BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7922_g1_i1 len=2132 path=[1:0-1419 1421:1420-2131]

Length=2132
                                                                      Score     E

ref|XP_009631060.1|  PREDICTED: sodium-dependent phosphate transp...    799   0.0      
emb|CDP09168.1|  unnamed protein product                                775   0.0      
ref|XP_006361301.1|  PREDICTED: sodium-dependent phosphate transp...    762   0.0      
gb|KDP46521.1|  hypothetical protein JCGZ_08493                         756   0.0      
ref|XP_010262796.1|  PREDICTED: sodium-dependent phosphate transp...    748   0.0      
ref|XP_004246963.1|  PREDICTED: sodium-dependent phosphate transp...    744   0.0      
ref|XP_011032143.1|  PREDICTED: sodium-dependent phosphate transp...    743   0.0      
ref|XP_011035184.1|  PREDICTED: sodium-dependent phosphate transp...    743   0.0      
ref|XP_008457384.1|  PREDICTED: sodium-dependent phosphate transp...    743   0.0      
ref|XP_002313389.2|  hypothetical protein POPTR_0009s04840g             741   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008355271.1|  PREDICTED: LOW QUALITY PROTEIN: sodium-depen...    742   0.0      
ref|XP_007207590.1|  hypothetical protein PRUPE_ppa019688mg             741   0.0      
ref|XP_002298320.2|  hypothetical protein POPTR_0001s25690g             739   0.0      Populus trichocarpa [western balsam poplar]
gb|KHG28505.1|  Sodium-dependent phosphate transport 1, chloropla...    739   0.0      
ref|XP_004164590.1|  PREDICTED: sodium-dependent phosphate transp...    739   0.0      
ref|XP_002279594.1|  PREDICTED: sodium-dependent phosphate transp...    738   0.0      Vitis vinifera
gb|EYU45976.1|  hypothetical protein MIMGU_mgv1a004451mg                737   0.0      
ref|XP_002525609.1|  Sodium-dependent phosphate transport protein...    737   0.0      Ricinus communis
gb|KGN65796.1|  hypothetical protein Csa_1G528610                       737   0.0      
ref|XP_008220532.1|  PREDICTED: sodium-dependent phosphate transp...    736   0.0      
ref|XP_006425040.1|  hypothetical protein CICLE_v10028231mg             730   0.0      
ref|XP_008358972.1|  PREDICTED: sodium-dependent phosphate transp...    725   0.0      
ref|XP_010033022.1|  PREDICTED: sodium-dependent phosphate transp...    723   0.0      
ref|XP_009374345.1|  PREDICTED: sodium-dependent phosphate transp...    721   0.0      
ref|XP_003637121.1|  Sodium-dependent phosphate transport protein       723   0.0      
ref|XP_007016153.1|  Sodium-dependent phosphate transport protein...    723   0.0      
gb|AFK38547.1|  unknown                                                 721   0.0      
ref|XP_004294239.1|  PREDICTED: sodium-dependent phosphate transp...    718   0.0      
ref|XP_004500238.1|  PREDICTED: sodium-dependent phosphate transp...    718   0.0      
ref|XP_006848140.1|  hypothetical protein AMTR_s00029p00225980          715   0.0      
ref|XP_003538283.1|  PREDICTED: sodium-dependent phosphate transp...    710   0.0      
ref|XP_010923099.1|  PREDICTED: probable anion transporter 1, chl...    710   0.0      
ref|XP_009144358.1|  PREDICTED: sodium-dependent phosphate transp...    704   0.0      
gb|KFK24153.1|  hypothetical protein AALP_AAs50253U001100               703   0.0      
ref|XP_010557216.1|  PREDICTED: sodium-dependent phosphate transp...    701   0.0      
ref|XP_009380609.1|  PREDICTED: probable anion transporter 1, chl...    701   0.0      
ref|XP_010469920.1|  PREDICTED: sodium-dependent phosphate transp...    699   0.0      
ref|XP_008785404.1|  PREDICTED: probable anion transporter 1, chl...    699   0.0      
ref|XP_010510439.1|  PREDICTED: sodium-dependent phosphate transp...    697   0.0      
ref|XP_010414365.1|  PREDICTED: sodium-dependent phosphate transp...    697   0.0      
ref|XP_002881062.1|  hypothetical protein ARALYDRAFT_481880             696   0.0      
ref|NP_180526.1|  phosphate transporter 4;1                             696   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABK51380.1|  Na+/Pi transporter                                      695   0.0      Eutrema halophilum
ref|XP_006410023.1|  hypothetical protein EUTSA_v10016491mg             695   0.0      
ref|XP_006296374.1|  hypothetical protein CARUB_v10025547mg             694   0.0      
ref|XP_010104671.1|  Sodium-dependent phosphate transport protein 1     691   0.0      
gb|AAL32642.1|  putative Na+-dependent inorganic phosphate cotran...    692   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051779.1|  Major facilitator superfamily protein isoform 2    693   0.0      
ref|XP_007051778.1|  Major facilitator superfamily protein isoform 1    694   0.0      
ref|XP_003528848.1|  PREDICTED: probable anion transporter 2, chl...    693   0.0      
gb|KDP28615.1|  hypothetical protein JCGZ_14386                         693   0.0      
ref|XP_006827574.1|  hypothetical protein AMTR_s00009p00227360          691   0.0      
ref|XP_006591210.1|  PREDICTED: sodium-dependent phosphate transp...    690   0.0      
ref|NP_001148011.1|  sialin                                             689   0.0      Zea mays [maize]
ref|XP_003567315.1|  PREDICTED: probable anion transporter 1, chl...    689   0.0      
ref|XP_008438037.1|  PREDICTED: probable anion transporter 2, chl...    692   0.0      
ref|XP_002455469.1|  hypothetical protein SORBIDRAFT_03g011370          689   0.0      Sorghum bicolor [broomcorn]
ref|XP_003520968.1|  PREDICTED: probable anion transporter 2, chl...    692   0.0      
ref|XP_007135089.1|  hypothetical protein PHAVU_010G099800g             691   0.0      
ref|XP_004967676.1|  PREDICTED: probable anion transporter 1, chl...    688   0.0      
ref|XP_006645772.1|  PREDICTED: probable anion transporter 1, chl...    688   0.0      
ref|XP_004510775.1|  PREDICTED: probable anion transporter 2, chl...    691   0.0      
ref|XP_010426983.1|  PREDICTED: probable anion transporter 2, chl...    689   0.0      
dbj|BAJ87051.1|  predicted protein                                      687   0.0      
ref|XP_009394618.1|  PREDICTED: probable anion transporter 2, chl...    691   0.0      
ref|XP_004133863.1|  PREDICTED: probable anion transporter 2, chl...    690   0.0      
ref|XP_004155828.1|  PREDICTED: probable anion transporter 2, chl...    690   0.0      
ref|XP_008654924.1|  PREDICTED: sialin isoform X1                       687   0.0      
ref|XP_010419576.1|  PREDICTED: probable anion transporter 2, chl...    688   0.0      
ref|XP_007051781.1|  Major facilitator superfamily protein isoform 4    690   0.0      
emb|CDM82990.1|  unnamed protein product                                686   0.0      
ref|XP_011093131.1|  PREDICTED: probable anion transporter 2, chl...    689   0.0      
emb|CDP08800.1|  unnamed protein product                                689   0.0      
ref|XP_011032142.1|  PREDICTED: sodium-dependent phosphate transp...    686   0.0      
ref|XP_010456292.1|  PREDICTED: probable anion transporter 2, chl...    687   0.0      
ref|XP_006286375.1|  hypothetical protein CARUB_v10000819mg             684   0.0      
ref|XP_010935846.1|  PREDICTED: probable anion transporter 4, chl...    689   0.0      
ref|NP_001042749.1|  Os01g0279700                                       685   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010053721.1|  PREDICTED: probable anion transporter 2, chl...    687   0.0      
ref|XP_010556546.1|  PREDICTED: probable anion transporter 2, chl...    686   0.0      
ref|XP_010255321.1|  PREDICTED: probable anion transporter 2, chl...    686   0.0      
ref|XP_010685595.1|  PREDICTED: sodium-dependent phosphate transp...    682   0.0      
gb|KCW78082.1|  hypothetical protein EUGRSUZ_D02302                     688   0.0      
ref|XP_010544390.1|  PREDICTED: probable anion transporter 2, chl...    683   0.0      
emb|CDY01998.1|  BnaC04g15030D                                          681   0.0      
ref|XP_009134563.1|  PREDICTED: probable anion transporter 2, chl...    681   0.0      
gb|KHG29407.1|  putative anion transporter 2, chloroplastic -like...    682   0.0      
ref|XP_006410024.1|  hypothetical protein EUTSA_v10016491mg             681   0.0      
ref|XP_006396238.1|  hypothetical protein EUTSA_v10028551mg             681   0.0      
ref|XP_002872956.1|  hypothetical protein ARALYDRAFT_912207             684   0.0      
ref|XP_011036486.1|  PREDICTED: probable anion transporter 2, chl...    682   0.0      
ref|XP_002275090.1|  PREDICTED: probable anion transporter 2, chl...    683   0.0      Vitis vinifera
ref|XP_010275631.1|  PREDICTED: probable anion transporter 2, chl...    682   0.0      
ref|XP_009111489.1|  PREDICTED: probable anion transporter 2, chl...    680   0.0      
ref|XP_010275627.1|  PREDICTED: probable anion transporter 2, chl...    683   0.0      
ref|XP_010275629.1|  PREDICTED: probable anion transporter 2, chl...    682   0.0      
ref|XP_011080691.1|  PREDICTED: sodium-dependent phosphate transp...    673   0.0      
ref|XP_002511874.1|  Sialin, putative                                   680   0.0      Ricinus communis
ref|XP_010544389.1|  PREDICTED: probable anion transporter 2, chl...    681   0.0      
ref|XP_004492749.1|  PREDICTED: probable anion transporter 2, chl...    679   0.0      
ref|XP_009629837.1|  PREDICTED: probable anion transporter 2, chl...    681   0.0      
ref|XP_006445019.1|  hypothetical protein CICLE_v10024243mg             681   0.0      
ref|XP_008244637.1|  PREDICTED: probable anion transporter 2, chl...    680   0.0      
gb|EYU32134.1|  hypothetical protein MIMGU_mgv1a003431mg                679   0.0      
ref|XP_006339586.1|  PREDICTED: probable anion transporter 2, chl...    679   0.0      
ref|XP_007220200.1|  hypothetical protein PRUPE_ppa003069mg             679   0.0      
ref|NP_567175.2|  inorganic phosphate transporter PHT4;4                676   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003623974.1|  Sodium-dependent phosphate transport protein       675   0.0      
ref|XP_010326478.1|  PREDICTED: probable anion transporter 2, chl...    678   0.0      
gb|EPS64644.1|  hypothetical protein M569_10135                         677   0.0      
gb|KHM99069.1|  Putative anion transporter 2, chloroplastic             675   0.0      
ref|XP_003627567.1|  Sodium-dependent phosphate transport protein       675   0.0      
ref|XP_003556597.1|  PREDICTED: probable anion transporter 2, chl...    675   0.0      
ref|XP_003551308.1|  PREDICTED: probable anion transporter 1, chl...    667   0.0      
gb|KDO66834.1|  hypothetical protein CISIN_1g010343mg                   669   0.0      
ref|XP_009797233.1|  PREDICTED: probable anion transporter 2, chl...    675   0.0      
ref|NP_001063986.1|  Os09g0570400                                       671   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CBI40390.3|  unnamed protein product                                669   0.0      
gb|KHG12724.1|  putative anion transporter 2, chloroplastic -like...    669   0.0      
ref|XP_004956239.1|  PREDICTED: probable anion transporter 4, chl...    669   0.0      
ref|XP_006661007.1|  PREDICTED: probable anion transporter 4, chl...    669   0.0      
ref|XP_010087952.1|  putative anion transporter 2                       669   0.0      
ref|XP_004306773.1|  PREDICTED: probable anion transporter 2, chl...    668   0.0      
ref|XP_003578693.1|  PREDICTED: probable anion transporter 4, chl...    667   0.0      
gb|KDO66835.1|  hypothetical protein CISIN_1g010343mg                   659   0.0      
ref|XP_007139828.1|  hypothetical protein PHAVU_008G061900g             666   0.0      
ref|XP_010670194.1|  PREDICTED: probable anion transporter 2, chl...    667   0.0      
ref|XP_008338836.1|  PREDICTED: probable anion transporter 2, chl...    665   0.0      
ref|XP_002320139.1|  sugar transporter family protein                   663   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008338835.1|  PREDICTED: probable anion transporter 2, chl...    665   0.0      
ref|NP_001130577.1|  uncharacterized protein LOC100191676               666   0.0      Zea mays [maize]
ref|XP_008656579.1|  PREDICTED: probable anion transporter 4, chl...    665   0.0      
ref|XP_011035185.1|  PREDICTED: probable anion transporter 1, chl...    655   0.0      
ref|XP_007016154.1|  Phosphate transporter 4,1 isoform 2                655   0.0      
ref|XP_004968946.1|  PREDICTED: probable anion transporter 4, chl...    664   0.0      
ref|XP_010557217.1|  PREDICTED: sodium-dependent phosphate transp...    654   0.0      
dbj|BAJ90562.1|  predicted protein                                      660   0.0      
emb|CDY07222.1|  BnaCnng02370D                                          655   0.0      
ref|XP_006591211.1|  PREDICTED: sodium-dependent phosphate transp...    652   0.0      
ref|NP_973561.1|  phosphate transporter 4;1                             647   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009367842.1|  PREDICTED: probable anion transporter 2, chl...    655   0.0      
ref|XP_006410022.1|  hypothetical protein EUTSA_v10016491mg             646   0.0      
ref|XP_010510443.1|  PREDICTED: sodium-dependent phosphate transp...    646   0.0      
ref|XP_010414366.1|  PREDICTED: sodium-dependent phosphate transp...    646   0.0      
gb|KHN47608.1|  Sodium-dependent phosphate transport protein 1, c...    645   0.0      
ref|XP_008342264.1|  PREDICTED: probable anion transporter 2, chl...    653   0.0      
ref|XP_010510441.1|  PREDICTED: sodium-dependent phosphate transp...    645   0.0      
ref|XP_010469921.1|  PREDICTED: sodium-dependent phosphate transp...    640   0.0      
ref|XP_002979008.1|  hypothetical protein SELMODRAFT_109981             640   0.0      
ref|XP_002988408.1|  hypothetical protein SELMODRAFT_128034             641   0.0      
gb|AIY53219.1|  phosphate transporter                                   638   0.0      
gb|KDO66832.1|  hypothetical protein CISIN_1g010343mg                   636   0.0      
ref|XP_006605416.1|  PREDICTED: probable anion transporter 2, chl...    639   0.0      
gb|KFK30624.1|  hypothetical protein AALP_AA6G006100                    630   0.0      
ref|XP_008220539.1|  PREDICTED: sodium-dependent phosphate transp...    628   0.0      
emb|CDX74333.1|  BnaA03g27140D                                          629   0.0      
emb|CDY66200.1|  BnaA09g51700D                                          625   0.0      
ref|XP_002457997.1|  hypothetical protein SORBIDRAFT_03g025190          619   0.0      Sorghum bicolor [broomcorn]
emb|CDX91912.1|  BnaC03g32140D                                          624   0.0      
gb|KDO66838.1|  hypothetical protein CISIN_1g010343mg                   618   0.0      
gb|EMS64245.1|  putative anion transporter 4, chloroplastic             617   0.0      
gb|EMT01332.1|  Putative anion transporter 4, chloroplastic             617   0.0      
gb|KCW52549.1|  hypothetical protein EUGRSUZ_J01933                     613   0.0      
ref|XP_001758228.1|  predicted protein                                  604   0.0      
ref|XP_010935848.1|  PREDICTED: probable anion transporter 4, chl...    608   0.0      
ref|XP_004151590.1|  PREDICTED: probable anion transporter 1, chl...    599   0.0      
gb|KCW52548.1|  hypothetical protein EUGRSUZ_J01933                     606   0.0      
ref|XP_006491127.1|  PREDICTED: probable anion transporter 2, chl...    601   0.0      
ref|XP_006605417.1|  PREDICTED: probable anion transporter 2, chl...    590   0.0      
gb|AFW79515.1|  hypothetical protein ZEAMMB73_518182                    582   0.0      
dbj|BAJ92669.1|  predicted protein                                      579   0.0      
ref|XP_010275628.1|  PREDICTED: probable anion transporter 2, chl...    579   0.0      
ref|XP_006396239.1|  hypothetical protein EUTSA_v10028551mg             574   0.0      
ref|XP_010326199.1|  PREDICTED: sodium-dependent phosphate transp...    570   0.0      
gb|KCW52550.1|  hypothetical protein EUGRSUZ_J01933                     569   0.0      
ref|XP_005849602.1|  hypothetical protein CHLNCDRAFT_143059             561   0.0      
ref|XP_010430991.1|  PREDICTED: probable anion transporter 2, chl...    550   0.0      
gb|KFM27578.1|  Sodium-dependent phosphate transport protein 1, c...    553   0.0      
gb|KDO66836.1|  hypothetical protein CISIN_1g010343mg                   542   0.0      
gb|KDO86200.1|  hypothetical protein CISIN_1g007159mg                   536   8e-180   
gb|KDO66837.1|  hypothetical protein CISIN_1g010343mg                   526   8e-180   
ref|XP_005648445.1|  putative inorganic phosphate transporter           529   4e-179   
ref|XP_003627568.1|  Sodium-dependent phosphate transport protein       528   4e-177   
gb|AAF02804.1|AF195115_24  weak similarity to phthalate permease ...    514   4e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146729.1|  hypothetical protein PHAVU_006G0649001g            500   6e-168   
ref|XP_009804712.1|  PREDICTED: sodium-dependent phosphate transp...    489   3e-164   
ref|NP_850136.1|  phosphate transporter 4;1                             479   7e-160   Arabidopsis thaliana [mouse-ear cress]
gb|EMS45969.1|  putative anion transporter 1, chloroplastic             475   3e-158   
gb|KDO66840.1|  hypothetical protein CISIN_1g010343mg                   437   8e-144   
gb|KCW52552.1|  hypothetical protein EUGRSUZ_J01933                     431   1e-140   
ref|XP_005703857.1|  MFS transporter, anion:cation symporter (ACS...    432   9e-140   
ref|XP_001694351.1|  major facilitator superfamily protein              417   1e-135   Chlamydomonas reinhardtii
ref|XP_005537971.1|  probable Na+-dependent inorganic phosphate c...    421   3e-134   
tpg|DAA59022.1|  TPA: hypothetical protein ZEAMMB73_730146              399   2e-127   
ref|XP_010923100.1|  PREDICTED: probable anion transporter 1, chl...    393   3e-125   
ref|XP_005712347.1|  unnamed protein product                            392   1e-124   
gb|ABR16151.1|  unknown                                                 393   8e-123   Picea sitchensis
ref|XP_009367836.1|  PREDICTED: probable anion transporter 2, chl...    385   3e-122   
ref|XP_002952950.1|  hypothetical protein VOLCADRAFT_105756             357   3e-109   
ref|XP_008338054.1|  PREDICTED: probable anion transporter 2, chl...    340   6e-106   
ref|XP_002961092.1|  hypothetical protein SELMODRAFT_70488              335   1e-103   
ref|XP_002966917.1|  hypothetical protein SELMODRAFT_144419             333   6e-103   
ref|XP_004137735.1|  PREDICTED: probable anion transporter 3, chl...    331   1e-100   
ref|XP_004514542.1|  PREDICTED: probable anion transporter 3, chl...    330   1e-100   
ref|XP_008442468.1|  PREDICTED: probable anion transporter 3, chl...    326   6e-99    
ref|XP_009602210.1|  PREDICTED: probable anion transporter 3, chl...    325   2e-98    
ref|NP_181341.2|  phosphate transporter 4;2                             324   3e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDP06516.1|  unnamed protein product                                320   4e-98    
ref|XP_010101818.1|  putative anion transporter 3                       323   7e-98    
gb|KEH23123.1|  anion transporter 4, putative                           323   8e-98    
gb|AES64609.2|  anion transporter 4                                     313   1e-97    
ref|XP_003594358.1|  Vesicular glutamate transporter 2.1                313   2e-97    
gb|ABN08856.1|  Putative transporter C20orf59 homolog, related          311   2e-97    Medicago truncatula
ref|XP_009803867.1|  PREDICTED: probable anion transporter 3, chl...    321   3e-97    
ref|XP_003529140.1|  PREDICTED: probable anion transporter 3, chl...    320   5e-97    
ref|XP_007140393.1|  hypothetical protein PHAVU_008G108000g             320   6e-97    
ref|XP_011012355.1|  PREDICTED: probable anion transporter 3, chl...    320   2e-96    
ref|XP_002527859.1|  Sialin, putative                                   319   2e-96    Ricinus communis
emb|CEF99668.1|  Major facilitator superfamily domain, general su...    317   7e-96    
ref|XP_001775235.1|  predicted protein                                  318   1e-95    
ref|XP_002509245.1|  major facilitator superfamily                      313   1e-95    Micromonas commoda
ref|XP_006363062.1|  PREDICTED: probable anion transporter 3, chl...    317   2e-95    
ref|XP_009141716.1|  PREDICTED: probable anion transporter 3, chl...    317   2e-95    
ref|XP_008239628.1|  PREDICTED: probable anion transporter 3, chl...    317   2e-95    
ref|XP_004302645.1|  PREDICTED: probable anion transporter 3, chl...    317   2e-95    
ref|XP_006429293.1|  hypothetical protein CICLE_v10011514mg             317   2e-95    
ref|XP_007208741.1|  hypothetical protein PRUPE_ppa015356mg             313   3e-95    
ref|XP_004246342.1|  PREDICTED: probable anion transporter 3, chl...    316   4e-95    
gb|KFK36704.1|  hypothetical protein AALP_AA4G158500                    314   9e-95    
ref|WP_007236306.1|  ABC transporter permease                           312   9e-95    
ref|XP_007026793.1|  Phosphate transporter 4,2                          315   9e-95    
emb|CDX93332.1|  BnaC04g45640D                                          314   1e-94    
ref|XP_001420334.1|  MFS family transporter: sugar                      311   1e-94    Ostreococcus lucimarinus CCE9901
gb|EYU41835.1|  hypothetical protein MIMGU_mgv1a007449mg                310   3e-94    
ref|XP_010256679.1|  PREDICTED: probable anion transporter 3, chl...    313   3e-94    
ref|XP_001762770.1|  predicted protein                                  310   3e-94    
ref|XP_004246962.1|  PREDICTED: probable anion transporter 4, chl...    313   4e-94    
ref|XP_011077593.1|  PREDICTED: probable anion transporter 3, chl...    313   5e-94    
ref|XP_010935849.1|  PREDICTED: probable anion transporter 2, chl...    312   2e-93    
ref|XP_002273820.1|  PREDICTED: probable anion transporter 3, chl...    311   2e-93    Vitis vinifera
gb|EPS69350.1|  hypothetical protein M569_05413                         308   4e-93    
gb|EYU26642.1|  hypothetical protein MIMGU_mgv1a007147mg                305   2e-92    
ref|XP_003061512.1|  major facilitator superfamily                      304   4e-92    
ref|XP_006345319.1|  PREDICTED: probable anion transporter 4, chl...    307   6e-92    
ref|XP_010687864.1|  PREDICTED: probable anion transporter 6, chl...    308   8e-92    
ref|XP_002881562.1|  hypothetical protein ARALYDRAFT_482813             306   1e-91    
ref|XP_009370209.1|  PREDICTED: LOW QUALITY PROTEIN: probable ani...    305   1e-91    
emb|CBI30430.3|  unnamed protein product                                302   2e-91    
gb|KFK26277.1|  hypothetical protein AALP_AA8G225900                    306   2e-91    
ref|XP_009402283.1|  PREDICTED: probable anion transporter 3, chl...    306   3e-91    
ref|XP_006381084.1|  hypothetical protein POPTR_0006s06110g             306   3e-91    
ref|XP_002520433.1|  Sialin, putative                                   306   4e-91    Ricinus communis
ref|XP_011020238.1|  PREDICTED: probable anion transporter 6, chl...    306   4e-91    
ref|XP_006848096.1|  hypothetical protein AMTR_s00029p00211500          306   4e-91    
ref|XP_010650940.1|  PREDICTED: probable anion transporter 4, chl...    305   5e-91    
ref|XP_010923136.1|  PREDICTED: probable anion transporter 2, chl...    306   6e-91    
ref|XP_007208476.1|  hypothetical protein PRUPE_ppa004163mg             305   6e-91    
ref|XP_004961903.1|  PREDICTED: probable anion transporter 2, chl...    305   1e-90    
ref|XP_009763196.1|  PREDICTED: probable anion transporter 4, chl...    304   1e-90    
ref|XP_008370058.1|  PREDICTED: probable anion transporter 3, chl...    303   1e-90    
emb|CBI16007.3|  unnamed protein product                                301   1e-90    
ref|XP_008220320.1|  PREDICTED: probable anion transporter 4, chl...    304   2e-90    
gb|AES91667.2|  anion transporter 4, putative                           304   2e-90    
ref|XP_002279865.1|  PREDICTED: probable anion transporter 4, chl...    303   2e-90    Vitis vinifera
ref|XP_011082377.1|  PREDICTED: probable anion transporter 4, chl...    303   3e-90    
ref|XP_011017899.1|  PREDICTED: probable anion transporter 6, chl...    303   4e-90    
ref|XP_010928923.1|  PREDICTED: probable anion transporter 3, chl...    303   5e-90    
gb|KDP24491.1|  hypothetical protein JCGZ_25055                         300   6e-90    
ref|XP_010685621.1|  PREDICTED: probable anion transporter 4, chl...    301   2e-89    
ref|XP_002439890.1|  hypothetical protein SORBIDRAFT_09g022090          301   3e-89    Sorghum bicolor [broomcorn]
ref|XP_009337321.1|  PREDICTED: probable anion transporter 4, chl...    301   3e-89    
ref|XP_010256677.1|  PREDICTED: probable anion transporter 3, chl...    301   3e-89    
emb|CDP09146.1|  unnamed protein product                                297   3e-89    
ref|XP_009602673.1|  PREDICTED: probable anion transporter 4, chl...    300   4e-89    
ref|XP_010047223.1|  PREDICTED: probable anion transporter 6, chl...    301   4e-89    
ref|NP_001132244.2|  uncharacterized protein LOC100193679               300   4e-89    Zea mays [maize]
gb|KHG00339.1|  putative anion transporter 3, chloroplastic -like...    300   5e-89    
emb|CBH32513.1|  sialin, putative, expressed                            300   6e-89    
ref|XP_006294026.1|  hypothetical protein CARUB_v10023018mg             300   6e-89    
ref|XP_004508421.1|  PREDICTED: probable anion transporter 6, chl...    300   6e-89    
gb|KDO42142.1|  hypothetical protein CISIN_1g016338mg                   295   6e-89    
ref|XP_006848092.1|  hypothetical protein AMTR_s00029p00210000          301   7e-89    
dbj|BAK06267.1|  predicted protein                                      299   8e-89    
ref|NP_001148061.1|  sialin                                             299   9e-89    
gb|AIY53221.1|  phosphate transporter                                   299   1e-88    
ref|XP_006594260.1|  PREDICTED: probable anion transporter 6, chl...    299   1e-88    
ref|XP_008785434.1|  PREDICTED: probable anion transporter 2, chl...    300   1e-88    
ref|XP_004508420.1|  PREDICTED: probable anion transporter 6, chl...    298   2e-88    
ref|XP_003541488.1|  PREDICTED: probable anion transporter 6, chl...    298   2e-88    
gb|EEE63926.1|  hypothetical protein OsJ_18751                          295   3e-88    
ref|XP_004153029.1|  PREDICTED: probable anion transporter 4, chl...    298   3e-88    
ref|XP_010517089.1|  PREDICTED: probable anion transporter 3, chl...    297   4e-88    
ref|NP_197538.2|  phosphate transporter 4;5                             297   4e-88    
ref|XP_008457406.1|  PREDICTED: probable anion transporter 4, chl...    298   4e-88    
ref|XP_008373326.1|  PREDICTED: probable anion transporter 4, chl...    297   6e-88    
ref|XP_006645029.1|  PREDICTED: probable anion transporter 3, chl...    297   6e-88    
emb|CDX86110.1|  BnaC03g56250D                                          298   8e-88    
gb|KDO66780.1|  hypothetical protein CISIN_1g009757mg                   296   9e-88    
ref|XP_008775072.1|  PREDICTED: probable anion transporter 3, chl...    297   9e-88    
ref|XP_006488474.1|  PREDICTED: probable anion transporter 4, chl...    296   1e-87    
ref|XP_010256676.1|  PREDICTED: probable anion transporter 3, chl...    300   1e-87    
ref|NP_001055705.1|  Os05g0451100                                       296   1e-87    
ref|XP_006404425.1|  hypothetical protein EUTSA_v10010272mg             296   1e-87    
gb|KDO66782.1|  hypothetical protein CISIN_1g009757mg                   296   1e-87    
ref|XP_002263200.2|  PREDICTED: probable anion transporter 6, chl...    296   1e-87    
ref|XP_009149944.1|  PREDICTED: probable anion transporter 4, chl...    296   2e-87    
ref|XP_003609470.1|  hypothetical protein MTR_4g116030                  296   2e-87    
ref|XP_006600724.1|  PREDICTED: probable anion transporter 6, chl...    296   2e-87    
ref|XP_006425011.1|  hypothetical protein CICLE_v10028197mg             296   2e-87    
ref|WP_008293696.1|  glucarate transporter                              293   2e-87    
gb|AAL32520.1|  putative protein                                        296   2e-87    
gb|KFK34018.1|  hypothetical protein AALP_AA5G091400                    296   2e-87    
ref|XP_002458775.1|  hypothetical protein SORBIDRAFT_03g040080          295   2e-87    
gb|ACR37762.1|  unknown                                                 294   2e-87    
ref|XP_006369556.1|  hypothetical protein POPTR_0001s25530g             296   2e-87    
ref|XP_007155082.1|  hypothetical protein PHAVU_003G171700g             295   3e-87    
ref|XP_009797809.1|  PREDICTED: probable anion transporter 6, chl...    296   3e-87    
ref|XP_010044080.1|  PREDICTED: probable anion transporter 3, chl...    295   4e-87    
ref|XP_003549724.1|  PREDICTED: probable anion transporter 6, chl...    295   4e-87    
ref|XP_009625835.1|  PREDICTED: probable anion transporter 6, chl...    295   4e-87    
ref|XP_003564623.1|  PREDICTED: probable anion transporter 3, chl...    295   4e-87    
ref|XP_009346897.1|  PREDICTED: probable anion transporter 4, chl...    295   4e-87    
ref|NP_001030824.1|  inorganic phosphate transporter 4;3                295   5e-87    
ref|NP_190282.2|  inorganic phosphate transporter 4;3                   295   6e-87    
ref|XP_005849963.1|  hypothetical protein CHLNCDRAFT_143323             290   8e-87    
ref|XP_002533670.1|  Inner membrane transport protein yjjL, putative    295   8e-87    
ref|NP_001147958.1|  sialin                                             294   9e-87    
emb|CDX99079.1|  BnaA06g17700D                                          295   9e-87    
ref|XP_002298326.1|  hypothetical protein POPTR_0001s25530g             295   1e-86    
ref|XP_002877535.1|  hypothetical protein ARALYDRAFT_485075             294   1e-86    
ref|XP_002873995.1|  hypothetical protein ARALYDRAFT_910078             293   1e-86    
ref|XP_011035201.1|  PREDICTED: probable anion transporter 4, chl...    294   1e-86    
ref|XP_004145261.1|  PREDICTED: probable anion transporter 4, chl...    294   1e-86    
ref|XP_010509231.1|  PREDICTED: probable anion transporter 3, chl...    293   2e-86    
ref|XP_006654491.1|  PREDICTED: LOW QUALITY PROTEIN: probable ani...    293   2e-86    
sp|Q8W0H5.1|PHT43_ORYSJ  RecName: Full=Probable anion transporter...    292   3e-86    
ref|XP_004970603.1|  PREDICTED: probable anion transporter 3, chl...    292   5e-86    
ref|XP_010426152.1|  PREDICTED: probable anion transporter 4, chl...    292   6e-86    
ref|XP_010426153.1|  PREDICTED: probable anion transporter 4, chl...    292   6e-86    
ref|XP_010515022.1|  PREDICTED: probable anion transporter 4, chl...    292   7e-86    
ref|XP_010503315.1|  PREDICTED: probable anion transporter 4, chl...    292   7e-86    
ref|XP_010515021.1|  PREDICTED: probable anion transporter 4, chl...    292   7e-86    
ref|XP_009777113.1|  PREDICTED: probable anion transporter 1, chl...    278   7e-86    
ref|XP_010503314.1|  PREDICTED: probable anion transporter 4, chl...    291   9e-86    
ref|XP_007013609.1|  Phosphate transporter 4,5 isoform 1                292   9e-86    
ref|XP_007142235.1|  hypothetical protein PHAVU_008G263700g             290   1e-85    
gb|KDP46557.1|  hypothetical protein JCGZ_08529                         291   1e-85    
ref|XP_010505416.1|  PREDICTED: probable anion transporter 3, chl...    290   2e-85    
ref|XP_004957606.1|  PREDICTED: probable anion transporter 6, chl...    291   2e-85    
ref|XP_006359498.1|  PREDICTED: probable anion transporter 6, chl...    291   2e-85    
gb|EYU45748.1|  hypothetical protein MIMGU_mgv1a004438mg                290   2e-85    
emb|CEF97011.1|  Major facilitator superfamily domain, general su...    288   3e-85    
ref|XP_004242733.1|  PREDICTED: probable anion transporter 6, chl...    290   3e-85    
ref|XP_010541712.1|  PREDICTED: probable anion transporter 6, chl...    290   3e-85    
ref|XP_011078539.1|  PREDICTED: probable anion transporter 6, chl...    290   3e-85    
ref|XP_007509469.1|  predicted protein                                  291   4e-85    
ref|XP_005651108.1|  MFS general substrate transporter                  287   4e-85    
dbj|BAJ89421.1|  predicted protein                                      290   5e-85    
ref|XP_003544870.1|  PREDICTED: probable anion transporter 4, chl...    289   5e-85    
ref|XP_010535423.1|  PREDICTED: probable anion transporter 4, chl...    290   6e-85    
gb|KCW79065.1|  hypothetical protein EUGRSUZ_C00489                     288   7e-85    
ref|XP_001701490.1|  carbohydrate transporter                           286   7e-85    
ref|XP_007016189.1|  Phosphate transporter 4,3 isoform 1                289   1e-84    
ref|XP_006389406.1|  hypothetical protein POPTR_0025s00420g             289   1e-84    
ref|XP_009407562.1|  PREDICTED: probable anion transporter 2, chl...    289   1e-84    
ref|XP_006661526.1|  PREDICTED: probable anion transporter 6, chl...    287   1e-84    
ref|XP_004287252.1|  PREDICTED: probable anion transporter 6, chl...    288   1e-84    
gb|KCW52567.1|  hypothetical protein EUGRSUZ_J01945                     289   1e-84    
ref|XP_008385014.1|  PREDICTED: probable anion transporter 6, chl...    288   2e-84    
gb|KHG26593.1|  putative anion transporter 4, chloroplastic -like...    288   2e-84    
ref|XP_006453121.1|  hypothetical protein CICLE_v10007933mg             288   2e-84    
ref|XP_002501720.1|  major facilitator superfamily                      290   2e-84    
ref|XP_010033035.1|  PREDICTED: probable anion transporter 4, chl...    289   2e-84    
ref|XP_003568337.1|  PREDICTED: probable anion transporter 2, chl...    288   3e-84    
gb|KDP30215.1|  hypothetical protein JCGZ_16997                         283   3e-84    
ref|XP_009384857.1|  PREDICTED: probable anion transporter 2, chl...    288   3e-84    
ref|XP_005850960.1|  hypothetical protein CHLNCDRAFT_19459              286   3e-84    
ref|XP_009358544.1|  PREDICTED: probable anion transporter 6, chl...    287   5e-84    
ref|XP_010676695.1|  PREDICTED: probable anion transporter 3, chl...    286   1e-83    
gb|KHN47115.1|  Putative anion transporter 6, chloroplastic             285   1e-83    
gb|KHN15031.1|  Putative anion transporter 6, chloroplastic             286   1e-83    
ref|XP_001416575.1|  MFS family transporter: sugar (sialic acid)        285   1e-83    
ref|XP_008242877.1|  PREDICTED: probable anion transporter 6, chl...    286   1e-83    
gb|ACJ85769.1|  unknown                                                 276   2e-83    
ref|XP_004961902.1|  PREDICTED: probable anion transporter 2, chl...    286   3e-83    
ref|XP_006290884.1|  hypothetical protein CARUB_v10016993mg             285   3e-83    
ref|XP_008336961.1|  PREDICTED: probable anion transporter 6, chl...    285   3e-83    
ref|XP_004294244.1|  PREDICTED: probable anion transporter 4, chl...    285   3e-83    
ref|WP_007234390.1|  General substrate transporter:Major facilita...    281   6e-83    
ref|XP_009358545.1|  PREDICTED: probable anion transporter 6, chl...    283   8e-83    
emb|CAN65535.1|  hypothetical protein VITISV_018284                     283   8e-83    
ref|XP_006400606.1|  hypothetical protein EUTSA_v10013250mg             283   2e-82    
ref|XP_009338386.1|  PREDICTED: probable anion transporter 6, chl...    282   3e-82    
ref|XP_010454342.1|  PREDICTED: probable anion transporter 6, chl...    281   5e-82    
ref|XP_007512723.1|  predicted protein                                  283   6e-82    
ref|XP_006453122.1|  hypothetical protein CICLE_v10007933mg             281   8e-82    
ref|XP_010493144.1|  PREDICTED: probable anion transporter 6, chl...    280   2e-81    
ref|XP_010420877.1|  PREDICTED: probable anion transporter 6, chl...    279   4e-81    
ref|XP_009363940.1|  PREDICTED: probable anion transporter 6, chl...    279   4e-81    
ref|XP_009338387.1|  PREDICTED: probable anion transporter 6, chl...    279   4e-81    
ref|XP_006287321.1|  hypothetical protein CARUB_v10000522mg             281   6e-81    
ref|XP_005643982.1|  MFS general substrate transporter                  274   7e-81    
ref|XP_009126443.1|  PREDICTED: probable anion transporter 6, chl...    278   1e-80    
gb|AES98528.2|  anion transporter 4                                     278   1e-80    
ref|XP_004490571.1|  PREDICTED: probable anion transporter 4, chl...    277   2e-80    
gb|KDO73432.1|  hypothetical protein CISIN_1g009409mg                   276   4e-80    
ref|WP_007223737.1|  ABC transporter permease                           273   5e-80    
ref|XP_001691846.1|  hypothetical protein CHLREDRAFT_78631              272   8e-80    
gb|EEE55682.1|  hypothetical protein OsJ_04099                          280   2e-79    
ref|XP_007204131.1|  hypothetical protein PRUPE_ppa023436mg             274   2e-79    
ref|XP_003519242.1|  PREDICTED: probable anion transporter 4, chl...    274   2e-79    
gb|KHN40042.1|  Putative anion transporter 4, chloroplastic             268   7e-79    
gb|KDO66783.1|  hypothetical protein CISIN_1g009757mg                   271   1e-78    
ref|XP_002950310.1|  hypothetical protein VOLCADRAFT_60348              268   3e-78    
ref|XP_003078008.1|  transporter-related (ISS)                          269   3e-78    
ref|XP_002155626.1|  PREDICTED: vesicular glutamate transporter 3...    270   6e-78    
emb|CDY45089.1|  BnaA02g04870D                                          270   8e-78    
gb|KDR12727.1|  Sialin                                                  269   2e-77    
ref|XP_005643096.1|  MFS general substrate transporter                  270   2e-77    
gb|EEC71820.1|  hypothetical protein OsI_04461                          277   4e-77    
ref|XP_003062657.1|  major facilitator superfamily                      264   5e-77    
ref|XP_002323555.2|  hypothetical protein POPTR_0016s11850g             262   9e-77    
emb|CAB61944.1|  putative protein                                       267   2e-76    
ref|XP_002429294.1|  sialin, putative                                   266   2e-76    
ref|XP_010554925.1|  PREDICTED: probable anion transporter 3, chl...    266   2e-76    
ref|XP_010256678.1|  PREDICTED: probable anion transporter 4, chl...    263   9e-76    
gb|KDO66781.1|  hypothetical protein CISIN_1g009757mg                   260   1e-75    
gb|KDR20852.1|  Vesicular glutamate transporter 2                       262   5e-75    
ref|XP_010326196.1|  PREDICTED: probable anion transporter 4, chl...    257   9e-75    
gb|ACJ24245.1|  hypothetical protein                                    260   1e-74    
ref|XP_005848708.1|  hypothetical protein CHLNCDRAFT_21975              259   2e-74    
ref|XP_006429292.1|  hypothetical protein CICLE_v10011514mg             258   4e-74    
gb|EKC30442.1|  Sialin                                                  259   4e-74    
gb|KHN46175.1|  Putative anion transporter 4, chloroplastic             256   7e-74    
ref|XP_004982440.1|  PREDICTED: probable anion transporter 7-like...    256   1e-73    
ref|NP_001148973.1|  inorganic phosphate cotransporter                  255   4e-73    
ref|XP_010104690.1|  putative anion transporter 4                       258   4e-73    
ref|XP_006571698.1|  PREDICTED: vesicular glutamate transporter 2...    257   4e-73    
ref|NP_001066311.1|  Os12g0180100                                       255   5e-73    
ref|XP_395682.4|  PREDICTED: vesicular glutamate transporter 2.2-...    256   6e-73    
gb|EJP72872.1|  sodium-dependent phosphate transport protein 1, ic      254   6e-73    
ref|NP_001168019.1|  uncharacterized protein LOC100381743               254   6e-73    
ref|XP_008807650.1|  PREDICTED: probable anion transporter 6            254   8e-73    
ref|XP_003695620.1|  PREDICTED: vesicular glutamate transporter 2...    256   1e-72    
ref|XP_970478.1|  PREDICTED: vesicular glutamate transporter 3-li...    255   1e-72    
ref|XP_002122757.1|  PREDICTED: sialin                                  256   1e-72    
ref|XP_006663872.1|  PREDICTED: probable anion transporter 7-like       254   1e-72    
ref|XP_010685622.1|  PREDICTED: probable anion transporter 4, chl...    251   1e-72    
ref|XP_010686534.1|  PREDICTED: probable anion transporter 5            253   2e-72    
ref|XP_006616115.1|  PREDICTED: vesicular glutamate transporter 2...    254   2e-72    
ref|XP_009763197.1|  PREDICTED: probable anion transporter 4, chl...    250   3e-72    
gb|ETN58283.1|  Sialin, Sodium/sialic acid cotransporter                253   5e-72    
gb|KFM63422.1|  putative inorganic phosphate cotransporter              254   8e-72    
gb|KDO66784.1|  hypothetical protein CISIN_1g009757mg                   252   8e-72    
gb|KDO73433.1|  hypothetical protein CISIN_1g009409mg                   252   1e-71    
ref|XP_003494012.1|  PREDICTED: vesicular glutamate transporter 1...    252   2e-71    
ref|WP_020034469.1|  hypothetical protein                               250   2e-71    
ref|XP_003393248.1|  PREDICTED: vesicular glutamate transporter 1...    251   4e-71    
ref|WP_020082614.1|  hypothetical protein                               248   8e-71    
ref|XP_007227454.1|  hypothetical protein PRUPE_ppa005821mg             249   1e-70    
ref|XP_316621.3|  AGAP006594-PA                                         250   1e-70    
ref|XP_004290071.1|  PREDICTED: probable anion transporter 5-like       247   2e-70    
ref|XP_006269813.1|  PREDICTED: sialin                                  249   2e-70    
gb|EJP72180.1|  sialin                                                  247   2e-70    
emb|CDM86266.1|  unnamed protein product                                247   3e-70    
ref|XP_001746784.1|  hypothetical protein                               253   4e-70    
ref|XP_010028850.1|  PREDICTED: probable anion transporter 5            247   4e-70    
gb|KFB49314.1|  AGAP006594-PA-like protein                              248   4e-70    
ref|XP_009420295.1|  PREDICTED: probable anion transporter 6            247   5e-70    
ref|XP_010912547.1|  PREDICTED: probable anion transporter 6            247   5e-70    
ref|XP_008775073.1|  PREDICTED: probable anion transporter 3, chl...    244   5e-70    
dbj|BAK07905.1|  predicted protein                                      246   6e-70    
ref|XP_001849053.1|  Sialin, Sodium/sialic acid cotransporter           248   6e-70    
ref|XP_002432809.1|  sialin, putative                                   248   6e-70    
ref|XP_006662793.1|  PREDICTED: probable anion transporter 6-like       246   7e-70    
ref|XP_006020537.1|  PREDICTED: sialin isoform X1                       248   8e-70    
gb|KDP28058.1|  hypothetical protein JCGZ_19466                         246   9e-70    
gb|EMT01775.1|  Putative anion transporter 7                            246   1e-69    
ref|WP_020029635.1|  hypothetical protein                               245   1e-69    
dbj|BAJ88931.1|  predicted protein                                      245   1e-69    
ref|NP_001067406.1|  Os11g0186800                                       245   1e-69    
ref|XP_003578833.1|  PREDICTED: probable anion transporter 7            245   1e-69    
ref|XP_003570363.1|  PREDICTED: probable anion transporter 7            245   2e-69    
ref|XP_001952158.1|  PREDICTED: vesicular glutamate transporter 1       246   2e-69    
gb|KFQ90176.1|  Sialin                                                  246   3e-69    
ref|XP_009063883.1|  hypothetical protein LOTGIDRAFT_107883             246   3e-69    
gb|EMT17004.1|  Putative anion transporter 7                            244   3e-69    
ref|XP_005852034.1|  hypothetical protein CHLNCDRAFT_18155              244   3e-69    
gb|KFZ64876.1|  Sialin                                                  245   3e-69    
ref|XP_007043074.1|  Phosphate transporter 4,6                          244   4e-69    
ref|XP_002739690.1|  PREDICTED: vesicular glutamate transporter 3...    248   4e-69    
ref|XP_006411007.1|  hypothetical protein EUTSA_v10017818mg             247   4e-69    
ref|XP_004291794.1|  PREDICTED: probable anion transporter 5-like       244   4e-69    
ref|NP_974392.1|  inorganic phosphate transporter 4;3                   245   4e-69    
ref|XP_002737486.1|  PREDICTED: sialin-like isoform X1                  246   4e-69    
ref|XP_010503316.1|  PREDICTED: probable anion transporter 4, chl...    241   5e-69    
ref|XP_006851011.1|  hypothetical protein AMTR_s00025p00219610          244   6e-69    
gb|EMS48492.1|  putative anion transporter 7                            245   6e-69    
ref|XP_010426154.1|  PREDICTED: probable anion transporter 4, chl...    241   7e-69    
ref|XP_008550562.1|  PREDICTED: vesicular glutamate transporter 2...    245   8e-69    



