protein [Glycine max]
Length=1027

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS +INCGG + ++    YEAD++  G A      ++W  S+TG F+   +DS  + Y  
Sbjct  418  YSLNINCGGNEANVSGNIYEADREQKGAAMLYYTSQDWALSSTGNFTDNDIDS--DPYIV  475

Query  182  TNISVINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S +NV   +S++Y TAR+SPL+LTYYG CL NGNYTVK
Sbjct  476  ANTSRLNVSALNSKLYTTARVSPLALTYYGLCLINGNYTVK  516



>ref|XP_004162114.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840-like 
[Cucumis sativus]
Length=579

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 66/99 (67%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG + +I G T ++ D+++ G + +     NW  SNTG F       + ++YT
Sbjct  325  YSLHINCGGKEETINGTTVFKGDRNA-GSSMFFVTGTNWAISNTGTFLD-DDGGSRDEYT  382

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            ATN S +++ + E+Y TAR+SPLS+TY+G C+ NGNYTV
Sbjct  383  ATNSSTLSMINPELYMTARVSPLSVTYFGFCMGNGNYTV  421



>gb|EEE69521.1| hypothetical protein OsJ_28982 [Oryza sativa Japonica Group]
Length=1021

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 7/102 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAK-YVSNRENWVASNTGYFSSWGMDSTAND--  172
            YS +INCG  +V+I  T YE D +  G +  Y S   NW  S+TG F    MD+  ND  
Sbjct  416  YSLNINCGDKEVTINGTKYETDVEPKGASLLYQSPGSNWAFSSTGNF----MDNNINDDS  471

Query  173  YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            Y AT+ S + V +SE+Y  ARLSPLSLTYYG C+ NG+YTVK
Sbjct  472  YIATSASKLTVPNSELYAKARLSPLSLTYYGLCMHNGSYTVK  513



>ref|XP_007142243.1| hypothetical protein PHAVU_008G264400g [Phaseolus vulgaris]
 gb|ESW14237.1| hypothetical protein PHAVU_008G264400g [Phaseolus vulgaris]
Length=1027

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 7/103 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDS----TAN  169
            Y+ +INCGG + +I N  YEAD +  G A    N ++W  S+TG F    +DS     AN
Sbjct  416  YALNINCGGKEANISNHIYEADGERKGAAMLYYNSQDWALSSTGNFMDNDIDSDPYIVAN  475

Query  170  DYTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
                 N+S +N   S++Y TAR+SPL+LTYYG CL NGNYT+K
Sbjct  476  TSRLNNVSALN---SQLYTTARVSPLALTYYGLCLINGNYTIK  515



>ref|XP_008463767.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Cucumis melo]
Length=541

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDS-TANDYT  178
            YS HINCGG +V+I  TT+E D D   P+ +VS++ NW  SNTG F     D+  + DY 
Sbjct  341  YSLHINCGGKEVTISGTTFEGDVDPGEPSVFVSSKTNWGFSNTGLFL---YDTGVSVDYI  397

Query  179  ATNISV-INVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              N S+      SE+Y++AR+SP+SLTYY  CL NGNY +
Sbjct  398  ELNHSLNFPTPYSELYESARVSPISLTYYAYCLGNGNYRI  437



>ref|XP_008463769.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Cucumis melo]
Length=496

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDS-TANDYT  178
            YS HINCGG +V+I  TT+E D D   P+ +VS++ NW  SNTG F     D+  + DY 
Sbjct  296  YSLHINCGGKEVTISGTTFEGDVDPGEPSVFVSSKTNWGFSNTGLFL---YDTGVSVDYI  352

Query  179  ATNISV-INVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              N S+      SE+Y++AR+SP+SLTYY  CL NGNY +
Sbjct  353  ELNHSLNFPTPYSELYESARVSPISLTYYAYCLGNGNYRI  392



>gb|EEC84403.1| hypothetical protein OsI_30981 [Oryza sativa Indica Group]
Length=1021

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 7/102 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAK-YVSNRENWVASNTGYFSSWGMDSTAND--  172
            YS +INCG  +V+I  T YE D +  G +  Y S   NW  S+TG F    MD+  ND  
Sbjct  416  YSLNINCGDKEVTINGTKYETDVEPKGASLLYQSPGSNWAFSSTGNF----MDNNINDDS  471

Query  173  YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            Y AT+ S + V +SE+Y  ARLSPLSLTYYG C+ NG+YTVK
Sbjct  472  YIATSASKLTVPNSELYAKARLSPLSLTYYGLCMHNGSYTVK  513



>gb|KHN19488.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=916

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 6/99 (6%)
 Frame = +2

Query  5    SFHINCGGG-DVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YT  178
            S HINCGG  + S     Y+ D DS+GP+      ENW  SNTG+F    ++S A++ Y 
Sbjct  305  SLHINCGGARETSSEGIIYDGDSDSLGPSTSKEVGENWAISNTGHF----LNSNASETYI  360