>ref|XP_009631060.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=519

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/530 (82%), Positives = 473/530 (89%), Gaps = 22/530 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTH--------TLFEFGSPFLPGRGF  1835
             MTA++ LLS+Y+  P  +C+  +    R+FS  +  +         LF+FGS +      
Sbjct  1     MTAKSFLLSHYSCSPPKNCN--SNIRGRNFSYYTTGNGIECRGAFRLFQFGSRY------  52

Query  1834  RRGLIRRT--SWRAWADVKSKTYGISDSVPESLKFEDALNDDVL-TEDDGETISGGFPKR  1664
               GL+RR   SW+AWADVKSK + I++S  ESLKFED ++D +L  ++DG+++   FPKR
Sbjct  53    GEGLVRRNNDSWKAWADVKSKPFKIAES-SESLKFEDPISDALLRKKEDGDSLE--FPKR  109

Query  1663  WVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIW  1484
             WVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHW PTTVGLIQSSFFWGYLLTQIAGGIW
Sbjct  110   WVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWGPTTVGLIQSSFFWGYLLTQIAGGIW  169

Query  1483  ADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKW  1304
             ADTVGGK VLGFGVVWWS+AT+LTPIAAKLGLPFLF+VRAFMGIGEGVAMPAMNN+LSKW
Sbjct  170   ADTVGGKAVLGFGVVWWSVATVLTPIAAKLGLPFLFVVRAFMGIGEGVAMPAMNNILSKW  229

Query  1303  VPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAH  1124
             VPVSERSRSLA+VYSGMYLGSVTGLAFSP+LIH FGWPSVF+SFGSLGTVWF VWL+KA+
Sbjct  230   VPVSERSRSLALVYSGMYLGSVTGLAFSPLLIHNFGWPSVFFSFGSLGTVWFAVWLNKAY  289

Query  1123  SSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT  944
             SSPLDDPEL PEEKKLIL +SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT
Sbjct  290   SSPLDDPELRPEEKKLILSSSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT  349

Query  943   WMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIG  764
             WMPTYYHQVLKFNLTESG+FAVLPWLTMA SA  GGWIADSLVRKGVSVTVVRKIMQTIG
Sbjct  350   WMPTYYHQVLKFNLTESGLFAVLPWLTMAISANIGGWIADSLVRKGVSVTVVRKIMQTIG  409

Query  763   FLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTA  584
             FLGPAFFLTQLSHVDSPAMAVLCM+CSQGSDAFSQSGLYSNHQDIAPRYSGVL+GLSNTA
Sbjct  410   FLGPAFFLTQLSHVDSPAMAVLCMSCSQGSDAFSQSGLYSNHQDIAPRYSGVLLGLSNTA  469

Query  583   GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWN FSTGEKI+D
Sbjct  470   GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNAFSTGEKIID  519



>emb|CDP09168.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/541 (77%), Positives = 452/541 (84%), Gaps = 27/541 (5%)
 Frame = -2

Query  1978  ALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLI-------  1820
             A ++S+Y+ PP  H SPE    +R +SS       F+   P  P       +        
Sbjct  6     ASVISFYS-PPSHHNSPEIQLQRRIWSSSFRFDAPFKLQLPIFPLNRASSSVHVCSGSSR  64

Query  1819  ---------RRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDD---GETIS--  1682
                      R++SWR W DVKSK Y ++DS  ESLKF+DA ND  L   D   G+ +   
Sbjct  65    SSSNGVVVGRKSSWRVWTDVKSKPYDVADSERESLKFQDAFNDAALKNGDAVDGQIVDIA  124

Query  1681  -----GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWG  1517
                    FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASE++WSP+TVGLIQSSFFWG
Sbjct  125   EIRWWEQFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEFNWSPSTVGLIQSSFFWG  184

Query  1516  YLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVA  1337
             YLLTQ+AGG+WADTVGGK VLGFGVVWWSIAT +TPIAA+LGLPFL + RA MGIGEGVA
Sbjct  185   YLLTQVAGGMWADTVGGKFVLGFGVVWWSIATTVTPIAARLGLPFLLVTRAIMGIGEGVA  244

Query  1336  MPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGT  1157
             MPAMNNLLS+WVPV+ERSRSLA+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLGT
Sbjct  245   MPAMNNLLSRWVPVAERSRSLALVYSGMYLGSVTGLAFSPLLIHKFGWPSVFYSFGSLGT  304

Query  1156  VWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHF  977
             VWF VWL+KAHS+PLDDP L  +EKKLIL NSV KEPVKSIPW+LILSK PVWALI+SHF
Sbjct  305   VWFAVWLNKAHSTPLDDPGLRLDEKKLILSNSVCKEPVKSIPWRLILSKSPVWALIISHF  364

Query  976   CHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSV  797
             CHNWGTFILLTWMPTYYHQVLKFNLTESGMF+VLPWLTMAFSA  GGWIADSLV KGVSV
Sbjct  365   CHNWGTFILLTWMPTYYHQVLKFNLTESGMFSVLPWLTMAFSANVGGWIADSLVSKGVSV  424

Query  796   TVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRY  617
             T+VRKIMQTIGFLGPAFFLTQL+HVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRY
Sbjct  425   TIVRKIMQTIGFLGPAFFLTQLNHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRY  484

Query  616   SGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             SGVL+GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYL GTVVWNLFSTGEKIL
Sbjct  485   SGVLLGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLAGTVVWNLFSTGEKIL  544

Query  436   D  434
             D
Sbjct  545   D  545



>ref|XP_006361301.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
[Solanum tuberosum]
Length=511

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/526 (79%), Positives = 451/526 (86%), Gaps = 22/526 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRS---HTHTLFEFGSPFLPGRGFRRGLI  1820
             M+A+A LLS+Y+  P          P+R+ +  +    T              G R  LI
Sbjct  1     MSAKAFLLSHYSFSPP-------NIPRRNLNVHNSFYDTSGSGRGRGRGRFRYGERELLI  53

Query  1819  RR--TSWRAWADVKSKTYGISDSVPESL--KFEDALNDDVLTEDDGETISGGFPKRWVIV  1652
             +R  +SW+ WADVKSK + I+D    SL  K ED  N   L ++        FPKRWVIV
Sbjct  54    KRNSSSWKLWADVKSKPFKIADDDSSSLLRKREDGDNSVGLPQE--------FPKRWVIV  105

Query  1651  LLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTv  1472
             +LCFSAFLLCNMDRVNMSIAILPMASEY+W+PTTVGLIQSSFFWGYLLTQIAGGIWADTV
Sbjct  106   ILCFSAFLLCNMDRVNMSIAILPMASEYNWTPTTVGLIQSSFFWGYLLTQIAGGIWADTV  165

Query  1471  ggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVS  1292
             GGK VLGFGV+WWS+AT+LTPIAAKLGLPFLF+VRAFMGIGEGVAMPAMNN+LSKWVPVS
Sbjct  166   GGKAVLGFGVIWWSVATVLTPIAAKLGLPFLFVVRAFMGIGEGVAMPAMNNILSKWVPVS  225

Query  1291  ERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpl  1112
             ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVF+SFGSLGTVWF VWLSKA+SSPL
Sbjct  226   ERSRSLALVYSGMYLGSVTGLAFSPFLIHEFGWPSVFFSFGSLGTVWFAVWLSKAYSSPL  285

Query  1111  ddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPT  932
             DDP L PEEKKLIL +SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPT
Sbjct  286   DDPTLRPEEKKLILSSSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPT  345

Query  931   YYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGP  752
             YYHQVLKFNLTESG+FAVLPWLTMA +A  GGWIADSLVR+G SVTVVRKIMQTIGFLGP
Sbjct  346   YYHQVLKFNLTESGLFAVLPWLTMAVTANVGGWIADSLVRRGTSVTVVRKIMQTIGFLGP  405

Query  751   AFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLA  572
             AFFLTQLSHVDSPAMAVLCM CSQGSDAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLA
Sbjct  406   AFFLTQLSHVDSPAMAVLCMACSQGSDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLA  465

Query  571   GVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWN FSTGEKI+D
Sbjct  466   GVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNAFSTGEKIID  511



>gb|KDP46521.1| hypothetical protein JCGZ_08493 [Jatropha curcas]
Length=520

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/523 (78%), Positives = 450/523 (86%), Gaps = 7/523 (1%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSF--SSRSHTHTLFEFGSPFLPG--RGFRRGL  1823
             M ARALL   Y+  P     P+ +  K+SF  S R   +    F S       R + R  
Sbjct  1     MNARALL---YSFSPHFRPLPDISLSKKSFGLSRREPFNFRVRFQSDERCAVFRIYVRNS  57

Query  1822  IRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLC  1643
              R    + +A+VKS+   +S+SVPES+KF+D+L+   L  +        FPKRWVIV+LC
Sbjct  58    NRSEFGKVYAEVKSEPCDVSESVPESVKFKDSLSSGDLELESSVPWWEEFPKRWVIVILC  117

Query  1642  FSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggk  1463
             FSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK
Sbjct  118   FSAFLLCNMDRVNMSIAILPMSAEYNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGK  177

Query  1462  lvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERS  1283
             LVLGFGVVWWSIAT LTP+AAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKWVPVSERS
Sbjct  178   LVLGFGVVWWSIATALTPVAAKLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWVPVSERS  237

Query  1282  RSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddp  1103
             RSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWFTVWL+KA+SSPLDDP
Sbjct  238   RSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFTVWLNKAYSSPLDDP  297

Query  1102  ellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH  923
             +L P+EK+LI+ NSVSKEPVKSIPW LILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+
Sbjct  298   KLQPKEKQLIVANSVSKEPVKSIPWGLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYN  357

Query  922   QVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFF  743
             QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG SVT VRKIMQTIGFLGPAFF
Sbjct  358   QVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGFSVTTVRKIMQTIGFLGPAFF  417

Query  742   LTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVF  563
             LTQLSH+DSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVF
Sbjct  418   LTQLSHIDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVF  477

Query  562   GTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GTAATGYILQHGSWDDVFKVSV LYLVGTVVWNLFSTGEKI+D
Sbjct  478   GTAATGYILQHGSWDDVFKVSVSLYLVGTVVWNLFSTGEKIVD  520



>ref|XP_010262796.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
[Nelumbo nucifera]
Length=536

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/541 (75%), Positives = 451/541 (83%), Gaps = 27/541 (5%)
 Frame = -2

Query  1990  MTARALLLS----YYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGR---GFR  1832
             M A A LLS    + +L  + + S   T  K + S     H   EF   FL  +   GFR
Sbjct  1     MNAGAFLLSSAPDFSSLQTRKNSSVRTTSRKAACS-----HLKTEFHVRFLSLKHHHGFR  55

Query  1831  ---------RGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG  1679
                       G  R+   R  ADVKS+ Y ++DS PES+KF D  +  V+ ED  E++  
Sbjct  56    VSWRNSRALEGSGRKDVGRVLADVKSEPYDVADSAPESVKFPDGFSQVVIAEDSLESLDE  115

Query  1678  G------FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWG  1517
             G      FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++E++W+PTTVGLIQSSFFWG
Sbjct  116   GLPWLEQFPKRWVIVILCFSAFLLCNMDRVNMSIAILPMSAEFNWNPTTVGLIQSSFFWG  175

Query  1516  YLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVA  1337
             YLLTQIAGGIWADTVGGK VLGFGVVWWSIAT LTPIAAK+GLPFL +VRAFMGIGEGVA
Sbjct  176   YLLTQIAGGIWADTVGGKRVLGFGVVWWSIATALTPIAAKIGLPFLLVVRAFMGIGEGVA  235

Query  1336  MPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGT  1157
             MPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLGT
Sbjct  236   MPAMNNILSKWIPVSERSRSLALVYSGMYLGSVTGLAFSPLLIHKFGWPSVFYSFGSLGT  295

Query  1156  VWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHF  977
             VWF VWL+KAHSSP +DP+L PEE+KLI   S+++EPVK IPW+LILSK PVWALIVSHF
Sbjct  296   VWFAVWLNKAHSSPAEDPQLRPEERKLIASTSITREPVKEIPWRLILSKAPVWALIVSHF  355

Query  976   CHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSV  797
             CHNWGTFILLTWMPTYY+QVLKFNLTESG+F VLPW TMA SA  GGWIAD+LV +G+SV
Sbjct  356   CHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVLPWFTMAVSANIGGWIADTLVSRGLSV  415

Query  796   TVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRY  617
             T+VRKIMQTIGFLGPAFFLTQLSHV+SPAMAVLCMTCSQG+DAFSQSGLYSNHQDI PRY
Sbjct  416   TMVRKIMQTIGFLGPAFFLTQLSHVNSPAMAVLCMTCSQGTDAFSQSGLYSNHQDIGPRY  475

Query  616   SGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             SGVL+GLSNTAGVLAGV GTAATGYILQHGSWDDVFKVSVGLYLVGTVVW+LFSTGEKIL
Sbjct  476   SGVLLGLSNTAGVLAGVLGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWSLFSTGEKIL  535

Query  436   D  434
             D
Sbjct  536   D  536



>ref|XP_004246963.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=512

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/523 (78%), Positives = 445/523 (85%), Gaps = 15/523 (3%)
 Frame = -2

Query  1990  MTARALLLSYYNL-PPKLHCSPEATFP-KRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIR  1817
             M+ +A LLS+Y+  PP +   P   F    SF   S + +    G            L++
Sbjct  1     MSGKAFLLSHYSFSPPNI---PRTNFNVHNSFYHTSESGSGRGRGRGRFGYGQRELLLVK  57

Query  1816  R--TSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLC  1643
             R  +S + WADVKSK + I++      K ED  N   L ++        FPKRWVIV+LC
Sbjct  58    RNSSSRKLWADVKSKPFKIAEDDALLRKKEDGDNSVGLPQE--------FPKRWVIVILC  109

Query  1642  FSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggk  1463
             FSAFLLCNMDRVNMSIAILPMASEY+W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK
Sbjct  110   FSAFLLCNMDRVNMSIAILPMASEYNWTPITVGLIQSSFFWGYLLTQIAGGIWADTVGGK  169

Query  1462  lvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERS  1283
              VLGFGV+WWS+AT+LTPIAAKLGLPFLF+VRAFMGIGEGVAMPAMNN+LSKWVPVSERS
Sbjct  170   AVLGFGVIWWSVATVLTPIAAKLGLPFLFVVRAFMGIGEGVAMPAMNNILSKWVPVSERS  229

Query  1282  RSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddp  1103
             RSLA+VYSGMYLGSVTGLAFSP LI +FGWPSVF+SFGS+GTVWF VWL+KA+SSPLDDP
Sbjct  230   RSLALVYSGMYLGSVTGLAFSPFLIKQFGWPSVFFSFGSVGTVWFAVWLNKAYSSPLDDP  289

Query  1102  ellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH  923
              L PEEKKLIL +SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH
Sbjct  290   TLRPEEKKLILCSSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH  349

Query  922   QVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFF  743
             QVLKFNLTESG+FAVLPWLTMA +A  GGWIADSLVR+G SVTVVRKIMQTIGFLGPAFF
Sbjct  350   QVLKFNLTESGLFAVLPWLTMAATANVGGWIADSLVRRGTSVTVVRKIMQTIGFLGPAFF  409

Query  742   LTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVF  563
             LTQLS VDSPAMAVLCM CSQGSDAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVF
Sbjct  410   LTQLSRVDSPAMAVLCMACSQGSDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVF  469

Query  562   GTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GTAATGYILQHGSWDDVFKVSVGLYLVGTVVWN FSTGEKI+D
Sbjct  470   GTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNAFSTGEKIID  512



>ref|XP_011032143.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=519

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/535 (77%), Positives = 446/535 (83%), Gaps = 35/535 (7%)
 Frame = -2

Query  1987  TARALLLSYYNLPPK-LHCSPEATFPKR------SFSSRSHTHTLFEFGSPFLPGRGFRR  1829
             T+RALL S+ +   + L   P+ + PKR      +F  R H H                R
Sbjct  3     TSRALLYSFTDPTFRPLKSPPDISSPKRRPREGLNFRVRLHNH----------------R  46

Query  1828  GLIRRTSWR---------AWADVKSKTYGISDSVPESLKFE-DALNDDVLTEDDGETISG  1679
             G + R S R          +ADVKS+ Y I  SVPES+K E DAL+D VL  D       
Sbjct  47    GCVSRVSVRNSGRGETGKVYADVKSEPYEILKSVPESVKLEEDALDDVVL--DSTMPWWE  104

Query  1678  GFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQI  1499
              FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++E +W+P TVGLIQSSFFWGYLLTQI
Sbjct  105   EFPKRWVIVILCFSAFLLCNMDRVNMSIAILPMSAENNWNPATVGLIQSSFFWGYLLTQI  164

Query  1498  AGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNN  1319
             AGGIWADTVGGK VLGFGV+WWSIATILTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN
Sbjct  165   AGGIWADTVGGKKVLGFGVIWWSIATILTPVAAKVGLPFLLVVRAFMGIGEGVAMPAMNN  224

Query  1318  LLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVW  1139
             +LSKWVPVSERSRSLA VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  W
Sbjct  225   ILSKWVPVSERSRSLAFVYSGMYLGSVTGLAFSPFLIHEFGWPSVFYSFGSLGTVWFAAW  284

Query  1138  LSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGT  959
             LSKAHSSPLDDP+L P EKKLI  NS SKEPV++IPW+LILSK PVWALIVSHFCHNWGT
Sbjct  285   LSKAHSSPLDDPQLRPAEKKLIFANSFSKEPVETIPWRLILSKAPVWALIVSHFCHNWGT  344

Query  958   FILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKI  779
             FILLTWMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKI
Sbjct  345   FILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKI  404

Query  778   MQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMG  599
             MQ+IGFLGPAFFLTQLSH+DSPA+AVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+G
Sbjct  405   MQSIGFLGPAFFLTQLSHIDSPAVAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLG  464

Query  598   LSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             LSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGT VWNLFSTGEKILD
Sbjct  465   LSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTAVWNLFSTGEKILD  519



>ref|XP_011035184.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
isoform X1 [Populus euphratica]
Length=514

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/523 (78%), Positives = 441/523 (84%), Gaps = 16/523 (3%)
 Frame = -2

Query  1987  TARALLLSYYNLPPK-LHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRT  1811
             T RALL S+ + P + L   P+ + PKR   + +    L          R  +R  I R 
Sbjct  3     TTRALLYSFTDRPFRPLKSLPDISCPKRPREALNFRVQL----------RTDQRCSIFRD  52

Query  1810  SWR----AWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLC  1643
             S R     +ADVKS  Y I +SVPES+K E+A  DD +  D        FPKRWVIV+LC
Sbjct  53    SVRKTGKVYADVKSDRYEILESVPESVKLEEAALDDAVL-DSTVPWWEEFPKRWVIVILC  111

Query  1642  FSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggk  1463
             FSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK
Sbjct  112   FSAFLLCNMDRVNMSIAILPMSAEYNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGK  171

Query  1462  lvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERS  1283
              VLGFGV+WWSIAT LTP+AAK GLPFL +VRAFMG+GEGVAMPAMN +LSKWVPVSERS
Sbjct  172   RVLGFGVIWWSIATALTPVAAKAGLPFLLVVRAFMGVGEGVAMPAMNTILSKWVPVSERS  231

Query  1282  RSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddp  1103
             RSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  WLSKAHSSPLDDP
Sbjct  232   RSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFAAWLSKAHSSPLDDP  291

Query  1102  ellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH  923
             +L PEEK LI  NS  KEPVKSIPW LILSK PVWALIVSHFCHNWGTFILLTWMPTYY+
Sbjct  292   QLRPEEKNLIFVNSSPKEPVKSIPWGLILSKAPVWALIVSHFCHNWGTFILLTWMPTYYN  351

Query  922   QVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFF  743
             QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ+IGFLGPAFF
Sbjct  352   QVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFF  411

Query  742   LTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVF  563
             LTQLSH+DSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVF
Sbjct  412   LTQLSHIDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVF  471

Query  562   GTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GTA+TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  472   GTASTGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  514



>ref|XP_008457384.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
[Cucumis melo]
Length=532

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/533 (77%), Positives = 449/533 (84%), Gaps = 19/533 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRS-------FSSRSHTHTLFEFGSPFLPGRGFR  1832
             M A ALL S+ + P     +P  +F K S       F SR H   L E    F+     R
Sbjct  5     MAAGALLYSFSSTP----LNPSDSFKKFSLTERRPKFPSRFHLTVLPE-DRCFVFQISAR  59

Query  1831  RGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS-------GGF  1673
             R    R +WR W DVKS  Y +S   P+S+KF  +++  VL +DD E            F
Sbjct  60    RHSGGRGNWRLWTDVKSNPYDVSIKAPDSVKFNSSIDKSVLDDDDEEEELGDELPWWKQF  119

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRW+IV LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIAG
Sbjct  120   PKRWLIVSLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPQTVGLIQSSFFWGYLLTQIAG  179

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             GIWADTVGGKLVLGFGV+WWS+AT LTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+L
Sbjct  180   GIWADTVGGKLVLGFGVIWWSVATALTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMNNIL  239

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVF+SFGSLG VWF+VWL+
Sbjct  240   SKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFFSFGSLGAVWFSVWLN  299

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFI  953
             KAHSSPLDDP+L P+EKKLI  NSVSKEPVKSIPW +ILSKPPVWALIVSHFCHNWGTFI
Sbjct  300   KAHSSPLDDPQLRPQEKKLIFANSVSKEPVKSIPWGMILSKPPVWALIVSHFCHNWGTFI  359

Query  952   LLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQ  773
             LLTWMPTYYHQVLKFNLTESG+  VLPWLTMAFSA  GGWIAD+LV +G+SVT VRKIMQ
Sbjct  360   LLTWMPTYYHQVLKFNLTESGLLCVLPWLTMAFSANLGGWIADTLVSRGLSVTTVRKIMQ  419

Query  772   TIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLS  593
             +IGFLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLS
Sbjct  420   SIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLS  479

Query  592   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  480   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  532



>ref|XP_002313389.2| hypothetical protein POPTR_0009s04840g [Populus trichocarpa]
 gb|EEE87344.2| hypothetical protein POPTR_0009s04840g [Populus trichocarpa]
Length=520

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/520 (78%), Positives = 441/520 (85%), Gaps = 4/520 (1%)
 Frame = -2

Query  1987  TARALLLSYYNLPPKLHCSP-EATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRT  1811
             T+RALL S+ +   +   SP + + PKR    R +              R   R   R  
Sbjct  3     TSRALLYSFTDPTFRPLKSPTDISSPKRRPRERHNFRVRLHTDHRCCVFRVSVRNSGRGE  62

Query  1810  SWRAWADVKSKTYGISDSVPESLKFE-DALNDDVLTEDDGETISGGFPKRWVIVLLCFSA  1634
             + + +ADVKS+ Y I ++VPES K E DAL+D VL  D        FPKRWVIV+LCFSA
Sbjct  63    TGKVYADVKSEPYEILETVPESAKLEEDALDDVVL--DSTVPWWEEFPKRWVIVILCFSA  120

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FL CNMDRVNMSIAILPM++E +W+P TVGLIQSSFFWGYLLTQ+AGGIWADTVGGK VL
Sbjct  121   FLPCNMDRVNMSIAILPMSAENNWNPATVGLIQSSFFWGYLLTQVAGGIWADTVGGKKVL  180

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GF V+WWSIATILTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+LSKWVPVSERSRSL
Sbjct  181   GFAVIWWSIATILTPVAAKVGLPFLLVVRAFMGIGEGVAMPAMNNILSKWVPVSERSRSL  240

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  WLSKAHSSPLDDP+L 
Sbjct  241   AFVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFAAWLSKAHSSPLDDPQLR  300

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
             P EKKLI  NS SKEPV+SIPW+LILSK PVWALIVSHFCHNWGTFILLTWMPTYY+QVL
Sbjct  301   PAEKKLIFANSFSKEPVESIPWRLILSKAPVWALIVSHFCHNWGTFILLTWMPTYYNQVL  360

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ+IGFLGPAFFLTQ
Sbjct  361   KFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFFLTQ  420

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSH+DSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVFGTA
Sbjct  421   LSHIDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVFGTA  480

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  481   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  520



>ref|XP_008355271.1| PREDICTED: LOW QUALITY PROTEIN: sodium-dependent phosphate transport 
protein 1, chloroplastic-like [Malus domestica]
Length=527

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/534 (75%), Positives = 445/534 (83%), Gaps = 22/534 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRT  1811
             M ARALL   Y+  PK + +P      +  +      T F F    +  R      +R +
Sbjct  1     MNARALL---YSFSPKPNIAPPDFSATKISADNPRPQTPFRFRVR-IRNREQYCCFVRVS  56

Query  1810  SW--------RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGG-------  1676
                       + +ADVKS+ Y IS+SV    KF+  L+D V  ++D E  S         
Sbjct  57    GGGGGNRRGGKVFADVKSEAYBISESVD---KFDKGLSDVVSVKEDLEAESAAEVSWLQE  113

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIA
Sbjct  114   FPKRWVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPATVGLIQSSFFWGYLLTQIA  173

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GGIWADTVGGK VL FGV+WWSIATILTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+
Sbjct  174   GGIWADTVGGKQVLAFGVIWWSIATILTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMNNI  233

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             LSKW+PV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF VWL
Sbjct  234   LSKWIPVAERSRSLALVYSGMYLGSVTGLAFSPYLIHQFGWPSVFYSFGSLGTVWFAVWL  293

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
             SKAHSSPL+DPEL P EKKLIL +S+SKEPVK IPWKLILSK PVWALIVSHFCHNWGTF
Sbjct  294   SKAHSSPLEDPELRPXEKKLILASSISKEPVKVIPWKLILSKAPVWALIVSHFCHNWGTF  353

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             ILLTWMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG SVT VRKIM
Sbjct  354   ILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGFSVTRVRKIM  413

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             QTIGFLGPAFFLTQLSH++SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GL
Sbjct  414   QTIGFLGPAFFLTQLSHINSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGL  473

Query  595   SNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SNTAGVLAGVFGTA+TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEK++D
Sbjct  474   SNTAGVLAGVFGTASTGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKVID  527



>ref|XP_007207590.1| hypothetical protein PRUPE_ppa019688mg [Prunus persica]
 gb|EMJ08789.1| hypothetical protein PRUPE_ppa019688mg [Prunus persica]
Length=532

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/542 (75%), Positives = 447/542 (82%), Gaps = 33/542 (6%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSP-EATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRR  1814
             M ARAL+ S+    PK H  P + + PKRSF   S   T F F       +      + R
Sbjct  1     MNARALIFSF---SPKPHIPPTDISAPKRSFCPDSRPQTPFRFRVQI---QNREHYWVLR  54

Query  1813  TSWR-----------AWADVKSKTYGISDSVPESLKFEDALND-----------DVLTED  1700
              S R            +ADVKS+ Y IS+SV    KFE  LND           + LT  
Sbjct  55    VSGRDSGGGKRRGGKVFADVKSEAYDISESVD---KFEKGLNDVPSRKEEELEEEPLTVA  111

Query  1699  DGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFW  1520
             +   +   FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFW
Sbjct  112   EASWLEQ-FPKRWVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPGTVGLIQSSFFW  170

Query  1519  GYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGV  1340
             GYLLTQIAGGIWADTVGGK VL FGV+WWSIATILTP+AAK+GLPFL +VRAFMGIGEGV
Sbjct  171   GYLLTQIAGGIWADTVGGKQVLAFGVIWWSIATILTPVAAKVGLPFLLVVRAFMGIGEGV  230

Query  1339  AMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG  1160
             AMPAMNN+LSKW+PV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLG
Sbjct  231   AMPAMNNILSKWIPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLG  290

Query  1159  TVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSH  980
             TVWF VW+SKAHSSPL+DPEL P EKKLIL +SVSKEPVK IPWKLILSK PVWALIVSH
Sbjct  291   TVWFAVWISKAHSSPLEDPELRPAEKKLILASSVSKEPVKEIPWKLILSKAPVWALIVSH  350

Query  979   FCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVS  800
             FCHNWGTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG S
Sbjct  351   FCHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGFS  410

Query  799   VTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPR  620
             VT VRKIMQTIGFLGPAFFLTQLSH++SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPR
Sbjct  411   VTRVRKIMQTIGFLGPAFFLTQLSHINSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPR  470

Query  619   YSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
             YSGVL+GLSNTAGVLAGVFGTA+TGYILQHGSWDDVFKVSVGLYL GTV+WNLFSTGEKI
Sbjct  471   YSGVLLGLSNTAGVLAGVFGTASTGYILQHGSWDDVFKVSVGLYLFGTVIWNLFSTGEKI  530

Query  439   LD  434
             +D
Sbjct  531   ID  532



>ref|XP_002298320.2| hypothetical protein POPTR_0001s25690g [Populus trichocarpa]
 gb|EEE83125.2| hypothetical protein POPTR_0001s25690g [Populus trichocarpa]
Length=519

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/523 (78%), Positives = 444/523 (85%), Gaps = 11/523 (2%)
 Frame = -2

Query  1987  TARALLLSYYNLPPK-LHCSPEATFPKR---SFSSRSHTHTLFEFGSPFLPGRGFRRGLI  1820
             T RALL S+ + P + L   P+ + PKR   + + R    T       ++  R   RG  
Sbjct  3     TTRALLYSFTDRPCRPLKSLPDISCPKRPTEALNFRVRLRTDQRCCIFWVSVRNSGRG--  60

Query  1819  RRTSWRAWADVKSKTYGISDSVPESLKFE-DALNDDVLTEDDGETISGGFPKRWVIVLLC  1643
                + + +ADVKS  Y I +SVPES+K E DAL+D  L  D        FPKRWVIV+LC
Sbjct  61    --ETGKVYADVKSDRYEILESVPESVKLEEDALDDAGL--DSTVPWWEEFPKRWVIVILC  116

Query  1642  FSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggk  1463
             FSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK
Sbjct  117   FSAFLLCNMDRVNMSIAILPMSAEYNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGK  176

Query  1462  lvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERS  1283
              VLGFGV+WWSIAT LTP+AAK GLPFL +VRAFMGIGEGVAMPAMN +LSKWVPVSERS
Sbjct  177   RVLGFGVIWWSIATALTPVAAKAGLPFLLVVRAFMGIGEGVAMPAMNTILSKWVPVSERS  236

Query  1282  RSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddp  1103
             RSLA+VYSGMYLGSVTGL FSP LIH+FGWPSVFYSFGSLGTVWF  WLSKAHSSPLDDP
Sbjct  237   RSLALVYSGMYLGSVTGLGFSPFLIHQFGWPSVFYSFGSLGTVWFAAWLSKAHSSPLDDP  296

Query  1102  ellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH  923
             +L PEEKKLI  NS SKEPVKSIPW LILSK PVWALIVSHFCHNWGTFILLTWMPTYY+
Sbjct  297   QLRPEEKKLIFANSSSKEPVKSIPWGLILSKGPVWALIVSHFCHNWGTFILLTWMPTYYN  356

Query  922   QVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFF  743
             QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ+IGFLGPAFF
Sbjct  357   QVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFF  416

Query  742   LTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVF  563
             LTQLSH+DSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVF
Sbjct  417   LTQLSHIDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVF  476

Query  562   GTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GTA+TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  477   GTASTGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  519



>gb|KHG28505.1| Sodium-dependent phosphate transport 1, chloroplastic -like protein 
[Gossypium arboreum]
Length=515

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/529 (76%), Positives = 451/529 (85%), Gaps = 24/529 (5%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSH-THTLFEFGSPFLPGRGFRRGLI--  1820
             M+ RALL S  N P           P  + S+R+  + T     SP     G R   +  
Sbjct  1     MSFRALLFSS-NFPKS---------PPENISTRTKPSPTRCLIRSPVNSPHGCRLSRLSA  50

Query  1819  ----RRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRW  1661
                 RR S + +ADV+     I+DS+ E +KF D+LND V +EDD ++       FPKRW
Sbjct  51    TEGRRRRSGKVYADVRE----IADSLRELVKFGDSLNDAVASEDDLDSAVPWWEQFPKRW  106

Query  1660  VIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWA  1481
             VIV+LCFSAFLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGGIWA
Sbjct  107   VIVILCFSAFLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIWA  166

Query  1480  DTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWV  1301
             DTVGGK VLGFGVVWWSIAT LTP+AAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKWV
Sbjct  167   DTVGGKTVLGFGVVWWSIATALTPVAAKLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWV  226

Query  1300  PVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHS  1121
             PV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF +WL+KA+S
Sbjct  227   PVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFALWLNKAYS  286

Query  1120  SplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTW  941
             SP++DPELLP+EKKLI+ N +SK+PVK+IPWKLILSKPPVWALIVSHFCHNWGTFILLTW
Sbjct  287   SPIEDPELLPQEKKLIVTNCISKQPVKTIPWKLILSKPPVWALIVSHFCHNWGTFILLTW  346

Query  940   MPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGF  761
             MPTYYHQVLKFNLT+SG+  VLPWLTMAFSA  GGWIAD+LV KG+SVT VRK+MQ+IGF
Sbjct  347   MPTYYHQVLKFNLTDSGLICVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKVMQSIGF  406

Query  760   LGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAG  581
             LGPAFFLTQLSHV+SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAG
Sbjct  407   LGPAFFLTQLSHVNSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAG  466

Query  580   VLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             VLAGVFGTAATGYILQHGSWD+VF+VSVGLYLVGTVVWNLFSTGEKILD
Sbjct  467   VLAGVFGTAATGYILQHGSWDNVFEVSVGLYLVGTVVWNLFSTGEKILD  515



>ref|XP_004164590.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
[Cucumis sativus]
Length=528

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/533 (76%), Positives = 447/533 (84%), Gaps = 19/533 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRS-------FSSRSHTHTLFEFGSPFLPGRGFR  1832
             M A ALL S+   PP    +P  +F K S       F SR H   L E    F+     R
Sbjct  1     MAAGALLYSFSPTPP----NPSDSFKKFSLTERRPKFPSRFHLTVLPE-DRCFVFQISAR  55

Query  1831  RGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS-------GGF  1673
             R    R +WR W D+KS  Y +S   P S+KF  +++  VL +D+ E            F
Sbjct  56    RHSGGRGNWRLWTDLKSNPYDVSIKPPNSVKFNSSIDKSVLDDDEEEDELGDELPWWKQF  115

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRW+IV LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIAG
Sbjct  116   PKRWLIVSLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPQTVGLIQSSFFWGYLLTQIAG  175

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             GIWADTVGGKLVLGFGV+WWS+AT+LTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+L
Sbjct  176   GIWADTVGGKLVLGFGVIWWSVATVLTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMNNIL  235

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH++GWPSVF+SFGSLG VWF VWL+
Sbjct  236   SKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQYGWPSVFFSFGSLGAVWFAVWLN  295

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFI  953
             KAHSSPLDDP+L P+EKKLI  NSVSKEPVKSIPW  ILSKPPVWALIVSHFCHNWGTFI
Sbjct  296   KAHSSPLDDPQLRPQEKKLIFANSVSKEPVKSIPWGTILSKPPVWALIVSHFCHNWGTFI  355

Query  952   LLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQ  773
             LLTWMPTYYHQVLKFNLTESG+  VLPWLTMAFSA  GGWIAD+LV +G+SVT VRKIMQ
Sbjct  356   LLTWMPTYYHQVLKFNLTESGLLCVLPWLTMAFSANLGGWIADTLVSRGLSVTTVRKIMQ  415

Query  772   TIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLS  593
             +IGFLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLS
Sbjct  416   SIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLS  475

Query  592   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  476   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  528



>ref|XP_002279594.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
[Vitis vinifera]
 emb|CBI15989.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/529 (78%), Positives = 448/529 (85%), Gaps = 25/529 (5%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEAT-FP---KRSFSSRSHTHT-LFEFGSPFLPGR--GFR  1832
             M ARA L S+      LH    ++ FP   KR F  R    T +F      + GR  G  
Sbjct  1     MNARAYLFSFSPDFHSLHSHKASSDFPLPKKRLFRFRFQDRTCVFR-----VSGRNAGEF  55

Query  1831  RGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRW  1661
              GL RR   + +A+VKS          E +KF++AL+D VL E+D E        FPKRW
Sbjct  56    TGLARREIGKVFAEVKS----------EQVKFQEALDDVVLGEEDLEGDVPWWEQFPKRW  105

Query  1660  VIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWA  1481
             VIV+LCFSAFLLCNMDRVNMSIAILPM++E++WSPTTVGLIQSSFFWGYLLTQIAGGIWA
Sbjct  106   VIVILCFSAFLLCNMDRVNMSIAILPMSAEFNWSPTTVGLIQSSFFWGYLLTQIAGGIWA  165

Query  1480  DTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWV  1301
             DTVGGKLVLGFGVVWWSIATILTPIAAK+GLPFL +VRAFMGIGEGVAMPAMNN+LSKWV
Sbjct  166   DTVGGKLVLGFGVVWWSIATILTPIAAKIGLPFLLVVRAFMGIGEGVAMPAMNNILSKWV  225

Query  1300  PVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHS  1121
             PVSERSRSLA+VYSGMYLGSVTGLAFSP LIH FGWPSVFYSFGSLGTVW   WLSKA+S
Sbjct  226   PVSERSRSLALVYSGMYLGSVTGLAFSPFLIHSFGWPSVFYSFGSLGTVWLATWLSKAYS  285

Query  1120  SplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTW  941
             SPL+DPELLP+EKKLI+ NSV+KEPVK IPW+LILSKPPVWALI SHFCHNWGTFILLTW
Sbjct  286   SPLEDPELLPKEKKLIVSNSVTKEPVKKIPWRLILSKPPVWALIGSHFCHNWGTFILLTW  345

Query  940   MPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGF  761
             MPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQTIGF
Sbjct  346   MPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQTIGF  405

Query  760   LGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAG  581
             LGPAFFLTQLSHV+SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAG
Sbjct  406   LGPAFFLTQLSHVNSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAG  465

Query  580   VLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             VLAGV GT ATGYILQHGSWDDVFKVSVGLYLVGTV+WNLFSTGEKILD
Sbjct  466   VLAGVLGTGATGYILQHGSWDDVFKVSVGLYLVGTVIWNLFSTGEKILD  514



>gb|EYU45976.1| hypothetical protein MIMGU_mgv1a004451mg [Erythranthe guttata]
Length=526

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/528 (77%), Positives = 445/528 (84%), Gaps = 14/528 (3%)
 Frame = -2

Query  1987  TARALLLSYYNLPPKLH--CSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRR  1814
             T+RALL+S Y+  PK H   SP ATF   S               P   G G      R 
Sbjct  3     TSRALLISLYS-APKTHPQISPRATFLPNSGLLLQLCPCQRAHFRPIYVGNGLSW---RV  58

Query  1813  TSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGG--------FPKRWV  1658
              S R  ADVKS+   I++S P+S++F       ++ +DD +             FP+RWV
Sbjct  59    KSGRVRADVKSEPCDIAESPPDSVQFGKVFATSIVDDDDDDGDVTSAAVPWWEQFPRRWV  118

Query  1657  IVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWAD  1478
             IV+LCFSAFLLCNMDRVNMSIAILPMASE HWS TTVGLIQSSFFWGYLLTQIAGGIWAD
Sbjct  119   IVILCFSAFLLCNMDRVNMSIAILPMASESHWSMTTVGLIQSSFFWGYLLTQIAGGIWAD  178

Query  1477  TvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVP  1298
             TVGGK VLGFGVVWWSIATILTPIAAKLGLP+L +VRAFMG+GEGVAMPAMNN+LSKWVP
Sbjct  179   TVGGKFVLGFGVVWWSIATILTPIAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILSKWVP  238

Query  1297  VSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSS  1118
             VSERSRSLA+VYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVW  +WL+ AHSS
Sbjct  239   VSERSRSLALVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWLALWLNMAHSS  298

Query  1117  plddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWM  938
             PL+DP+LLPEEKKLILRNS SKEPVKSIPW+LILSKPPVWALIVSHFCHNWGTFILLTWM
Sbjct  299   PLEDPKLLPEEKKLILRNSSSKEPVKSIPWRLILSKPPVWALIVSHFCHNWGTFILLTWM  358

Query  937   PTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFL  758
             PTYYHQVLK NLTESG+F+V PWLTMAF+A  GGWIAD+LV +GVSVT+VRKIMQTIGFL
Sbjct  359   PTYYHQVLKLNLTESGLFSVFPWLTMAFAANLGGWIADTLVSRGVSVTIVRKIMQTIGFL  418

Query  757   GPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGV  578
             GPAFFLTQL+H+++P MAVLCM CSQG DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGV
Sbjct  419   GPAFFLTQLTHIETPTMAVLCMACSQGLDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGV  478

Query  577   LAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             LAGVFGTAATGYILQHGSWDDVF+VSVGLYLVGTVVWNLFSTGEKI+D
Sbjct  479   LAGVFGTAATGYILQHGSWDDVFQVSVGLYLVGTVVWNLFSTGEKIVD  526



>ref|XP_002525609.1| Sodium-dependent phosphate transport protein, putative [Ricinus 
communis]
 gb|EEF36727.1| Sodium-dependent phosphate transport protein, putative [Ricinus 
communis]
Length=530

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/536 (76%), Positives = 450/536 (84%), Gaps = 23/536 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSP-EATFPKRSFSS---RSHTHTLFEFGSPFL-PGRGFRRG  1826
             M+ARALL  YY+  P       + + PK+SF            F F    L P  G   G
Sbjct  1     MSARALL--YYSSAPLFRPRKTDISVPKKSFGQIIPDLKPRESFNFRVVRLQPEGGSCSG  58

Query  1825  LIRRTSWRA----------WADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--  1682
             L R ++ ++           ADVKS+ Y IS+SVPES+KFED+L+ +    D   ++   
Sbjct  59    LFRVSAHKSSRSRSEFVKVHADVKSERYKISESVPESVKFEDSLSGN----DSESSLPWW  114

Query  1681  GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQ  1502
               FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQ
Sbjct  115   EEFPKRWVIVILCFSAFLLCNMDRVNMSIAILPMSAEYNWNPATVGLIQSSFFWGYLLTQ  174

Query  1501  IAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMN  1322
             IAGGIWADTVGGKLVLGFGVVWWSIAT LTP+AAK GLPFL +VR FMGIGEGVAMPAM 
Sbjct  175   IAGGIWADTVGGKLVLGFGVVWWSIATALTPVAAKFGLPFLLVVRVFMGIGEGVAMPAMT  234

Query  1321  NLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTV  1142
             N+LSKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGT+WF V
Sbjct  235   NILSKWVPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTIWFAV  294

Query  1141  WLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWG  962
             WL+KA+SSPLDDP+L PEEK+LI+ NS  KEPVK IPW LILSKPPVWALIVSHFCHNWG
Sbjct  295   WLNKAYSSPLDDPQLRPEEKQLIIANSACKEPVKVIPWGLILSKPPVWALIVSHFCHNWG  354

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             TFILLTWMPTYY+QVLKF+LTESG+  VLPWLTMAFSA  GGWIAD+LV KG SVT VRK
Sbjct  355   TFILLTWMPTYYNQVLKFDLTESGLVCVLPWLTMAFSANLGGWIADTLVSKGYSVTTVRK  414

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQTIGFLGPAFFLTQLSH++SPAMAVLCMTCSQG+DAFSQSGLYSNHQDIAPRYSGVL+
Sbjct  415   IMQTIGFLGPAFFLTQLSHINSPAMAVLCMTCSQGTDAFSQSGLYSNHQDIAPRYSGVLL  474

Query  601   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI+D
Sbjct  475   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIVD  530



>gb|KGN65796.1| hypothetical protein Csa_1G528610 [Cucumis sativus]
Length=532

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/533 (76%), Positives = 447/533 (84%), Gaps = 19/533 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRS-------FSSRSHTHTLFEFGSPFLPGRGFR  1832
             M A ALL S+   PP    +P  +F K S       F SR H   L E    F+     R
Sbjct  5     MAAGALLYSFSPTPP----NPSDSFKKFSLTERRPKFPSRFHLTVLPE-DRCFVFQISAR  59

Query  1831  RGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS-------GGF  1673
             R    R +WR W D+KS  Y +S   P S+KF  +++  VL +D+ E            F
Sbjct  60    RHSGGRGNWRLWTDLKSNPYDVSIKPPNSVKFNSSIDKSVLDDDEEEDELGDELPWWKQF  119

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRW+IV LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIAG
Sbjct  120   PKRWLIVSLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPQTVGLIQSSFFWGYLLTQIAG  179

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             GIWADTVGGKLVLGFGV+WWS+AT+LTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+L
Sbjct  180   GIWADTVGGKLVLGFGVIWWSVATVLTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMNNIL  239

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH++GWPSVF+SFGSLG VWF VWL+
Sbjct  240   SKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQYGWPSVFFSFGSLGAVWFAVWLN  299

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFI  953
             KAHSSPLDDP+L P+EKKLI  +SVSKEPVKSIPW  ILSKPPVWALIVSHFCHNWGTFI
Sbjct  300   KAHSSPLDDPQLRPQEKKLIFASSVSKEPVKSIPWGTILSKPPVWALIVSHFCHNWGTFI  359

Query  952   LLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQ  773
             LLTWMPTYYHQVLKFNLTESG+  VLPWLTMAFSA  GGWIAD+LV +G+SVT VRKIMQ
Sbjct  360   LLTWMPTYYHQVLKFNLTESGLLCVLPWLTMAFSANLGGWIADTLVSRGLSVTTVRKIMQ  419

Query  772   TIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLS  593
             +IGFLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLS
Sbjct  420   SIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLS  479

Query  592   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  480   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  532



>ref|XP_008220532.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
isoform X1 [Prunus mume]
Length=532

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/542 (75%), Positives = 446/542 (82%), Gaps = 33/542 (6%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSP-EATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRR  1814
             M ARAL+ S+ + P   H  P + + PKRS    S  HT F F       +      + R
Sbjct  1     MNARALIYSFSHKP---HIPPTDISAPKRSLCPDSRRHTPFRFRVQI---QNREHYWVLR  54

Query  1813  TSWR-----------AWADVKSKTYGISDSVPESLKFEDALND-----------DVLTED  1700
              S R            +ADVKS+ Y IS+SV    KFE  LND           + L   
Sbjct  55    VSGRDSGGGKRRGGKVFADVKSEAYDISESVD---KFEKGLNDVPSGKEEELEEEPLAVA  111

Query  1699  DGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFW  1520
             +   +   FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFW
Sbjct  112   EASWLEQ-FPKRWVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPGTVGLIQSSFFW  170

Query  1519  GYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGV  1340
             GYLLTQIAGGIWADTVGGK VL FGV+WWSIATILTP+AAK+GLPFL +VRAFMGIGEGV
Sbjct  171   GYLLTQIAGGIWADTVGGKQVLAFGVIWWSIATILTPVAAKVGLPFLLVVRAFMGIGEGV  230

Query  1339  AMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG  1160
             AMPAMNN+LSKW+PV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLG
Sbjct  231   AMPAMNNILSKWIPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLG  290

Query  1159  TVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSH  980
             TVWF VW+SKAHSSPL+DPEL P EKKLIL +SVSKEPVK IPWKLILSK PVWALIVSH
Sbjct  291   TVWFAVWISKAHSSPLEDPELRPAEKKLILASSVSKEPVKEIPWKLILSKAPVWALIVSH  350

Query  979   FCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVS  800
             FCHNWGTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG S
Sbjct  351   FCHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGFS  410

Query  799   VTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPR  620
             VT VRKIMQTIGFLGPAFFLTQLSH++SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPR
Sbjct  411   VTRVRKIMQTIGFLGPAFFLTQLSHINSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPR  470

Query  619   YSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
             YSGVL+GLSNTAGVLAGVFGTA+TGYILQHGSWDDVFKVSVGLYL GTVVWNLFSTGEKI
Sbjct  471   YSGVLLGLSNTAGVLAGVFGTASTGYILQHGSWDDVFKVSVGLYLFGTVVWNLFSTGEKI  530

Query  439   LD  434
             ++
Sbjct  531   IE  532



>ref|XP_006425040.1| hypothetical protein CICLE_v10028231mg [Citrus clementina]
 ref|XP_006488494.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR38280.1| hypothetical protein CICLE_v10028231mg [Citrus clementina]
 gb|KDO66833.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis]
Length=512

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/533 (76%), Positives = 447/533 (84%), Gaps = 35/533 (7%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLI---  1820
             M+ARAL  S     P L   P  +   R+  SR+            L  RG  R L+   
Sbjct  1     MSARALFYS-----PILQSPPYIS--ARNKLSRAE-----------LRPRGLPRLLLGVL  42

Query  1819  ---RRTSWR-AWADVKSKTYGISDSVPESLKFEDALNDDVL-TED---DGETIS---GGF  1673
                R  S+R +  DVKS++Y +S+   +S+KFE+AL D  L +ED   D E++      F
Sbjct  43    SGDRVCSFRVSVRDVKSESYNVSE---KSVKFEEALKDIALRSEDLGVDSESLVPWWEEF  99

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRW IV+LCFSAFLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAG
Sbjct  100   PKRWFIVVLCFSAFLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAG  159

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             GIWADTVGGK VLGFGVVWWSIAT LTP+AAKLGLPFL +VR FMGIGEGVAMPAMNN+L
Sbjct  160   GIWADTVGGKAVLGFGVVWWSIATALTPVAAKLGLPFLLVVRVFMGIGEGVAMPAMNNIL  219

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWFTVWLS
Sbjct  220   SKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHRFGWPSVFYSFGSLGTVWFTVWLS  279

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFI  953
             KAHSSP +DP+L P EKKLI+ +  SKEPVK+IPW LILSKPPVWALIVSHFCHNWGTFI
Sbjct  280   KAHSSPAEDPQLRPAEKKLIVSSCASKEPVKTIPWGLILSKPPVWALIVSHFCHNWGTFI  339

Query  952   LLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQ  773
             LLTWMPTYY+QVL FNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ
Sbjct  340   LLTWMPTYYNQVLHFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQ  399

Query  772   TIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLS  593
             +IGFLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLS
Sbjct  400   SIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLS  459

Query  592   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGT VWNLFSTGEK++D
Sbjct  460   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTAVWNLFSTGEKVVD  512



>ref|XP_008358972.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
[Malus domestica]
Length=521

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/533 (74%), Positives = 438/533 (82%), Gaps = 26/533 (5%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLH-CSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRR  1814
             M  RALL   Y+  PK +   P+ +  KRSF + +  H          P   F   +  R
Sbjct  1     MNPRALL---YSFSPKPNIVPPDISATKRSFGADNPRHQ---------PPFRFLERIRNR  48

Query  1813  TSWRAWADVKSKTYG------ISDSVPESLKFEDALNDDVLTEDDGETISGG-------F  1673
               +  +  V S   G      +   V    KFE  L+  V  ++D E  S         F
Sbjct  49    EQYCCFVRVSSGGGGKRRSGKVFADVKSVDKFEKGLDKVVSGKEDLEVESAAEVSWLQEF  108

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIAG
Sbjct  109   PKRWVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPATVGLIQSSFFWGYLLTQIAG  168

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             GIWADTVGGK VL FGV+WWSIATILTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+L
Sbjct  169   GIWADTVGGKQVLAFGVIWWSIATILTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMNNIL  228

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKW+PV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF +W+S
Sbjct  229   SKWIPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFALWIS  288

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFI  953
             KAHSSPL+DPEL P EKKLIL +S+SKEPVK IPWKLILSK PVWALIVSHFCHNWGTFI
Sbjct  289   KAHSSPLEDPELRPAEKKLILASSISKEPVKQIPWKLILSKAPVWALIVSHFCHNWGTFI  348

Query  952   LLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQ  773
             LLTWMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG SVT VRKIMQ
Sbjct  349   LLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGYSVTRVRKIMQ  408

Query  772   TIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLS  593
             TIGFLGPAFFLTQLSH++SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+G+S
Sbjct  409   TIGFLGPAFFLTQLSHINSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGMS  468

Query  592   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             NTAGVLAGVFGTA+TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI+D
Sbjct  469   NTAGVLAGVFGTASTGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIID  521



>ref|XP_010033022.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW52553.1| hypothetical protein EUGRSUZ_J01933 [Eucalyptus grandis]
Length=511

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/529 (76%), Positives = 441/529 (83%), Gaps = 28/529 (5%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKL-----HCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRG  1826
             M ARA L SY   P  L       SP  T P++SF+S +  H            R   RG
Sbjct  1     MNARAFLCSYTPHPDSLLKQRTSLSPPPT-PRKSFASAARFHCQV---------RLISRG  50

Query  1825  LIRRTSWRAWAD---VKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRW  1661
               RR ++R  A    +KS+ Y ISD V E  KF+         ED G  +     FPKRW
Sbjct  51    --RRYTFRVSARNPGLKSEQYEISD-VREPAKFKTGE-----VEDGGVVVPWWEKFPKRW  102

Query  1660  VIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWA  1481
             VIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+PTTVGLIQSSFFWGYLLTQIAGGIWA
Sbjct  103   VIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPTTVGLIQSSFFWGYLLTQIAGGIWA  162

Query  1480  DTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWV  1301
             DTVGGKLVLGFGV+WWSIAT LTP+AAKLGLP+L +VRAFMGIGEGVAMPAMNN+LSKWV
Sbjct  163   DTVGGKLVLGFGVIWWSIATALTPVAAKLGLPYLLVVRAFMGIGEGVAMPAMNNILSKWV  222

Query  1300  PVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHS  1121
             PVSERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  WL+KA+S
Sbjct  223   PVSERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFATWLNKAYS  282

Query  1120  SplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTW  941
             SPLDDP+L PEEK+LIL NSV +EPV +IPW L+LS+PPVWALIV HFCHNWGTFILLTW
Sbjct  283   SPLDDPQLRPEEKRLILTNSVPREPVTTIPWGLLLSQPPVWALIVCHFCHNWGTFILLTW  342

Query  940   MPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGF  761
             MPTYY+QVLKFNLTESG+  VLPWLTMAFSA  GGWIAD+LV  G+SVT VRKIMQ+IGF
Sbjct  343   MPTYYNQVLKFNLTESGLICVLPWLTMAFSANLGGWIADTLVSNGLSVTTVRKIMQSIGF  402

Query  760   LGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAG  581
             LGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQD+APRYSGVL+GLSNTAG
Sbjct  403   LGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDLAPRYSGVLLGLSNTAG  462

Query  580   VLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             VLAGVFGTAATGYILQHGSWDDVFKVSVGLYL GTVVWNLFS+GEKILD
Sbjct  463   VLAGVFGTAATGYILQHGSWDDVFKVSVGLYLTGTVVWNLFSSGEKILD  511



>ref|XP_009374345.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=468

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/473 (81%), Positives = 419/473 (89%), Gaps = 12/473 (3%)
 Frame = -2

Query  1837  FRRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDV---LTEDDGETIS--GGF  1673
              R G++ R        V  ++ G  +  P     ED +++     L ED    +S    F
Sbjct  3     LRNGVVDRL-------VLIESLGFREDFPAGGAGEDIVSERETLDLEEDLEAEVSWLQEF  55

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIAG
Sbjct  56    PKRWVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPATVGLIQSSFFWGYLLTQIAG  115

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             GIWADTVGGK VL FGV+WWSIATILTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+L
Sbjct  116   GIWADTVGGKQVLAFGVIWWSIATILTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMNNIL  175

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKW+PV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF+VWLS
Sbjct  176   SKWIPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFSVWLS  235

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFI  953
             KAHSSPL+DPEL P EKKLIL +S+SKEPVK+IPWKLILSK PVWALIVSHFCHNWGTFI
Sbjct  236   KAHSSPLEDPELRPVEKKLILASSISKEPVKAIPWKLILSKAPVWALIVSHFCHNWGTFI  295

Query  952   LLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQ  773
             LLTWMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG SVT VRKIMQ
Sbjct  296   LLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGFSVTRVRKIMQ  355

Query  772   TIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLS  593
             TIGFLGPAFFLTQLSH++SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLS
Sbjct  356   TIGFLGPAFFLTQLSHINSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLS  415

Query  592   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             NTAGVLAGVFGTA+TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEK++D
Sbjct  416   NTAGVLAGVFGTASTGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKVID  468



>ref|XP_003637121.1| Sodium-dependent phosphate transport protein [Medicago truncatula]
 gb|KEH34211.1| sodium-dependent phosphate transporter, putative [Medicago truncatula]
Length=516

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/501 (78%), Positives = 433/501 (86%), Gaps = 24/501 (5%)
 Frame = -2

Query  1894  RSHTHTLFEFGSPFLPGRGFRRGLI--RRTSWRAWADVKSKTYGISDSVPE-SLKFED-A  1727
             +S T TLF   SP+     F   L+  RR   + WADVKS+ +G     PE S K++D A
Sbjct  26    QSRTRTLFNH-SPY----PFPLHLLCHRRGRGKVWADVKSEKHG-----PEASSKYQDLA  75

Query  1726  LNDDVLTEDDGETISGG----------FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMA  1577
             ++  V++  DG  +             FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM+
Sbjct  76    VHKKVVSGLDGVDVEEEVTESSSWWEVFPKRWVIVILCFSAFLLCNMDRVNMSIAILPMS  135

Query  1576  SEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAK  1397
             +EY+W+PTTVGL+QSSFFWGYLLTQIAGGIWADTVGGK VL FGV+WWS+ATILTP+AAK
Sbjct  136   AEYNWNPTTVGLVQSSFFWGYLLTQIAGGIWADTVGGKQVLAFGVIWWSVATILTPVAAK  195

Query  1396  LGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSP  1217
             LGLPFL + RAFMGIGEGVAMPAMNN+LSKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP
Sbjct  196   LGLPFLLVARAFMGIGEGVAMPAMNNILSKWVPVAERSRSLALVYSGMYLGSVTGLAFSP  255

Query  1216  MLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKS  1037
              LIH++GWPSVFYSFGSLGTVWF +WLSKAHSSPLDDPE+ PEEKKLI  N  SKEPVK 
Sbjct  256   FLIHQYGWPSVFYSFGSLGTVWFCIWLSKAHSSPLDDPEMRPEEKKLIATNGFSKEPVKE  315

Query  1036  IPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMA  857
             IPW LILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMA
Sbjct  316   IPWGLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMA  375

Query  856   FSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQG  677
              SA  GGWIAD+LV +GVSVT VRKIMQT+GFLGPAFFLTQLSH+DSP +AVLCMTCSQG
Sbjct  376   ISANFGGWIADTLVTRGVSVTRVRKIMQTVGFLGPAFFLTQLSHIDSPVVAVLCMTCSQG  435

Query  676   SDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSV  497
             +DAFSQSGLYSNHQDIAPRYSG+L+GLSNTAGVLAGV GTAATGYILQHGSWDDVFKVSV
Sbjct  436   TDAFSQSGLYSNHQDIAPRYSGILLGLSNTAGVLAGVLGTAATGYILQHGSWDDVFKVSV  495

Query  496   GLYLVGTVVWNLFSTGEKILD  434
             GLYLVGTVVWNLFSTGEKI+D
Sbjct  496   GLYLVGTVVWNLFSTGEKIID  516



>ref|XP_007016153.1| Sodium-dependent phosphate transport protein 1 isoform 1 [Theobroma 
cacao]
 gb|EOY33772.1| Sodium-dependent phosphate transport protein 1 isoform 1 [Theobroma 
cacao]
Length=519

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/530 (74%), Positives = 447/530 (84%), Gaps = 22/530 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRT  1811
             M++ ALL S     P    SP      R+  +R+ +       SP   G  F R L+  +
Sbjct  1     MSSGALLFS-----PNFPKSPPDIISTRNKPNRARSLFRVWVNSPH--GSLFFRVLVSDS  53

Query  1810  SW--------RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKR  1664
             S         + +ADV+     I +S+ E +K  + LND VL E+D ++       FPKR
Sbjct  54    SSDRRRRRSGKVFADVRE----IPESIREPVKLGERLNDVVLNEEDFDSSVPWWEQFPKR  109

Query  1663  WVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIW  1484
             WVIV+LCFSAFLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGGIW
Sbjct  110   WVIVILCFSAFLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIW  169

Query  1483  ADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKW  1304
             ADTVGGK VLGFGV+WWSIAT LTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+LS+W
Sbjct  170   ADTVGGKSVLGFGVIWWSIATALTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMNNILSRW  229

Query  1303  VPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAH  1124
             VPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF +WL+KAH
Sbjct  230   VPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFGIWLNKAH  289

Query  1123  SSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT  944
             SSPL+DP+L P+EKKLI+ N+++ +PVK+IPW+LILSKPPV ALIVSHFCHNWGTFILLT
Sbjct  290   SSPLEDPQLRPQEKKLIVTNNITNKPVKTIPWRLILSKPPVLALIVSHFCHNWGTFILLT  349

Query  943   WMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIG  764
             WMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ+IG
Sbjct  350   WMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIG  409

Query  763   FLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTA  584
             FLGPAFFLTQLSHV+SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTA
Sbjct  410   FLGPAFFLTQLSHVNSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTA  469

Query  583   GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  470   GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  519



>gb|AFK38547.1| unknown [Medicago truncatula]
Length=516

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/501 (78%), Positives = 432/501 (86%), Gaps = 24/501 (5%)
 Frame = -2

Query  1894  RSHTHTLFEFGSPFLPGRGFRRGLI--RRTSWRAWADVKSKTYGISDSVPE-SLKFED-A  1727
             +S T TLF   SP+     F   L+  RR   + WADVKS+ +G     PE S K++D A
Sbjct  26    QSRTRTLFNH-SPY----PFPLHLLCHRRGRGKVWADVKSEKHG-----PEASSKYQDLA  75

Query  1726  LNDDVLTEDDGETISGG----------FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMA  1577
             ++  V++  D   +             FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM+
Sbjct  76    VHKKVVSGLDSVDVEEEVTESSSWWEVFPKRWVIVILCFSAFLLCNMDRVNMSIAILPMS  135

Query  1576  SEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAK  1397
             +EY+W+PTTVGL+QSSFFWGYLLTQIAGGIW+DTVGGK VL FGV+WWS+ATILTP+AAK
Sbjct  136   AEYNWNPTTVGLVQSSFFWGYLLTQIAGGIWSDTVGGKQVLAFGVIWWSVATILTPVAAK  195

Query  1396  LGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSP  1217
             LGLPFL + RAFMGIGEGVAMPAMNN+LSKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP
Sbjct  196   LGLPFLLVARAFMGIGEGVAMPAMNNILSKWVPVAERSRSLALVYSGMYLGSVTGLAFSP  255

Query  1216  MLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKS  1037
              LIH++GWPSVFYSFGSLGTVWF +WLSKAHSSPLDDPE+ PEEKKLI  N  SKEPVK 
Sbjct  256   FLIHQYGWPSVFYSFGSLGTVWFCIWLSKAHSSPLDDPEMRPEEKKLIATNGFSKEPVKE  315

Query  1036  IPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMA  857
             IPW LILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMA
Sbjct  316   IPWGLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMA  375

Query  856   FSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQG  677
              SA  GGWIAD+LV +GVSVT VRKIMQT+GFLGPAFFLTQLSH+DSP +AVLCMTCSQG
Sbjct  376   ISANFGGWIADTLVTRGVSVTRVRKIMQTVGFLGPAFFLTQLSHIDSPVVAVLCMTCSQG  435

Query  676   SDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSV  497
             +DAFSQSGLYSNHQDIAPRYSG+L+GLSNTAGVLAGV GTAATGYILQHGSWDDVFKVSV
Sbjct  436   TDAFSQSGLYSNHQDIAPRYSGILLGLSNTAGVLAGVLGTAATGYILQHGSWDDVFKVSV  495

Query  496   GLYLVGTVVWNLFSTGEKILD  434
             GLYLVGTVVWNLFSTGEKI+D
Sbjct  496   GLYLVGTVVWNLFSTGEKIID  516



>ref|XP_004294239.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=507

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/526 (75%), Positives = 437/526 (83%), Gaps = 26/526 (5%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSP---FLPGRGFRRGLI  1820
             M ARAL+   Y+  PK +  P+ + PKRS  S       F   SP   FL  RG    ++
Sbjct  1     MNARALV---YSFSPKPNFPPDISGPKRSLGSG------FRPVSPVHQFLVNRGQYCCVV  51

Query  1819  R----RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIV  1652
             R    R   + +ADVKS+ Y +S    E L   +++ D+V   +        FPKRWVIV
Sbjct  52    RVSGERRGGKVFADVKSEAYELSKKAKEEL---ESVADEVSWLEQ-------FPKRWVIV  101

Query  1651  LLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTv  1472
             +LCF+AFLLCNMDRVNMSIAILPM++EYHW+ +TVGLIQSSFFWGYLLTQIAGGI ADT+
Sbjct  102   ILCFTAFLLCNMDRVNMSIAILPMSAEYHWNSSTVGLIQSSFFWGYLLTQIAGGILADTI  161

Query  1471  ggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVS  1292
             GGK VL FGV+WWS+AT LTPIAA LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVS
Sbjct  162   GGKQVLAFGVIWWSVATALTPIAATLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWIPVS  221

Query  1291  ERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpl  1112
             ERSR+LA+VYSGMY+GSVTG AFSP LIH+FGWPSVFYSFGSLGTVWF VWLSKA+SSP 
Sbjct  222   ERSRALALVYSGMYIGSVTGFAFSPFLIHQFGWPSVFYSFGSLGTVWFAVWLSKAYSSPA  281

Query  1111  ddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPT  932
             +DPEL PEEKKLIL  +VSKE VK IPW  ILSK PVWALIVSHFCHNWGTFILLTWMPT
Sbjct  282   EDPELRPEEKKLILAGNVSKERVKVIPWGQILSKAPVWALIVSHFCHNWGTFILLTWMPT  341

Query  931   YYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGP  752
             YY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV +GVSVT VRKIMQTIGFLGP
Sbjct  342   YYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSRGVSVTRVRKIMQTIGFLGP  401

Query  751   AFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLA  572
             AFFLTQLSHV+SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLA
Sbjct  402   AFFLTQLSHVNSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLA  461

Query  571   GVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GV GT +TGYILQHGSWDDVFKVSVGLYLVGTVVWN+FSTGEKI+D
Sbjct  462   GVLGTVSTGYILQHGSWDDVFKVSVGLYLVGTVVWNVFSTGEKIID  507



>ref|XP_004500238.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=515

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/477 (81%), Positives = 426/477 (89%), Gaps = 20/477 (4%)
 Frame = -2

Query  1819  RRTSWRAWADVKSKTYGISDSVPE-SLKFED-ALNDDV----LTEDDG---ETISGG---  1676
             RR   + WADVKS+ +     VPE S K++D +L++ V    L  DD    E I G    
Sbjct  44    RRGRGKVWADVKSEKH-----VPEPSTKYQDLSLHNKVARAGLDGDDDVEEEAIIGSSPW  98

Query  1675  ---FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLT  1505
                FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+PTTVGL+QSSFFWGYLLT
Sbjct  99    WQVFPKRWVIVILCFSAFLLCNMDRVNMSIAILPMSAEYNWNPTTVGLVQSSFFWGYLLT  158

Query  1504  QIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAM  1325
             QIAGGIWADTVGGK VLGFGV+WWS+ATILTP+AAKLGLPFL + RAFMGIGEGVAMPAM
Sbjct  159   QIAGGIWADTVGGKQVLGFGVIWWSVATILTPVAAKLGLPFLLVARAFMGIGEGVAMPAM  218

Query  1324  NNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFT  1145
             NN+LSKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH++GWPSVFYSFGSLGTVWF+
Sbjct  219   NNILSKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQYGWPSVFYSFGSLGTVWFS  278

Query  1144  VWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNW  965
             +WLSKAHSSPLDDPEL PEEKKLI  N  SKEPVK+IPWKLILSKPPVWALIVSHFCHNW
Sbjct  279   IWLSKAHSSPLDDPELRPEEKKLIATNGFSKEPVKAIPWKLILSKPPVWALIVSHFCHNW  338

Query  964   GTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVR  785
             GTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMA SA  GGWIAD+LV +GV VT VR
Sbjct  339   GTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAISANFGGWIADTLVTRGVPVTRVR  398

Query  784   KIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVL  605
             KIMQT+GFLGPAFFLTQLSH++SP MAVLCMTCSQG+DAFSQSGLYSNHQDIAPRYSG+L
Sbjct  399   KIMQTVGFLGPAFFLTQLSHINSPVMAVLCMTCSQGTDAFSQSGLYSNHQDIAPRYSGIL  458

Query  604   MGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             +GLSNTAGVLAGV GTAATGYILQHGSWDDVFKVSVGLYLVGTVV+NLF+TGEKI+D
Sbjct  459   LGLSNTAGVLAGVLGTAATGYILQHGSWDDVFKVSVGLYLVGTVVFNLFATGEKIVD  515



>ref|XP_006848140.1| hypothetical protein AMTR_s00029p00225980 [Amborella trichopoda]
 gb|ERN09721.1| hypothetical protein AMTR_s00029p00225980 [Amborella trichopoda]
Length=578

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/457 (82%), Positives = 415/457 (91%), Gaps = 3/457 (1%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLL  1625
             AD+KSK Y I +S  +S+KF   L++ VL+E+D +  S     FPKRWVIVLLC SAFLL
Sbjct  122   ADLKSKPYDIIESKSDSVKFFKVLSEVVLSEEDTQDKSPWWEQFPKRWVIVLLCSSAFLL  181

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM++E++WSP+TVGLIQSSFFWGYLLTQIAGGIWADTVGGKLVLGFG
Sbjct  182   CNMDRVNMSIAILPMSAEFNWSPSTVGLIQSSFFWGYLLTQIAGGIWADTVGGKLVLGFG  241

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWSIAT+LTP+AAKLGLPFL ++RAFMGIGEGVAMPAMNN+LSKW+PV ERSRSLA+V
Sbjct  242   VVWWSIATVLTPVAAKLGLPFLLVMRAFMGIGEGVAMPAMNNILSKWIPVKERSRSLALV  301

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLAFSP+LI KFGWPSVFYSFGSLGTVW  +WL+KA+SSP +DP+L  +E
Sbjct  302   YSGMYLGSVTGLAFSPLLIQKFGWPSVFYSFGSLGTVWVAIWLNKAYSSPQEDPQLCEDE  361

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KKLI+ +SVSK+   +IPW+LILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  362   KKLIVGDSVSKQLTTTIPWRLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  421

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+  VLPWLTMA SA  GGWIADSLV KG S+T VRKIMQ+IGFLGPAFFLTQLSH
Sbjct  422   LTESGLLCVLPWLTMAVSANIGGWIADSLVSKGFSITTVRKIMQSIGFLGPAFFLTQLSH  481

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             V SPAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  482   VHSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  541

Query  544   YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             YILQHGSWDDVFKV+VGLYL GTVVWNLFSTGEKILD
Sbjct  542   YILQHGSWDDVFKVAVGLYLGGTVVWNLFSTGEKILD  578



>ref|XP_003538283.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X1 [Glycine max]
Length=511

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/476 (80%), Positives = 416/476 (87%), Gaps = 17/476 (4%)
 Frame = -2

Query  1834  RRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGG-------  1676
             RR  +     R W +VKS+      ++ ES K+ED   D V+ +     +          
Sbjct  44    RRSHLVAGGRRVWVNVKSE-----KNLSESPKYED---DVVVQKKKKRGLDNVEEEARWW  95

Query  1675  --FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQ  1502
               FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P+TVGLIQSSFFWGYLLTQ
Sbjct  96    QVFPKRWVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPSTVGLIQSSFFWGYLLTQ  155

Query  1501  IAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMN  1322
             IAGGIWADTVGGK VLGFGVVWWS+AT LTPIAAKLGLPFL + RAFMGIGEGVAMPAMN
Sbjct  156   IAGGIWADTVGGKQVLGFGVVWWSVATALTPIAAKLGLPFLLVARAFMGIGEGVAMPAMN  215

Query  1321  NLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTV  1142
             N+LSKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW +V
Sbjct  216   NILSKWVPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWCSV  275

Query  1141  WLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWG  962
             WLSKAHSSPL+DPEL PEEKKLI  N  SKEPVK+IPW+LILSKPPVWALIVSHFCHNWG
Sbjct  276   WLSKAHSSPLEDPELRPEEKKLITANCSSKEPVKTIPWRLILSKPPVWALIVSHFCHNWG  335

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             TFILLTWMPTYY+QVLKFNLTESG+F VLPW  MA SA  GGWIAD+LV KG+SVT VRK
Sbjct  336   TFILLTWMPTYYNQVLKFNLTESGLFCVLPWFIMAISANVGGWIADTLVSKGLSVTRVRK  395

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQTIGFLGPAFFLTQLSH +SP MAVLCMTCSQG+DAFSQSGLYSNHQDIAPRYSG+L+
Sbjct  396   IMQTIGFLGPAFFLTQLSHANSPVMAVLCMTCSQGTDAFSQSGLYSNHQDIAPRYSGILL  455

Query  601   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVV+NLFSTGEKIL+
Sbjct  456   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVFNLFSTGEKILE  511



>ref|XP_010923099.1| PREDICTED: probable anion transporter 1, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=533

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/468 (80%), Positives = 416/468 (89%), Gaps = 17/468 (4%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDV--------LTEDDGETIS------GGFPKRWV  1658
             AD++S+   +SDS PES+ F + L++ V          E+DG   +        FPKRWV
Sbjct  69    ADLQSE---VSDSSPESINFRETLSEAVSPPREEEEEEEEDGWVAAVSSLGLDKFPKRWV  125

Query  1657  IVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWAD  1478
             IV+LCFSAFLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGG+WAD
Sbjct  126   IVILCFSAFLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGVWAD  185

Query  1477  TvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVP  1298
             TVGGK VLGFGVVWWSIAT LTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+LSKWVP
Sbjct  186   TVGGKTVLGFGVVWWSIATALTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMNNILSKWVP  245

Query  1297  VSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSS  1118
             V+ERSRSLA+VYSGMYLGSVTGLAFSP+LIH FGWPSVFYSFGSLGTVWF +W SKA+SS
Sbjct  246   VAERSRSLALVYSGMYLGSVTGLAFSPLLIHNFGWPSVFYSFGSLGTVWFAIWSSKAYSS  305

Query  1117  plddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWM  938
             PL+DP L  EEKKLI   SV+ EPV++IPW+LILSKPPVWALIVSHFCHNWGTFILLTWM
Sbjct  306   PLEDPGLRAEEKKLIESKSVANEPVRTIPWRLILSKPPVWALIVSHFCHNWGTFILLTWM  365

Query  937   PTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFL  758
             PTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT+VRKIMQ+IGFL
Sbjct  366   PTYYNQVLKFNLTESGLFCVLPWLTMAFSANIGGWIADTLVSKGLSVTMVRKIMQSIGFL  425

Query  757   GPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGV  578
             GPAFFLTQLSH+ SPAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL+GLSNTAGV
Sbjct  426   GPAFFLTQLSHIHSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGV  485

Query  577   LAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             LAGVFGTAATGYILQHGSWDDVFKVSV LYL GTVVWNLFSTGEKILD
Sbjct  486   LAGVFGTAATGYILQHGSWDDVFKVSVALYLAGTVVWNLFSTGEKILD  533



>ref|XP_009144358.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
[Brassica rapa]
 emb|CDY45462.1| BnaA05g12390D [Brassica napus]
Length=512

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/522 (73%), Positives = 424/522 (81%), Gaps = 13/522 (2%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRT  1811
             M ARALL S    P      P  T P+   + +    +L          R +     R +
Sbjct  1     MNARALLYSPNLHPLYTSNRPPETSPRNRRTLKPDPKSL----------RIWIHQRNRSS  50

Query  1810  SWRAWADVKSKTYGISDSVPESLKF-EDALNDDVLTEDDGETIS--GGFPKRWVIVLLCF  1640
              +R       K    + S  E++K   + +N + +  D   ++     FPKRWVIVLLCF
Sbjct  51    VFRVLVRSSDKRESSNSSYAETIKEGREIVNGNGVVSDSLSSVPWWEEFPKRWVIVLLCF  110

Query  1639  SAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggkl  1460
             SAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK+
Sbjct  111   SAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKM  170

Query  1459  vlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSR  1280
             VLGFGVVWWSIATILTPIAAKLGLPFL +VRAFMG+GEGVAMPAMNN+LSKWVPV ERSR
Sbjct  171   VLGFGVVWWSIATILTPIAAKLGLPFLLVVRAFMGVGEGVAMPAMNNILSKWVPVQERSR  230

Query  1279  SLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpe  1100
             SLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW T+WL+KA SSP++D  
Sbjct  231   SLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLTLWLTKAESSPIEDLS  290

Query  1099  llpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQ  920
             LLPEE+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPTYYHQ
Sbjct  291   LLPEERKLIADNCASKEPVKSIPWRLILSKPPVWALIGCHFCHNWGTFILLTWMPTYYHQ  350

Query  919   VLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFL  740
             VLKFNL ESG+ +V PWLTMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGPAFFL
Sbjct  351   VLKFNLMESGLLSVFPWLTMAISANAGGWIADTLVSRGFSVTNVRKIMQTIGFLGPAFFL  410

Query  739   TQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFG  560
             TQL H+DSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGV G
Sbjct  411   TQLKHIDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVLG  470

Query  559   TAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  471   TAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  512



>gb|KFK24153.1| hypothetical protein AALP_AAs50253U001100 [Arabis alpina]
Length=507

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/524 (73%), Positives = 426/524 (81%), Gaps = 22/524 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHC-----SPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRG  1826
             M ARALL S     P LH       P  T  +   + +S  ++L  +  P      FR  
Sbjct  1     MNARALLYS-----PNLHSLYTSNRPPETSSRNRRNLKSAPNSLRVWIYPRNRSSVFRV-  54

Query  1825  LIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLL  1646
             L+R +  R  ++  ++ YG      E L+  +   +DV      +     FPKRWVIVLL
Sbjct  55    LVRSSDKRESSNPYAEVYG------EGLEKVNGNGNDVSVPWWEQ-----FPKRWVIVLL  103

Query  1645  CFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvgg  1466
             CFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGG
Sbjct  104   CFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGG  163

Query  1465  klvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSER  1286
             K VLGFGV+WWS+ATILTPIAAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKWVPV ER
Sbjct  164   KTVLGFGVIWWSVATILTPIAAKLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWVPVQER  223

Query  1285  SRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpldd  1106
             SRSLA+VYSGMYLGSV GLAFSP LIH+FGWPSVFYSFGSLGTVW T+WL+KA SSP++D
Sbjct  224   SRSLALVYSGMYLGSVIGLAFSPFLIHQFGWPSVFYSFGSLGTVWVTLWLTKAESSPIED  283

Query  1105  pellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYY  926
               LLPEE+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPTYY
Sbjct  284   LTLLPEERKLIADNCASKEPVKSIPWRLILSKPPVWALITCHFCHNWGTFILLTWMPTYY  343

Query  925   HQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAF  746
             HQVLKFNL ESG+ +V PW+TMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGPAF
Sbjct  344   HQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGYSVTTVRKIMQTIGFLGPAF  403

Query  745   FLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGV  566
             FLTQL H+DSPAMAVLCM CSQG DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGV
Sbjct  404   FLTQLKHIDSPAMAVLCMACSQGMDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGV  463

Query  565   FGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
              GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  464   LGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  507



>ref|XP_010557216.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=509

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/414 (88%), Positives = 390/414 (94%), Gaps = 0/414 (0%)
 Frame = -2

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM++E+ W+P TVGLIQSSFFWGYLLTQIA
Sbjct  96    FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEFGWNPATVGLIQSSFFWGYLLTQIA  155

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GGIWADTVGGK VLGFGV+WWS+AT+LTPIAAKLGLPFL +VRAFMGIGEGVAMPAMNN+
Sbjct  156   GGIWADTVGGKTVLGFGVIWWSVATVLTPIAAKLGLPFLLVVRAFMGIGEGVAMPAMNNI  215

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             LSKWVPV ERSRSLA+VYSGMYLGSVTGLAFSP LIH FGWPSVFYSFGSLGTVW T+WL
Sbjct  216   LSKWVPVQERSRSLALVYSGMYLGSVTGLAFSPFLIHHFGWPSVFYSFGSLGTVWLTLWL  275

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
             +KA SSP++D ELLPEE+KLI  NSV KEPVK+IPW+LILSKPPVWALI SHFCHNWGTF
Sbjct  276   NKAESSPIEDTELLPEERKLIADNSVCKEPVKTIPWRLILSKPPVWALIGSHFCHNWGTF  335

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             I+LTWMPTYYHQVLKFNL ESG+ +VLPWLTMA SA AGGWIAD+LV KG+SVT VRK+M
Sbjct  336   IILTWMPTYYHQVLKFNLMESGLLSVLPWLTMAVSANAGGWIADTLVSKGLSVTTVRKVM  395

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             QTIGFLGPAFFLTQL HVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GL
Sbjct  396   QTIGFLGPAFFLTQLKHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGL  455

Query  595   SNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SNTAGVLAGV GTAATG+ILQHGSWDDVF VSVGLYLVGTVVWNLFSTGEKI+D
Sbjct  456   SNTAGVLAGVLGTAATGHILQHGSWDDVFSVSVGLYLVGTVVWNLFSTGEKIID  509



>ref|XP_009380609.1| PREDICTED: probable anion transporter 1, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=543

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/469 (78%), Positives = 416/469 (89%), Gaps = 16/469 (3%)
 Frame = -2

Query  1792  DVKSKTYGISDSVPESLKFEDALNDDVLTE-----------DDG--ETISGG---FPKRW  1661
             D+K + + + DSVP+S+ F   +  ++++             DG    +  G   FPKRW
Sbjct  75    DLKPEAFDVPDSVPDSIGFPKVVRRELVSPALRPREEEEEEGDGWLGAVGAGLETFPKRW  134

Query  1660  VIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWA  1481
             VIV+LCFSAFLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGGIWA
Sbjct  135   VIVILCFSAFLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIWA  194

Query  1480  DTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWV  1301
             D VGGKLVLGFGVVWWSIAT LTPIAAK GLPFL +VRAFMGIGEGVAMPAMNN+LS+W+
Sbjct  195   DMVGGKLVLGFGVVWWSIATALTPIAAKAGLPFLLVVRAFMGIGEGVAMPAMNNILSRWI  254

Query  1300  PVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHS  1121
             PV+ERSRSLA+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG+VW TVWLSKA+S
Sbjct  255   PVAERSRSLALVYSGMYLGSVTGLAFSPLLIHKFGWPSVFYSFGSLGSVWLTVWLSKAYS  314

Query  1120  SplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTW  941
             SP +DPE+ P+EKKLI+ ++V KEPVK+IPW+LILSKPPVWALI SHFCHNWGTFILLTW
Sbjct  315   SPFEDPEISPDEKKLIVSDNVLKEPVKTIPWRLILSKPPVWALITSHFCHNWGTFILLTW  374

Query  940   MPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGF  761
             MPTYY+QVLKFNLT+SG+F +LPWLTMA SA  GGWIAD+LV KG+SVT+VRKIMQ+IGF
Sbjct  375   MPTYYNQVLKFNLTDSGLFCILPWLTMAVSANVGGWIADTLVSKGMSVTIVRKIMQSIGF  434