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              N + +++ D+ +YKTAR+SP+SLTYYG CL NG+YTV
Sbjct  361  QQNTTRLSMPDNALYKTARVSPISLTYYGFCLENGDYTV  399



>ref|NP_001237942.1| receptor-like protein kinase [Glycine max]
 gb|ACJ37405.1| receptor-like protein kinase [Glycine max]
Length=679

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS +INCGG + ++    YEAD++  G A      ++W  S+TG F    +DS  + Y  
Sbjct  66   YSLNINCGGNEANVSGNIYEADREQKGAAMLYYTSQDWALSSTGNFMDNDIDS--DPYIV  123

Query  182  TNISVINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S +NV   +S++Y TAR+SPL+LTYYG CL NGNYTVK
Sbjct  124  ANTSRLNVSALNSKLYTTARVSPLALTYYGLCLINGNYTVK  164



>ref|XP_006592942.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Glycine max]
Length=987

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 6/99 (6%)
 Frame = +2

Query  5    SFHINCGGG-DVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YT  178
            S HINCGG  + S     Y+ D DS+GP+      ENW  SNTG+F    ++S A++ Y 
Sbjct  386  SLHINCGGARETSSEGIIYDGDSDSLGPSTSKEVGENWAISNTGHF----LNSNASETYI  441

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              N + +++ D+ +YKTAR+SP+SLTYYG CL NG+YTV
Sbjct  442  QQNTTRLSMPDNALYKTARVSPISLTYYGFCLENGDYTV  480



>ref|XP_008463768.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Cucumis melo]
Length=537

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDS-TANDYT  178
            YS HINCGG +V+I  TT+E D D   P+ +VS++ NW  SNTG F     D+  + DY 
Sbjct  337  YSLHINCGGKEVTISGTTFEGDVDPGEPSVFVSSKTNWGFSNTGLFL---YDTGVSVDYI  393

Query  179  ATNISV-INVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
              N S+      SE+Y++AR+SP+SLTYY  CL NGNY +
Sbjct  394  ELNHSLNFPTPYSELYESARVSPISLTYYAYCLGNGNYRI  433



>ref|XP_007048781.1| Leucine-rich repeat transmembrane protein kinase isoform 2 [Theobroma 
cacao]
 gb|EOX92938.1| Leucine-rich repeat transmembrane protein kinase isoform 2 [Theobroma 
cacao]
Length=873

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG ++++ GN  YEAD++  G + +    ++W  S+TG F    +D  A+DY 
Sbjct  265  YSLHINCGGKELNVNGNAKYEADREPRGASMFYLG-QHWALSSTGNFMDNDID--ADDYI  321

Query  179  ATN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN   +S ++   SE+Y TAR+SPLSLTYY  CL NGNYTV
Sbjct  322  VTNTSALSNVSAIHSELYTTARVSPLSLTYYALCLMNGNYTV  363



>ref|XP_010916565.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Elaeis guineensis]
Length=1005

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 61/102 (60%), Gaps = 11/102 (11%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYV-SNRENWVASNTGYFSSWGMDSTAND--  172
            Y   INCGG  V I +  YE D    GP++Y  S+   W  S+TG FS       AND  
Sbjct  416  YKVFINCGGPKVIIDDNEYEDDSSQQGPSRYAASDSGKWAYSSTGVFS-------ANDDA  468

Query  173  -YTATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             Y ATN+S +N+ + E+Y TARL+PLSL YYG CL  G+YTV
Sbjct  469  NYIATNVSALNMTEPELYMTARLNPLSLKYYGLCLQKGSYTV  510



>ref|XP_008780294.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440, partial [Phoenix dactylifera]
Length=286

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYV-SNRENWVASNTGYFSSWGMDSTANDYT  178
            Y   INCGG  V I +  YE D    GP++Y  S+   W  S+TG F     ++ AN Y 
Sbjct  18   YKLFINCGGPKVIIDDNEYEDDTSQEGPSRYAASDSGKWAYSSTGVFVQ---NANAN-YI  73

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
            ATN+S +N+   E+Y TARL+PLSL YYG CL  G+YTV
Sbjct  74   ATNVSALNMTKPELYMTARLNPLSLKYYGLCLQKGSYTV  112



>gb|KHN11945.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=980

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS +INCGG + ++    YEAD++  G A      ++W  S+TG F    +DS  + Y  
Sbjct  418  YSLNINCGGNEANVSGNIYEADREQKGAAMLYYTSQDWALSSTGNFMDNDIDS--DPYIV  475

Query  182  TNISVINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S +NV   +S++Y TAR+SPL+LTYYG CL NGNYTVK
Sbjct  476  ANTSRLNVSALNSKLYTTARVSPLALTYYGLCLINGNYTVK  516



>ref|XP_007048780.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
 gb|EOX92937.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
Length=1029