Query  760   LGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAG  581
             LGPAFFLTQLSHV SPAMA+LCM CSQG+DAFSQSGLYSNHQDI PRY+GVL+GLSNTAG
Sbjct  435   LGPAFFLTQLSHVHSPAMAILCMACSQGTDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAG  494

Query  580   VLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             VLAGVFGTAATGYILQHGSWDDVFKVSV LY+ GTVVWNLFSTGEKILD
Sbjct  495   VLAGVFGTAATGYILQHGSWDDVFKVSVTLYIAGTVVWNLFSTGEKILD  543



>ref|XP_010469920.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
isoform X1 [Camelina sativa]
Length=508

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/525 (73%), Positives = 421/525 (80%), Gaps = 23/525 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGR--GFRRGLIR  1817
             M ARALL S     P LH    +  P    S R+             P    G  R L+R
Sbjct  1     MNARALLCS-----PNLHSLYTSNRPPEKTSYRNIKPAPKSLRVWVYPRNRSGVFRVLVR  55

Query  1816  RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS----GGFPKRWVIVL  1649
              +  R      S +Y I +        E    ++V+++    +I       FPKRWVIVL
Sbjct  56    SSDKRE----SSNSYYIDE--------ERVSQNEVVSDSSTSSIVVPWWEEFPKRWVIVL  103

Query  1648  LCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvg  1469
             LCFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTVG
Sbjct  104   LCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVG  163

Query  1468  gklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSE  1289
             GK VLGF V+WWSIATILTP+AAKLGLP+L +VRAFMG+GEGVAMPAMNN+LSKWVPV E
Sbjct  164   GKRVLGFAVIWWSIATILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILSKWVPVQE  223

Query  1288  RSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpld  1109
             RSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW  +WL+KA SSPL+
Sbjct  224   RSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLILWLTKAESSPLE  283

Query  1108  dpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTY  929
             DP LLP+E+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPTY
Sbjct  284   DPTLLPKERKLIADNCASKEPVKSIPWRLILSKPPVWALIGCHFCHNWGTFILLTWMPTY  343

Query  928   YHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPA  749
             YHQVLKFNL ESG+ +V PW+TMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGPA
Sbjct  344   YHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGFSVTNVRKIMQTIGFLGPA  403

Query  748   FFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAG  569
             FFLTQL H+DSP MAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAG
Sbjct  404   FFLTQLKHIDSPTMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAG  463

Query  568   VFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             V GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  464   VLGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  508



>ref|XP_008785404.1| PREDICTED: probable anion transporter 1, chloroplastic [Phoenix 
dactylifera]
Length=536

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/471 (79%), Positives = 413/471 (88%), Gaps = 20/471 (4%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDV----------LTEDDGETISGG-------FPK  1667
             ADV+S+   +SDS P+S+ F DA ++ V            E++G  ++         FPK
Sbjct  69    ADVQSE---VSDSSPKSISFRDAFSEVVSPPREEEEEEEEEEEGLWVAAASSLGLEKFPK  125

Query  1666  RWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGI  1487
             RWVIV+LCFSAFLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGGI
Sbjct  126   RWVIVILCFSAFLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGI  185

Query  1486  WADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSK  1307
             WADTVGGK VLGFGVVWWSIAT LTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+LSK
Sbjct  186   WADTVGGKRVLGFGVVWWSIATALTPVAAKVGLPFLLVVRAFMGIGEGVAMPAMNNILSK  245

Query  1306  WVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKA  1127
             WVPV+ERSRSLA+VYSGMYLGSVTGLAFSP+LIH FGWPSVFYSFGSLGTVW  +W SKA
Sbjct  246   WVPVAERSRSLALVYSGMYLGSVTGLAFSPLLIHNFGWPSVFYSFGSLGTVWLAIWSSKA  305

Query  1126  HSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILL  947
             +SSPL+DPEL  EEKKLI   +V  EPV +IPW+LILSKPPVWALIV+HFCHNWGTFILL
Sbjct  306   YSSPLEDPELSSEEKKLIESKNVPNEPVTTIPWRLILSKPPVWALIVTHFCHNWGTFILL  365

Query  946   TWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTI  767
             TWMPTYY+QVLKFNLTESG+  +LPWLTMAFSA  GGWIAD+LV KG SVT+VRKIMQ+I
Sbjct  366   TWMPTYYNQVLKFNLTESGLICILPWLTMAFSANIGGWIADTLVSKGFSVTMVRKIMQSI  425

Query  766   GFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNT  587
             GFLGPAFFLTQLSHV SPAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL+GLSNT
Sbjct  426   GFLGPAFFLTQLSHVHSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGVLLGLSNT  485

Query  586   AGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             AGVLAGVFGTAATGYILQHGSWDDVFKVSV LYL GTVVWNLFSTGEKILD
Sbjct  486   AGVLAGVFGTAATGYILQHGSWDDVFKVSVALYLAGTVVWNLFSTGEKILD  536



>ref|XP_010510439.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010510440.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=509

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/525 (73%), Positives = 423/525 (81%), Gaps = 22/525 (4%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGR--GFRRGLIR  1817
             M ARALL S     P LH    +  P    S R+             P    G  R L+R
Sbjct  1     MNARALLCS-----PNLHSLYTSNRPPEKTSYRNIKPAPKSLRVWVYPRNRSGVFRVLVR  55

Query  1816  RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS----GGFPKRWVIVL  1649
              +  R   +  S +Y + +        E    ++V+++    +I       FPKRWVIVL
Sbjct  56    SSDKR---ESSSNSYYLDE--------ERVSQNEVVSDSSTSSIIVPWWEEFPKRWVIVL  104

Query  1648  LCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvg  1469
             LCFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTVG
Sbjct  105   LCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVG  164

Query  1468  gklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSE  1289
             GK VLGFGV+WWSIATILTP+AAKLGLP+L +VRAFMG+GEGVAMPAMNN+LSKWVPV E
Sbjct  165   GKRVLGFGVIWWSIATILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILSKWVPVQE  224

Query  1288  RSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpld  1109
             RSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW  +WL+KA SSPL+
Sbjct  225   RSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLILWLTKAESSPLE  284

Query  1108  dpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTY  929
             DP LLP+E+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPTY
Sbjct  285   DPTLLPKERKLIADNCASKEPVKSIPWRLILSKPPVWALIGCHFCHNWGTFILLTWMPTY  344

Query  928   YHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPA  749
             YHQVLKFNL ESG+ +V PW+TMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGPA
Sbjct  345   YHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGFSVTNVRKIMQTIGFLGPA  404

Query  748   FFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAG  569
             FFLTQL H+DSP MAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAG
Sbjct  405   FFLTQLKHIDSPTMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAG  464

Query  568   VFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             V GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  465   VLGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  509



>ref|XP_010414365.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=509

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/526 (73%), Positives = 425/526 (81%), Gaps = 24/526 (5%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFP-KRSFSSRSHTHTLFEFGSPFLPGR--GFRRGLI  1820
             M ARALL S     P LH    +  P ++S SSR              P    G  R L+
Sbjct  1     MNARALLCS-----PNLHSLYTSNRPPEKSVSSRGLKPAPKSLRVWVYPRNRSGVFRVLV  55

Query  1819  RRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS----GGFPKRWVIV  1652
             R +  R      S +Y + +        E    ++V+++    +I       FPKRWVIV
Sbjct  56    RSSDKRE----SSNSYYLDE--------ERVSQNEVVSDSSTSSIVVPWWEEFPKRWVIV  103

Query  1651  LLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTv  1472
             LLCFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTV
Sbjct  104   LLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTV  163

Query  1471  ggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVS  1292
             GGK VLGFGV+WWSIATILTP+AAKLGLP+L +VRAFMG+GEGVAMPAMNN+LSKWVPV 
Sbjct  164   GGKRVLGFGVIWWSIATILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILSKWVPVQ  223

Query  1291  ERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpl  1112
             ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW  +WL+KA SSPL
Sbjct  224   ERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLILWLTKAESSPL  283

Query  1111  ddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPT  932
             +DP LLP+E+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPT
Sbjct  284   EDPTLLPKERKLIADNCASKEPVKSIPWRLILSKPPVWALIGCHFCHNWGTFILLTWMPT  343

Query  931   YYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGP  752
             YYHQVLKFNL ESG+ +V PW+TMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGP
Sbjct  344   YYHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGFSVTNVRKIMQTIGFLGP  403

Query  751   AFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLA  572
             AFFLTQL H+DSP MAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLA
Sbjct  404   AFFLTQLKHIDSPTMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLA  463

Query  571   GVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GV GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  464   GVLGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  509



>ref|XP_002881062.1| hypothetical protein ARALYDRAFT_481880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57321.1| hypothetical protein ARALYDRAFT_481880 [Arabidopsis lyrata subsp. 
lyrata]
Length=512

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/414 (87%), Positives = 387/414 (93%), Gaps = 0/414 (0%)
 Frame = -2

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIA
Sbjct  99    FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIA  158

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GGIWADTVGGK VLGFGV+WWSIATILTP+AAKLGLP+L +VRAFMG+GEGVAMPAMNN+
Sbjct  159   GGIWADTVGGKRVLGFGVIWWSIATILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNI  218

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             LSKWVPV ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW T+WL
Sbjct  219   LSKWVPVQERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLTLWL  278

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
             +KA SSPL+DP LLPEE+KLI+ N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTF
Sbjct  279   TKAESSPLEDPTLLPEERKLIVDNCASKEPVKSIPWRLILSKPPVWALISCHFCHNWGTF  338

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             ILLTWMPTYYHQVLKFNL ESG+ +V PW+TMA SA AGGWIAD+LV +G SVT VRKIM
Sbjct  339   ILLTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGFSVTNVRKIM  398

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             QTIGFLGPAFFLTQL H+DSP MAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GL
Sbjct  399   QTIGFLGPAFFLTQLKHIDSPTMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGL  458

Query  595   SNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SNTAGVLAGV GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  459   SNTAGVLAGVLGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  512



>ref|NP_180526.1| phosphate transporter 4;1 [Arabidopsis thaliana]
 sp|O82390.1|ANTR1_ARATH RecName: Full=Sodium-dependent phosphate transport protein 1, 
chloroplastic; AltName: Full=Anion transporter 1; AltName: 
Full=Na(+)/PI cotransporter 1; AltName: Full=Phosphate transporter 
PHT4;1; AltName: Full=Sodium/phosphate cotransporter 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC35230.1| putative Na+-dependent inorganic phosphate cotransporter [Arabidopsis 
thaliana]
 gb|AEC08286.1| sodium-dependent phosphate transport protein 1 [Arabidopsis thaliana]
Length=512

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/433 (83%), Positives = 394/433 (91%), Gaps = 3/433 (1%)
 Frame = -2

Query  1723  NDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPT  1553
             N+DV+++     +      FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM++EY W+P 
Sbjct  80    NNDVVSDSPSSIVLPWWEEFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPA  139

Query  1552  TVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFI  1373
             TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGV+WWSIATILTP+AAKLGLP+L +
Sbjct  140   TVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLGFGVIWWSIATILTPVAAKLGLPYLLV  199

Query  1372  VRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGW  1193
             VRAFMG+GEGVAMPAMNN+LSKWVPV ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGW
Sbjct  200   VRAFMGVGEGVAMPAMNNILSKWVPVQERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGW  259

Query  1192  PSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILS  1013
             PSVFYSFGSLGTVW T+WL+KA SSPL+DP LLPEE+KLI  N  SKEPVKSIPW+LILS
Sbjct  260   PSVFYSFGSLGTVWLTLWLTKAESSPLEDPTLLPEERKLIADNCASKEPVKSIPWRLILS  319

Query  1012  KPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGW  833
             KPPVWALI  HFCHNWGTFILLTWMPTYYHQVLKFNL ESG+ +V PW+TMA SA AGGW
Sbjct  320   KPPVWALISCHFCHNWGTFILLTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGW  379

Query  832   IADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSG  653
             IAD+LV +G SVT VRKIMQTIGFLGPAFFLTQL H+DSP MAVLCM CSQG+DAFSQSG
Sbjct  380   IADTLVSRGFSVTNVRKIMQTIGFLGPAFFLTQLKHIDSPTMAVLCMACSQGTDAFSQSG  439

Query  652   LYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTV  473
             LYSNHQDIAPRYSGVL+GLSNTAGVLAGV GTAATG+ILQHGSWDDVF +SVGLYLVGTV
Sbjct  440   LYSNHQDIAPRYSGVLLGLSNTAGVLAGVLGTAATGHILQHGSWDDVFTISVGLYLVGTV  499

Query  472   VWNLFSTGEKILD  434
             +WNLFSTGEKI+D
Sbjct  500   IWNLFSTGEKIID  512



>gb|ABK51380.1| Na+/Pi transporter [Eutrema halophilum]
Length=510

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/414 (86%), Positives = 383/414 (93%), Gaps = 0/414 (0%)
 Frame = -2

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIA
Sbjct  97    FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIA  156

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GGIWADTVGGK+VLGFGV+WWSIATILTPIAAKLGLPFL +VRAFMG+GEGVAMPAMNNL
Sbjct  157   GGIWADTVGGKMVLGFGVIWWSIATILTPIAAKLGLPFLLVVRAFMGVGEGVAMPAMNNL  216

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             LSKWVPV ERSRSLA+VYSGMY+GSV GLAFSP LIH+FGWPSVFY FGSLGTVW T+WL
Sbjct  217   LSKWVPVQERSRSLALVYSGMYIGSVIGLAFSPFLIHQFGWPSVFYCFGSLGTVWLTLWL  276

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
             +KA SSP++D  LLP+E+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTF
Sbjct  277   TKAESSPVEDLTLLPQERKLIADNCASKEPVKSIPWRLILSKPPVWALICCHFCHNWGTF  336

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             ILLTWMPTYYHQVLKFNL ESG+ +V PWLTMA SA AGGWIAD+LV +G SVT VRKIM
Sbjct  337   ILLTWMPTYYHQVLKFNLMESGLLSVFPWLTMAISANAGGWIADTLVSRGFSVTNVRKIM  396

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             QTIGFLGPAFFLTQL H+DSP MAVLCM CSQG DAFSQSGLYSNHQDIAPRYSGVL+GL
Sbjct  397   QTIGFLGPAFFLTQLKHIDSPTMAVLCMACSQGLDAFSQSGLYSNHQDIAPRYSGVLLGL  456

Query  595   SNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SNTAGVLAGV GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  457   SNTAGVLAGVLGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  510



>ref|XP_006410023.1| hypothetical protein EUTSA_v10016491mg [Eutrema salsugineum]
 dbj|BAJ33784.1| unnamed protein product [Thellungiella halophila]
 dbj|BAJ33806.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51476.1| hypothetical protein EUTSA_v10016491mg [Eutrema salsugineum]
Length=510

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/414 (86%), Positives = 383/414 (93%), Gaps = 0/414 (0%)
 Frame = -2

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIA
Sbjct  97    FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIA  156

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GGIWADTVGGK+VLGFGV+WWSIATILTPIAAKLGLPFL +VRAFMG+GEGVAMPAMNNL
Sbjct  157   GGIWADTVGGKMVLGFGVIWWSIATILTPIAAKLGLPFLLVVRAFMGVGEGVAMPAMNNL  216

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             LSKWVPV ERSRSLA+VYSGMY+GSV GLAFSP LIH+FGWPSVFY FGSLGTVW T+WL
Sbjct  217   LSKWVPVQERSRSLALVYSGMYIGSVIGLAFSPFLIHQFGWPSVFYCFGSLGTVWLTLWL  276

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
             +KA SSP++D  LLP+E+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTF
Sbjct  277   TKAESSPVEDLTLLPQERKLIADNCASKEPVKSIPWRLILSKPPVWALICCHFCHNWGTF  336

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             ILLTWMPTYYHQVLKFNL ESG+ +V PWLTMA SA AGGWIAD+LV +G SVT VRKIM
Sbjct  337   ILLTWMPTYYHQVLKFNLMESGLLSVFPWLTMAISANAGGWIADTLVSRGFSVTNVRKIM  396

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             QTIGFLGPAFFLTQL H+DSP MAVLCM CSQG DAFSQSGLYSNHQDIAPRYSGVL+GL
Sbjct  397   QTIGFLGPAFFLTQLKHIDSPTMAVLCMACSQGLDAFSQSGLYSNHQDIAPRYSGVLLGL  456

Query  595   SNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SNTAGVLAGV GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  457   SNTAGVLAGVLGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  510



>ref|XP_006296374.1| hypothetical protein CARUB_v10025547mg [Capsella rubella]
 gb|EOA29272.1| hypothetical protein CARUB_v10025547mg [Capsella rubella]
Length=512

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/537 (72%), Positives = 420/537 (78%), Gaps = 43/537 (8%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRT  1811
             M ARALL S     P LH    +  P    SS                 R FR       
Sbjct  1     MNARALLCS-----PNLHSLYTSNRPPEKPSS----------------SRSFRNLKPAPN  39

Query  1810  SWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGG---------------  1676
             S R W   ++++      V  S K E + +  V    DGE +S                 
Sbjct  40    SLRVWVYQRNRSGVFRVLVRSSDKRESSNSYYV----DGERVSQNDVVSDSSTSSIVLPW  95

Query  1675  ---FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLT  1505
                FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLT
Sbjct  96    WEEFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLT  155

Query  1504  QIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAM  1325
             QIAGGIWADTVGGK VLGFGV+WWSIATILTP+AAKLGLP+L +VRAFMG+GEGVAMPAM
Sbjct  156   QIAGGIWADTVGGKRVLGFGVIWWSIATILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAM  215

Query  1324  NNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFT  1145
             NN+LSKWVPV ERSRSLA+VYSGMYLGSVTGLAFSP LIH FGWPSVFYSFGSLGTVW  
Sbjct  216   NNILSKWVPVQERSRSLALVYSGMYLGSVTGLAFSPFLIHHFGWPSVFYSFGSLGTVWLI  275

Query  1144  VWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNW  965
             +WL+KA SSPL+DP LLPEE+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNW
Sbjct  276   LWLTKAESSPLEDPTLLPEERKLIADNCASKEPVKSIPWRLILSKPPVWALIGCHFCHNW  335

Query  964   GTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVR  785
             GTFILLTWMPTYYHQVLKFNL ESG+ +V PW+TMA SA AGGWIAD+LV +G SVT VR
Sbjct  336   GTFILLTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGFSVTNVR  395

Query  784   KIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVL  605
             KIMQTIGFLGPAFFLTQL H+DSP MAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL
Sbjct  396   KIMQTIGFLGPAFFLTQLKHIDSPTMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVL  455

Query  604   MGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             +GLSNTAGVLAGV GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  456   LGLSNTAGVLAGVLGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  512



>ref|XP_010104671.1| Sodium-dependent phosphate transport protein 1 [Morus notabilis]
 gb|EXC01477.1| Sodium-dependent phosphate transport protein 1 [Morus notabilis]
Length=491

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/525 (74%), Positives = 427/525 (81%), Gaps = 40/525 (8%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHT--LFEFGSPFLPGRGFRRGLIR  1817
             M ARA LL  ++  PK   SP    P++  +S S   T   F F  P     GF   + R
Sbjct  1     MNARAALL--FSFSPKPDISP----PRKVLASGSTHQTPFRFRFQYPQSERHGFFSVVSR  54

Query  1816  RTSWRAWADVKSKTYGISDSVPES-LKFEDALNDDVLTEDDGETIS---GGFPKRWVIVL  1649
             R  W+ WADVKSK Y + DSVP+S +KFEDA +D    +++ E +      FPKRWVIV+
Sbjct  55    RRVWKVWADVKSKRYEVPDSVPKSSVKFEDACDDVDSGKEESELVGPWWEVFPKRWVIVV  114

Query  1648  LCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvg  1469
             LCFSAFLLCNMDRVNMSIAILPM+SEY+W+P TVGLIQSSFFWGYLLTQIAGGIWADTVG
Sbjct  115   LCFSAFLLCNMDRVNMSIAILPMSSEYNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVG  174

Query  1468  gklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSE  1289
             GK VLGFGVVWWS+AT+LTP+AAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKWVPV+E
Sbjct  175   GKKVLGFGVVWWSVATVLTPVAAKLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWVPVAE  234

Query  1288  RSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpld  1109
             RSRSLA+VYSGMYLGSVTGLAFSP+LIH+FGWPSVFYSFGSLGTVWFTVWL++A+SSPL+
Sbjct  235   RSRSLALVYSGMYLGSVTGLAFSPLLIHQFGWPSVFYSFGSLGTVWFTVWLNQAYSSPLE  294

Query  1108  dpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTY  929
             DP L PEEKKLIL NSVSKEPVK IPW  ILSK P                         
Sbjct  295   DPRLRPEEKKLILTNSVSKEPVKVIPWGQILSKAP-------------------------  329

Query  928   YHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPA  749
                VLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KGVSVT VRKIMQTIGFLGPA
Sbjct  330   ---VLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGVSVTTVRKIMQTIGFLGPA  386

Query  748   FFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAG  569
             FFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAG
Sbjct  387   FFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAG  446

Query  568   VFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             VFGTA+TGYILQHGSWD+VF+VSVGLYLVGTVVWNLFSTGEKI+D
Sbjct  447   VFGTASTGYILQHGSWDNVFEVSVGLYLVGTVVWNLFSTGEKIID  491



>gb|AAL32642.1| putative Na+-dependent inorganic phosphate cotransporter [Arabidopsis 
thaliana]
 gb|AAM48002.1| putative Na+-dependent inorganic phosphate cotransporter [Arabidopsis 
thaliana]
Length=512

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/433 (83%), Positives = 393/433 (91%), Gaps = 3/433 (1%)
 Frame = -2

Query  1723  NDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPT  1553
             N+DV+++     +      FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM++EY W+P 
Sbjct  80    NNDVVSDSPSSIVLPWWEEFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPA  139

Query  1552  TVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFI  1373
             TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGV+WWSIATILTP+AAKLGLP+L +
Sbjct  140   TVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLGFGVIWWSIATILTPVAAKLGLPYLLV  199

Query  1372  VRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGW  1193
             VRAFMG+GEGVAMPAMNN+LSKWVPV ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGW
Sbjct  200   VRAFMGVGEGVAMPAMNNILSKWVPVQERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGW  259

Query  1192  PSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILS  1013
             PSVFYSFGSLGTVW T+WL+KA SSPL+DP LLPEE+KLI  N  SKEPVKSIP +LILS
Sbjct  260   PSVFYSFGSLGTVWLTLWLTKAESSPLEDPTLLPEERKLIADNCASKEPVKSIPRRLILS  319

Query  1012  KPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGW  833
             KPPVWALI  HFCHNWGTFILLTWMPTYYHQVLKFNL ESG+ +V PW+TMA SA AGGW
Sbjct  320   KPPVWALISCHFCHNWGTFILLTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGW  379

Query  832   IADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSG  653
             IAD+LV +G SVT VRKIMQTIGFLGPAFFLTQL H+DSP MAVLCM CSQG+DAFSQSG
Sbjct  380   IADTLVSRGFSVTNVRKIMQTIGFLGPAFFLTQLKHIDSPTMAVLCMACSQGTDAFSQSG  439

Query  652   LYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTV  473
             LYSNHQDIAPRYSGVL+GLSNTAGVLAGV GTAATG+ILQHGSWDDVF +SVGLYLVGTV
Sbjct  440   LYSNHQDIAPRYSGVLLGLSNTAGVLAGVLGTAATGHILQHGSWDDVFTISVGLYLVGTV  499

Query  472   VWNLFSTGEKILD  434
             +WNLFSTGEKI+D
Sbjct  500   IWNLFSTGEKIID  512



>ref|XP_007051779.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 ref|XP_007051780.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX95936.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX95937.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=553

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/466 (77%), Positives = 409/466 (88%), Gaps = 5/466 (1%)
 Frame = -2

Query  1822  IRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIV  1652
             IR+   RA+   KS+ Y I+++  + L   +A N+ VL E + +        FPKRW IV
Sbjct  90    IRKNRTRAY--YKSEEYDITEAKVDPLPSPEATNEVVLVEGEMQEAVPWWQSFPKRWFIV  147

Query  1651  LLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTv  1472
             LLCF+AFLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD  
Sbjct  148   LLCFAAFLLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKF  207

Query  1471  ggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVS  1292
             GGKLVLGFGV+WWS+ATILTPIAA++GLPFL  +RAFMGIGEGVAMPAMNNLLSKW+PVS
Sbjct  208   GGKLVLGFGVIWWSVATILTPIAARIGLPFLLTMRAFMGIGEGVAMPAMNNLLSKWIPVS  267

Query  1291  ERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpl  1112
             ERSRSLA+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL KA+SSP 
Sbjct  268   ERSRSLALVYSGMYLGSVTGLAFSPILIHKFGWPSVFYSFGSLGSIWFALWLRKAYSSPN  327

Query  1111  ddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPT  932
             +DP+L  EEKKLI+  S+SKEPVK IPW+LILSK PVWALI+SHFCHNWGTFILLTWMPT
Sbjct  328   EDPKLSKEEKKLIMGGSISKEPVKIIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPT  387

Query  931   YYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGP  752
             YY+QVLKFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGP
Sbjct  388   YYNQVLKFNLTESGLFCVLPWLTMAAFANIGGWIADTLVSKGLSITAVRKIMQSIGFLGP  447

Query  751   AFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLA  572
             AFFLTQLSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLA
Sbjct  448   AFFLTQLSHVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLA  507

Query  571   GVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GVFGTAATGYILQ GSW+DVFKVSV LY++GT+VWNLFSTGEK+LD
Sbjct  508   GVFGTAATGYILQRGSWNDVFKVSVALYIIGTLVWNLFSTGEKVLD  553



>ref|XP_007051778.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95935.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=601

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/466 (77%), Positives = 409/466 (88%), Gaps = 5/466 (1%)
 Frame = -2

Query  1822  IRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIV  1652
             IR+   RA+   KS+ Y I+++  + L   +A N+ VL E + +        FPKRW IV
Sbjct  138   IRKNRTRAY--YKSEEYDITEAKVDPLPSPEATNEVVLVEGEMQEAVPWWQSFPKRWFIV  195

Query  1651  LLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTv  1472
             LLCF+AFLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD  
Sbjct  196   LLCFAAFLLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKF  255

Query  1471  ggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVS  1292
             GGKLVLGFGV+WWS+ATILTPIAA++GLPFL  +RAFMGIGEGVAMPAMNNLLSKW+PVS
Sbjct  256   GGKLVLGFGVIWWSVATILTPIAARIGLPFLLTMRAFMGIGEGVAMPAMNNLLSKWIPVS  315

Query  1291  ERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpl  1112
             ERSRSLA+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL KA+SSP 
Sbjct  316   ERSRSLALVYSGMYLGSVTGLAFSPILIHKFGWPSVFYSFGSLGSIWFALWLRKAYSSPN  375

Query  1111  ddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPT  932
             +DP+L  EEKKLI+  S+SKEPVK IPW+LILSK PVWALI+SHFCHNWGTFILLTWMPT
Sbjct  376   EDPKLSKEEKKLIMGGSISKEPVKIIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPT  435

Query  931   YYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGP  752
             YY+QVLKFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGP
Sbjct  436   YYNQVLKFNLTESGLFCVLPWLTMAAFANIGGWIADTLVSKGLSITAVRKIMQSIGFLGP  495

Query  751   AFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLA  572
             AFFLTQLSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLA
Sbjct  496   AFFLTQLSHVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLA  555

Query  571   GVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GVFGTAATGYILQ GSW+DVFKVSV LY++GT+VWNLFSTGEK+LD
Sbjct  556   GVFGTAATGYILQRGSWNDVFKVSVALYIIGTLVWNLFSTGEKVLD  601



>ref|XP_003528848.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Glycine 
max]
 gb|KHN26956.1| Putative anion transporter 2, chloroplastic [Glycine soja]
Length=592

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/451 (80%), Positives = 401/451 (89%), Gaps = 0/451 (0%)
 Frame = -2

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRV  1607
             KS+ Y IS++  + L+  +   + +L E         FPKRWVIVLLCF+AFLLCNMDRV
Sbjct  142   KSEEYDISETKMDPLQSTEGTGEAILLEGRASPWWQQFPKRWVIVLLCFTAFLLCNMDRV  201

Query  1606  NMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSI  1427
             NMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGVVWWSI
Sbjct  202   NMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQIIGGIWADKLGGKLVLGFGVVWWSI  261

Query  1426  ATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYL  1247
             AT+LTPIAAKLGLP L I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYL
Sbjct  262   ATVLTPIAAKLGLPCLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALVYSGMYL  321

Query  1246  GSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILR  1067
             GSVTGLAFSP+LI KFGWPSVFYSFGSLG++WF +WLSKA+SSP +DP+L  EEKKLIL 
Sbjct  322   GSVTGLAFSPILIQKFGWPSVFYSFGSLGSIWFVLWLSKAYSSPKEDPDLGAEEKKLILG  381

Query  1066  NSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGM  887
              +VSKEPV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+
Sbjct  382   GNVSKEPVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGL  441

Query  886   FAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAM  707
             F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQLSHV +PAM
Sbjct  442   FCVLPWLTMAIFANIGGWIADTLVSKGLSITSVRKIMQSIGFLGPAFFLTQLSHVKTPAM  501

Query  706   AVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHG  527
             AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ G
Sbjct  502   AVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRG  561

Query  526   SWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SWDDVFKV+V LY++GT+VWN+FSTGEKILD
Sbjct  562   SWDDVFKVAVALYIIGTLVWNIFSTGEKILD  592



>gb|KDP28615.1| hypothetical protein JCGZ_14386 [Jatropha curcas]
Length=582

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/502 (73%), Positives = 418/502 (83%), Gaps = 7/502 (1%)
 Frame = -2

Query  1924  ATFPKRSFSSRSHTHTLFEFGSPFLPGRG--FRRGLIRRTSWRAWADVKSKTYGISDSVP  1751
             A++P++    R    +    G+     +G     G +R +  RA+   KS+ Y I+++  
Sbjct  83    ASYPQQRSLGRCECSSYPSVGNFLQQSKGHCLHFGPVRVSRTRAY--YKSEEYDITEASL  140

Query  1750  ESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM  1580
             +SL   +   + VL E + +  S     FPKRWVIVLLCF AFLLCNMDRVNMSIAILPM
Sbjct  141   DSLNSAEGSGEAVLVEGNLQGTSPWWEQFPKRWVIVLLCFMAFLLCNMDRVNMSIAILPM  200

Query  1579  ASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAA  1400
             + E++W+ TTVGLIQSSFFWGYL+TQI GGIWAD +GGKLVLGFGVVWWS AT+LTPIAA
Sbjct  201   SQEFNWNSTTVGLIQSSFFWGYLMTQILGGIWADKLGGKLVLGFGVVWWSAATVLTPIAA  260

Query  1399  KLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFS  1220
             ++GLPFL ++RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGLA S
Sbjct  261   RIGLPFLLMMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALVYSGMYLGSVTGLAVS  320

Query  1219  PMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVK  1040
             P+LI KFGWPSVFYSFGSLGT+WF +WL KA+SSP +DP L  +EKKLI   SVSKEPV 
Sbjct  321   PVLIQKFGWPSVFYSFGSLGTIWFALWLQKAYSSPNEDPGLSAQEKKLIFSGSVSKEPVS  380

Query  1039  SIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTM  860
              IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTM
Sbjct  381   VIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTM  440

Query  859   AFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQ  680
             AF A  GGWIAD+LV KG S+T VRKIMQ+IGFLGPAFFLTQLSHV +PAMAVLCM CSQ
Sbjct  441   AFFANIGGWIADTLVSKGFSITTVRKIMQSIGFLGPAFFLTQLSHVKTPAMAVLCMACSQ  500

Query  679   GSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVS  500
             GSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+
Sbjct  501   GSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVA  560

Query  499   VGLYLVGTVVWNLFSTGEKILD  434
             V LY++GT+VWN FSTGEK+LD
Sbjct  561   VVLYIIGTLVWNFFSTGEKVLD  582



>ref|XP_006827574.1| hypothetical protein AMTR_s00009p00227360 [Amborella trichopoda]
 gb|ERM94990.1| hypothetical protein AMTR_s00009p00227360 [Amborella trichopoda]
Length=545

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/471 (77%), Positives = 407/471 (86%), Gaps = 9/471 (2%)
 Frame = -2

Query  1837  FRRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPK  1667
             FR+  + R      AD KS+ Y I+    +SLK  D+ N+ +   +  + ++     FPK
Sbjct  81    FRQKTMMR------ADFKSEQYDITGLNLDSLKPPDSPNEGIALNEYIQKMTYWWEQFPK  134

Query  1666  RWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGI  1487
             RW+IVLLCFSAFLLCNMDRVNMSIAILPM+ E++W+P T GLIQSSFFWGYLLTQI GGI
Sbjct  135   RWMIVLLCFSAFLLCNMDRVNMSIAILPMSKEFNWNPATAGLIQSSFFWGYLLTQILGGI  194

Query  1486  WADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSK  1307
             WAD +GGKLVLGFGVVWWSIAT+LTPIAA++GLPFL I+RAFMGIGEGVAMPAMNN+LSK
Sbjct  195   WADKLGGKLVLGFGVVWWSIATVLTPIAARIGLPFLLIMRAFMGIGEGVAMPAMNNILSK  254

Query  1306  WVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKA  1127
             W+PVSERSRSLA+VYSGMYLGSVTG AFSPMLIHKFGWPSVFYSFGSLG +W  +WL+KA
Sbjct  255   WIPVSERSRSLALVYSGMYLGSVTGFAFSPMLIHKFGWPSVFYSFGSLGIIWLAIWLNKA  314

Query  1126  HSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILL  947
             HSSP +DPEL  EEK+LIL  S+ K+PV +IPWKLILSK PVWALI+SHFCHNWGTFILL
Sbjct  315   HSSPQEDPELRIEEKELILGGSIVKDPVTAIPWKLILSKAPVWALIISHFCHNWGTFILL  374

Query  946   TWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTI  767
             TWMPTYY+QVLKFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+I
Sbjct  375   TWMPTYYNQVLKFNLTESGLFCVLPWLTMAVFANIGGWIADTLVSKGLSITTVRKIMQSI  434

Query  766   GFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNT  587
             GFLGPAFFLTQLSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNT
Sbjct  435   GFLGPAFFLTQLSHVHTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNT  494

Query  586   AGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             AGVLAGV GTAATGYILQ GSWDDVFKV+V LY+VGT VWN FSTGEKILD
Sbjct  495   AGVLAGVLGTAATGYILQRGSWDDVFKVAVALYVVGTFVWNFFSTGEKILD  545



>ref|XP_006591210.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X2 [Glycine max]
Length=517

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/464 (80%), Positives = 404/464 (87%), Gaps = 17/464 (4%)
 Frame = -2

Query  1834  RRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGG-------  1676
             RR  +     R W +VKS+      ++ ES K+ED   D V+ +     +          
Sbjct  44    RRSHLVAGGRRVWVNVKSE-----KNLSESPKYED---DVVVQKKKKRGLDNVEEEARWW  95

Query  1675  --FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQ  1502
               FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P+TVGLIQSSFFWGYLLTQ
Sbjct  96    QVFPKRWVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPSTVGLIQSSFFWGYLLTQ  155

Query  1501  IAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMN  1322
             IAGGIWADTVGGK VLGFGVVWWS+AT LTPIAAKLGLPFL + RAFMGIGEGVAMPAMN
Sbjct  156   IAGGIWADTVGGKQVLGFGVVWWSVATALTPIAAKLGLPFLLVARAFMGIGEGVAMPAMN  215

Query  1321  NLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTV  1142
             N+LSKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW +V
Sbjct  216   NILSKWVPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWCSV  275

Query  1141  WLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWG  962
             WLSKAHSSPL+DPEL PEEKKLI  N  SKEPVK+IPW+LILSKPPVWALIVSHFCHNWG
Sbjct  276   WLSKAHSSPLEDPELRPEEKKLITANCSSKEPVKTIPWRLILSKPPVWALIVSHFCHNWG  335

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             TFILLTWMPTYY+QVLKFNLTESG+F VLPW  MA SA  GGWIAD+LV KG+SVT VRK
Sbjct  336   TFILLTWMPTYYNQVLKFNLTESGLFCVLPWFIMAISANVGGWIADTLVSKGLSVTRVRK  395

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQTIGFLGPAFFLTQLSH +SP MAVLCMTCSQG+DAFSQSGLYSNHQDIAPRYSG+L+
Sbjct  396   IMQTIGFLGPAFFLTQLSHANSPVMAVLCMTCSQGTDAFSQSGLYSNHQDIAPRYSGILL  455

Query  601   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVV  470
             GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTV+
Sbjct  456   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVI  499



>ref|NP_001148011.1| sialin [Zea mays]
 gb|ACG29384.1| sialin [Zea mays]
Length=511

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/424 (83%), Positives = 386/424 (91%), Gaps = 0/424 (0%)
 Frame = -2

Query  1705  EDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSF  1526
             E D E   G FPKRW IV LCFSAFLLCNMDRVNMSIAILPM++E+ W+P TVGLIQSSF
Sbjct  88    EGDSEEEQGQFPKRWAIVFLCFSAFLLCNMDRVNMSIAILPMSAEFGWNPQTVGLIQSSF  147

Query  1525  FWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGE  1346
             FWGYLLTQIAGGIWADTVGGK VLGFGVVWWSIAT LTP+AA LGLPFL +VRAFMGIGE
Sbjct  148   FWGYLLTQIAGGIWADTVGGKTVLGFGVVWWSIATALTPVAAHLGLPFLLVVRAFMGIGE  207

Query  1345  GVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGS  1166
             GVAMPAMNN+LSKWVPVSERSRSL++VYSGMYLGSVTGLAFSP+LIHKFGWPSVF+SFGS
Sbjct  208   GVAMPAMNNILSKWVPVSERSRSLSLVYSGMYLGSVTGLAFSPLLIHKFGWPSVFFSFGS  267

Query  1165  LGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIV  986
             LG VWFT W +KA+SSPL+DP +   EKKLI   S + EPVK+IPW+LILSKPPVWALIV
Sbjct  268   LGLVWFTTWATKAYSSPLEDPGISAAEKKLIASQSTAGEPVKTIPWRLILSKPPVWALIV  327

Query  985   SHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKG  806
             SHFCHNWGTFILLTWMPTYY+QVLKFNL ESG+  VLPW TMA SA  GGWIAD+LV +G
Sbjct  328   SHFCHNWGTFILLTWMPTYYNQVLKFNLMESGLICVLPWFTMAVSANVGGWIADTLVSRG  387

Query  805   VSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIA  626
             VSVT VRKIMQ+IGFLGPAFFLTQLSHV+SPAMAVLCM CSQG+DAFSQSGLYSNHQDI 
Sbjct  388   VSVTTVRKIMQSIGFLGPAFFLTQLSHVNSPAMAVLCMACSQGTDAFSQSGLYSNHQDIG  447

Query  625   PRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGE  446
             PRY+GVL+GLSNTAGVLAGVFGTAATGYILQHGSWD+VF++SV LYLVGT+VWN+FSTGE
Sbjct  448   PRYAGVLLGLSNTAGVLAGVFGTAATGYILQHGSWDNVFELSVVLYLVGTLVWNIFSTGE  507

Query  445   KILD  434
             KILD
Sbjct  508   KILD  511



>ref|XP_003567315.1| PREDICTED: probable anion transporter 1, chloroplastic [Brachypodium 
distachyon]
Length=520

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/478 (76%), Positives = 404/478 (85%), Gaps = 15/478 (3%)
 Frame = -2

Query  1822  IRRTSWRAWADVKSKTYGISDSVP--ESLKFEDALNDD-----------VLTED--DGET  1688
             +RR + R   DV+  T   S      E    E    DD           +L +D  +G+ 
Sbjct  43    VRRRALRGGTDVQPDTPSSSSHRDGGEPPHSEAGDGDDGSGALLASVRQLLLDDAAEGKE  102

Query  1687  ISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLL  1508
               G FPKRW IV LCFSAFLLCNMDRVNMSIAI+PM++E+ W+P TVGLIQSSFFWGYLL
Sbjct  103   EPGQFPKRWAIVFLCFSAFLLCNMDRVNMSIAIMPMSAEFDWNPQTVGLIQSSFFWGYLL  162

Query  1507  TQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPA  1328
             TQIAGGIWAD VGGK VLGFGV+WWS+AT LTPIAAKLGLPFL +VRAFMGIGEGVAMPA
Sbjct  163   TQIAGGIWADKVGGKTVLGFGVIWWSVATALTPIAAKLGLPFLLVVRAFMGIGEGVAMPA  222

Query  1327  MNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWF  1148
             MNN+LSKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP LIHKFGWPSVFYSFGSLGTVWF
Sbjct  223   MNNILSKWVPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHKFGWPSVFYSFGSLGTVWF  282

Query  1147  TVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHN  968
               W++KA+S+PL+DP +  EEKKLI   + S EPV +IPW+LILSKPPVWALIV HFCHN
Sbjct  283   ATWVTKAYSTPLEDPGISAEEKKLITTQTTSGEPVTTIPWRLILSKPPVWALIVCHFCHN  342

Query  967   WGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVV  788
             WGTFILLTWMPTYY+QVLKFNLTES +F VLPWLTMA SA  GGWIAD+LV +G SVT V
Sbjct  343   WGTFILLTWMPTYYNQVLKFNLTESSLFCVLPWLTMAISANVGGWIADTLVSRGTSVTTV  402

Query  787   RKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGV  608
             RKIMQ++GFLGPAFFLTQLSH+DSPA+AVLCM CSQG+DAFSQSGLYSNHQDI PRY+GV
Sbjct  403   RKIMQSVGFLGPAFFLTQLSHIDSPALAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGV  462

Query  607   LMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             L+GLSNTAGVLAGVFGTAATGYILQHGSWDDVFK+SV LYL+GTVVWN+FSTGEKI+D
Sbjct  463   LLGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKLSVVLYLIGTVVWNVFSTGEKIID  520



>ref|XP_008438037.1| PREDICTED: probable anion transporter 2, chloroplastic [Cucumis 
melo]
Length=600

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/507 (71%), Positives = 418/507 (82%), Gaps = 18/507 (4%)
 Frame = -2

Query  1945  KLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRTSWRAWADVKSKTYGI  1766
             K  C P+ T           +  +   G  +L  +  R   + RTS    A+ KS  + I
Sbjct  109   KCRCYPQCT-----------SACILSNGPSWLQCQKSRYVKVDRTS----ANYKSNDFDI  153

Query  1765  SDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNMDRVNMSI  1595
             +    ++L   +   D    E++ + +S     FPKRWVIVLLCF +FLLCNMDRVNMSI
Sbjct  154   TKGDVDALALAEGSGDAFFMEENEQIVSPWWESFPKRWVIVLLCFFSFLLCNMDRVNMSI  213

Query  1594  AILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATIL  1415
             AILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGVVWWSIATIL
Sbjct  214   AILPMSKEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKLVLGFGVVWWSIATIL  273

Query  1414  TPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVT  1235
             TPIAA++GLPFL ++RAFMGIGEGVAMPAMNN++SKW+PVSERSRSLA+VYSGMYLGSVT
Sbjct  274   TPIAARIGLPFLLMMRAFMGIGEGVAMPAMNNIISKWIPVSERSRSLALVYSGMYLGSVT  333

Query  1234  GLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVS  1055
             GLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL+KA+SSP +DP L  +EKK+I   S+S
Sbjct  334   GLAFSPVLIHKFGWPSVFYSFGSLGSIWFALWLTKAYSSPKEDPGLSAKEKKIIFDGSIS  393

Query  1054  KEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVL  875
             KEPVK IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+F VL
Sbjct  394   KEPVKVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVL  453

Query  874   PWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLC  695
             PWLTMA  A  GGWIAD+LV +G S+T VRKIMQ+IGFLGPAFFLTQLSHV +PAMAVLC
Sbjct  454   PWLTMAVFANIGGWIADTLVSRGFSITTVRKIMQSIGFLGPAFFLTQLSHVRTPAMAVLC  513

Query  694   MTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDD  515
             M CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG+ILQ GSWDD
Sbjct  514   MACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGFILQRGSWDD  573

Query  514   VFKVSVGLYLVGTVVWNLFSTGEKILD  434
             VFKVSV LY++GT+VWN+F+TGEKILD
Sbjct  574   VFKVSVALYIIGTLVWNIFATGEKILD  600



>ref|XP_002455469.1| hypothetical protein SORBIDRAFT_03g011370 [Sorghum bicolor]
 gb|EES00589.1| hypothetical protein SORBIDRAFT_03g011370 [Sorghum bicolor]
Length=512

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/417 (85%), Positives = 383/417 (92%), Gaps = 0/417 (0%)
 Frame = -2

Query  1684  SGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLT  1505
              G FPKRW IV LCFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLT
Sbjct  96    QGQFPKRWAIVFLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPQTVGLIQSSFFWGYLLT  155

Query  1504  QIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAM  1325
             QIAGGIWADTVGGK VLGFGVVWWSIAT LTP+AAKLGLPFL +VRAFMGIGEGVAMPAM
Sbjct  156   QIAGGIWADTVGGKTVLGFGVVWWSIATALTPVAAKLGLPFLLVVRAFMGIGEGVAMPAM  215

Query  1324  NNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFT  1145
             NN+LSKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG VW T
Sbjct  216   NNILSKWVPVSERSRSLALVYSGMYLGSVTGLAFSPLLIHKFGWPSVFYSFGSLGAVWVT  275

Query  1144  VWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNW  965
              W +KA+SSPL+DP +   EKKLI   S + EPVK+IPW+LILSKPPVWALIVSHFCHNW
Sbjct  276   TWATKAYSSPLEDPGISAAEKKLIASQSTAGEPVKTIPWRLILSKPPVWALIVSHFCHNW  335

Query  964   GTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVR  785
             GTFILLTWMPTYY+QVLKFNL ESG+  VLPW TMA SA  GGWIAD+LV +GVSVT VR
Sbjct  336   GTFILLTWMPTYYNQVLKFNLMESGLVCVLPWFTMAVSANVGGWIADTLVSRGVSVTTVR  395

Query  784   KIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVL  605
             KIMQ+IGFLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL
Sbjct  396   KIMQSIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGVL  455

Query  604   MGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             +GLSNTAGVLAGVFGTAATGYILQHGSWD+VF++SV LYLVGT+VWN+FSTGEKILD
Sbjct  456   LGLSNTAGVLAGVFGTAATGYILQHGSWDNVFELSVVLYLVGTLVWNVFSTGEKILD  512



>ref|XP_003520968.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Glycine 
max]
 gb|KHN42190.1| Putative anion transporter 2, chloroplastic [Glycine soja]
Length=593

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/498 (74%), Positives = 417/498 (84%), Gaps = 11/498 (2%)
 Frame = -2

Query  1894  RSHTHTLFE--FGSPFLPGRG-FRRGLIRRTSWRAWAD--------VKSKTYGISDSVPE  1748
             RSH+  LF   +GS  +  +  +R GL +R   +             KS+ Y IS++  +
Sbjct  96    RSHSSFLFSAPYGSNNVGHQEVYRLGLSKRKHAKTEVGKANKFRVCYKSEEYDISETKMD  155

Query  1747  SLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEY  1568
              L+  +   + +L E         FPKRWVIVLLCF+AFLLCNMDRVNMSIAILPM+ E+
Sbjct  156   PLQSTEGTGEAILLEGRALPWWQQFPKRWVIVLLCFTAFLLCNMDRVNMSIAILPMSQEF  215

Query  1567  HWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGL  1388
             +W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGVVWWSIAT+LTPIAAK GL
Sbjct  216   NWNSATVGLIQSSFFWGYLLTQIVGGIWADKLGGKLVLGFGVVWWSIATVLTPIAAKFGL  275

Query  1387  PFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLI  1208
             P L I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGLAFSPMLI
Sbjct  276   PCLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALVYSGMYLGSVTGLAFSPMLI  335

Query  1207  HKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPW  1028
              KFGWPSVFYSFGSLG++WF +WLSKA+SSP +DP+L  EEKK IL  +VSKEPV  IPW
Sbjct  336   QKFGWPSVFYSFGSLGSIWFVLWLSKAYSSPDEDPDLGAEEKKFILGGNVSKEPVSVIPW  395

Query  1027  KLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSA  848
             KLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMA  A
Sbjct  396   KLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAIFA  455

Query  847   YAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDA  668
               GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQLSHV +PAMAVLCM CSQGSDA
Sbjct  456   NIGGWIADTLVSKGLSITSVRKIMQSIGFLGPAFFLTQLSHVRTPAMAVLCMACSQGSDA  515

Query  667   FSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLY  488
             FSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+V LY
Sbjct  516   FSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVALY  575

Query  487   LVGTVVWNLFSTGEKILD  434
             ++GT+VWN+FSTGEKILD
Sbjct  576   IIGTLVWNIFSTGEKILD  593



>ref|XP_007135089.1| hypothetical protein PHAVU_010G099800g [Phaseolus vulgaris]
 gb|ESW07083.1| hypothetical protein PHAVU_010G099800g [Phaseolus vulgaris]
Length=591

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/454 (80%), Positives = 403/454 (89%), Gaps = 3/454 (1%)
 Frame = -2

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNM  1616
             KS+ Y IS++  + L+  +   + +L E + +  S     FPKRWVIVLLCFSAFLLCNM
Sbjct  138   KSEGYNISETKIDPLQSTEGTGEAILLEGNLQQASPWWQQFPKRWVIVLLCFSAFLLCNM  197

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             DRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGV+W
Sbjct  198   DRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKLVLGFGVIW  257

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WSIAT+LTPIAAKLGLPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSG
Sbjct  258   WSIATVLTPIAAKLGLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALVYSG  317

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSVTGLAFSP+LI KFGWPSVFYSFGSLG++WF +WLSKA+SSP DDP+L  EEKKL
Sbjct  318   MYLGSVTGLAFSPVLIQKFGWPSVFYSFGSLGSIWFVLWLSKAYSSPNDDPDLGAEEKKL  377

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             I   +VSKEPV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTE
Sbjct  378   IFGGNVSKEPVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTE  437

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+F VLPWLTMA  A  GGWIAD+LV KG S+T VRKIMQ+IGFLGPAFFLTQLSHV +
Sbjct  438   SGLFCVLPWLTMAIFANIGGWIADTLVSKGFSITSVRKIMQSIGFLGPAFFLTQLSHVRT  497

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
             PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYIL
Sbjct  498   PAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYIL  557

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             Q GSWDDVFKV+V LY++GT+VWN+FSTGEKILD
Sbjct  558   QRGSWDDVFKVAVVLYIIGTLVWNIFSTGEKILD  591



>ref|XP_004967676.1| PREDICTED: probable anion transporter 1, chloroplastic-like [Setaria 
italica]
Length=518

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/417 (85%), Positives = 385/417 (92%), Gaps = 0/417 (0%)
 Frame = -2

Query  1684  SGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLT  1505
              G FPKRW IV LCFSAFL+CNMDRVNMSIAILPM++E+ W+P TVGLIQSSFFWGYLLT
Sbjct  102   QGQFPKRWAIVFLCFSAFLICNMDRVNMSIAILPMSAEFGWNPQTVGLIQSSFFWGYLLT  161

Query  1504  QIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAM  1325
             QIAGGIWADTVGGK VLGFGVVWWSIAT+LTPIAAKLGLPFL +VRAFMGIGEGVAMPAM
Sbjct  162   QIAGGIWADTVGGKTVLGFGVVWWSIATVLTPIAAKLGLPFLLVVRAFMGIGEGVAMPAM  221

Query  1324  NNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFT  1145
             NN+LSKWVPVSERSRSL++VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG VWFT
Sbjct  222   NNILSKWVPVSERSRSLSLVYSGMYLGSVTGLAFSPLLIHKFGWPSVFYSFGSLGAVWFT  281

Query  1144  VWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNW  965
              W +KA+SSPL+DP +   EKKLI   S + EPVK+IPWKLILSKPPVWALIVSHFCHNW
Sbjct  282   TWATKAYSSPLEDPGISAAEKKLITSQSTAGEPVKTIPWKLILSKPPVWALIVSHFCHNW  341

Query  964   GTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVR  785
             GTFILLTWMPTYY+QVLKFNL ESG+  VLPW TMA SA  GGWIAD+LV +GVSVT VR
Sbjct  342   GTFILLTWMPTYYNQVLKFNLMESGLVCVLPWFTMAVSANVGGWIADTLVSRGVSVTRVR  401

Query  784   KIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVL  605
             KIMQ+IGFLGPAFFLTQLSHV+SPAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL
Sbjct  402   KIMQSIGFLGPAFFLTQLSHVNSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGVL  461

Query  604   MGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             +GLSNTAGVLAGVFGTAATGYILQHGSWD+VF+VSV LYLVGT+VWN+FSTGEKILD
Sbjct  462   LGLSNTAGVLAGVFGTAATGYILQHGSWDNVFEVSVVLYLVGTLVWNVFSTGEKILD  518



>ref|XP_006645772.1| PREDICTED: probable anion transporter 1, chloroplastic-like [Oryza 
brachyantha]
Length=526

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/416 (85%), Positives = 381/416 (92%), Gaps = 0/416 (0%)
 Frame = -2

Query  1681  GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQ  1502
             G FPKRW IV LCFSAFLLCNMDRVNMSIAILPM++E+ W+P TVGLIQSSFFWGYLLTQ
Sbjct  111   GQFPKRWAIVFLCFSAFLLCNMDRVNMSIAILPMSAEFGWNPQTVGLIQSSFFWGYLLTQ  170

Query  1501  IAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMN  1322
             IAGGIWADTVGGK VLGFGVVWWSIAT LTP+AAKLGLPFL + RAFMGIGEGVAMPAMN
Sbjct  171   IAGGIWADTVGGKTVLGFGVVWWSIATALTPVAAKLGLPFLLVTRAFMGIGEGVAMPAMN  230

Query  1321  NLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTV  1142
             N+LSKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP+LIH  GWPSVFYSFGSLG VWFT 
Sbjct  231   NILSKWVPVSERSRSLALVYSGMYLGSVTGLAFSPLLIHNLGWPSVFYSFGSLGVVWFTT  290

Query  1141  WLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWG  962
             W  KA+SSPL+DP +  +EKKLI   S   EPVK IPW LILSKPPVWALIVSHFCHNWG
Sbjct  291   WARKAYSSPLEDPGISAKEKKLITSQSTGGEPVKEIPWGLILSKPPVWALIVSHFCHNWG  350

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             TFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMA SA  GGWIAD+LV +G+SVT VRK
Sbjct  351   TFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAVSANFGGWIADTLVSRGLSVTTVRK  410

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             +MQ+IGFLGPAFFLTQLSH+DSPAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL+
Sbjct  411   VMQSIGFLGPAFFLTQLSHIDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGVLL  470

Query  601   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSV LYLVGT+VWNLFSTGEKI+D
Sbjct  471   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVVLYLVGTLVWNLFSTGEKIID  526



>ref|XP_004510775.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Cicer 
arietinum]
Length=602

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/454 (79%), Positives = 401/454 (88%), Gaps = 3/454 (1%)
 Frame = -2

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNM  1616
             KS+ Y I+    + L+  +   + +L E +   IS     FPKRWVIVLLCF+AFLLCNM
Sbjct  149   KSEEYDIAKPKIDRLQSSEGTGEAILLEGNLHQISPWWQQFPKRWVIVLLCFTAFLLCNM  208

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             DRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD VGGKLVLGFGVVW
Sbjct  209   DRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKVGGKLVLGFGVVW  268

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WSIATILTPIAAKLGLP+L ++RAFMGIGEGVAMPAMNN+LSKWVPVSERSRSLA+VYSG
Sbjct  269   WSIATILTPIAAKLGLPYLLVMRAFMGIGEGVAMPAMNNILSKWVPVSERSRSLALVYSG  328

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSVTGLAFSP LIHKFGWPSVFYSFGSLG++WF +WL KA+S+P +DP+L  EEK+L
Sbjct  329   MYLGSVTGLAFSPFLIHKFGWPSVFYSFGSLGSIWFALWLRKAYSTPKEDPDLGVEEKRL  388

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             IL  SVSKEPV  IPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+QVLKFNLTE
Sbjct  389   ILGGSVSKEPVSVIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLKFNLTE  448

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+  VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLT LSHV +
Sbjct  449   SGLLCVLPWLTMAIFANIGGWIADTLVSKGLSITTVRKIMQSIGFLGPAFFLTLLSHVRT  508

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
             PAMAVLCM+CSQG DAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYIL
Sbjct  509   PAMAVLCMSCSQGCDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYIL  568

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             Q GSW+DVFKVSV LY++GT+VWN+FSTGEKILD
Sbjct  569   QRGSWNDVFKVSVVLYIIGTLVWNIFSTGEKILD  602



>ref|XP_010426983.1| PREDICTED: probable anion transporter 2, chloroplastic [Camelina 
sativa]
Length=554

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/460 (78%), Positives = 402/460 (87%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R+ A  KS+   I+D V +SL   D   + +L E + ++ S     FP+RWVIVLLCF++
Sbjct  95    RSRAYYKSEDSDITDGVVDSLPSADGSAEAILVEGNLQSASPWWQQFPRRWVIVLLCFAS  154

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ EY+WS  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VL
Sbjct  155   FLLCNMDRVNMSIAILPMSQEYNWSSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVL  214

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWS ATI+TPIAA+LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  215   GFGVVWWSFATIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  274

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG++WF +WL  A+SSP DDP L 
Sbjct  275   ALVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGSIWFMLWLKYAYSSPKDDPGLS  334

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  335   AEEKKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVL  394

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+  VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFL+Q
Sbjct  395   KFNLTESGLLCVLPWLTMAIFANIGGWIADTLVSRGISITNVRKIMQSIGFLGPAFFLSQ  454

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  455   LSHVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  514

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSWDDVFKV+V LYL+GT+VWNLF+TGEKILD
Sbjct  515   ATGYILQRGSWDDVFKVAVALYLIGTLVWNLFATGEKILD  554



>dbj|BAJ87051.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87622.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87834.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=522

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/519 (71%), Positives = 412/519 (79%), Gaps = 27/519 (5%)
 Frame = -2

Query  1951  PPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRTSWRAWADVKSKTY  1772
             PP   C  +   P +      H +           G G R   +RR + R  ADV+  T 
Sbjct  18    PPPHRCFVDGGSPSQRTGPGLHANN----------GFGVR---VRRRALRG-ADVQPDTP  63

Query  1771  GISDSVPESLKFEDALNDD-----------VLTED--DGETISGGFPKRWVIVLLCFSAF  1631
                    + L  +    +D           +L ED   GE   G FPKRW IV LCFSAF
Sbjct  64    SSRRDGDKPLHADAQQGEDGGVELLDSVRKLLLEDAEPGEEEQGQFPKRWAIVFLCFSAF  123

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAI+PM+ EY W+P TVGLIQSSFFWGYLLTQIAGGIWAD VGGK VLG
Sbjct  124   LLCNMDRVNMSIAIMPMSVEYGWNPQTVGLIQSSFFWGYLLTQIAGGIWADKVGGKTVLG  183

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGV+WWS+AT LTP+AAKLGLPFL IVRAFMGIGEGVAMPAMNN+LSKWVPVSERSRSLA
Sbjct  184   FGVIWWSVATALTPVAAKLGLPFLLIVRAFMGIGEGVAMPAMNNILSKWVPVSERSRSLA  243

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGLAFSP LIHKFGWPSVFYSFGSLGTVWF  W +KA+S+PL+DP +  
Sbjct  244   LVYSGMYLGSVTGLAFSPFLIHKFGWPSVFYSFGSLGTVWFATWATKAYSTPLEDPGISS  303

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
             EEKKLI+  + S EPV +IPW +ILSKPPVWALI  HFCHNWGTFILLTWMPTYY+QVLK
Sbjct  304   EEKKLIISQTTSGEPVTTIPWGVILSKPPVWALIACHFCHNWGTFILLTWMPTYYNQVLK  363

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTES +F VLPWLTMA SA  GGWIAD+LV +G SVT VRKIMQ+IGFLGPAFFL+QL
Sbjct  364   FNLTESSLFCVLPWLTMAISANVGGWIADTLVSRGTSVTTVRKIMQSIGFLGPAFFLSQL  423

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             SH+DSPA+AVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  424   SHIDSPALAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  483

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQHGSWDDVFK+SV LYL+GTV+WN+FSTGEKI+D
Sbjct  484   TGYILQHGSWDDVFKLSVTLYLIGTVIWNIFSTGEKIID  522



>ref|XP_009394618.1| PREDICTED: probable anion transporter 2, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=614

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/460 (78%), Positives = 407/460 (88%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R  A+ KS+ Y + ++  +SL   +  ++ VL   +   +S     FPKRW+IVLLCF +
Sbjct  155   RTRANFKSEQYEVPETQLDSLNSSEMPSEAVLIGANATEVSPWWEQFPKRWLIVLLCFFS  214

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPMA+E++W+P T+GLIQSSFFWGYLLTQI GGIWAD +GGKLVL
Sbjct  215   FLLCNMDRVNMSIAILPMAAEFNWNPATMGLIQSSFFWGYLLTQIVGGIWADKIGGKLVL  274

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWSIATILTPIAAK+GLPFL ++RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  275   GFGVVWWSIATILTPIAAKIGLPFLLVMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSL  334

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFY+FGSLG+VWF +W SKA+SSP +DP L 
Sbjct  335   ALVYSGMYLGSVTGLAFSPILIHKFGWPSVFYAFGSLGSVWFALWQSKAYSSPKEDPALS  394

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEKKLIL  SVSKEPV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  395   AEEKKLILGGSVSKEPVTSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVL  454

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  455   KFNLTESGLFCVLPWLTMAVFANIGGWIADTLVAKGLSITTVRKIMQSIGFLGPAFFLTQ  514

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  515   LSHVRTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  574

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
              TG+ILQ GSWDDVFKVSV LY++GT+VWN+FSTGEKILD
Sbjct  575   VTGFILQRGSWDDVFKVSVVLYIIGTLVWNIFSTGEKILD  614



>ref|XP_004133863.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56509.1| hypothetical protein Csa_3G122330 [Cucumis sativus]
Length=600

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/460 (77%), Positives = 403/460 (88%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R  A+ KS  + ++    ++L   +   D    E++ + +S     FPKRWVIVLLCF +
Sbjct  141   RTSANYKSNDFDMTKGDVDALALAEGSGDAFFMEENEQIVSPWWESFPKRWVIVLLCFFS  200

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVL
Sbjct  201   FLLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKLVL  260

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWSIATILTPIAAK+GLPFL ++RAFMGIGEGVAMPAMNN++SKW+PVSERSRSL
Sbjct  261   GFGVVWWSIATILTPIAAKIGLPFLLMMRAFMGIGEGVAMPAMNNIISKWIPVSERSRSL  320

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL+KA+SSP +DP L 
Sbjct  321   ALVYSGMYLGSVTGLAFSPILIHKFGWPSVFYSFGSLGSIWFALWLTKAYSSPKEDPGLS  380

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              +EKK+I   S+SKEPVK IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  381   AKEKKIIFDGSISKEPVKVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVL  440

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV +G S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  441   KFNLTESGLFCVLPWLTMAVFANIGGWIADTLVSRGFSITTVRKIMQSIGFLGPAFFLTQ  500

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  501   LSHVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  560

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATG+ILQ GSWDDVFKVSV LY++GT+VWN+F+TGEKILD
Sbjct  561   ATGFILQRGSWDDVFKVSVALYIIGTLVWNIFATGEKILD  600



>ref|XP_004155828.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Cucumis 
sativus]
Length=600

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/460 (77%), Positives = 403/460 (88%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R  A+ KS  + ++    ++L   +   D    E++ + +S     FPKRWVIVLLCF +
Sbjct  141   RTSANYKSNDFDMTKGDVDALALAEGSGDAFFMEENEQIVSPWWESFPKRWVIVLLCFFS  200

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVL
Sbjct  201   FLLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKLVL  260

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWSIATILTPIAAK+GLPFL ++RAFMGIGEGVAMPAMNN++SKW+PVSERSRSL
Sbjct  261   GFGVVWWSIATILTPIAAKIGLPFLLMMRAFMGIGEGVAMPAMNNIISKWIPVSERSRSL  320

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL+KA+SSP +DP L 
Sbjct  321   ALVYSGMYLGSVTGLAFSPILIHKFGWPSVFYSFGSLGSIWFALWLTKAYSSPKEDPGLS  380

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              +EKK+I   S+SKEPVK IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  381   AKEKKIIFDGSISKEPVKVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVL  440

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV +G S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  441   KFNLTESGLFCVLPWLTMAVFANIGGWIADTLVSRGFSITTVRKIMQSIGFLGPAFFLTQ  500

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  501   LSHVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  560

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATG+ILQ GSWDDVFKVSV LY++GT+VWN+F+TGEKILD
Sbjct  561   ATGFILQRGSWDDVFKVSVALYIIGTLVWNIFATGEKILD  600



>ref|XP_008654924.1| PREDICTED: sialin isoform X1 [Zea mays]
 gb|AFW79516.1| sialin [Zea mays]
Length=515

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/423 (83%), Positives = 385/423 (91%), Gaps = 0/423 (0%)
 Frame = -2

Query  1702  DDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFF  1523
             D  E   G FPKRW IV LCFSAFLLCNMDRVNMSIAILPM++E+ W+P TVGLIQSSFF
Sbjct  93    DSEEEEQGQFPKRWAIVFLCFSAFLLCNMDRVNMSIAILPMSAEFGWNPQTVGLIQSSFF  152

Query  1522  WGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEG  1343
             WGYLLTQIAGGIWADTVGGK VLGFGVVWWSIAT LTP+AA LGLPFL +VRAFMGIGEG
Sbjct  153   WGYLLTQIAGGIWADTVGGKTVLGFGVVWWSIATALTPVAAHLGLPFLLVVRAFMGIGEG  212

Query  1342  VAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSL  1163
             VAMPAMNN+LSKWVPVSERSRSL++VYSGMYLGSVTGLAFSP+LIHKFGWPSVF+SFGSL
Sbjct  213   VAMPAMNNILSKWVPVSERSRSLSLVYSGMYLGSVTGLAFSPLLIHKFGWPSVFFSFGSL  272

Query  1162  GTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVS  983
             G VWFT W +KA+SSPL+DP +   EKKLI   S + EPVK+IPW+LILSKPPVWALIVS
Sbjct  273   GLVWFTTWATKAYSSPLEDPGISAAEKKLIASQSTAGEPVKTIPWRLILSKPPVWALIVS  332

Query  982   HFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGV  803
             HFCHNWGTFILLTWMPTYY+QVLKFNL ESG+  VLPW TMA SA  GGWIAD+LV +GV
Sbjct  333   HFCHNWGTFILLTWMPTYYNQVLKFNLMESGLICVLPWFTMAVSANVGGWIADTLVSRGV  392

Query  802   SVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAP  623
             SVT VRKIMQ+IGFLGPAFFLTQLSHV+SPAMAVLCM CSQG+DAFSQSGLYSNHQDI P
Sbjct  393   SVTTVRKIMQSIGFLGPAFFLTQLSHVNSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGP  452

Query  622   RYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEK  443
             RY+GVL+GLSNTAGVLAGVFGTAATGYILQHGSWD+VF++SV LYLVGT+VWN+FSTGEK
Sbjct  453   RYAGVLLGLSNTAGVLAGVFGTAATGYILQHGSWDNVFELSVVLYLVGTLVWNVFSTGEK  512

Query  442   ILD  434
             ILD
Sbjct  513   ILD  515



>ref|XP_010419576.1| PREDICTED: probable anion transporter 2, chloroplastic [Camelina 
sativa]
Length=558

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/460 (78%), Positives = 402/460 (87%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R+ A  KS+   I+D V +SL   D   + +L E + +  S     FP+RWVIVLLCF++
Sbjct  99    RSRAYYKSEDSDITDGVVDSLPSADGSAEAILVEGNLQNTSPWWQQFPRRWVIVLLCFAS  158

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ EY+WS  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VL
Sbjct  159   FLLCNMDRVNMSIAILPMSQEYNWSSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVL  218

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWS ATI+TPIAA+LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  219   GFGVVWWSFATIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  278

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG++WF +WL  A+SSP DDP+L 
Sbjct  279   ALVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGSIWFMLWLKYAYSSPKDDPDLS  338

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  339   AEEKKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVL  398

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+  VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFL+Q
Sbjct  399   KFNLTESGLLCVLPWLTMAIFANIGGWIADTLVSRGLSITNVRKIMQSIGFLGPAFFLSQ  458

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  459   LSHVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  518

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSWDDVFKV+V LYL+GT+VWNLF+TGEKILD
Sbjct  519   ATGYILQRGSWDDVFKVAVALYLIGTLVWNLFATGEKILD  558



>ref|XP_007051781.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao]
 gb|EOX95938.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao]
Length=602

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/467 (77%), Positives = 409/467 (88%), Gaps = 6/467 (1%)
 Frame = -2

Query  1822  IRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIV  1652
             IR+   RA+   KS+ Y I+++  + L   +A N+ VL E + +        FPKRW IV
Sbjct  138   IRKNRTRAY--YKSEEYDITEAKVDPLPSPEATNEVVLVEGEMQEAVPWWQSFPKRWFIV  195

Query  1651  LLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTv  1472
             LLCF+AFLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD  
Sbjct  196   LLCFAAFLLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKF  255

Query  1471  ggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVS  1292
             GGKLVLGFGV+WWS+ATILTPIAA++GLPFL  +RAFMGIGEGVAMPAMNNLLSKW+PVS
Sbjct  256   GGKLVLGFGVIWWSVATILTPIAARIGLPFLLTMRAFMGIGEGVAMPAMNNLLSKWIPVS  315

Query  1291  ERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpl  1112
             ERSRSLA+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL KA+SSP 
Sbjct  316   ERSRSLALVYSGMYLGSVTGLAFSPILIHKFGWPSVFYSFGSLGSIWFALWLRKAYSSPN  375

Query  1111  ddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPT  932
             +DP+L  EEKKLI+  S+SKEPVK IPW+LILSK PVWALI+SHFCHNWGTFILLTWMPT
Sbjct  376   EDPKLSKEEKKLIMGGSISKEPVKIIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPT  435

Query  931   YYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGP  752
             YY+QVLKFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGP
Sbjct  436   YYNQVLKFNLTESGLFCVLPWLTMAAFANIGGWIADTLVSKGLSITAVRKIMQSIGFLGP  495

Query  751   AFFLTQLSHVDSPAMAVLCMTCS-QGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVL  575
             AFFLTQLSHV +PAMAVLCM CS QGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVL
Sbjct  496   AFFLTQLSHVRTPAMAVLCMACSQQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVL  555

Query  574   AGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             AGVFGTAATGYILQ GSW+DVFKVSV LY++GT+VWNLFSTGEK+LD
Sbjct  556   AGVFGTAATGYILQRGSWNDVFKVSVALYIIGTLVWNLFSTGEKVLD  602



>emb|CDM82990.1| unnamed protein product [Triticum aestivum]
Length=522

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/453 (79%), Positives = 392/453 (87%), Gaps = 9/453 (2%)
 Frame = -2

Query  1792  DVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMD  1613
              V+     + DSV   L  EDA        + GE   G FPKRW IV LCFSAFLLCNMD
Sbjct  79    QVEGSGVDLLDSV-RKLLLEDA--------EPGEEEQGQFPKRWAIVFLCFSAFLLCNMD  129

Query  1612  RVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWW  1433
             RVNMSIAI+PM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWAD VGGK VLGFGV+WW
Sbjct  130   RVNMSIAIMPMSAEYGWNPQTVGLIQSSFFWGYLLTQIAGGIWADKVGGKTVLGFGVIWW  189

Query  1432  SIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGM  1253
             S+AT LTP+AAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKWVPVSERSRSLA+VYSGM
Sbjct  190   SVATALTPVAAKLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWVPVSERSRSLALVYSGM  249

Query  1252  YLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLI  1073
             YLGSVTGL FSP LIHKFGWPSVFYSFGSLGTVWF  W +KA+S+PL+DP +  EEKKLI
Sbjct  250   YLGSVTGLTFSPFLIHKFGWPSVFYSFGSLGTVWFVTWAAKAYSTPLEDPGISAEEKKLI  309

Query  1072  LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTES  893
             +    S EPV +IPW +ILSKPPVWALI  HFCHNWGTFILLTWMPTYY+QVLKFNLTES
Sbjct  310   ISQITSGEPVTTIPWGVILSKPPVWALIACHFCHNWGTFILLTWMPTYYNQVLKFNLTES  369

Query  892   GMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSP  713
              +F VLPWLTMA SA  GGWIAD+LV +G SVT VRKIMQ+IGFLGPAFFL+QLSH+DSP
Sbjct  370   SLFCVLPWLTMAISANVGGWIADTLVSRGTSVTTVRKIMQSIGFLGPAFFLSQLSHIDSP  429

Query  712   AMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ  533
             A+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ
Sbjct  430   ALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQ  489

Query  532   HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             HGSWDDVFK+SV LYLVGTV+WNLFSTGEKI+D
Sbjct  490   HGSWDDVFKLSVTLYLVGTVIWNLFSTGEKIID  522



>ref|XP_011093131.1| PREDICTED: probable anion transporter 2, chloroplastic [Sesamum 
indicum]
Length=602

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/470 (77%), Positives = 405/470 (86%), Gaps = 2/470 (0%)
 Frame = -2

Query  1837  FRRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTE--DDGETISGGFPKR  1664
             F  G    T  R  AD KS+ Y I+ +  ES    +   +  L E  +  +     FPKR
Sbjct  133   FVDGSKHTTVMRTRADFKSQDYDITGTELESFVSSEGAGEAALLEGVETAKPWWKQFPKR  192

Query  1663  WVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIW  1484
             WV+VLLCF+AFLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIW
Sbjct  193   WVMVLLCFAAFLLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQIVGGIW  252

Query  1483  ADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKW  1304
             AD +GGKLVLGFGVVWWS+AT+LTPIAA++GLPFL ++RAFMGIGEGVAMPAMNNLLSKW
Sbjct  253   ADKIGGKLVLGFGVVWWSVATVLTPIAARIGLPFLLVMRAFMGIGEGVAMPAMNNLLSKW  312

Query  1303  VPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAH  1124
             +PVSERSRSLA+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WLSKAH
Sbjct  313   IPVSERSRSLALVYSGMYLGSVTGLAFSPILIHKFGWPSVFYSFGSLGSIWFALWLSKAH  372

Query  1123  SSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT  944
             SSP +DP+L  EEKKLIL  S+SKEPV  IPWK ILSK PVWALI+SHFCHNWGTFILLT
Sbjct  373   SSPEEDPDLSLEEKKLILGGSISKEPVSRIPWKKILSKAPVWALIISHFCHNWGTFILLT  432

Query  943   WMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIG  764
             WMPTYY+QVLKFNLTESG+  VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IG
Sbjct  433   WMPTYYNQVLKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVSKGLSITSVRKIMQSIG  492

Query  763   FLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTA  584
             FLGPAFFLTQLS+V +PA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTA
Sbjct  493   FLGPAFFLTQLSNVKTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTA  552

Query  583   GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GVLAGVFGTAATGYILQ GSWDDVFKV+V LY+VGT+VWN FSTGEKILD
Sbjct  553   GVLAGVFGTAATGYILQKGSWDDVFKVAVVLYIVGTLVWNFFSTGEKILD  602



>emb|CDP08800.1| unnamed protein product [Coffea canephora]
Length=610

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/456 (78%), Positives = 401/456 (88%), Gaps = 2/456 (0%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLCFSAFLLC  1622
             AD KS+ Y I+++  ESL   +   + VL E+  +T S    FPKRWVIVLLCF++FLLC
Sbjct  155   ADYKSEDYEITEAKLESLVSSEGAGEAVLMEEVVQTNSWWERFPKRWVIVLLCFASFLLC  214

Query  1621  NMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgv  1442
             NMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGV
Sbjct  215   NMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKLVLGFGV  274

Query  1441  VWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVY  1262
             VWWS+AT+LTPIAA++GLPFL  +RAFMGIGEGVAMPAMNNLLSKW+PVSERSRSLA+VY
Sbjct  275   VWWSVATVLTPIAARIGLPFLLAMRAFMGIGEGVAMPAMNNLLSKWIPVSERSRSLALVY  334

Query  1261  SGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeek  1082
             SGMYLGSVTGLA SP+LIH FGWPSVFYSFGSLG +W  +WLSK HSSP +DP++  EE+
Sbjct  335   SGMYLGSVTGLALSPVLIHSFGWPSVFYSFGSLGIIWIALWLSKGHSSPSEDPDISAEER  394

Query  1081  kLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNL  902
             KLIL  S  KEPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNL
Sbjct  395   KLILGGSALKEPVSVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNL  454

Query  901   TESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHV  722
             TESG+F VLPWLTMAF A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQLSHV
Sbjct  455   TESGLFCVLPWLTMAFFANIGGWIADTLVSKGLSITSVRKIMQSIGFLGPAFFLTQLSHV  514

Query  721   DSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGY  542
              +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGY
Sbjct  515   KTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGY  574

Query  541   ILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ILQ GSWD VFKV+V LY++GT+VWN FSTGEK+L+
Sbjct  575   ILQRGSWDSVFKVAVALYILGTLVWNFFSTGEKVLE  610



>ref|XP_011032142.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=531

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/515 (74%), Positives = 420/515 (82%), Gaps = 35/515 (7%)
 Frame = -2

Query  1987  TARALLLSYYNLPPK-LHCSPEATFPKR------SFSSRSHTHTLFEFGSPFLPGRGFRR  1829
             T+RALL S+ +   + L   P+ + PKR      +F  R H H                R
Sbjct  3     TSRALLYSFTDPTFRPLKSPPDISSPKRRPREGLNFRVRLHNH----------------R  46

Query  1828  GLIRRTSWR---------AWADVKSKTYGISDSVPESLKFE-DALNDDVLTEDDGETISG  1679
             G + R S R          +ADVKS+ Y I  SVPES+K E DAL+D VL  D       
Sbjct  47    GCVSRVSVRNSGRGETGKVYADVKSEPYEILKSVPESVKLEEDALDDVVL--DSTMPWWE  104

Query  1678  GFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQI  1499
              FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++E +W+P TVGLIQSSFFWGYLLTQI
Sbjct  105   EFPKRWVIVILCFSAFLLCNMDRVNMSIAILPMSAENNWNPATVGLIQSSFFWGYLLTQI  164

Query  1498  AGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNN  1319
             AGGIWADTVGGK VLGFGV+WWSIATILTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN
Sbjct  165   AGGIWADTVGGKKVLGFGVIWWSIATILTPVAAKVGLPFLLVVRAFMGIGEGVAMPAMNN  224

Query  1318  LLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVW  1139
             +LSKWVPVSERSRSLA VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  W
Sbjct  225   ILSKWVPVSERSRSLAFVYSGMYLGSVTGLAFSPFLIHEFGWPSVFYSFGSLGTVWFAAW  284

Query  1138  LSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGT  959
             LSKAHSSPLDDP+L P EKKLI  NS SKEPV++IPW+LILSK PVWALIVSHFCHNWGT
Sbjct  285   LSKAHSSPLDDPQLRPAEKKLIFANSFSKEPVETIPWRLILSKAPVWALIVSHFCHNWGT  344

Query  958   FILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKI  779
             FILLTWMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKI
Sbjct  345   FILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKI  404

Query  778   MQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMG  599
             MQ+IGFLGPAFFLTQLSH+DSPA+AVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+G
Sbjct  405   MQSIGFLGPAFFLTQLSHIDSPAVAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLG  464

Query  598   LSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVG  494
             LSNTAGVLAGVFGTAATGYILQHG    +  ++ G
Sbjct  465   LSNTAGVLAGVFGTAATGYILQHGKSSSLAFIAAG  499



>ref|XP_010456292.1| PREDICTED: probable anion transporter 2, chloroplastic [Camelina 
sativa]
Length=550

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/460 (78%), Positives = 402/460 (87%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R+ A  KS+   I+D V +SL   D   + +L E + +  S     FP+RWVIVLLCF++
Sbjct  91    RSRAYYKSEDSDITDGVVDSLPSVDGSAEAILVEGNLQNASPWWQQFPRRWVIVLLCFAS  150

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ EY+WS  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VL
Sbjct  151   FLLCNMDRVNMSIAILPMSQEYNWSSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVL  210

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWS ATI+TPIAA+LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  211   GFGVVWWSFATIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  270

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG++WF +WL  A+SSP DDP+L 
Sbjct  271   ALVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGSIWFMLWLKYAYSSPKDDPDLS  330

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  331   AEEKKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVL  390

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+  VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFL+Q
Sbjct  391   KFNLTESGLLCVLPWLTMAIFANIGGWIADTLVSRGLSITNVRKIMQSIGFLGPAFFLSQ  450

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  451   LSHVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  510

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSWDDVFKV+V LYL+GT+VWNLF+TGEKILD
Sbjct  511   ATGYILQRGSWDDVFKVAVALYLIGTLVWNLFATGEKILD  550



>ref|XP_006286375.1| hypothetical protein CARUB_v10000819mg [Capsella rubella]
 gb|EOA19273.1| hypothetical protein CARUB_v10000819mg [Capsella rubella]
Length=491

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/457 (78%), Positives = 399/457 (87%), Gaps = 3/457 (1%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLL  1625
             A  KS+   I+D V +SL   D   + +L + +    S     FP+RWVIVLLCF++FLL
Sbjct  35    AYYKSEDSDITDGVVDSLPSADGSAEAILVDGNLHNTSPWWQQFPRRWVIVLLCFASFLL  94

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ EY+WS  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLGFG
Sbjct  95    CNMDRVNMSIAILPMSQEYNWSSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVLGFG  154

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWS ATI+TPIAA+LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+V
Sbjct  155   VVWWSFATIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALV  214

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG++WF +WL  A+SSP DDP+L  EE
Sbjct  215   YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGSIWFMLWLRYAYSSPKDDPDLSAEE  274

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  275   KKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  334

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+  VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFL+QLSH
Sbjct  335   LTESGLLCVLPWLTMAIFANIGGWIADTLVSRGLSITNVRKIMQSIGFLGPAFFLSQLSH  394

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  395   VKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  454

Query  544   YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             YILQ GSWDDVFKV+V LYL+GT+VWNLFSTGEKILD
Sbjct  455   YILQRGSWDDVFKVAVALYLIGTLVWNLFSTGEKILD  491



>ref|XP_010935846.1| PREDICTED: probable anion transporter 4, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=616

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/464 (77%), Positives = 406/464 (88%), Gaps = 3/464 (1%)
 Frame = -2

Query  1816  RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLL  1646
             R++ R  AD +S+ Y ++    +SL   +  ++ VL   D   +S     FPKRW+IVLL
Sbjct  153   RSAIRPHADFRSEQYEMTGPQMDSLNSSEVPSEAVLFGGDVRKVSHWWEQFPKRWLIVLL  212

Query  1645  CFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvgg  1466
             CF +FLLCNMDRVNMSIAILPM++E+ W+P T+GLIQSSFFWGYLLTQI GGIWAD +GG
Sbjct  213   CFFSFLLCNMDRVNMSIAILPMSTEFKWNPATMGLIQSSFFWGYLLTQIVGGIWADKIGG  272

Query  1465  klvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSER  1286
             KLVLGFGVVWWSIAT+LTPIAAK+GLPFL ++RAFMGIGEGVAMPAMNN+LSKW+PVSER
Sbjct  273   KLVLGFGVVWWSIATVLTPIAAKIGLPFLLVMRAFMGIGEGVAMPAMNNILSKWIPVSER  332

Query  1285  SRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpldd  1106
             SRSLA VYSGMYLGSVTGLA SP+LIH FGWPSVFY+FGSLG++WF +W SKAHSSP  D
Sbjct  333   SRSLAFVYSGMYLGSVTGLALSPILIHNFGWPSVFYAFGSLGSIWFALWQSKAHSSPQQD  392

Query  1105  pellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYY  926
             PEL  EEK+LIL  +VSKEPV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY
Sbjct  393   PELSSEEKRLILGGNVSKEPVSSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYY  452

Query  925   HQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAF  746
             +QVLKFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAF
Sbjct  453   NQVLKFNLTESGLFCVLPWLTMAVFANVGGWIADTLVGKGLSITTVRKIMQSIGFLGPAF  512

Query  745   FLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGV  566
             FLTQLSHV +PA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGV
Sbjct  513   FLTQLSHVRTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGV  572

Query  565   FGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             FGTAATGYILQ GSWDDVFKVSV LY++GT+VWN+F+TGEK+LD
Sbjct  573   FGTAATGYILQRGSWDDVFKVSVALYIIGTLVWNIFATGEKVLD  616



>ref|NP_001042749.1| Os01g0279700 [Oryza sativa Japonica Group]
 sp|Q9SDI4.1|PHT41_ORYSJ RecName: Full=Probable anion transporter 1, chloroplastic; AltName: 
Full=Phosphate transporter 4;1; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAA87831.1| putative solute carrier family 17 (anion/sugar transporter), 
member 5 [Oryza sativa Japonica Group]
 dbj|BAB17729.1| putative Na+-dependen inorganic phosphate cotransporter [Oryza 
sativa Japonica Group]
 dbj|BAF04663.1| Os01g0279700 [Oryza sativa Japonica Group]
 dbj|BAG90539.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94450.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70409.1| hypothetical protein OsI_01403 [Oryza sativa Indica Group]
 gb|EEE54336.1| hypothetical protein OsJ_01311 [Oryza sativa Japonica Group]
Length=529

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/417 (85%), Positives = 381/417 (91%), Gaps = 0/417 (0%)
 Frame = -2

Query  1684  SGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLT  1505
              G FPKRW IV LCFSAFLLCNMDRVNMSIAILPM++E+ W+P TVGLIQSSFFWGYLLT
Sbjct  113   QGQFPKRWAIVFLCFSAFLLCNMDRVNMSIAILPMSAEFGWNPQTVGLIQSSFFWGYLLT  172

Query  1504  QIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAM  1325
             QIAGGIWADTVGGK VLGFGV+WWSIAT LTP AAKLGLPFL + RAFMG+GEGVAMPAM
Sbjct  173   QIAGGIWADTVGGKTVLGFGVIWWSIATALTPFAAKLGLPFLLVTRAFMGVGEGVAMPAM  232

Query  1324  NNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFT  1145
             NN+LSKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP+LIH FGWPSVFYSFGSLG  WF+
Sbjct  233   NNILSKWVPVSERSRSLALVYSGMYLGSVTGLAFSPLLIHNFGWPSVFYSFGSLGVFWFS  292

Query  1144  VWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNW  965
              W SKA+SSPL+DP +  EEKKLI   +   EPVK IPW LILSKPPVWALIVSHFCHNW
Sbjct  293   TWASKAYSSPLEDPGISAEEKKLITSQTTGGEPVKEIPWGLILSKPPVWALIVSHFCHNW  352