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG ++++ GN  YEAD++  G + +    ++W  S+TG F    +D  A+DY 
Sbjct  421  YSLHINCGGKELNVNGNAKYEADREPRGASMFYLG-QHWALSSTGNFMDNDID--ADDYI  477

Query  179  ATN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN   +S ++   SE+Y TAR+SPLSLTYY  CL NGNYTV
Sbjct  478  VTNTSALSNVSAIHSELYTTARVSPLSLTYYALCLMNGNYTV  519



>ref|XP_006595488.1| PREDICTED: receptor-like protein kinase isoform X1 [Glycine max]
Length=1027

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS +INCGG + ++    YEAD++  G A      ++W  S+TG F    +DS  + Y  
Sbjct  418  YSLNINCGGNEANVSGNIYEADREQKGAAMLYYTSQDWALSSTGNFMDNDIDS--DPYIV  475

Query  182  TNISVINVK--DSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
             N S +NV   +S++Y TAR+SPL+LTYYG CL NGNYTVK
Sbjct  476  ANTSRLNVSALNSKLYTTARVSPLALTYYGLCLINGNYTVK  516



>ref|XP_007048782.1| Leucine-rich repeat transmembrane protein kinase isoform 3 [Theobroma 
cacao]
 gb|EOX92939.1| Leucine-rich repeat transmembrane protein kinase isoform 3 [Theobroma 
cacao]
Length=773

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = +2

Query  2    YSFHINCGGGDVSI-GNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYT  178
            YS HINCGG ++++ GN  YEAD++  G + +    ++W  S+TG F    +D  A+DY 
Sbjct  278  YSLHINCGGKELNVNGNAKYEADREPRGASMFYLG-QHWALSSTGNFMDNDID--ADDYI  334

Query  179  ATN---ISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             TN   +S ++   SE+Y TAR+SPLSLTYY  CL NGNYTV
Sbjct  335  VTNTSALSNVSAIHSELYTTARVSPLSLTYYALCLMNGNYTV  376



>ref|XP_010094304.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB55700.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=677

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS H+NCGG +V+I    YEAD++  G + +  + ++W  S+TG F    MD  A+ Y  
Sbjct  416  YSLHLNCGGKEVNINGQKYEADREQRGASMFYLS-QDWALSSTGNFVDNDMD--ADTYIE  472

Query  182  TNISVI-NVKD--SEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN S I NV    SE+Y TAR+SPLSLTYY  CL NGNYTV+
Sbjct  473  TNTSTISNVSGLISELYTTARVSPLSLTYYRLCLMNGNYTVR  514



>ref|XP_006593302.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Glycine max]
Length=858

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 62/99 (63%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTAND-YT  178
            YS HINCGG  +S GN  Y+ D    GPA++     NWV SNTG+F     DS+  D YT
Sbjct  254  YSLHINCGGKLISNGNMKYDDDSLEAGPARFRRTGSNWVFSNTGHF----FDSSRLDYYT  309

Query  179  ATNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
             +N + + + + E+Y  AR+S LSLTYY  C+ NG+YTV
Sbjct  310  WSNTTKLAMDNGELYMDARVSALSLTYYAFCMGNGSYTV  348



>ref|XP_008812544.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650, partial [Phoenix dactylifera]
Length=952

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG +  I  T YEAD +  G + +     NW  S+TG F     D+ A++Y  
Sbjct  352  YSLHINCGGEETIIKGTKYEADTEERGASTFYLG-PNWAFSSTGDF--MDDDANADNYIT  408

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTVK  298
            TN S++++   E+Y  ARLS LSLTYYG C+ NG+YTVK
Sbjct  409  TNTSILSMLHPELYTKARLSALSLTYYGLCMMNGSYTVK  447



>ref|XP_010665668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Beta vulgaris subsp. vulgaris]
Length=862

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +I  +TY+ D +  G AK+V  R  W  S++G F  W      ++Y A
Sbjct  270  YSLHINCGGTETTIRKSTYDEDDERGGAAKFVPRRAEWGFSSSGEF--W-YSQVPSNYIA  326

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
                ++ +KDS++Y TARLS  SLTYYG CL  GNY+V
Sbjct  327  KGNPLLGLKDSKLYMTARLSATSLTYYGSCLGKGNYSV  364



>ref|XP_010665665.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1000

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +2

Query  2    YSFHINCGGGDVSIGNTTYEADKDSVGPAKYVSNRENWVASNTGYFSSWGMDSTANDYTA  181
            YS HINCGG + +I  +TY+ D +  G AK+V  R  W  S++G F  W      ++Y A
Sbjct  408  YSLHINCGGTETTIRKSTYDEDDERGGAAKFVPRRAEWGFSSSGEF--W-YSQVPSNYIA  464

Query  182  TNISVINVKDSEIYKTARLSPLSLTYYGRCLANGNYTV  295
                ++ +KDS++Y TARLS  SLTYYG CL  GNY+V
Sbjct  465  KGNPLLGLKDSKLYMTARLSATSLTYYGSCLGKGNYSV  502



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 533915589554