Query  964   GTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVR  785
             GTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMA SA  GGWIAD+LV +G+SVT VR
Sbjct  353   GTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAVSANFGGWIADTLVSRGLSVTTVR  412

Query  784   KIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVL  605
             KIMQ+IGFLGPAFFLTQLSH+DSPAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL
Sbjct  413   KIMQSIGFLGPAFFLTQLSHIDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGVL  472

Query  604   MGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             +GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSV LYLVGT+VWNLFSTGEKI+D
Sbjct  473   LGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVVLYLVGTLVWNLFSTGEKIID  529



>ref|XP_010053721.1| PREDICTED: probable anion transporter 2, chloroplastic [Eucalyptus 
grandis]
Length=602

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/518 (71%), Positives = 415/518 (80%), Gaps = 10/518 (2%)
 Frame = -2

Query  1957  NLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRG---LIRRTSW----RA  1799
             NLP + +CS  A +  R       + +        L      R    L+R++      R 
Sbjct  85    NLPDESNCSTLARYRSRGRCYCCASSSSCHVSRSRLHAPQVLRTKNRLVRQSELVKVNRT  144

Query  1798  WADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFL  1628
              A  KS+ Y IS++  E+L   +  +D +L E   +  S     FPKRWV+VLLCF+AFL
Sbjct  145   RAYYKSEDYEISEARLEALTVPEGSSDALLVEGSAQETSPWWEQFPKRWVMVLLCFTAFL  204

Query  1627  LCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgf  1448
             LCNMDRVNMSIAILPM+ E+ W+  TVGLIQSSFFWGYLLTQI GGIWAD  GGKLVLGF
Sbjct  205   LCNMDRVNMSIAILPMSQEFGWNSATVGLIQSSFFWGYLLTQIVGGIWADKSGGKLVLGF  264

Query  1447  gvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAM  1268
             GVVWWS+ATILTPIAAKLGLPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+
Sbjct  265   GVVWWSLATILTPIAAKLGLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLAL  324

Query  1267  VYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpe  1088
             VYSGMYLGSV GLAFSP LIHK GWPSVFYSFGSLG++WF +WL K +SSP  DP L   
Sbjct  325   VYSGMYLGSVAGLAFSPFLIHKCGWPSVFYSFGSLGSIWFALWLRKGYSSPKQDPGLTAN  384

Query  1087  ekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKF  908
             EK+LIL   +S+EPV  IPWKLILSK PVWALIVSHFCHNWGTFILLTWMPTYY+QVLKF
Sbjct  385   EKQLILSGGMSEEPVSVIPWKLILSKAPVWALIVSHFCHNWGTFILLTWMPTYYNQVLKF  444

Query  907   NLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLS  728
             NLTESG+  VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQLS
Sbjct  445   NLTESGLLCVLPWLTMAIFANLGGWIADTLVSKGISITNVRKIMQSIGFLGPAFFLTQLS  504

Query  727   HVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAAT  548
             HV +PA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAAT
Sbjct  505   HVKTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAAT  564

Query  547   GYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GYILQ GSWDDVFKV+V LYL+GT+VWNLFSTGEKILD
Sbjct  565   GYILQRGSWDDVFKVAVVLYLIGTLVWNLFSTGEKILD  602



>ref|XP_010556546.1| PREDICTED: probable anion transporter 2, chloroplastic [Tarenaya 
hassleriana]
Length=571

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/454 (77%), Positives = 397/454 (87%), Gaps = 3/454 (1%)
 Frame = -2

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNM  1616
             KS+ Y I+++  E L+  D   + VL E + +  S     FPKRWVIVLLCF++FLLCNM
Sbjct  118   KSEEYDITETNVEPLRSADGSPEAVLVEGNLQDASPWWQQFPKRWVIVLLCFASFLLCNM  177

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             DRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD  GGK VLGFGV+W
Sbjct  178   DRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKFGGKAVLGFGVIW  237

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WSIAT++TPIAA+LGLPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSG
Sbjct  238   WSIATVMTPIAARLGLPFLLIMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSG  297

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL  A+S+P DDP L  EEK +
Sbjct  298   MYLGSVTGLAFSPVLIHKFGWPSVFYSFGSLGSIWFVLWLKNAYSTPKDDPNLTAEEKMV  357

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             IL  +  +EPV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTE
Sbjct  358   ILGGNKPREPVTVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTE  417

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQLSHV +
Sbjct  418   SGLFCVLPWLTMAVFANLGGWIADTLVSKGLSITAVRKIMQSIGFLGPAFFLTQLSHVKT  477

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
             PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYIL
Sbjct  478   PAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYIL  537

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             Q GSWDDVFKV+V LY+VGT+VWN F+TGEK+LD
Sbjct  538   QRGSWDDVFKVAVALYIVGTLVWNFFATGEKVLD  571



>ref|XP_010255321.1| PREDICTED: probable anion transporter 2, chloroplastic [Nelumbo 
nucifera]
Length=601

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/476 (76%), Positives = 410/476 (86%), Gaps = 8/476 (2%)
 Frame = -2

Query  1840  GFRRGLIRRTSWR----AWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG--  1679
             G   G  ++  +R      AD K + + I++ + +     +A  + VL E + + I+   
Sbjct  127   GISDGQFQKCEYRQATTTRADYKPEHFDITEPL-DPRNTSEASAEVVLVEGNVQKITSWW  185

Query  1678  -GFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQ  1502
               FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQ
Sbjct  186   KQFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQ  245

Query  1501  IAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMN  1322
             I GGIWAD +GGKLVLGFGVVWWS+AT+LTP+AAK+GLPFL I+RAFMGIGEGVAMPAMN
Sbjct  246   IIGGIWADKIGGKLVLGFGVVWWSVATVLTPLAAKVGLPFLLIMRAFMGIGEGVAMPAMN  305

Query  1321  NLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTV  1142
             N+LSKWVPVSERSRSLA+VYSGMYLGSV GLAFSP+LIH FGWPSVFYSFGSLG++WF +
Sbjct  306   NILSKWVPVSERSRSLALVYSGMYLGSVIGLAFSPVLIHNFGWPSVFYSFGSLGSIWFAL  365

Query  1141  WLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWG  962
             WLSKAHSSP +DPEL  EEKKLIL  S SKEPV  IPWKLILSK PVWALI+SHFCHNWG
Sbjct  366   WLSKAHSSPQEDPELHIEEKKLILGESQSKEPVSVIPWKLILSKAPVWALIISHFCHNWG  425

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             TFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRK
Sbjct  426   TFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAVFANLGGWIADTLVSKGLSITAVRK  485

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQ+IGFLGPAFFLTQLS+V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+
Sbjct  486   IMQSIGFLGPAFFLTQLSYVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLL  545

Query  601   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+V LY++GT++WNLF+TGEKILD
Sbjct  546   GLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVALYIIGTLIWNLFATGEKILD  601



>ref|XP_010685595.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=515

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/464 (80%), Positives = 405/464 (87%), Gaps = 9/464 (2%)
 Frame = -2

Query  1822  IRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLC  1643
             IRR+  + WA+VK K   +S     +    DALND VL E   E     FPKRW IV+LC
Sbjct  60    IRRSFGKVWANVKPKPLEVSAESSGT----DALNDGVLEEKWWEE----FPKRWTIVILC  111

Query  1642  FSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggk  1463
             FS+FLLCNMDRVNMSIAILPM++EY W+ TTVGLIQSSFFWGYLLTQ+AGGIWADT+GGK
Sbjct  112   FSSFLLCNMDRVNMSIAILPMSTEYGWNLTTVGLIQSSFFWGYLLTQVAGGIWADTIGGK  171

Query  1462  lvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERS  1283
              VLGF VVWWSIAT LTP+AAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKWVPVSERS
Sbjct  172   TVLGFAVVWWSIATALTPVAAKLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWVPVSERS  231

Query  1282  RSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddp  1103
             RSLA+VYSGMYLGSVTGLAFSP LIH FGWPSVFYSFGSLGTVWF  W SKA +SPL+DP
Sbjct  232   RSLALVYSGMYLGSVTGLAFSPYLIHTFGWPSVFYSFGSLGTVWFAAWQSKACNSPLEDP  291

Query  1102  ellpeekkLIL-RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYY  926
             +L P EKKLIL  +SVSK  +K+IPW  ILSK PVWALIV HFCHNWGTFI+LTWMPTYY
Sbjct  292   DLRPAEKKLILGSSSVSKVSIKNIPWGEILSKRPVWALIVCHFCHNWGTFIILTWMPTYY  351

Query  925   HQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAF  746
             HQVLKFNLT+SGM  VLPWLTMA SA  GGWIAD+LV KG SVT VRKIMQT+GFLGPAF
Sbjct  352   HQVLKFNLTDSGMLCVLPWLTMAISANFGGWIADTLVSKGYSVTTVRKIMQTVGFLGPAF  411

Query  745   FLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGV  566
             FLTQLSHV+SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSG+L+GLSNTAGVLAGV
Sbjct  412   FLTQLSHVNSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGILLGLSNTAGVLAGV  471

Query  565   FGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
              GTAATGYILQHGSWD+VF+VSVGLYLVGTV+WNLFSTGEKILD
Sbjct  472   LGTAATGYILQHGSWDNVFEVSVGLYLVGTVIWNLFSTGEKILD  515



>gb|KCW78082.1| hypothetical protein EUGRSUZ_D02302 [Eucalyptus grandis]
Length=682

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/460 (78%), Positives = 396/460 (86%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R  A  KS+ Y IS++  E+L   +  +D +L E   +  S     FPKRWV+VLLCF+A
Sbjct  223   RTRAYYKSEDYEISEARLEALTVPEGSSDALLVEGSAQETSPWWEQFPKRWVMVLLCFTA  282

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ E+ W+  TVGLIQSSFFWGYLLTQI GGIWAD  GGKLVL
Sbjct  283   FLLCNMDRVNMSIAILPMSQEFGWNSATVGLIQSSFFWGYLLTQIVGGIWADKSGGKLVL  342

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWS+ATILTPIAAKLGLPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  343   GFGVVWWSLATILTPIAAKLGLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSL  402

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSV GLAFSP LIHK GWPSVFYSFGSLG++WF +WL K +SSP  DP L 
Sbjct  403   ALVYSGMYLGSVAGLAFSPFLIHKCGWPSVFYSFGSLGSIWFALWLRKGYSSPKQDPGLT  462

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
               EK+LIL   +S+EPV  IPWKLILSK PVWALIVSHFCHNWGTFILLTWMPTYY+QVL
Sbjct  463   ANEKQLILSGGMSEEPVSVIPWKLILSKAPVWALIVSHFCHNWGTFILLTWMPTYYNQVL  522

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+  VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  523   KFNLTESGLLCVLPWLTMAIFANLGGWIADTLVSKGISITNVRKIMQSIGFLGPAFFLTQ  582

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  583   LSHVKTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  642

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSWDDVFKV+V LYL+GT+VWNLFSTGEKILD
Sbjct  643   ATGYILQRGSWDDVFKVAVVLYLIGTLVWNLFSTGEKILD  682



>ref|XP_010544390.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=570

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/460 (77%), Positives = 401/460 (87%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R+ A  KS+ + I+++  ESL+  D   + VL E   +  S     FPKRWVIVLLCF++
Sbjct  111   RSRAYYKSEEHDITETNMESLQSADGSAEAVLVEGSLQDASPWWQLFPKRWVIVLLCFAS  170

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ +++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVL
Sbjct  171   FLLCNMDRVNMSIAILPMSQQFNWNSATVGLIQSSFFWGYLLTQILGGIWADKIGGKLVL  230

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWSIAT+LTPIAA+LGLPFL  +RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  231   GFGVVWWSIATVLTPIAARLGLPFLLTMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  290

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL  A+SSP DDP L 
Sbjct  291   ALVYSGMYLGSVTGLAFSPVLIHKFGWPSVFYSFGSLGSIWFALWLKYAYSSPKDDPNLT  350

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEKK+IL  S  +EPV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  351   EEEKKVILGGSKPREPVTVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVL  410

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  411   KFNLTESGLFCVLPWLTMAVFANLGGWIADTLVSKGLSITAVRKIMQSIGFLGPAFFLTQ  470

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  471   LSHVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  530

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ G+WDDVFKV+V LY+VGT+VWN F+TGEK+ D
Sbjct  531   ATGYILQRGTWDDVFKVAVALYIVGTLVWNFFATGEKVFD  570



>emb|CDY01998.1| BnaC04g15030D [Brassica napus]
Length=511

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/522 (73%), Positives = 425/522 (81%), Gaps = 14/522 (3%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRT  1811
             M ARALL S    P      P  T P+   + +    +L          R +     R +
Sbjct  1     MNARALLYSPNLHPLYTSNRPPETSPRNRRTLKPDPKSL----------RVWIHQRNRSS  50

Query  1810  SWRAWADVKSKTYGISDSVPESLKF-EDALNDDVLTEDDGETIS--GGFPKRWVIVLLCF  1640
              +R       K    S+S  E++K   + +N + +  D   ++     FPKRWVIVLLCF
Sbjct  51    VFRVLVRSSDKRES-SNSYAETIKEGREIVNGNGVVSDSLSSVPWWEEFPKRWVIVLLCF  109

Query  1639  SAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggkl  1460
             SAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK+
Sbjct  110   SAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKM  169

Query  1459  vlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSR  1280
             VLGFGV+WWSIATILTPIAAKLGLPFL +VRAFMG+GEGVAMPAMNN+LSKWVPV ERSR
Sbjct  170   VLGFGVIWWSIATILTPIAAKLGLPFLLVVRAFMGVGEGVAMPAMNNILSKWVPVQERSR  229

Query  1279  SLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpe  1100
             SLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGT+W T+WL+KA SSP++D  
Sbjct  230   SLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTLWLTLWLTKAESSPIEDLT  289

Query  1099  llpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQ  920
             LLPEE+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPTYYHQ
Sbjct  290   LLPEERKLIADNCASKEPVKSIPWRLILSKPPVWALIGCHFCHNWGTFILLTWMPTYYHQ  349

Query  919   VLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFL  740
             VLKFNL ESG+ +V PWLTMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGPAFFL
Sbjct  350   VLKFNLMESGLLSVFPWLTMAISANAGGWIADTLVSRGFSVTNVRKIMQTIGFLGPAFFL  409

Query  739   TQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFG  560
             TQL H+DSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGV G
Sbjct  410   TQLKHIDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVLG  469

Query  559   TAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  470   TAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  511



>ref|XP_009134563.1| PREDICTED: probable anion transporter 2, chloroplastic [Brassica 
rapa]
Length=539

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/484 (74%), Positives = 408/484 (84%), Gaps = 11/484 (2%)
 Frame = -2

Query  1882  HTLFEFGSPFLPGRGFR-RGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLT  1706
             H+   FG   LP R FR +G   R S+++    +S+  G  D +P +        + +L 
Sbjct  66    HSRRGFGCFLLPTRLFRFKGNTSRASYKS--SEESQGAGAVDPLPYA--------EAILV  115

Query  1705  EDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSF  1526
             + +       FP+RWVIVLLCF++FLLCNMDRVNMSIAILPM+ +Y+W+  TVGLIQSSF
Sbjct  116   QGNASWWQLQFPRRWVIVLLCFASFLLCNMDRVNMSIAILPMSQQYNWNSATVGLIQSSF  175

Query  1525  FWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGE  1346
             FWGYLLTQI GGIWAD  GGK+VLGFGVVWWSIAT++TPIAAKLGLPFL +VRAFMGIGE
Sbjct  176   FWGYLLTQILGGIWADKYGGKVVLGFGVVWWSIATVMTPIAAKLGLPFLLVVRAFMGIGE  235

Query  1345  GVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGS  1166
             GVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGL FSPMLI KFGWPSVFYSFGS
Sbjct  236   GVAMPAMNNMLSKWIPVSERSRSLALVYSGMYLGSVTGLGFSPMLIQKFGWPSVFYSFGS  295

Query  1165  LGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIV  986
             LG++WF +WL  A+SSP DDPEL  EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+
Sbjct  296   LGSIWFLLWLKYAYSSPKDDPELSEEEKKIILGGSKPREPVTVIPWKLILSKPPVWALII  355

Query  985   SHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKG  806
             SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+  VLPW TMA  A  GGWIAD+LV +G
Sbjct  356   SHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVLPWFTMAVLANVGGWIADTLVSRG  415

Query  805   VSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIA  626
             +S+T VRKIMQ+IGFLGPAFFLTQLS V +PAMAVLCM CSQG+DAFSQSGLYSNHQDI 
Sbjct  416   LSITSVRKIMQSIGFLGPAFFLTQLSRVKTPAMAVLCMACSQGADAFSQSGLYSNHQDIG  475

Query  625   PRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGE  446
             PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+VGLYL+GT+VWNLF+TGE
Sbjct  476   PRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVGLYLIGTLVWNLFATGE  535

Query  445   KILD  434
             K+LD
Sbjct  536   KVLD  539



>gb|KHG29407.1| putative anion transporter 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=560

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/457 (79%), Positives = 403/457 (88%), Gaps = 4/457 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLL  1625
             R  A  KS+ Y I+++  +SL   D  N+ +L E D       FPKRWVIVLLCF+AFLL
Sbjct  108   RTSAFYKSEEYDITEAKLDSLPSPDETNEAILVERDIPWWQS-FPKRWVIVLLCFAAFLL  166

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFG
Sbjct  167   CNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKIGGKLVLGFG  226

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWS+ATILTPIAAK+GLPFL I+RAFMGIGEGVAMPAMNNLLSKW+PVSERSRSLA+V
Sbjct  227   VVWWSVATILTPIAAKIGLPFLLIMRAFMGIGEGVAMPAMNNLLSKWIPVSERSRSLALV  286

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL KA+SSP +DPEL  EE
Sbjct  287   YSGMYLGSVTGLAFSPILIHKFGWPSVFYSFGSLGSIWFALWLRKAYSSPEEDPELRKEE  346

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KKLI+  S+SKEPVK IPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  347   KKLIMGGSLSKEPVKVIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  406

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+  VLPWLTMA  A  GGWIAD+LV +G+S+T    IMQ+IGFLGPAFFLTQLS+
Sbjct  407   LTESGLLCVLPWLTMAAFANIGGWIADTLVSRGLSITA---IMQSIGFLGPAFFLTQLSY  463

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  464   VRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  523

Query  544   YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             YILQ GSWDDVFKVSV LY++GT+VWNLFSTGEKILD
Sbjct  524   YILQRGSWDDVFKVSVALYIIGTLVWNLFSTGEKILD  560



>ref|XP_006410024.1| hypothetical protein EUTSA_v10016491mg [Eutrema salsugineum]
 gb|ESQ51477.1| hypothetical protein EUTSA_v10016491mg [Eutrema salsugineum]
Length=537

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/441 (81%), Positives = 383/441 (87%), Gaps = 27/441 (6%)
 Frame = -2

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIA
Sbjct  97    FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIA  156

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GGIWADTVGGK+VLGFGV+WWSIATILTPIAAKLGLPFL +VRAFMG+GEGVAMPAMNNL
Sbjct  157   GGIWADTVGGKMVLGFGVIWWSIATILTPIAAKLGLPFLLVVRAFMGVGEGVAMPAMNNL  216

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             LSKWVPV ERSRSLA+VYSGMY+GSV GLAFSP LIH+FGWPSVFY FGSLGTVW T+WL
Sbjct  217   LSKWVPVQERSRSLALVYSGMYIGSVIGLAFSPFLIHQFGWPSVFYCFGSLGTVWLTLWL  276

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
             +KA SSP++D  LLP+E+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTF
Sbjct  277   TKAESSPVEDLTLLPQERKLIADNCASKEPVKSIPWRLILSKPPVWALICCHFCHNWGTF  336

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             ILLTWMPTYYHQVLKFNL ESG+ +V PWLTMA SA AGGWIAD+LV +G SVT VRKIM
Sbjct  337   ILLTWMPTYYHQVLKFNLMESGLLSVFPWLTMAISANAGGWIADTLVSRGFSVTNVRKIM  396

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYS------  614
             QTIGFLGPAFFLTQL H+DSP MAVLCM CSQG DAFSQSGLYSNHQDIAPRYS      
Sbjct  397   QTIGFLGPAFFLTQLKHIDSPTMAVLCMACSQGLDAFSQSGLYSNHQDIAPRYSVSIINY  456

Query  613   ---------------------GVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSV  497
                                  GVL+GLSNTAGVLAGV GTAATG+ILQHGSWDDVF +SV
Sbjct  457   FFTSHATQKTNGLAHCCCCGQGVLLGLSNTAGVLAGVLGTAATGHILQHGSWDDVFTISV  516

Query  496   GLYLVGTVVWNLFSTGEKILD  434
             GLYLVGTVVWNLFSTGEKI+D
Sbjct  517   GLYLVGTVVWNLFSTGEKIID  537



>ref|XP_006396238.1| hypothetical protein EUTSA_v10028551mg [Eutrema salsugineum]
 gb|ESQ37691.1| hypothetical protein EUTSA_v10028551mg [Eutrema salsugineum]
Length=557

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/457 (78%), Positives = 399/457 (87%), Gaps = 1/457 (0%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLL  1625
             R+ A  KS+   I++ V +SL   D   + VL + +       FP+RWVIVLLCF++FLL
Sbjct  102   RSRAYYKSEESDITEGVVDSLPSADGSAEAVLAQGNLPWWQQ-FPRRWVIVLLCFASFLL  160

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ EY+W+  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLGFG
Sbjct  161   CNMDRVNMSIAILPMSQEYNWNSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVLGFG  220

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWSIATI+TPIAA+LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+V
Sbjct  221   VVWWSIATIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALV  280

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG++WF +WL  A+SSP DDPEL  EE
Sbjct  281   YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGSIWFLLWLKYAYSSPKDDPELSEEE  340

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  341   KKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  400

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+  VLPW TMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFLTQLS 
Sbjct  401   LTESGLLCVLPWFTMAVFANIGGWIADTLVSRGLSITAVRKIMQSIGFLGPAFFLTQLSR  460

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  461   VKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  520

Query  544   YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             YILQ GSWDDVFKV+V LYL+GT+VWNLF+TGEK+LD
Sbjct  521   YILQRGSWDDVFKVAVALYLIGTLVWNLFATGEKVLD  557



>ref|XP_002872956.1| hypothetical protein ARALYDRAFT_912207 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49215.1| hypothetical protein ARALYDRAFT_912207 [Arabidopsis lyrata subsp. 
lyrata]
Length=625

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/457 (78%), Positives = 400/457 (88%), Gaps = 3/457 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLL  1625
             R+ A  KS+   I++ V  S    D   + +L E + +  S  FP+RWVIVLLCF++FLL
Sbjct  172   RSRAYYKSEDSDITEGVVPS---ADGSAEAILVEGNLQNASPWFPRRWVIVLLCFASFLL  228

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ EY+WS  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLGFG
Sbjct  229   CNMDRVNMSIAILPMSQEYNWSSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVLGFG  288

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWS ATI+TPIAA+LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+V
Sbjct  289   VVWWSFATIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALV  348

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG++WF +WL  A+SSP DDP+L  EE
Sbjct  349   YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGSIWFLLWLKFAYSSPKDDPDLSEEE  408

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  409   KKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  468

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+  VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFL+QLSH
Sbjct  469   LTESGLLCVLPWLTMAVFANIGGWIADTLVSRGLSITNVRKIMQSIGFLGPAFFLSQLSH  528

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  529   VKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  588

Query  544   YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             YILQ GSWDDVFKV+V LYL+GT+VWNLF+TGEKILD
Sbjct  589   YILQRGSWDDVFKVAVALYLIGTLVWNLFATGEKILD  625



>ref|XP_011036486.1| PREDICTED: probable anion transporter 2, chloroplastic [Populus 
euphratica]
Length=580

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/501 (73%), Positives = 416/501 (83%), Gaps = 6/501 (1%)
 Frame = -2

Query  1930  PEATFPK-RSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRTSWRAWADVKSKTYGISDSV  1754
             P AT P+ R    + +       GS   P +G  +      + R     KS+ Y I++  
Sbjct  84    PLATCPQQRRGRCKCYLSADPSLGSWLRPNKGKCQHFNHVKAIRTRTYYKSEEYDITEPA  143

Query  1753  P-ESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMA  1577
               +S+K  +  ++ VL     E +    PKRWVIVLLCF+AFLLCNMDRVNMSIAILPM+
Sbjct  144   GVDSMKAAEGSSEVVLVSSWWEQV----PKRWVIVLLCFTAFLLCNMDRVNMSIAILPMS  199

Query  1576  SEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAK  1397
              E+ W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGVVWWS+ATILTPIAA+
Sbjct  200   QEFKWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKLVLGFGVVWWSMATILTPIAAR  259

Query  1396  LGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSP  1217
             +GLPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGLA SP
Sbjct  260   IGLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALVYSGMYLGSVTGLAVSP  319

Query  1216  MLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKS  1037
             MLIHKFGW SVFYSFGSLG++WF +W+ KA+SSP +DPEL P+EKKLIL  +V+KEPV  
Sbjct  320   MLIHKFGWASVFYSFGSLGSIWFALWIKKAYSSPKEDPELSPQEKKLILGGNVAKEPVSV  379

Query  1036  IPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMA  857
             IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+  VLPWLTMA
Sbjct  380   IPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVLPWLTMA  439

Query  856   FSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQG  677
               A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFLTQLSHV +PAMAVLCM CSQG
Sbjct  440   VFANIGGWIADTLVSRGLSITTVRKIMQSIGFLGPAFFLTQLSHVRTPAMAVLCMACSQG  499

Query  676   SDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSV  497
             SDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+V
Sbjct  500   SDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAV  559

Query  496   GLYLVGTVVWNLFSTGEKILD  434
              LY++GT+VWNLFSTGEKILD
Sbjct  560   ALYIIGTLVWNLFSTGEKILD  580



>ref|XP_002275090.1| PREDICTED: probable anion transporter 2, chloroplastic [Vitis 
vinifera]
Length=615

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/460 (77%), Positives = 403/460 (88%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R  +  KSK Y I  +  +SLK  +   + +L E++ +++S     FPKRWVIVLLCF+A
Sbjct  156   RTRSAYKSKEYDIKGADVDSLKSSEGAGEVILAEENLQSVSPWWQQFPKRWVIVLLCFAA  215

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVL
Sbjct  216   FLLCNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKLGGKLVL  275

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGV+WWS+AT+LTPIAA++GLPFL  +RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  276   GFGVIWWSVATVLTPIAARIGLPFLLTMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSL  335

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLA SP LI KFGWPSVFYSFGSLG++WF +WLSKA+SSP +DPEL 
Sbjct  336   ALVYSGMYLGSVTGLAVSPALIQKFGWPSVFYSFGSLGSIWFALWLSKAYSSPAEDPELS  395

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEK++IL  S SKEPV SIPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  396   EEEKRVILGGSTSKEPVSSIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVL  455

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+  VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  456   KFNLTESGLLCVLPWLTMAVFANIGGWIADTLVSKGLSITSVRKIMQSIGFLGPAFFLTQ  515

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             L ++ +PA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  516   LGNIRTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  575

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSW DVFKV+V LY++GT+VWNLF+TGEKILD
Sbjct  576   ATGYILQRGSWGDVFKVAVVLYIIGTLVWNLFATGEKILD  615



>ref|XP_010275631.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X4 [Nelumbo nucifera]
Length=589

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/457 (77%), Positives = 400/457 (88%), Gaps = 3/457 (1%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLL  1625
             AD K + + I++   + L   +  ++ VL E +   I+     FPKRWVIVLLCFSAFLL
Sbjct  133   ADYKPEHFDITEPNLDPLNSSEMSDEVVLVEGNMPKITYWWERFPKRWVIVLLCFSAFLL  192

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGK VLGFG
Sbjct  193   CNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKFVLGFG  252

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWS+AT+LTP+AA++GLPFL I+RA MGIGEGVAMPAMNN+LSKW+PVSERSR+LA+V
Sbjct  253   VVWWSVATVLTPVAARIGLPFLLIMRALMGIGEGVAMPAMNNILSKWIPVSERSRALALV  312

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLA SP+LIHKFGWPSVFYSFGSLG++WFT+WL+KAHSSP +D EL  EE
Sbjct  313   YSGMYLGSVTGLALSPVLIHKFGWPSVFYSFGSLGSIWFTLWLNKAHSSPQEDLELRVEE  372

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KKLIL  S  K+PV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  373   KKLILGGSELKKPVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  432

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+F VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQTIGFLGPAFFLTQLSH
Sbjct  433   LTESGLFCVLPWLTMAVFANIGGWIADTLVSRGLSITSVRKIMQTIGFLGPAFFLTQLSH  492

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             V SPA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  493   VRSPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  552

Query  544   YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             YILQ GSW+DVFKV+V LY++GT++WN F+TGEKILD
Sbjct  553   YILQRGSWNDVFKVAVALYIIGTLIWNFFATGEKILD  589



>ref|XP_009111489.1| PREDICTED: probable anion transporter 2, chloroplastic [Brassica 
rapa]
Length=554

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/505 (72%), Positives = 415/505 (82%), Gaps = 11/505 (2%)
 Frame = -2

Query  1915  PKRSFSSR-SHTHTLF----EFGSPFLPGRGFRRGLIRRTSWRAWAD---VKSKTYGISD  1760
             P+++ S + S  H L      FG    PG    R L  + S +  +      S+   I++
Sbjct  50    PRKTLSLQASLQHDLVVHRTSFGCFLQPGNLEHRSLRFKNSNKNTSRPYYKSSEESDITE  109

Query  1759  SVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAI  1589
              V +SL   D   + +L + + +  S     FP+RWVIVLLCF++FLLCNMDRVNMSIAI
Sbjct  110   EVVDSLSSADGSAEAILVQGNQQNASPWWKQFPRRWVIVLLCFASFLLCNMDRVNMSIAI  169

Query  1588  LPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTP  1409
             LPM+ +Y+W+  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLGFGVVWWSIAT++TP
Sbjct  170   LPMSQQYNWNSATVGLIQSSFFWGYLLTQILGGIWADKYGGKVVLGFGVVWWSIATVMTP  229

Query  1408  IAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGL  1229
             IAAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGL
Sbjct  230   IAAKLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSGMYLGSVTGL  289

Query  1228  AFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKE  1049
              FSPMLI KFGWPSVFYSFGSLG++WF +WL  A+SSP DDPEL  EEKK+IL  S  +E
Sbjct  290   GFSPMLIQKFGWPSVFYSFGSLGSIWFLLWLKYAYSSPKDDPELSEEEKKIILGGSKPRE  349

Query  1048  PVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPW  869
             PV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+  VLPW
Sbjct  350   PVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVLPW  409

Query  868   LTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMT  689
              TMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFLTQLS V +PAMAVLCM 
Sbjct  410   FTMAVLANVGGWIADTLVSRGLSITSVRKIMQSIGFLGPAFFLTQLSRVKTPAMAVLCMA  469

Query  688   CSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVF  509
             CSQG+DAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSWDDVF
Sbjct  470   CSQGADAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWDDVF  529

Query  508   KVSVGLYLVGTVVWNLFSTGEKILD  434
             KV+VGLYL+GT+VWNLF+TGEK+LD
Sbjct  530   KVAVGLYLIGTLVWNLFATGEKVLD  554



>ref|XP_010275627.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=625

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/457 (77%), Positives = 400/457 (88%), Gaps = 3/457 (1%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLL  1625
             AD K + + I++   + L   +  ++ VL E +   I+     FPKRWVIVLLCFSAFLL
Sbjct  169   ADYKPEHFDITEPNLDPLNSSEMSDEVVLVEGNMPKITYWWERFPKRWVIVLLCFSAFLL  228

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGK VLGFG
Sbjct  229   CNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKFVLGFG  288

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWS+AT+LTP+AA++GLPFL I+RA MGIGEGVAMPAMNN+LSKW+PVSERSR+LA+V
Sbjct  289   VVWWSVATVLTPVAARIGLPFLLIMRALMGIGEGVAMPAMNNILSKWIPVSERSRALALV  348

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLA SP+LIHKFGWPSVFYSFGSLG++WFT+WL+KAHSSP +D EL  EE
Sbjct  349   YSGMYLGSVTGLALSPVLIHKFGWPSVFYSFGSLGSIWFTLWLNKAHSSPQEDLELRVEE  408

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KKLIL  S  K+PV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  409   KKLILGGSELKKPVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  468

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+F VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQTIGFLGPAFFLTQLSH
Sbjct  469   LTESGLFCVLPWLTMAVFANIGGWIADTLVSRGLSITSVRKIMQTIGFLGPAFFLTQLSH  528

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             V SPA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  529   VRSPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  588

Query  544   YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             YILQ GSW+DVFKV+V LY++GT++WN F+TGEKILD
Sbjct  589   YILQRGSWNDVFKVAVALYIIGTLIWNFFATGEKILD  625



>ref|XP_010275629.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X3 [Nelumbo nucifera]
 ref|XP_010275630.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X3 [Nelumbo nucifera]
Length=618

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/457 (77%), Positives = 400/457 (88%), Gaps = 3/457 (1%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLL  1625
             AD K + + I++   + L   +  ++ VL E +   I+     FPKRWVIVLLCFSAFLL
Sbjct  162   ADYKPEHFDITEPNLDPLNSSEMSDEVVLVEGNMPKITYWWERFPKRWVIVLLCFSAFLL  221

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGK VLGFG
Sbjct  222   CNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKFVLGFG  281

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWS+AT+LTP+AA++GLPFL I+RA MGIGEGVAMPAMNN+LSKW+PVSERSR+LA+V
Sbjct  282   VVWWSVATVLTPVAARIGLPFLLIMRALMGIGEGVAMPAMNNILSKWIPVSERSRALALV  341

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLA SP+LIHKFGWPSVFYSFGSLG++WFT+WL+KAHSSP +D EL  EE
Sbjct  342   YSGMYLGSVTGLALSPVLIHKFGWPSVFYSFGSLGSIWFTLWLNKAHSSPQEDLELRVEE  401

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KKLIL  S  K+PV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  402   KKLILGGSELKKPVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  461

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+F VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQTIGFLGPAFFLTQLSH
Sbjct  462   LTESGLFCVLPWLTMAVFANIGGWIADTLVSRGLSITSVRKIMQTIGFLGPAFFLTQLSH  521

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             V SPA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  522   VRSPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  581

Query  544   YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             YILQ GSW+DVFKV+V LY++GT++WN F+TGEKILD
Sbjct  582   YILQRGSWNDVFKVAVALYIIGTLIWNFFATGEKILD  618



>ref|XP_011080691.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
[Sesamum indicum]
Length=390

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/390 (91%), Positives = 375/390 (96%), Gaps = 0/390 (0%)
 Frame = -2

Query  1603  MSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIA  1424
             MSIAILPMASE+HWSPTTVGLIQSSFFWGYLLTQ+AGGIWADTVGGK VLGFGVVWWSIA
Sbjct  1     MSIAILPMASEFHWSPTTVGLIQSSFFWGYLLTQVAGGIWADTVGGKSVLGFGVVWWSIA  60

Query  1423  TILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLG  1244
             T LTPIAAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKWVPVSERSRSLA+VYSGMYLG
Sbjct  61    TALTPIAAKLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWVPVSERSRSLALVYSGMYLG  120

Query  1243  SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRN  1064
             SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWF++WL+KAHSSP +DPELLP+EKKLIL N
Sbjct  121   SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFSLWLNKAHSSPREDPELLPQEKKLILCN  180

Query  1063  SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMF  884
               SKEPVKSIPW+LILSK PVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESG+ 
Sbjct  181   CTSKEPVKSIPWRLILSKSPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGLL  240

Query  883   AVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMA  704
             +V PWLTMAFSA  GGWIAD+LV +GVSVT+VRKIMQTIGFLGPAFFLTQL H+DSPAMA
Sbjct  241   SVFPWLTMAFSANLGGWIADTLVSRGVSVTMVRKIMQTIGFLGPAFFLTQLKHIDSPAMA  300

Query  703   VLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGS  524
             VLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVFGTAATGYILQHGS
Sbjct  301   VLCMACSQGADAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVFGTAATGYILQHGS  360

Query  523   WDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             WDDVF+VSVGLYLVGTVVWNLFSTGEKILD
Sbjct  361   WDDVFEVSVGLYLVGTVVWNLFSTGEKILD  390



>ref|XP_002511874.1| Sialin, putative [Ricinus communis]
 gb|EEF50543.1| Sialin, putative [Ricinus communis]
Length=571

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/457 (78%), Positives = 399/457 (87%), Gaps = 8/457 (2%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLL  1625
             R  A  KS+ Y I+ +   S       ++ VL E +       FPKRWVIVLLCF AFLL
Sbjct  123   RTRAHYKSEEYDITQAAEGS-------SEAVLVEGNLPWWEQ-FPKRWVIVLLCFMAFLL  174

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYL+TQI GGIWAD +GGKLVLGFG
Sbjct  175   CNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLMTQIVGGIWADKIGGKLVLGFG  234

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWSIAT+LTPIAA++GLPFL ++RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+V
Sbjct  235   VVWWSIATVLTPIAARIGLPFLLMMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALV  294

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSV GLA SP+LI KFGWPSVFYSFGSLG++WF +WL KA+SSP +DPEL  +E
Sbjct  295   YSGMYLGSVMGLAVSPVLIQKFGWPSVFYSFGSLGSIWFALWLRKAYSSPKEDPELSAQE  354

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KKLIL  SVSKEPV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  355   KKLILGGSVSKEPVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  414

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+F VLPWLTMAF A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQLSH
Sbjct  415   LTESGLFCVLPWLTMAFFANIGGWIADTLVSKGLSITAVRKIMQSIGFLGPAFFLTQLSH  474

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  475   VRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  534

Query  544   YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             YILQ GSWDDVFKV+V LY++GT+VWNLFSTGEKILD
Sbjct  535   YILQRGSWDDVFKVAVVLYIIGTLVWNLFSTGEKILD  571



>ref|XP_010544389.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=603

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/460 (77%), Positives = 401/460 (87%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R+ A  KS+ + I+++  ESL+  D   + VL E   +  S     FPKRWVIVLLCF++
Sbjct  144   RSRAYYKSEEHDITETNMESLQSADGSAEAVLVEGSLQDASPWWQLFPKRWVIVLLCFAS  203

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ +++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVL
Sbjct  204   FLLCNMDRVNMSIAILPMSQQFNWNSATVGLIQSSFFWGYLLTQILGGIWADKIGGKLVL  263

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWSIAT+LTPIAA+LGLPFL  +RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  264   GFGVVWWSIATVLTPIAARLGLPFLLTMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  323

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFYSFGSLG++WF +WL  A+SSP DDP L 
Sbjct  324   ALVYSGMYLGSVTGLAFSPVLIHKFGWPSVFYSFGSLGSIWFALWLKYAYSSPKDDPNLT  383

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEKK+IL  S  +EPV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  384   EEEKKVILGGSKPREPVTVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVL  443

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  444   KFNLTESGLFCVLPWLTMAVFANLGGWIADTLVSKGLSITAVRKIMQSIGFLGPAFFLTQ  503

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  504   LSHVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  563

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ G+WDDVFKV+V LY+VGT+VWN F+TGEK+ D
Sbjct  564   ATGYILQRGTWDDVFKVAVALYIVGTLVWNFFATGEKVFD  603



>ref|XP_004492749.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Cicer 
arietinum]
Length=539

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/460 (76%), Positives = 398/460 (87%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             RA    +S+ Y I+++  + +  ++   + ++ E +G  +S      PKRWVIVLLCF+A
Sbjct  80    RACVHYRSEEYDIAETKVDPVASDEGTGEAIILEGNGTPVSPWWQKLPKRWVIVLLCFTA  139

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ EY+W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGK+VL
Sbjct  140   FLLCNMDRVNMSIAILPMSQEYNWNSATVGLIQSSFFWGYLLTQILGGIWADKLGGKVVL  199

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWS+AT+LTPIAA++GLP+L I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  200   GFGVVWWSMATVLTPIAARIGLPYLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSL  259

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             ++VYSGMYLGSV GLAFSPMLI  FGW SVFYSFGSLG++WF  WL KA+SSP DDP+L 
Sbjct  260   SLVYSGMYLGSVVGLAFSPMLIQNFGWASVFYSFGSLGSIWFAFWLRKAYSSPKDDPDLG  319

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEK+LIL   VSK PV  IPWKLILSKP VWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  320   AEEKRLILEGGVSKAPVSDIPWKLILSKPAVWALIISHFCHNWGTFILLTWMPTYYNQVL  379

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+  VLPWLTMA  A  GGWIAD+LV KG S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  380   KFNLTESGLLCVLPWLTMAIFANIGGWIADTLVSKGFSITTVRKIMQSIGFLGPAFFLTQ  439

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  440   LSHVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  499

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSW+DVFKVSV LY++GT+VWN+FSTGEKILD
Sbjct  500   ATGYILQRGSWNDVFKVSVALYIIGTLVWNIFSTGEKILD  539



>ref|XP_009629837.1| PREDICTED: probable anion transporter 2, chloroplastic [Nicotiana 
tomentosiformis]
Length=604

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/459 (76%), Positives = 402/459 (88%), Gaps = 3/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLCFSAF  1631
             R  AD KS  Y I+ ++ ESL   +  ++ +L E+  ++      FP+RW++VLLCF+AF
Sbjct  147   RTQADYKSDEYDITGAL-ESLVSSEGASEAILVEEVEQSKPWWEQFPRRWIVVLLCFAAF  205

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGK+VLG
Sbjct  206   LLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKLGGKVVLG  265

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGVVWWSIAT+LTPIAA++GLPFL +VRA MGIGEGVAMPAMNN+LSKW+PVSERSRSLA
Sbjct  266   FGVVWWSIATVLTPIAARMGLPFLLVVRALMGIGEGVAMPAMNNMLSKWIPVSERSRSLA  325

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGLAFSP+LI KFGWPSVFYSFGSLG++WF +WL+KA+SSP DDP L  
Sbjct  326   LVYSGMYLGSVTGLAFSPILIQKFGWPSVFYSFGSLGSIWFALWLTKAYSSPKDDPGLSA  385

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
              EK+LI+  SVSKEPV +IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY QVLK
Sbjct  386   LEKRLIMGGSVSKEPVSNIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYSQVLK  445

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+  VLPWLTMA  A  GGWIAD+LV KG S+T VRKIMQ+IGFLGPAFFL+QL
Sbjct  446   FNLTESGLLCVLPWLTMAVFANVGGWIADTLVSKGFSITSVRKIMQSIGFLGPAFFLSQL  505

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             SHV +PA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  506   SHVRTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  565

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWDDVFKV+V LY++GT+VWN FSTGE+IL+
Sbjct  566   TGYILQKGSWDDVFKVAVILYIIGTLVWNFFSTGERILE  604



>ref|XP_006445019.1| hypothetical protein CICLE_v10024243mg [Citrus clementina]
 ref|XP_006491126.1| PREDICTED: probable anion transporter 2, chloroplastic-like isoform 
X1 [Citrus sinensis]
 gb|ESR58259.1| hypothetical protein CICLE_v10024243mg [Citrus clementina]
 gb|KDO86198.1| hypothetical protein CISIN_1g007159mg [Citrus sinensis]
Length=615

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/460 (77%), Positives = 402/460 (87%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R  A  KS  Y I+++  +SL+  +  ++ VL + D +  S     FPKRWV+VLLCFSA
Sbjct  156   RICAFYKSDEYDITEAKVDSLQSTEIPSEAVLPDGDLQETSPWWEQFPKRWVVVLLCFSA  215

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ E++W+ TTVGLIQSSFFWGYLLTQI GGIWAD  GGK VL
Sbjct  216   FLLCNMDRVNMSIAILPMSKEFNWNSTTVGLIQSSFFWGYLLTQIVGGIWADKFGGKPVL  275

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGV+WWS+AT+LTP+AA++GLPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  276   GFGVIWWSVATVLTPVAARIGLPFLLIMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  335

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A VYSGMYLGSVTGLA SP+LI KFGWPSVFYSFGSLG++WF +WL KA+SSP +DPEL 
Sbjct  336   AFVYSGMYLGSVTGLAVSPILIQKFGWPSVFYSFGSLGSIWFALWLKKAYSSPKEDPELR  395

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEK+ IL  S+SKE V  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  396   AEEKRHILGGSISKEAVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVL  455

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  456   KFNLTESGLFCVLPWLTMAVFANMGGWIADTLVSKGLSITAVRKIMQSIGFLGPAFFLTQ  515

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  516   LSHVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  575

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSWDDVFKV+V LY++GT+VWNLF+TGE++L+
Sbjct  576   ATGYILQRGSWDDVFKVAVVLYIIGTLVWNLFATGERVLE  615



>ref|XP_008244637.1| PREDICTED: probable anion transporter 2, chloroplastic [Prunus 
mume]
Length=607

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/476 (74%), Positives = 407/476 (86%), Gaps = 4/476 (1%)
 Frame = -2

Query  1852  LPGRGFRRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG--  1679
             L  R +++  + + + R  A  KS+   I+    +SL   +  ++ VL + +   +S   
Sbjct  133   LDNRQYQKYELVKVN-RTRAYYKSEDNDITKPEVDSLSSIEGSSEAVLADGNVLKLSSWW  191

Query  1678  -GFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQ  1502
               FPKRWVIVLLCF+AFLLCNMDRVNMSIAILPM+ E++W   TVGLIQSSFFWGYLLTQ
Sbjct  192   EQFPKRWVIVLLCFTAFLLCNMDRVNMSIAILPMSQEFNWDSATVGLIQSSFFWGYLLTQ  251

Query  1501  IAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMN  1322
             I GGIWAD +GGK VLGFGV+WWS+AT+LTP+AAK+ LPFL I+RAFMGIGEGVAMPAMN
Sbjct  252   ILGGIWADKIGGKRVLGFGVIWWSVATVLTPVAAKISLPFLLIMRAFMGIGEGVAMPAMN  311

Query  1321  NLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTV  1142
             N+LSKW+PVSERSR+L++VYSGMYLGSVTGLAFSP+LI KF WPSVFYSFGSLG++WF +
Sbjct  312   NILSKWIPVSERSRALSLVYSGMYLGSVTGLAFSPILIQKFKWPSVFYSFGSLGSIWFAL  371

Query  1141  WLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWG  962
             WL KA+SSP +DPEL  EEK+LI+  ++SKEPV  IPWKLILSKPPVWALI+ HFCHNWG
Sbjct  372   WLKKAYSSPKEDPELSTEEKELIMGGNISKEPVTVIPWKLILSKPPVWALIICHFCHNWG  431

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             TFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMA  A  GGWIAD+LV +G+SVT VRK
Sbjct  432   TFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAVFANIGGWIADTLVSRGLSVTTVRK  491

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQ+IGFLGPAFFL+QLS V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRYSGVL+
Sbjct  492   IMQSIGFLGPAFFLSQLSRVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYSGVLL  551

Query  601   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+V LYLVGT++WN+FSTGEKILD
Sbjct  552   GLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVALYLVGTLIWNIFSTGEKILD  607



>gb|EYU32134.1| hypothetical protein MIMGU_mgv1a003431mg [Erythranthe guttata]
Length=585

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/436 (81%), Positives = 391/436 (90%), Gaps = 2/436 (0%)
 Frame = -2

Query  1735  EDALNDDVLTE--DDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHW  1562
              +  ++DVL E  +  +     FPKRW++VLLCF+AFLLCNMDRVNMSIAILPM+ E++W
Sbjct  150   NEGTSEDVLIEGVEPAKPWWQKFPKRWLMVLLCFAAFLLCNMDRVNMSIAILPMSKEFNW  209

Query  1561  SPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPF  1382
                TVGLIQSSFFWGYLLTQI GGIWAD VGGKLVLGFGVVWWSIATILTPIAAKLGLPF
Sbjct  210   DSATVGLIQSSFFWGYLLTQIVGGIWADKVGGKLVLGFGVVWWSIATILTPIAAKLGLPF  269

Query  1381  LFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHK  1202
             L ++RAFMGIGEGVAMPAMNNLLSKW+PVSERSRSLA+VYSGMYLGSVTGLAFSP+LIHK
Sbjct  270   LLVMRAFMGIGEGVAMPAMNNLLSKWIPVSERSRSLALVYSGMYLGSVTGLAFSPILIHK  329

Query  1201  FGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKL  1022
             FGWPSVFYSFGSLG++WF +WLSKAHSSP DDP L  EEK+LIL  SVSKEPV  IPWK 
Sbjct  330   FGWPSVFYSFGSLGSIWFAIWLSKAHSSPKDDPNLNLEEKELILGGSVSKEPVTEIPWKK  389

Query  1021  ILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYA  842
             ILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+  VLPWLTMA  A  
Sbjct  390   ILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVLPWLTMAVFANI  449

Query  841   GGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFS  662
             GGWIAD+L+ KG+S+T VRKIMQ+IGFLGPAFFL+QLS V +PA+AVLCM+CSQG DAFS
Sbjct  450   GGWIADTLISKGLSITTVRKIMQSIGFLGPAFFLSQLSKVKTPALAVLCMSCSQGLDAFS  509

Query  661   QSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLV  482
             QSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+V LY++
Sbjct  510   QSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQKGSWDDVFKVAVVLYII  569

Query  481   GTVVWNLFSTGEKILD  434
             GT+VWNLF+TGEKILD
Sbjct  570   GTLVWNLFATGEKILD  585



>ref|XP_006339586.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Solanum 
tuberosum]
Length=606

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/459 (76%), Positives = 401/459 (87%), Gaps = 3/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTE--DDGETISGGFPKRWVIVLLCFSAF  1631
             RA AD KS  Y I+ ++   +  E A ++ +L E  +  +     FP+RW++VLLCF+AF
Sbjct  149   RAQADFKSDGYDITGALGSLMSSEGA-SETILVEGVEQAKPWWEQFPRRWIVVLLCFAAF  207

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGK+VLG
Sbjct  208   LLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKLGGKVVLG  267

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGV+WWSIAT+LTP AA+LGLPFL +VRA MGIGEGVAMPAMNN+LSKW+PVSERSRSLA
Sbjct  268   FGVIWWSIATVLTPFAARLGLPFLLVVRALMGIGEGVAMPAMNNMLSKWIPVSERSRSLA  327

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGLAFSPMLI KFGWPSVFYSFGSLG++WF +WL+KA+S+P DDP L  
Sbjct  328   LVYSGMYLGSVTGLAFSPMLIQKFGWPSVFYSFGSLGSIWFALWLTKAYSTPKDDPGLSE  387

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
             +EK+LI+  SVSKEPV +IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY QVLK
Sbjct  388   QEKRLIMDGSVSKEPVTNIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYSQVLK  447

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+F VLPWLTMA  A  GGWIAD+LV KG S+T VRKIMQ+IGFLGPAFFLTQL
Sbjct  448   FNLTESGLFCVLPWLTMAIFANLGGWIADTLVSKGFSITSVRKIMQSIGFLGPAFFLTQL  507

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             SHV +PA AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  508   SHVKTPAFAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  567

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWDDVFKV+V LY++GT+VWN FSTGE+IL+
Sbjct  568   TGYILQKGSWDDVFKVAVVLYIIGTLVWNFFSTGERILE  606



>ref|XP_007220200.1| hypothetical protein PRUPE_ppa003069mg [Prunus persica]
 gb|EMJ21399.1| hypothetical protein PRUPE_ppa003069mg [Prunus persica]
Length=607

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/460 (77%), Positives = 398/460 (87%), Gaps = 3/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG---GFPKRWVIVLLCFSA  1634
             R  A  KS+   I+    +SL   +  ++ VL + +   +S     FPKRWVIVLLCF+A
Sbjct  148   RTRAYYKSEDNDITKPEVDSLSSIEGSSEAVLADGNVLKLSSWWEQFPKRWVIVLLCFTA  207

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ E++W   TVGLIQSSFFWGYLLTQI GGIWAD +GGK VL
Sbjct  208   FLLCNMDRVNMSIAILPMSQEFNWDSATVGLIQSSFFWGYLLTQILGGIWADKIGGKRVL  267

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWS+ATILTPIAAK+ LPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSR+L
Sbjct  268   GFGVVWWSVATILTPIAAKISLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRAL  327

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             ++VYSGMYLGSVTGLAFSP+LI KF WPSVFYSFGSLG++WF +WL KA+SSP +DPEL 
Sbjct  328   SLVYSGMYLGSVTGLAFSPILIQKFKWPSVFYSFGSLGSIWFALWLKKAYSSPKEDPELS  387

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
               EK+LI+  ++SKEPV  IPWKLILSKPPVWALI+ HFCHNWGTFILLTWMPTYY+QVL
Sbjct  388   TGEKELIMGGNISKEPVTVIPWKLILSKPPVWALIICHFCHNWGTFILLTWMPTYYNQVL  447

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV +G+SVT VRKIMQ+IGFLGPAFFL+Q
Sbjct  448   KFNLTESGLFCVLPWLTMAVFANIGGWIADTLVSRGLSVTTVRKIMQSIGFLGPAFFLSQ  507

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LS V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRYSGVL+GLSNTAGVLAGVFGTA
Sbjct  508   LSRVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYSGVLLGLSNTAGVLAGVFGTA  567

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSWDDVFKV+V LYLVGT++WNLFSTGEKILD
Sbjct  568   ATGYILQRGSWDDVFKVAVALYLVGTLIWNLFSTGEKILD  607



>ref|NP_567175.2| inorganic phosphate transporter PHT4;4 [Arabidopsis thaliana]
 sp|Q8GX78.1|ANTR2_ARATH RecName: Full=Probable anion transporter 2, chloroplastic; AltName: 
Full=Phosphate transporter PHT4;4; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAC43000.1| unknown protein [Arabidopsis thaliana]
 gb|AAP78931.1| At4g00370 [Arabidopsis thaliana]
 gb|AEE81870.1| inorganic phosphate transporter PHT4;4 [Arabidopsis thaliana]
Length=541

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/460 (78%), Positives = 399/460 (87%), Gaps = 6/460 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R+ A  KS+   I++ V  S    D   + +L E + +  S     FP+RWVIVLLCFS+
Sbjct  85    RSRAYYKSEESDITEGVVPS---ADGSAEAILVEGNLQNASPWWQQFPRRWVIVLLCFSS  141

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ EY+WS  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VL
Sbjct  142   FLLCNMDRVNMSIAILPMSQEYNWSSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVL  201

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWS ATI+TPIAA+LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  202   GFGVVWWSFATIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  261

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSPMLI KFGWPSVFYSFGSLG++WF +WL  A+SSP DDP+L 
Sbjct  262   ALVYSGMYLGSVTGLAFSPMLITKFGWPSVFYSFGSLGSIWFLLWLKFAYSSPKDDPDLS  321

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  322   EEEKKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVL  381

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+  VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFL+Q
Sbjct  382   KFNLTESGLLCVLPWLTMAVFANIGGWIADTLVSRGLSITNVRKIMQSIGFLGPAFFLSQ  441

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  442   LSHVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  501

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSWDDVFKV+V LYL+GT+VWNLF+TGEKILD
Sbjct  502   ATGYILQRGSWDDVFKVAVALYLIGTLVWNLFATGEKILD  541



>ref|XP_003623974.1| Sodium-dependent phosphate transport protein [Medicago truncatula]
 gb|AES80192.1| phosphate transporter [Medicago truncatula]
Length=534

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/492 (73%), Positives = 406/492 (83%), Gaps = 14/492 (3%)
 Frame = -2

Query  1897  SRSHTHTLFEFGSPFLPGRGFRR-GLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALN  1721
             SRSH      +G       G R+   I RT         S+ YGI ++  + +  ++   
Sbjct  53    SRSHVEQREVYG------LGVRKLNKINRTC----VHYSSEEYGIDETKVDPVASDEGTG  102

Query  1720  DDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTT  1550
             + +  E +G  +S      PKRW+IVLLCF+AFLLCNMDRVNMSIAILPM+ E++W+  T
Sbjct  103   EAIPLEGNGSPVSPWWQQLPKRWLIVLLCFTAFLLCNMDRVNMSIAILPMSQEFNWNSAT  162

Query  1549  VGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIV  1370
             VGLIQSSFFWGYLLTQI GGIWAD +GGK+VLGFGVVWWS+ATILTPIAA++GLP+L I+
Sbjct  163   VGLIQSSFFWGYLLTQILGGIWADKLGGKVVLGFGVVWWSMATILTPIAARIGLPYLLIM  222

Query  1369  RAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWP  1190
             RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL++VYSGMYLGSV GLAFSP LI   GWP
Sbjct  223   RAFMGIGEGVAMPAMNNILSKWIPVSERSRSLSLVYSGMYLGSVVGLAFSPFLIQNLGWP  282

Query  1189  SVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSK  1010
             SVFYSFGSLG++WF  WL KA+SSP DDP+L  EEKKLIL   VSK PV  IPWKLILSK
Sbjct  283   SVFYSFGSLGSIWFAFWLRKAYSSPKDDPDLGVEEKKLILEGGVSKTPVSDIPWKLILSK  342

Query  1009  PPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWI  830
              PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+  VLPWLTMA  A  GGWI
Sbjct  343   APVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVLPWLTMAVFANIGGWI  402

Query  829   ADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGL  650
             AD+LV KGVS+T VRKIMQ+IGFLGPAFFLTQLSHV +PAMAVLCM CSQGSDAFSQSGL
Sbjct  403   ADTLVSKGVSITTVRKIMQSIGFLGPAFFLTQLSHVKTPAMAVLCMACSQGSDAFSQSGL  462

Query  649   YSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVV  470
             YSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSW+DVFKVSV LY++GT+V
Sbjct  463   YSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWNDVFKVSVALYIIGTLV  522

Query  469   WNLFSTGEKILD  434
             WN+FSTGEKILD
Sbjct  523   WNIFSTGEKILD  534



>ref|XP_010326478.1| PREDICTED: probable anion transporter 2, chloroplastic [Solanum 
lycopersicum]
Length=606

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/459 (77%), Positives = 401/459 (87%), Gaps = 3/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTE--DDGETISGGFPKRWVIVLLCFSAF  1631
             RA AD KS  Y I+ ++   +  E A ++ +L E  +  +     FP+RW++VLLCF+AF
Sbjct  149   RAQADFKSDGYDITGALGSLMSSEGA-SEAILVEGVEQAKPWWEQFPRRWIVVLLCFAAF  207

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGK+VLG
Sbjct  208   LLCNMDRVNMSIAILPMSKEFNWNNATVGLIQSSFFWGYLLTQIVGGIWADKLGGKVVLG  267

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGVVWWSIAT+LTP AA+LGLPFL +VRA MGIGEGVAMPAMNN+LSKW+PVSERSRSLA
Sbjct  268   FGVVWWSIATVLTPFAARLGLPFLLVVRALMGIGEGVAMPAMNNMLSKWIPVSERSRSLA  327

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGLAFSP+LI KFGWPSVFYSFGSLG++WF +WL+KA+S+P DDP L  
Sbjct  328   LVYSGMYLGSVTGLAFSPILIQKFGWPSVFYSFGSLGSIWFALWLTKAYSTPKDDPGLSE  387

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
             +EK+LIL  SVSKEPV +IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY QVLK
Sbjct  388   QEKRLILDGSVSKEPVTNIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYSQVLK  447

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+F VLPWLTMA  A  GGWIAD+LV KG S+T VRKIMQ+IGFLGPAFFLTQL
Sbjct  448   FNLTESGLFCVLPWLTMAVFANLGGWIADTLVSKGFSITSVRKIMQSIGFLGPAFFLTQL  507

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             SHV +PA AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  508   SHVKTPAFAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  567

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWDDVFKV+V LY++GT+VWN FSTGE+IL+
Sbjct  568   TGYILQKGSWDDVFKVAVVLYIIGTLVWNFFSTGERILE  606



>gb|EPS64644.1| hypothetical protein M569_10135, partial [Genlisea aurea]
Length=627

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/414 (84%), Positives = 377/414 (91%), Gaps = 0/414 (0%)
 Frame = -2

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FPKRWVIVLLCF AFLLCNMDRVNMSIAILPMA E++W+  TVGLIQSSFFWGY+LTQI 
Sbjct  214   FPKRWVIVLLCFHAFLLCNMDRVNMSIAILPMAKEFNWNSATVGLIQSSFFWGYVLTQIV  273

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GGIWAD VGGKLVLGFGVVWWSIAT+LTPIAA +GLPFLFIVRAFMGIGEGVAMPAMNN+
Sbjct  274   GGIWADKVGGKLVLGFGVVWWSIATVLTPIAAHIGLPFLFIVRAFMGIGEGVAMPAMNNI  333

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             LSKW+PVSERSRSL++VYSGMYLGSVTGLAFSPMLIH++GWPSVFYSFGSLG++WF +WL
Sbjct  334   LSKWIPVSERSRSLSLVYSGMYLGSVTGLAFSPMLIHRYGWPSVFYSFGSLGSIWFALWL  393

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
              KAHSSP +D  L  EE+KLI  +SVSKEPV SIPWK ILSK PVWALI SHFCHNWGTF
Sbjct  394   IKAHSSPNEDATLSSEERKLISSSSVSKEPVSSIPWKKILSKGPVWALIASHFCHNWGTF  453

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             ILLTWMPTYY+QVLKFNLTESG+  VLPW TMA  A  GGWIAD LV +G+S+T VRKIM
Sbjct  454   ILLTWMPTYYNQVLKFNLTESGLLCVLPWFTMAVFANIGGWIADHLVSRGLSITAVRKIM  513

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             Q+IGFLGPAFFL+QLSHV +P  AVLCM CSQG DAFSQSGLYSNHQDI PRY+GVL+GL
Sbjct  514   QSIGFLGPAFFLSQLSHVTTPGQAVLCMACSQGLDAFSQSGLYSNHQDIGPRYAGVLLGL  573

Query  595   SNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SNTAGVLAGV GTAATGYILQ+GSWD+VFKVSVGLYLVGT+VWNLFSTGEKILD
Sbjct  574   SNTAGVLAGVLGTAATGYILQNGSWDEVFKVSVGLYLVGTLVWNLFSTGEKILD  627



>gb|KHM99069.1| Putative anion transporter 2, chloroplastic [Glycine soja]
Length=597

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/454 (77%), Positives = 401/454 (88%), Gaps = 3/454 (1%)
 Frame = -2

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG---GFPKRWVIVLLCFSAFLLCNM  1616
             KS+ + I+++  + L+  +   + +L E +   +S     FPKRWVIVLLCF+AFLLCNM
Sbjct  144   KSEEHDITEAKMDPLESTEGTGESILLEGNVPQVSSWWQQFPKRWVIVLLCFAAFLLCNM  203

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             DRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGVVW
Sbjct  204   DRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKIGGKLVLGFGVVW  263

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WS+AT+LTPIAA++GLP L I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSG
Sbjct  264   WSMATVLTPIAARIGLPCLLIMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSG  323

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSV GLAFSP+LI KFGWPSVFYSFGSLG++WF +WL KA+SSP DDP+L  EEK+L
Sbjct  324   MYLGSVVGLAFSPLLIQKFGWPSVFYSFGSLGSIWFALWLRKAYSSPKDDPDLGVEEKRL  383

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             IL  +VS  PV SIPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNL E
Sbjct  384   ILEGNVSNAPVSSIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLME  443

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+  VLPWLTMA  A  GGWIAD+LVRKG+S+TVVRKIMQ+IGFLGPAFFL+QLSHV +
Sbjct  444   SGLLCVLPWLTMAAFANIGGWIADTLVRKGLSITVVRKIMQSIGFLGPAFFLSQLSHVRT  503

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
             PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG+IL
Sbjct  504   PAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGFIL  563

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             Q GSW+DVFKV+V LY++GT+VWN+FSTGEK+LD
Sbjct  564   QRGSWNDVFKVAVALYIIGTLVWNVFSTGEKVLD  597



>ref|XP_003627567.1| Sodium-dependent phosphate transport protein [Medicago truncatula]
 gb|AET02043.1| anion transporter 4 [Medicago truncatula]
Length=588

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/465 (76%), Positives = 399/465 (86%), Gaps = 3/465 (1%)
 Frame = -2

Query  1819  RRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVL  1649
             +R + +     K++ Y  ++   + L+  D   + +L E +    S     FPKRWVIVL
Sbjct  124   QRKANKFQVRYKAEEYEFAEPNIDGLQPTDGTGEAILLEGNLLQTSPWWQQFPKRWVIVL  183

Query  1648  LCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvg  1469
             LCF+AFLLCNMDRVNMSIAILPM+ +++W+  TVGLIQSSFFWGYLLTQIAGGIWAD VG
Sbjct  184   LCFTAFLLCNMDRVNMSIAILPMSQQFNWNSATVGLIQSSFFWGYLLTQIAGGIWADKVG  243

Query  1468  gklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSE  1289
             GKLVLGFGVVWWSIAT+LTPIAAKLGLP+L ++RAFMGIGEGVAMPAMNN+LSKW+PVSE
Sbjct  244   GKLVLGFGVVWWSIATVLTPIAAKLGLPYLLVMRAFMGIGEGVAMPAMNNILSKWIPVSE  303

Query  1288  RSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpld  1109
             RSRSLA+VYSGMYLGSVTGL FSP LI KFGWPSVFYSFGSLG++WF +WL  A+S+P D
Sbjct  304   RSRSLALVYSGMYLGSVTGLGFSPFLIQKFGWPSVFYSFGSLGSIWFALWLRNAYSTPKD  363

Query  1108  dpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTY  929
             DP L  EEK+LIL  +VSKEPV  IPWKLILSK PVWALIVSHFCHNWGTFILLTWMPTY
Sbjct  364   DPNLGDEEKRLILGGNVSKEPVTVIPWKLILSKAPVWALIVSHFCHNWGTFILLTWMPTY  423

Query  928   YHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPA  749
             Y+QVLKFNLTESG+  VLPWLTMA  A  GGWIAD+LV KG S+T VRKIMQ+IGFLGPA
Sbjct  424   YNQVLKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVSKGFSITTVRKIMQSIGFLGPA  483

Query  748   FFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAG  569
             FFLTQLS+V +PAMAVLCM CSQG DAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAG
Sbjct  484   FFLTQLSNVRTPAMAVLCMACSQGCDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAG  543

Query  568   VFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             VFGTAATGYILQ GSW+DVFKVSV LYL+GT+VWN+FSTGEKILD
Sbjct  544   VFGTAATGYILQRGSWNDVFKVSVVLYLIGTLVWNIFSTGEKILD  588



>ref|XP_003556597.1| PREDICTED: probable anion transporter 2, chloroplastic-like isoform 
X1 [Glycine max]
Length=597

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/454 (77%), Positives = 401/454 (88%), Gaps = 3/454 (1%)
 Frame = -2

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG---GFPKRWVIVLLCFSAFLLCNM  1616
             KS+ + I+++  + L+  +   + +L E +   +S     FPKRWVIVLLCF+AFLLCNM
Sbjct  144   KSEEHDITEAKVDPLESTEGTGESILLEGNVPQVSSWWQQFPKRWVIVLLCFAAFLLCNM  203

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             DRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGVVW
Sbjct  204   DRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKIGGKLVLGFGVVW  263

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WS+AT+LTPIAA++GLP L I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSG
Sbjct  264   WSMATVLTPIAARIGLPCLLIMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSG  323

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSV GLAFSP+LI KFGWPSVFYSFGSLG++WF +WL KA+SSP DDP+L  EEK+L
Sbjct  324   MYLGSVVGLAFSPLLIQKFGWPSVFYSFGSLGSIWFALWLRKAYSSPKDDPDLGVEEKRL  383

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             IL  +VS  PV SIPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNL E
Sbjct  384   ILEGNVSNAPVSSIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLME  443

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+  VLPWLTMA  A  GGWIAD+LVRKG+S+TVVRKIMQ+IGFLGPAFFL+QLSHV +
Sbjct  444   SGLLCVLPWLTMAAFANIGGWIADTLVRKGLSITVVRKIMQSIGFLGPAFFLSQLSHVRT  503

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
             PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG+IL
Sbjct  504   PAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGFIL  563

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             Q GSW+DVFKV+V LY++GT+VWN+FSTGEK+LD
Sbjct  564   QRGSWNDVFKVAVALYIIGTLVWNVFSTGEKVLD  597



>ref|XP_003551308.1| PREDICTED: probable anion transporter 1, chloroplastic-like [Glycine 
max]
 gb|KHN06255.1| Putative anion transporter 1, chloroplastic [Glycine soja]
Length=395

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/395 (89%), Positives = 376/395 (95%), Gaps = 0/395 (0%)
 Frame = -2

Query  1618  MDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvV  1439
             MDRVNMSIAILPM++EY+W+P+TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGVV
Sbjct  1     MDRVNMSIAILPMSAEYNWNPSTVGLIQSSFFWGYLLTQIAGGIWADTVGGKQVLGFGVV  60

Query  1438  WWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYS  1259
             WWS+AT LTPIAAKLGLPFL + RAFMGIGEGVAMPAMNN+LSKWVPVSERSRSLA+VYS
Sbjct  61    WWSVATALTPIAAKLGLPFLLVARAFMGIGEGVAMPAMNNILSKWVPVSERSRSLALVYS  120

Query  1258  GMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekk  1079
             GMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF+VWLSKAHSSPL+DPEL PEEKK
Sbjct  121   GMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFSVWLSKAHSSPLEDPELRPEEKK  180

Query  1078  LILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLT  899
             LI  N  SKEPVK+IPW+LILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+QVLKFNLT
Sbjct  181   LITTNCSSKEPVKTIPWRLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLKFNLT  240

Query  898   ESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVD  719
             ESG+F VLPWL MA SA  GGWIAD+LV KGVSVT VRKIMQTIGFLGPAFFLTQLSHV+
Sbjct  241   ESGLFCVLPWLIMAISANVGGWIADTLVSKGVSVTRVRKIMQTIGFLGPAFFLTQLSHVN  300

Query  718   SPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYI  539
             SP MAVLCMTCSQG+DAFSQSGLYSNHQDIAPRYSG+L+GLSNTAGVLAGVFGTAATGYI
Sbjct  301   SPVMAVLCMTCSQGTDAFSQSGLYSNHQDIAPRYSGILLGLSNTAGVLAGVFGTAATGYI  360

Query  538   LQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             LQHGSWDDVFKVSV LYLVGTVV+NLFSTGEK+L+
Sbjct  361   LQHGSWDDVFKVSVVLYLVGTVVFNLFSTGEKVLE  395



>gb|KDO66834.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis]
Length=454

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/410 (85%), Positives = 378/410 (92%), Gaps = 2/410 (0%)
 Frame = -2

Query  1657  IVLLCFSAF--LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIW  1484
             I+ LC   F  +     +VNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGGIW
Sbjct  45    IISLCVGNFEQIFIVFGQVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIW  104

Query  1483  ADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKW  1304
             ADTVGGK VLGFGVVWWSIAT LTP+AAKLGLPFL +VR FMGIGEGVAMPAMNN+LSKW
Sbjct  105   ADTVGGKAVLGFGVVWWSIATALTPVAAKLGLPFLLVVRVFMGIGEGVAMPAMNNILSKW  164

Query  1303  VPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAH  1124
             VPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWFTVWLSKAH
Sbjct  165   VPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHRFGWPSVFYSFGSLGTVWFTVWLSKAH  224

Query  1123  SSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT  944
             SSP +DP+L P EKKLI+ +  SKEPVK+IPW LILSKPPVWALIVSHFCHNWGTFILLT
Sbjct  225   SSPAEDPQLRPAEKKLIVSSCASKEPVKTIPWGLILSKPPVWALIVSHFCHNWGTFILLT  284

Query  943   WMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIG  764
             WMPTYY+QVL FNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ+IG
Sbjct  285   WMPTYYNQVLHFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIG  344

Query  763   FLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTA  584
             FLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTA
Sbjct  345   FLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTA  404

Query  583   GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGT VWNLFSTGEK++D
Sbjct  405   GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTAVWNLFSTGEKVVD  454



>ref|XP_009797233.1| PREDICTED: probable anion transporter 2, chloroplastic [Nicotiana 
sylvestris]
Length=604

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/459 (76%), Positives = 400/459 (87%), Gaps = 3/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLCFSAF  1631
             R  AD KS  Y I+ ++ ESL   +  ++ +L E+  ++      FP+RW++VLLCF+AF
Sbjct  147   RTQADYKSDEYDITGAL-ESLVSSEGASEAILVEEVEQSKPWWEQFPRRWIVVLLCFAAF  205

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLG
Sbjct  206   LLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKFGGKVVLG  265

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGVVWWSIAT+LTPIAA++GLPFL +VRA MGIGEGVAMPAMNN+LSKW+PVSERSRSLA
Sbjct  266   FGVVWWSIATVLTPIAARMGLPFLLVVRALMGIGEGVAMPAMNNMLSKWIPVSERSRSLA  325

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGL FSP+LI KFGWPSVFYSFGSLG++WF +WL+KA+SSP DDP L  
Sbjct  326   LVYSGMYLGSVTGLGFSPILIQKFGWPSVFYSFGSLGSIWFALWLTKAYSSPKDDPGLSA  385

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
             +EK+LI+  SVSKEPV +IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY QVLK
Sbjct  386   QEKRLIMGGSVSKEPVSNIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYSQVLK  445

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+  VLPWLTMA  A  GGWIAD+LV KG S+T VRKIMQ+IGFLGPAFFL+QL
Sbjct  446   FNLTESGLLCVLPWLTMAVFANVGGWIADTLVSKGFSITSVRKIMQSIGFLGPAFFLSQL  505

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             SHV +PA+AVLCM  SQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  506   SHVRTPALAVLCMAFSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  565

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWDDVFKV+V LY++GT+VWN FSTGE+IL+
Sbjct  566   TGYILQKGSWDDVFKVAVILYIIGTLVWNFFSTGERILE  604



>ref|NP_001063986.1| Os09g0570400 [Oryza sativa Japonica Group]
 sp|Q652N5.1|PHT44_ORYSJ RecName: Full=Probable anion transporter 4, chloroplastic; AltName: 
Full=Phosphate transporter 4;4; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAD46232.1| putative sialin [Oryza sativa Japonica Group]
 dbj|BAF25900.1| Os09g0570400 [Oryza sativa Japonica Group]
 dbj|BAG89449.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC85095.1| hypothetical protein OsI_32467 [Oryza sativa Indica Group]
 gb|EEE70272.1| hypothetical protein OsJ_30419 [Oryza sativa Japonica Group]
Length=591

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/459 (77%), Positives = 392/459 (85%), Gaps = 5/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLCFSAF  1631
             R  AD K++ Y I+ S    L   D   + VL  D  E       FPKRW +VLLCF +F
Sbjct  136   RTRADCKAEQYEITGS---PLSPSDVPAEAVLIGDTNEISPWWQQFPKRWTVVLLCFFSF  192

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+SE+ WSP TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLG
Sbjct  193   LLCNMDRVNMSIAILPMSSEFGWSPATVGLIQSSFFWGYLLTQILGGIWADRFGGKVVLG  252

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGVVWWSIAT+LTP+AAK+GLPFL ++RAFMGIGEGVAMPAMNN+LSKWVPVSERSRSLA
Sbjct  253   FGVVWWSIATVLTPLAAKIGLPFLLVMRAFMGIGEGVAMPAMNNILSKWVPVSERSRSLA  312

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGLAFSP+LI +FGWPSVFY+FGSLG+VWF +W  KAHSSP +DPEL  
Sbjct  313   LVYSGMYLGSVTGLAFSPLLISRFGWPSVFYAFGSLGSVWFALWQRKAHSSPSEDPELSK  372

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
              EK+ IL  S  KEPV SIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+QVLK
Sbjct  373   AEKRYILGGSTLKEPVTSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLK  432

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+  VLPWLTMA  A  GGWIAD+LV +GVS+T VRKIMQ+IGFLGPA FLT L
Sbjct  433   FNLTESGLLCVLPWLTMAIFANIGGWIADTLVGRGVSITNVRKIMQSIGFLGPALFLTLL  492

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             S V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  493   SKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  552

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWD VF+V+V LY+VGTVVWN+FSTGEK+L+
Sbjct  553   TGYILQKGSWDSVFQVAVVLYIVGTVVWNVFSTGEKVLE  591



>emb|CBI40390.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/436 (79%), Positives = 391/436 (90%), Gaps = 3/436 (1%)
 Frame = -2

Query  1732  DALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHW  1562
             +   + +L E++ +++S     FPKRWVIVLLCF+AFLLCNMDRVNMSIAILPM+ E++W
Sbjct  140   EGAGEVILAEENLQSVSPWWQQFPKRWVIVLLCFAAFLLCNMDRVNMSIAILPMSQEFNW  199

Query  1561  SPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPF  1382
             +  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGV+WWS+AT+LTPIAA++GLPF
Sbjct  200   NSATVGLIQSSFFWGYLLTQILGGIWADKLGGKLVLGFGVIWWSVATVLTPIAARIGLPF  259

Query  1381  LFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHK  1202
             L  +RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGLA SP LI K
Sbjct  260   LLTMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALVYSGMYLGSVTGLAVSPALIQK  319

Query  1201  FGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKL  1022
             FGWPSVFYSFGSLG++WF +WLSKA+SSP +DPEL  EEK++IL  S SKEPV SIPWKL
Sbjct  320   FGWPSVFYSFGSLGSIWFALWLSKAYSSPAEDPELSEEEKRVILGGSTSKEPVSSIPWKL  379

Query  1021  ILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYA  842
             ILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+  VLPWLTMA  A  
Sbjct  380   ILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVLPWLTMAVFANI  439

Query  841   GGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFS  662
             GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQL ++ +PA+AVLCM CSQGSDAFS
Sbjct  440   GGWIADTLVSKGLSITSVRKIMQSIGFLGPAFFLTQLGNIRTPALAVLCMACSQGSDAFS  499

Query  661   QSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLV  482
             QSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSW DVFKV+V LY++
Sbjct  500   QSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWGDVFKVAVVLYII  559

Query  481   GTVVWNLFSTGEKILD  434
             GT+VWNLF+TGEKILD
Sbjct  560   GTLVWNLFATGEKILD  575



>gb|KHG12724.1| putative anion transporter 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=595

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/508 (71%), Positives = 414/508 (81%), Gaps = 17/508 (3%)
 Frame = -2

Query  1939  HCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFR---RGLIRRTSWRAWADVKSKTYG  1769
             HC        R  S  S  +  + F SP +PG       +  I + S  A+   KS+ Y 
Sbjct  99    HCKKTHKVSPRQRSRGSFGY--YSFSSP-VPGGCLEPSDKDGIGKNSTSAY--YKSEEYD  153

Query  1768  ISDSVPESLKFEDALNDDVLTEDDGET---ISGGFPKRWVIVLLCFSAFLLCNMDRVNMS  1598
             I+++  +S    D  N+ +L   D +    +   FPKRWVIVLLCF+AFLLCNMDRVNMS
Sbjct  154   ITEAKVDSFPSPDGTNEAILVGGDMQEAVPLWQDFPKRWVIVLLCFAAFLLCNMDRVNMS  213

Query  1597  IAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATI  1418
             IAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGVVWWS+AT+
Sbjct  214   IAILPMSKEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKIGGKLVLGFGVVWWSVATV  273

Query  1417  LTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSV  1238
             LTPIAA+ GLPFL I+RAFMGIGEGVAMPAMNNLLSKW+PVSERSRSLA+VYSGMYLGSV
Sbjct  274   LTPIAARFGLPFLLIMRAFMGIGEGVAMPAMNNLLSKWIPVSERSRSLALVYSGMYLGSV  333

Query  1237  TGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSV  1058
              GLAFSP+LI+KFGWPSVFYSFGSLG++WF +WL KA+SSP +DPEL  EEKK+I+  S+
Sbjct  334   IGLAFSPILINKFGWPSVFYSFGSLGSIWFALWLRKAYSSPKEDPELSKEEKKIIMGGSI  393

Query  1057  SKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAV  878
             SKEPV  IPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+  V
Sbjct  394   SKEPVTVIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCV  453

Query  877   LPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVL  698
             LPWLTMA  A  GGWIAD+LV KG+S      IMQ+IGFLGPAFFLTQL HV +PAMAVL
Sbjct  454   LPWLTMAAFANVGGWIADTLVSKGLS------IMQSIGFLGPAFFLTQLIHVKTPAMAVL  507

Query  697   CMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWD  518
             CM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSW+
Sbjct  508   CMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWN  567

Query  517   DVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             DVFKVSV LY++GT+VWNLFSTGEK+LD
Sbjct  568   DVFKVSVALYIIGTLVWNLFSTGEKVLD  595



>ref|XP_004956239.1| PREDICTED: probable anion transporter 4, chloroplastic-like [Setaria 
italica]
Length=597

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/463 (76%), Positives = 392/463 (85%), Gaps = 5/463 (1%)
 Frame = -2

Query  1816  RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLC  1643
             R   R  AD K++ YGI+ S    L   D   D +L  D          FPKRW IVLLC
Sbjct  138   RVPIRRRADCKAEQYGITGS---PLSPSDGPADTILVGDTSNISPWWQQFPKRWTIVLLC  194

Query  1642  FSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggk  1463
             F AFLLCNMDRVN+SIAILPMASE+ W+P TVGLIQSSFFWGYLLTQI GGIWAD  GGK
Sbjct  195   FFAFLLCNMDRVNLSIAILPMASEFSWNPATVGLIQSSFFWGYLLTQILGGIWADRFGGK  254

Query  1462  lvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERS  1283
             +VLGFGVVWWSIAT+LTP+AAK+GLP L I RAFMGIGEGVAMPAMNN+LSKW+PVSERS
Sbjct  255   VVLGFGVVWWSIATVLTPLAAKIGLPCLLIARAFMGIGEGVAMPAMNNILSKWIPVSERS  314

Query  1282  RSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddp  1103
             RSLA+VYSGMYLGSVTGLAFSP+LI +FGWPSVFY+FGSLG+VWF +W +KAHSSP DDP
Sbjct  315   RSLALVYSGMYLGSVTGLAFSPLLISRFGWPSVFYAFGSLGSVWFALWQTKAHSSPDDDP  374

Query  1102  ellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH  923
             EL   EK+ IL  +  KEPV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+
Sbjct  375   ELSKAEKRHILGGNALKEPVTSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYN  434

Query  922   QVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFF  743
             QVLKFNLTESG+  VLPWLTMA  A  GGWIAD+LV++G+S+T VRKIMQ++GFLGPA F
Sbjct  435   QVLKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVQRGISITNVRKIMQSVGFLGPALF  494

Query  742   LTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVF  563
             LT LS V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVF
Sbjct  495   LTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVF  554

Query  562   GTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GTAATGYIL+ GSWD VFKVSV LY+VGTVVWN+FSTGEK+L+
Sbjct  555   GTAATGYILEKGSWDSVFKVSVVLYIVGTVVWNVFSTGEKVLE  597



>ref|XP_006661007.1| PREDICTED: probable anion transporter 4, chloroplastic-like [Oryza 
brachyantha]
Length=600

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/459 (77%), Positives = 391/459 (85%), Gaps = 5/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLCFSAF  1631
             R  AD K++ Y I+ S    L   DA  + VL  D  E       FPKRW +VLLCF AF
Sbjct  145   RTRADCKAEQYEITGS---PLSPSDAPAEAVLIGDTNEISPWWQQFPKRWTVVLLCFFAF  201

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+SE+ WSP TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLG
Sbjct  202   LLCNMDRVNMSIAILPMSSEFGWSPATVGLIQSSFFWGYLLTQILGGIWADRFGGKIVLG  261

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGVVWWSIATILTPIAAK+GLP L ++RAFMGIGEGVAMPAMNN+LSKWVPVSERSRSLA
Sbjct  262   FGVVWWSIATILTPIAAKIGLPCLLVMRAFMGIGEGVAMPAMNNILSKWVPVSERSRSLA  321

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGLAFSP+LI +FGWPSVFY+FGSLG++WF +W  KAHSSP +DPEL  
Sbjct  322   LVYSGMYLGSVTGLAFSPLLISRFGWPSVFYAFGSLGSIWFALWQRKAHSSPSEDPELTK  381

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
              EK+ IL  S  +EPV SIPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVLK
Sbjct  382   AEKRYILGGSTLREPVTSIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLK  441

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+  VLPWLTMA  A  GGWIAD+LV +G S+T VRKIMQ+IGFLGPA FLT L
Sbjct  442   FNLTESGLLCVLPWLTMAVFANIGGWIADTLVERGFSITNVRKIMQSIGFLGPAIFLTLL  501

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             S V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+G+SNTAGVLAGVFGTAA
Sbjct  502   SKVQTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGMSNTAGVLAGVFGTAA  561

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWD VFKV+V LY+VGTVVWN+FSTGEK+++
Sbjct  562   TGYILQKGSWDSVFKVAVVLYIVGTVVWNVFSTGEKVIE  600



>ref|XP_010087952.1| putative anion transporter 2 [Morus notabilis]
 gb|EXB30874.1| putative anion transporter 2 [Morus notabilis]
Length=610

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/490 (73%), Positives = 406/490 (83%), Gaps = 21/490 (4%)
 Frame = -2

Query  1846  GRGFRRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GG  1676
             G+ ++   ++    RA+   KS+   I+++  ++L   +   + VL E D          
Sbjct  123   GQYYKSKNVKTNRIRAY--YKSEEDDITEAKVDALPAMEGSGEAVLVEGDLPKACPWWQQ  180

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FPKRWVIVLLCF+AFLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI 
Sbjct  181   FPKRWVIVLLCFAAFLLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLTQIL  240

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GGIWAD +GGKLVLGFGVVWWSIAT+LTPIAA++GLPFL ++RAFMGIGEGVAMPAMNN+
Sbjct  241   GGIWADKIGGKLVLGFGVVWWSIATVLTPIAARIGLPFLLVMRAFMGIGEGVAMPAMNNI  300

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             LSKW+PVSERSRSLA+VYSGMYLGSVTGLA SP+LIHKFGWPSVFY FGSLG+VWF +WL
Sbjct  301   LSKWIPVSERSRSLALVYSGMYLGSVTGLAVSPVLIHKFGWPSVFYCFGSLGSVWFALWL  360

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
              KA+SSP +DPEL  EEKKLIL  SVSKEPV  IPWKLILSK PVWALI+SHFCHNWGTF
Sbjct  361   KKAYSSPKEDPELGEEEKKLILGGSVSKEPVSVIPWKLILSKAPVWALIISHFCHNWGTF  420

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK--  782
             ILLTWMPTYY+QVLKFNLTESG+  VLPWLTMA  A  GGWIAD+LV +G+S+T VRK  
Sbjct  421   ILLTWMPTYYNQVLKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVSRGLSITAVRKAS  480

Query  781   --------------IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYS  644
                           IMQ+IGFLGPAFFLTQLSHV +PAMAVLCM CSQGSDAFSQSGLYS
Sbjct  481   ITVAGFCIMFIHHEIMQSIGFLGPAFFLTQLSHVRTPAMAVLCMACSQGSDAFSQSGLYS  540

Query  643   NHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWN  464
             NHQDI PRY+GVL+GLSNTAGVLAGVFGT ATG ILQ GSWDDVFKVSV LY++GT+VWN
Sbjct  541   NHQDIGPRYAGVLLGLSNTAGVLAGVFGTVATGLILQRGSWDDVFKVSVALYIIGTLVWN  600

Query  463   LFSTGEKILD  434
             LFSTGEK+L+
Sbjct  601   LFSTGEKVLE  610



>ref|XP_004306773.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/477 (74%), Positives = 397/477 (83%), Gaps = 12/477 (3%)
 Frame = -2

Query  1831  RGLIRRTSWRAWADVKSKTYGI-SDSVPESLKFEDALNDDVLTEDDGETISGG-------  1676
             R L +  +W+       K   I +D  PE +   +    D LT      ++ G       
Sbjct  124   RKLDKLDNWQYQKSENVKVNRIRADYKPEDIDITET-EVDSLTPSGEAVLADGKVFKASA  182

Query  1675  ---FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLT  1505
                 PKRWVIVLLCF+AFLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLT
Sbjct  183   WWEIPKRWVIVLLCFAAFLLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGYLLT  242

Query  1504  QIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAM  1325
             QI GGIWAD +GGK VLGFGV+WWS+AT+LTPIAAK+ LPFL ++RAFMGIGEGVAMPAM
Sbjct  243   QILGGIWADKIGGKRVLGFGVIWWSVATVLTPIAAKISLPFLLVMRAFMGIGEGVAMPAM  302

Query  1324  NNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFT  1145
             NN+LSKW+PVSERSR+L++VYSGMYLGSVTGLA SP+LI +F WPSVFYSFGSLG+VWF 
Sbjct  303   NNILSKWIPVSERSRALSLVYSGMYLGSVTGLAVSPILIQQFKWPSVFYSFGSLGSVWFA  362

Query  1144  VWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNW  965
             +WLSKA+S+P +DP L  EEK+LIL  +VSKEPV  IPWKLILSKP VWALI+SHFCHNW
Sbjct  363   LWLSKAYSTPKEDPGLSAEEKELILGGNVSKEPVTVIPWKLILSKPAVWALIISHFCHNW  422

Query  964   GTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVR  785
             GTFILLTWMPTYY+QVLKFNLTESG+  VLPWLTMA  A  GGWIAD+LV KG S+T VR
Sbjct  423   GTFILLTWMPTYYNQVLKFNLTESGLLCVLPWLTMAIFANIGGWIADTLVSKGYSITTVR  482

Query  784   KIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVL  605
             KIMQ+IGFLGPAFFLTQLS V +PAMAVLCM CSQG+DAFSQSGLYSNHQDI PRYSGVL
Sbjct  483   KIMQSIGFLGPAFFLTQLSRVKTPAMAVLCMACSQGADAFSQSGLYSNHQDIGPRYSGVL  542

Query  604   MGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             +GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+V LYL+GTVVWNLFSTGEK+LD
Sbjct  543   LGLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVVLYLIGTVVWNLFSTGEKVLD  599



>ref|XP_003578693.1| PREDICTED: probable anion transporter 4, chloroplastic [Brachypodium 
distachyon]
Length=594

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/463 (76%), Positives = 391/463 (84%), Gaps = 5/463 (1%)
 Frame = -2

Query  1816  RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLC  1643
             R   R  AD K++ + I+ S    L   D   + VL  D  E       FPKRW IVLLC
Sbjct  135   RIPIRTRADCKAEQFEITGS---PLSPSDVPAEAVLVGDANEVSPWWQQFPKRWAIVLLC  191

Query  1642  FSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggk  1463
             F +FLLCNMDRVNMSIAILPM++E+ WSP TVGLIQSSFFWGYLLTQI GGIWAD  GGK
Sbjct  192   FFSFLLCNMDRVNMSIAILPMSAEFGWSPATVGLIQSSFFWGYLLTQILGGIWADRFGGK  251

Query  1462  lvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERS  1283
             +VLGFGVVWWSIAT+LTPIAAK+GLP L IVRAFMGIGEGVAMPAMNN+LSKW+PVSERS
Sbjct  252   VVLGFGVVWWSIATVLTPIAAKIGLPCLLIVRAFMGIGEGVAMPAMNNILSKWIPVSERS  311

Query  1282  RSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddp  1103
             RSLA+VYSGMYLGSVTGLAFSP LI KFGWPSVFY+FGSLG++WF +WL KA SSP +DP
Sbjct  312   RSLALVYSGMYLGSVTGLAFSPFLISKFGWPSVFYAFGSLGSIWFALWLRKARSSPSEDP  371

Query  1102  ellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH  923
             E+   EK+ IL  +  KEPV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+
Sbjct  372   EISEAEKRHILGGNTIKEPVTSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYN  431

Query  922   QVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFF  743
             QVLKFNLTESG+  VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFF
Sbjct  432   QVLKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVAKGISITNVRKIMQSIGFLGPAFF  491

Query  742   LTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVF  563
             LT LS V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVF
Sbjct  492   LTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVF  551

Query  562   GTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GTAATGYILQ GSWD VF+V+V LYLVGTVVWN+FSTGE+IL+
Sbjct  552   GTAATGYILQKGSWDSVFQVAVVLYLVGTVVWNVFSTGERILE  594



>gb|KDO66835.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis]
Length=390

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/390 (88%), Positives = 369/390 (95%), Gaps = 0/390 (0%)
 Frame = -2

Query  1603  MSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIA  1424
             MSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGVVWWSIA
Sbjct  1     MSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKAVLGFGVVWWSIA  60

Query  1423  TILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLG  1244
             T LTP+AAKLGLPFL +VR FMGIGEGVAMPAMNN+LSKWVPV+ERSRSLA+VYSGMYLG
Sbjct  61    TALTPVAAKLGLPFLLVVRVFMGIGEGVAMPAMNNILSKWVPVAERSRSLALVYSGMYLG  120

Query  1243  SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRN  1064
             SVTGLAFSP LIH+FGWPSVFYSFGSLGTVWFTVWLSKAHSSP +DP+L P EKKLI+ +
Sbjct  121   SVTGLAFSPFLIHRFGWPSVFYSFGSLGTVWFTVWLSKAHSSPAEDPQLRPAEKKLIVSS  180

Query  1063  SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMF  884
               SKEPVK+IPW LILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+QVL FNLTESG+F
Sbjct  181   CASKEPVKTIPWGLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLHFNLTESGLF  240

Query  883   AVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMA  704
              VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ+IGFLGPAFFLTQLSHVDSPAMA
Sbjct  241   CVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFFLTQLSHVDSPAMA  300

Query  703   VLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGS  524
             VLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVFGTAATGYILQHGS
Sbjct  301   VLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVFGTAATGYILQHGS  360

Query  523   WDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             WDDVFKVSVGLYLVGT VWNLFSTGEK++D
Sbjct  361   WDDVFKVSVGLYLVGTAVWNLFSTGEKVVD  390



>ref|XP_007139828.1| hypothetical protein PHAVU_008G061900g [Phaseolus vulgaris]
 gb|ESW11822.1| hypothetical protein PHAVU_008G061900g [Phaseolus vulgaris]
Length=590

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/447 (77%), Positives = 391/447 (87%), Gaps = 3/447 (1%)
 Frame = -2

Query  1765  SDSVPESLKFEDALNDDVLTEDDGETISG---GFPKRWVIVLLCFSAFLLCNMDRVNMSI  1595
             S+S  + L   +   + +L E +   +S     FPKRWVIVLLCF+AFLLCNMDRVNMSI
Sbjct  144   SESEVDPLASTEGTGEAILLEGNAPQVSSWWQKFPKRWVIVLLCFAAFLLCNMDRVNMSI  203

Query  1594  AILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATIL  1415
             AILPM+ E+ W+  TVGLIQSSFFWGYLLTQ+ GGIWAD +GGKLVLGFGVVWWS+ATIL
Sbjct  204   AILPMSQEFKWNSATVGLIQSSFFWGYLLTQVLGGIWADKLGGKLVLGFGVVWWSMATIL  263

Query  1414  TPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVT  1235
             TPIAA+ GLP L I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSV 
Sbjct  264   TPIAARFGLPCLLIMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSGMYLGSVV  323

Query  1234  GLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVS  1055
             GLAFSP+LI KFGWPSVFYSFGSLG++WF +WL KA+SSP DDP+L  EEK+ IL  +VS
Sbjct  324   GLAFSPLLIQKFGWPSVFYSFGSLGSLWFALWLKKAYSSPKDDPDLGVEEKRFILEGNVS  383

Query  1054  KEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVL  875
               PV SIPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+  VL
Sbjct  384   NAPVSSIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVL  443

Query  874   PWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLC  695
             PWLTMA SA  GGWIAD+LVRKG+S+T VRKIMQ+IGFLGPAFFL+QLS+V +PAMAVLC
Sbjct  444   PWLTMAASANIGGWIADTLVRKGLSITTVRKIMQSIGFLGPAFFLSQLSNVKTPAMAVLC  503

Query  694   MTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDD  515
             M C QGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG ILQ GSW+D
Sbjct  504   MVCCQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGLILQRGSWND  563

Query  514   VFKVSVGLYLVGTVVWNLFSTGEKILD  434
             VFKV+V LY++GT+VWN+FSTGEK++D
Sbjct  564   VFKVAVVLYIIGTLVWNIFSTGEKVID  590



>ref|XP_010670194.1| PREDICTED: probable anion transporter 2, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=617

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/466 (74%), Positives = 396/466 (85%), Gaps = 5/466 (1%)
 Frame = -2

Query  1822  IRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG---GFPKRWVIV  1652
             +R    RA+   KS+   I++S  ESL   +   + VL +   +  +      PKRWV+V
Sbjct  154   VRDHGVRAY--YKSEDIDITESTFESLGTPEGAGEVVLPDKSTQKAASWLDQLPKRWVVV  211

Query  1651  LLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTv  1472
             LLCF AFLLCNMDRVNMSIAILPM+ EY+W+ TTVGLIQSSFFWGYLLTQI GGIWAD V
Sbjct  212   LLCFVAFLLCNMDRVNMSIAILPMSKEYNWNSTTVGLIQSSFFWGYLLTQIVGGIWADKV  271

Query  1471  ggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVS  1292
             GGKLVLGFGV+WWSIAT+LTPIAA++ LP L ++RAFMGIGEGVAMPAMNN++SKW+PVS
Sbjct  272   GGKLVLGFGVIWWSIATVLTPIAARISLPCLLVMRAFMGIGEGVAMPAMNNMISKWIPVS  331

Query  1291  ERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpl  1112
             ERSR+L+ VYSGMYLGSVTGLAFSP LIHKFGWPSVFYSFGSLG++WF +W++KAHSSP 
Sbjct  332   ERSRALSFVYSGMYLGSVTGLAFSPFLIHKFGWPSVFYSFGSLGSIWFALWIAKAHSSPT  391

Query  1111  ddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPT  932
             +DPE+  +EK+ IL  S+SKEPV  IPWKLILSK PVWALIVSHFCHNWGTFILLTWMPT
Sbjct  392   EDPEISAQEKRFILEGSISKEPVTVIPWKLILSKAPVWALIVSHFCHNWGTFILLTWMPT  451

Query  931   YYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGP  752
             YY+QVLKFNL ESG+F VLPWLTMA  A  GGWIAD+L+ KG+SVT VRKIMQTIGF+GP
Sbjct  452   YYNQVLKFNLMESGLFCVLPWLTMAVFANIGGWIADTLITKGLSVTSVRKIMQTIGFMGP  511

Query  751   AFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLA  572
             A  L+ LS   +PA+AVLCM CSQGSDAFSQSGLYSNHQDI PRYSGVL+GLSNTAGVLA
Sbjct  512   ALSLSLLSRARTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYSGVLLGLSNTAGVLA  571

Query  571   GVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GV GTAATG+ILQ GSWDDVFKVS+ LYL+GT+VWNLF+TGEKILD
Sbjct  572   GVLGTAATGFILQRGSWDDVFKVSIALYLIGTLVWNLFATGEKILD  617



>ref|XP_008338836.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X2 [Malus domestica]
Length=573

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/513 (69%), Positives = 410/513 (80%), Gaps = 4/513 (1%)
 Frame = -2

Query  1960  YNLPPKLHCSPEATFPKRSFSSRSHTHT--LFEFGSPFLPGRGFRRGLIRRTSWRAWADV  1787
             Y+  P+   S +    K ++  R       L    S         + ++  +  R  A  
Sbjct  61    YSPYPRAISSSDTNIRKATYRVRDEGENPHLISLQSSIRSQSIITKQILIGSRKRTCAYY  120

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG--GFPKRWVIVLLCFSAFLLCNMD  1613
             KS+   I++S  +SL   +  +  VL       +S     PKRWVIVLLCF+AFLLCNMD
Sbjct  121   KSEDNDITESEVDSLTSIEGSSGAVLAAGSVRQLSSWWEIPKRWVIVLLCFTAFLLCNMD  180

Query  1612  RVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWW  1433
             RVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGI AD +GGK VLGFGV+WW
Sbjct  181   RVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQILGGILADKIGGKRVLGFGVIWW  240

Query  1432  SIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGM  1253
             S+ATILTPIAAK+ LPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSR+L++VY+GM
Sbjct  241   SVATILTPIAAKISLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRALSLVYTGM  300

Query  1252  YLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLI  1073
             YLGSVTGLA SP+LI KF WPSVFYSFGSLG++W  +WL+KA+S+P +DPEL  EEK+LI
Sbjct  301   YLGSVTGLAVSPILIQKFKWPSVFYSFGSLGSIWLALWLNKAYSTPKEDPELSAEEKELI  360

Query  1072  LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTES  893
             +  ++SKEPVK IPWKLILSKPPVWALIV HFCHNWGTFILLTWMPTYY+QVLKFNLTES
Sbjct  361   MGGNISKEPVKVIPWKLILSKPPVWALIVCHFCHNWGTFILLTWMPTYYNQVLKFNLTES  420

Query  892   GMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSP  713
             G+  VLPWLTMA  A  GGWIAD+LV KG SVT VRKIMQ+IGFLGPAFFLT LS V +P
Sbjct  421   GLLCVLPWLTMAIFANIGGWIADTLVSKGFSVTTVRKIMQSIGFLGPAFFLTLLSRVKTP  480

Query  712   AMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ  533
             AMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ
Sbjct  481   AMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQ  540

Query  532   HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
              GSWDDVFKVSV LY++GT++WNLFSTGEKI+D
Sbjct  541   RGSWDDVFKVSVVLYIMGTLIWNLFSTGEKIID  573



>ref|XP_002320139.1| sugar transporter family protein [Populus trichocarpa]
 gb|EEE98454.1| sugar transporter family protein [Populus trichocarpa]
Length=541

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/495 (73%), Positives = 407/495 (82%), Gaps = 19/495 (4%)
 Frame = -2

Query  1882  HTLFEFGSPFLPGRGFRRGLIRRTSWRAWADVKSKTYGISD-SVPESLKFEDALNDDVLT  1706
             H     GS   P +G  +      + R     KS+ Y I++ +  +S+K  +  ++ VL 
Sbjct  54    HCQMANGSWLRPNKGKCQHFNHVKAIRTRTYYKSEEYDITEPAAVDSMKAAEGSSEVVLA  113

Query  1705  EDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSF  1526
                 E +    PKRWVIVLLCF+AFLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSF
Sbjct  114   SSWWEQV----PKRWVIVLLCFTAFLLCNMDRVNMSIAILPMSQEFNWNSATVGLIQSSF  169

Query  1525  FWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGE  1346
             FWGYLLTQI GGIWAD +GGK+VLGFGVVWWSIATILTPIAA++GLPFL I RAFMGIGE
Sbjct  170   FWGYLLTQIVGGIWADRIGGKVVLGFGVVWWSIATILTPIAARIGLPFLLITRAFMGIGE  229

Query  1345  GVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGS  1166
             GVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGLA SPMLIHKFGW SVFYSFGS
Sbjct  230   GVAMPAMNNILSKWIPVSERSRSLALVYSGMYLGSVTGLAVSPMLIHKFGWASVFYSFGS  289

Query  1165  LGTVWFTVWLSK-----------AHSSplddpellpeekkLILRNSVSKEPVKSIPWKLI  1019
             LG++WF +W+ K           A+SSP +DPEL P+EKKLIL  +V+KEPV  IPWKLI
Sbjct  290   LGSIWFALWIKKASICFFKLFFSAYSSPKEDPELSPQEKKLILGGNVAKEPVSVIPWKLI  349

Query  1018  LSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAG  839
             LSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+  VLPWLTMA  A  G
Sbjct  350   LSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVLPWLTMAVFANIG  409

Query  838   GWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQ  659
             GWIAD+LV +G+S+T    IMQ+IGFLGPAFFLTQLSHV +PAMAVLCM CSQGSDAFSQ
Sbjct  410   GWIADTLVSRGLSITT---IMQSIGFLGPAFFLTQLSHVRTPAMAVLCMACSQGSDAFSQ  466

Query  658   SGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVG  479
             SGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+V LY++G
Sbjct  467   SGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVALYIIG  526

Query  478   TVVWNLFSTGEKILD  434
             TVVWNLFSTGEKILD
Sbjct  527   TVVWNLFSTGEKILD  541



>ref|XP_008338835.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X1 [Malus domestica]
Length=608

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/459 (76%), Positives = 394/459 (86%), Gaps = 2/459 (0%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG--GFPKRWVIVLLCFSAF  1631
             R  A  KS+   I++S  +SL   +  +  VL       +S     PKRWVIVLLCF+AF
Sbjct  150   RTCAYYKSEDNDITESEVDSLTSIEGSSGAVLAAGSVRQLSSWWEIPKRWVIVLLCFTAF  209

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGI AD +GGK VLG
Sbjct  210   LLCNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQILGGILADKIGGKRVLG  269

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGV+WWS+ATILTPIAAK+ LPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSR+L+
Sbjct  270   FGVIWWSVATILTPIAAKISLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRALS  329

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VY+GMYLGSVTGLA SP+LI KF WPSVFYSFGSLG++W  +WL+KA+S+P +DPEL  
Sbjct  330   LVYTGMYLGSVTGLAVSPILIQKFKWPSVFYSFGSLGSIWLALWLNKAYSTPKEDPELSA  389

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
             EEK+LI+  ++SKEPVK IPWKLILSKPPVWALIV HFCHNWGTFILLTWMPTYY+QVLK
Sbjct  390   EEKELIMGGNISKEPVKVIPWKLILSKPPVWALIVCHFCHNWGTFILLTWMPTYYNQVLK  449

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+  VLPWLTMA  A  GGWIAD+LV KG SVT VRKIMQ+IGFLGPAFFLT L
Sbjct  450   FNLTESGLLCVLPWLTMAIFANIGGWIADTLVSKGFSVTTVRKIMQSIGFLGPAFFLTLL  509

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             S V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  510   SRVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  569

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWDDVFKVSV LY++GT++WNLFSTGEKI+D
Sbjct  570   TGYILQRGSWDDVFKVSVVLYIMGTLIWNLFSTGEKIID  608



>ref|NP_001130577.1| uncharacterized protein LOC100191676 [Zea mays]
 gb|ACF78850.1| unknown [Zea mays]
 tpg|DAA59020.1| TPA: hypothetical protein ZEAMMB73_730146 [Zea mays]
 tpg|DAA59021.1| TPA: hypothetical protein ZEAMMB73_730146 [Zea mays]
Length=614

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/459 (77%), Positives = 389/459 (85%), Gaps = 5/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLCFSAF  1631
             R  AD K++ Y I+ S    L   D   D V+  D  E       FPKRW +VLLCF AF
Sbjct  159   RTRADCKAEQYEITGS---PLSPSDVPADAVMIGDTNEISPWWQEFPKRWTVVLLCFFAF  215

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+SE+ W+P TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLG
Sbjct  216   LLCNMDRVNMSIAILPMSSEFSWNPATVGLIQSSFFWGYLLTQILGGIWADRFGGKVVLG  275

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGVVWWS AT+LTP+AAK+GLP L  +RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA
Sbjct  276   FGVVWWSFATVLTPLAAKIGLPCLLTMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLA  335

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGL+ SP+LI +FGWPSVFY+FGSLGTVWF +W SKAHSSP DDPEL  
Sbjct  336   LVYSGMYLGSVTGLSLSPLLISRFGWPSVFYAFGSLGTVWFALWQSKAHSSPDDDPELSK  395

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
              EK+ IL  S  KEPV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLK
Sbjct  396   AEKRHILGGSALKEPVTSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLK  455

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+  VLPWLTMA  A  GGWIAD+LV++GVSVT VRKIMQ+IGFLGPA FLT L
Sbjct  456   FNLTESGLLCVLPWLTMAVFANIGGWIADTLVQRGVSVTNVRKIMQSIGFLGPALFLTLL  515

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             S V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  516   SKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  575

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWD VFKVSV LY+VGTVVWN+FSTGEKIL+
Sbjct  576   TGYILQKGSWDSVFKVSVVLYIVGTVVWNVFSTGEKILE  614



>ref|XP_008656579.1| PREDICTED: probable anion transporter 4, chloroplastic [Zea mays]
 ref|XP_008656580.1| PREDICTED: probable anion transporter 4, chloroplastic [Zea mays]
 ref|XP_008656581.1| PREDICTED: probable anion transporter 4, chloroplastic [Zea mays]
 gb|AFW82990.1| hypothetical protein ZEAMMB73_321564 [Zea mays]
Length=608

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/459 (77%), Positives = 392/459 (85%), Gaps = 7/459 (2%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLCFSAF  1631
             R  AD K++ Y I+ S    L   DA  D V+  D  E       FPKRW+IVLLCF AF
Sbjct  155   RTRADCKAEQYEITGS---PLSPSDA--DAVMIGDTNEISPWWQEFPKRWMIVLLCFFAF  209

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+SE+ WSP TVGLIQSSFFWGYLLTQI GGIWAD  GGKLVLG
Sbjct  210   LLCNMDRVNMSIAILPMSSEFSWSPATVGLIQSSFFWGYLLTQILGGIWADRFGGKLVLG  269

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGV+WWSIAT+LTP+AAK+GLP L  +RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA
Sbjct  270   FGVIWWSIATVLTPLAAKIGLPCLLTMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLA  329

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGLA SP+LI +FGWPSVFY+FGSLG+VWF +W SKAHSSP DDPEL  
Sbjct  330   LVYSGMYLGSVTGLALSPLLISRFGWPSVFYAFGSLGSVWFALWQSKAHSSPDDDPELSK  389

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
              EK+ IL  S  KEPV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLK
Sbjct  390   AEKRHILGGSPLKEPVTSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLK  449

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+  VLPWLTMA  A  GGWIAD+LV++G+SVT VRKIMQ+IGFLGPA FLT L
Sbjct  450   FNLTESGLLCVLPWLTMAVFANIGGWIADTLVQRGISVTNVRKIMQSIGFLGPALFLTLL  509

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             S V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  510   SKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  569

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWD VFKVSV LY+VGTVVWN+F+TGEK+L+
Sbjct  570   TGYILQKGSWDSVFKVSVVLYIVGTVVWNVFATGEKVLE  608



>ref|XP_011035185.1| PREDICTED: probable anion transporter 1, chloroplastic isoform 
X2 [Populus euphratica]
Length=390

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/390 (89%), Positives = 367/390 (94%), Gaps = 0/390 (0%)
 Frame = -2

Query  1603  MSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIA  1424
             MSIAILPM++EY+W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGV+WWSIA
Sbjct  1     MSIAILPMSAEYNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLGFGVIWWSIA  60

Query  1423  TILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLG  1244
             T LTP+AAK GLPFL +VRAFMG+GEGVAMPAMN +LSKWVPVSERSRSLA+VYSGMYLG
Sbjct  61    TALTPVAAKAGLPFLLVVRAFMGVGEGVAMPAMNTILSKWVPVSERSRSLALVYSGMYLG  120

Query  1243  SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRN  1064
             SVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  WLSKAHSSPLDDP+L PEEK LI  N
Sbjct  121   SVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFAAWLSKAHSSPLDDPQLRPEEKNLIFVN  180

Query  1063  SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMF  884
             S  KEPVKSIPW LILSK PVWALIVSHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+F
Sbjct  181   SSPKEPVKSIPWGLILSKAPVWALIVSHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLF  240

Query  883   AVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMA  704
              VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ+IGFLGPAFFLTQLSH+DSPAMA
Sbjct  241   CVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFFLTQLSHIDSPAMA  300

Query  703   VLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGS  524
             VLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVFGTA+TGYILQHGS
Sbjct  301   VLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVFGTASTGYILQHGS  360

Query  523   WDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             WDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  361   WDDVFKVSVGLYLVGTVVWNLFSTGEKILD  390



>ref|XP_007016154.1| Phosphate transporter 4,1 isoform 2 [Theobroma cacao]
 gb|EOY33773.1| Phosphate transporter 4,1 isoform 2 [Theobroma cacao]
Length=390

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/390 (87%), Positives = 374/390 (96%), Gaps = 0/390 (0%)
 Frame = -2

Query  1603  MSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIA  1424
             MSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGV+WWSIA
Sbjct  1     MSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKSVLGFGVIWWSIA  60

Query  1423  TILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLG  1244
             T LTP+AAK+GLPFL +VRAFMGIGEGVAMPAMNN+LS+WVPV+ERSRSLA+VYSGMYLG
Sbjct  61    TALTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMNNILSRWVPVAERSRSLALVYSGMYLG  120

Query  1243  SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRN  1064
             SVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF +WL+KAHSSPL+DP+L P+EKKLI+ N
Sbjct  121   SVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFGIWLNKAHSSPLEDPQLRPQEKKLIVTN  180

Query  1063  SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMF  884
             +++ +PVK+IPW+LILSKPPV ALIVSHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+F
Sbjct  181   NITNKPVKTIPWRLILSKPPVLALIVSHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLF  240

Query  883   AVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMA  704
              VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ+IGFLGPAFFLTQLSHV+SPAMA
Sbjct  241   CVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFFLTQLSHVNSPAMA  300

Query  703   VLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGS  524
             VLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVFGTAATGYILQHGS
Sbjct  301   VLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVFGTAATGYILQHGS  360

Query  523   WDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             WDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  361   WDDVFKVSVGLYLVGTVVWNLFSTGEKILD  390



>ref|XP_004968946.1| PREDICTED: probable anion transporter 4, chloroplastic-like [Setaria 
italica]
Length=616

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/459 (77%), Positives = 389/459 (85%), Gaps = 5/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLCFSAF  1631
             R  AD K++ Y I+ S    L   D   + V   D  E       FPKRW IVLLCF AF
Sbjct  161   RTRADCKAEQYEITGS---PLSPSDVPAEAVRIGDTNEVSPWWQEFPKRWTIVLLCFFAF  217

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+SE++W+P TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLG
Sbjct  218   LLCNMDRVNMSIAILPMSSEFNWNPATVGLIQSSFFWGYLLTQILGGIWADRFGGKVVLG  277

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGVVWWS+ATILTPIAAK+GLP L  VRAFMGIGEGVAMP+MNN+LSKW+PVSERSRSLA
Sbjct  278   FGVVWWSLATILTPIAAKIGLPCLLTVRAFMGIGEGVAMPSMNNILSKWIPVSERSRSLA  337

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGLAFSPMLI KFGWPSVFY+FGSLG+VWF +W SKAHSSP DDP L  
Sbjct  338   LVYSGMYLGSVTGLAFSPMLISKFGWPSVFYAFGSLGSVWFALWQSKAHSSPDDDPNLSN  397

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
              EK+ IL     K+PV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLK
Sbjct  398   AEKRHILGGGTFKQPVTSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLK  457

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTESG+  VLPWLTMA  A  GGWIAD+LV++GVS+T VRKIMQ+IGFLGPA FLT L
Sbjct  458   FNLTESGLLCVLPWLTMAVFANIGGWIADTLVQRGVSITNVRKIMQSIGFLGPALFLTLL  517

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             S V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAA
Sbjct  518   SKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAA  577

Query  550   TGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TGYILQ GSWD VFKV+V LY++GTVVWN+FSTGEKIL+
Sbjct  578   TGYILQKGSWDSVFKVAVVLYIIGTVVWNVFSTGEKILE  616



>ref|XP_010557217.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=423

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/393 (87%), Positives = 369/393 (94%), Gaps = 0/393 (0%)
 Frame = -2

Query  1612  RVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWW  1433
             +VNMSIAILPM++E+ W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGV+WW
Sbjct  31    QVNMSIAILPMSAEFGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKTVLGFGVIWW  90

Query  1432  SIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGM  1253
             S+AT+LTPIAAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKWVPV ERSRSLA+VYSGM
Sbjct  91    SVATVLTPIAAKLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWVPVQERSRSLALVYSGM  150

Query  1252  YLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLI  1073
             YLGSVTGLAFSP LIH FGWPSVFYSFGSLGTVW T+WL+KA SSP++D ELLPEE+KLI
Sbjct  151   YLGSVTGLAFSPFLIHHFGWPSVFYSFGSLGTVWLTLWLNKAESSPIEDTELLPEERKLI  210

Query  1072  LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTES  893
               NSV KEPVK+IPW+LILSKPPVWALI SHFCHNWGTFI+LTWMPTYYHQVLKFNL ES
Sbjct  211   ADNSVCKEPVKTIPWRLILSKPPVWALIGSHFCHNWGTFIILTWMPTYYHQVLKFNLMES  270

Query  892   GMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSP  713
             G+ +VLPWLTMA SA AGGWIAD+LV KG+SVT VRK+MQTIGFLGPAFFLTQL HVDSP
Sbjct  271   GLLSVLPWLTMAVSANAGGWIADTLVSKGLSVTTVRKVMQTIGFLGPAFFLTQLKHVDSP  330

Query  712   AMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ  533
             AMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGV GTAATG+ILQ
Sbjct  331   AMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVLGTAATGHILQ  390

Query  532   HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             HGSWDDVF VSVGLYLVGTVVWNLFSTGEKI+D
Sbjct  391   HGSWDDVFSVSVGLYLVGTVVWNLFSTGEKIID  423



>dbj|BAJ90562.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=612

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/467 (75%), Positives = 389/467 (83%), Gaps = 11/467 (2%)
 Frame = -2

Query  1816  RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGG------FPKRWVI  1655
             R   R   D +++ Y ++ S P  +  E A    VL  D    +         FPKRW I
Sbjct  151   RAPLRKRRDCRAEQYEMAGS-PSDVPAEAA----VLVGDANAGVVSAPPWWQQFPKRWTI  205

Query  1654  VLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADT  1475
             V+LCF +FLLCNMDRVNMSIAILPM++E+ WSP TVGLIQSSFFWGYLLTQI GGIWAD 
Sbjct  206   VVLCFFSFLLCNMDRVNMSIAILPMSAEFSWSPATVGLIQSSFFWGYLLTQILGGIWADR  265

Query  1474  vggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPV  1295
              GGK+VLGFGVVWWSIATILTP AAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PV
Sbjct  266   FGGKVVLGFGVVWWSIATILTPFAAKLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWIPV  325

Query  1294  SERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSp  1115
             SERSRSLA+VYSGMYLGSVTGLAFSP LI KFGWPSVFY FGSLG++WF +W  KA SSP
Sbjct  326   SERSRSLALVYSGMYLGSVTGLAFSPFLISKFGWPSVFYGFGSLGSIWFAMWQLKARSSP  385

Query  1114  lddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMP  935
              +DPE+  +EK+ IL  S  KEPV SIPWKLILSKP VWALIVSHFCHNWGTFILLTWMP
Sbjct  386   SEDPEVTEDEKRHILGGSTVKEPVSSIPWKLILSKPAVWALIVSHFCHNWGTFILLTWMP  445

Query  934   TYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLG  755
             TYY+QVLKFNLTESG+  VLPWLTMA  A  GGWIAD+LV KGVS+T VRKIMQ+IGFLG
Sbjct  446   TYYNQVLKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVAKGVSITNVRKIMQSIGFLG  505

Query  754   PAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVL  575
             PA FLT LS V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVL
Sbjct  506   PALFLTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVL  565

Query  574   AGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             AGVFGTAATGYILQ GSWD VF+V+V LY+VGTVVWNLFSTGE+IL+
Sbjct  566   AGVFGTAATGYILQKGSWDSVFQVAVLLYIVGTVVWNLFSTGERILE  612



>emb|CDY07222.1| BnaCnng02370D [Brassica napus]
Length=558

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/536 (68%), Positives = 418/536 (78%), Gaps = 31/536 (6%)
 Frame = -2

Query  1996  KAMTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGR----GFRR  1829
             + +  RA+ L   + P K+  S +A+        +  T  +  FG    PG     G R 
Sbjct  39    RVIIPRAIALCRNHQPRKI-LSLQASL-------QHDTGHMTSFGCFLQPGNLEHHGIRF  90

Query  1828  GLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWV  1658
                 + + R +    S+   I++ V +SL   +AL    L + +    S     FP+RWV
Sbjct  91    KNSNKNTSRPYYK-SSEESDITEEVVDSLSSAEAL----LVQGNRNKASPWWQQFPRRWV  145

Query  1657  IVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWAD  1478
             IVLLCF++FLLCNMDRVNMSIAILPM+ +Y+W+  TVGLIQSSFFWGYLLTQI GGIWAD
Sbjct  146   IVLLCFASFLLCNMDRVNMSIAILPMSQQYNWNSATVGLIQSSFFWGYLLTQILGGIWAD  205

Query  1477  TvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVP  1298
               GGKLVLGFGVVWWSIAT++TPIAAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+P
Sbjct  206   KYGGKLVLGFGVVWWSIATVMTPIAAKLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIP  265

Query  1297  VSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSS  1118
             VSERSRSLA+VYSGMYLGSVTGL FSPMLI KFGWPSVFYSFGSLG++WF +WL  A+SS
Sbjct  266   VSERSRSLALVYSGMYLGSVTGLGFSPMLIQKFGWPSVFYSFGSLGSIWFLLWLKYAYSS  325

Query  1117  plddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWM  938
             P DDPEL  EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWM
Sbjct  326   PKDDPELSEEEKKIILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWM  385

Query  937   PTYY--------HQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             PTYY        H VLKFNLTESG+  VLPW TMA  A  GGWIAD+LV +G+S+T    
Sbjct  386   PTYYNQACTPTSHMVLKFNLTESGLLCVLPWFTMAVLANVGGWIADTLVSRGLSIT---S  442

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQ+IGFLGPAFFLTQLS V +PAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL+
Sbjct  443   IMQSIGFLGPAFFLTQLSRVKTPAMAVLCMACSQGADAFSQSGLYSNHQDIGPRYAGVLL  502

Query  601   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+VGLYL+GT+VWNLF+TGEK+LD
Sbjct  503   GLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVGLYLIGTLVWNLFATGEKVLD  558



>ref|XP_006591211.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X3 [Glycine max]
Length=494

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/444 (79%), Positives = 384/444 (86%), Gaps = 17/444 (4%)
 Frame = -2

Query  1834  RRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGG-------  1676
             RR  +     R W +VKS+      ++ ES K+ED   D V+ +     +          
Sbjct  44    RRSHLVAGGRRVWVNVKSE-----KNLSESPKYED---DVVVQKKKKRGLDNVEEEARWW  95

Query  1675  --FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQ  1502
               FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P+TVGLIQSSFFWGYLLTQ
Sbjct  96    QVFPKRWVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPSTVGLIQSSFFWGYLLTQ  155

Query  1501  IAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMN  1322
             IAGGIWADTVGGK VLGFGVVWWS+AT LTPIAAKLGLPFL + RAFMGIGEGVAMPAMN
Sbjct  156   IAGGIWADTVGGKQVLGFGVVWWSVATALTPIAAKLGLPFLLVARAFMGIGEGVAMPAMN  215

Query  1321  NLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTV  1142
             N+LSKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW +V
Sbjct  216   NILSKWVPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWCSV  275

Query  1141  WLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWG  962
             WLSKAHSSPL+DPEL PEEKKLI  N  SKEPVK+IPW+LILSKPPVWALIVSHFCHNWG
Sbjct  276   WLSKAHSSPLEDPELRPEEKKLITANCSSKEPVKTIPWRLILSKPPVWALIVSHFCHNWG  335

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             TFILLTWMPTYY+QVLKFNLTESG+F VLPW  MA SA  GGWIAD+LV KG+SVT VRK
Sbjct  336   TFILLTWMPTYYNQVLKFNLTESGLFCVLPWFIMAISANVGGWIADTLVSKGLSVTRVRK  395

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQTIGFLGPAFFLTQLSH +SP MAVLCMTCSQG+DAFSQSGLYSNHQDIAPRYSG+L+
Sbjct  396   IMQTIGFLGPAFFLTQLSHANSPVMAVLCMTCSQGTDAFSQSGLYSNHQDIAPRYSGILL  455

Query  601   GLSNTAGVLAGVFGTAATGYILQH  530
             GLSNTAGVLAGVFGTAATGYILQH
Sbjct  456   GLSNTAGVLAGVFGTAATGYILQH  479



>ref|NP_973561.1| phosphate transporter 4;1 [Arabidopsis thaliana]
 gb|AEC08287.1| sodium-dependent phosphate transport protein 1 [Arabidopsis thaliana]
Length=400

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/394 (85%), Positives = 365/394 (93%), Gaps = 0/394 (0%)
 Frame = -2

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             + VNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGV+W
Sbjct  7     EAVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLGFGVIW  66

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WSIATILTP+AAKLGLP+L +VRAFMG+GEGVAMPAMNN+LSKWVPV ERSRSLA+VYSG
Sbjct  67    WSIATILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILSKWVPVQERSRSLALVYSG  126

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW T+WL+KA SSPL+DP LLPEE+KL
Sbjct  127   MYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLTLWLTKAESSPLEDPTLLPEERKL  186

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             I  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPTYYHQVLKFNL E
Sbjct  187   IADNCASKEPVKSIPWRLILSKPPVWALISCHFCHNWGTFILLTWMPTYYHQVLKFNLME  246

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+ +V PW+TMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGPAFFLTQL H+DS
Sbjct  247   SGLLSVFPWMTMAISANAGGWIADTLVSRGFSVTNVRKIMQTIGFLGPAFFLTQLKHIDS  306

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
             P MAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGV GTAATG+IL
Sbjct  307   PTMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVLGTAATGHIL  366

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             QHGSWDDVF +SVGLYLVGTV+WNLFSTGEKI+D
Sbjct  367   QHGSWDDVFTISVGLYLVGTVIWNLFSTGEKIID  400



>ref|XP_009367842.1| PREDICTED: probable anion transporter 2, chloroplastic [Pyrus 
x bretschneideri]
Length=610

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/461 (75%), Positives = 391/461 (85%), Gaps = 4/461 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG--GFPKRWVIVLLCFSAF  1631
             R  A  KS+   I++S  +SL   +   + VL   +   +      PKRWVIVLLCF+AF
Sbjct  150   RTCAYYKSEENDITESEVDSLTSIEGSGEAVLAARNVRKVPSWWEIPKRWVIVLLCFTAF  209

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGI AD +GGK VLG
Sbjct  210   LLCNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQILGGILADKIGGKRVLG  269

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGV+WWS+ATILTPIAAK+ LPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSR+L+
Sbjct  270   FGVIWWSVATILTPIAAKISLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRALS  329

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VY+GMYLGSVTGLA SP+LI KF WPSVFYSFGSLG++W  +WL+KA+S+P +DPEL  
Sbjct  330   LVYTGMYLGSVTGLAVSPILIQKFKWPSVFYSFGSLGSIWLALWLNKAYSTPKEDPELSA  389

Query  1090  eekkLIL--RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQV  917
             EEK+LI+    + SKEPVK IPWKLILSK PVWALIV HFCHNWGTFILLTWMPTYY+QV
Sbjct  390   EEKELIMGGTGNTSKEPVKVIPWKLILSKTPVWALIVCHFCHNWGTFILLTWMPTYYNQV  449

Query  916   LKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLT  737
             LKFNLTESG+  VLPWLTMA  A  GGWIAD+LV KG SVT VRKIMQ+IGFLGPAF LT
Sbjct  450   LKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVTKGFSVTTVRKIMQSIGFLGPAFSLT  509

Query  736   QLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGT  557
              LS V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGT
Sbjct  510   LLSRVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGT  569

Query  556   AATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             AATGYILQ GSWDDVFKVSV LY++GT++WNLFSTGEKILD
Sbjct  570   AATGYILQRGSWDDVFKVSVVLYIIGTLIWNLFSTGEKILD  610



>ref|XP_006410022.1| hypothetical protein EUTSA_v10016491mg [Eutrema salsugineum]
 gb|ESQ51475.1| hypothetical protein EUTSA_v10016491mg [Eutrema salsugineum]
Length=423

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/393 (85%), Positives = 362/393 (92%), Gaps = 0/393 (0%)
 Frame = -2

Query  1612  RVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWW  1433
             +VNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK+VLGFGV+WW
Sbjct  31    QVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKMVLGFGVIWW  90

Query  1432  SIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGM  1253
             SIATILTPIAAKLGLPFL +VRAFMG+GEGVAMPAMNNLLSKWVPV ERSRSLA+VYSGM
Sbjct  91    SIATILTPIAAKLGLPFLLVVRAFMGVGEGVAMPAMNNLLSKWVPVQERSRSLALVYSGM  150

Query  1252  YLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLI  1073
             Y+GSV GLAFSP LIH+FGWPSVFY FGSLGTVW T+WL+KA SSP++D  LLP+E+KLI
Sbjct  151   YIGSVIGLAFSPFLIHQFGWPSVFYCFGSLGTVWLTLWLTKAESSPVEDLTLLPQERKLI  210

Query  1072  LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTES  893
               N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPTYYHQVLKFNL ES
Sbjct  211   ADNCASKEPVKSIPWRLILSKPPVWALICCHFCHNWGTFILLTWMPTYYHQVLKFNLMES  270

Query  892   GMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSP  713
             G+ +V PWLTMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGPAFFLTQL H+DSP
Sbjct  271   GLLSVFPWLTMAISANAGGWIADTLVSRGFSVTNVRKIMQTIGFLGPAFFLTQLKHIDSP  330

Query  712   AMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ  533
              MAVLCM CSQG DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGV GTAATG+ILQ
Sbjct  331   TMAVLCMACSQGLDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVLGTAATGHILQ  390

Query  532   HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             HGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  391   HGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  423



>ref|XP_010510443.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X5 [Camelina sativa]
 ref|XP_010510445.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X6 [Camelina sativa]
Length=424

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/412 (83%), Positives = 371/412 (90%), Gaps = 3/412 (1%)
 Frame = -2

Query  1660  VIVLLCFSAFLLCNMD---RVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGG  1490
             V + L FS+      D   +VNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGG
Sbjct  13    VTLFLSFSSLQYGQNDVFQQVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGG  72

Query  1489  IWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLS  1310
             IWADTVGGK VLGFGV+WWSIATILTP+AAKLGLP+L +VRAFMG+GEGVAMPAMNN+LS
Sbjct  73    IWADTVGGKRVLGFGVIWWSIATILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILS  132

Query  1309  KWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             KWVPV ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW  +WL+K
Sbjct  133   KWVPVQERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLILWLTK  192

Query  1129  AHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFIL  950
             A SSPL+DP LLP+E+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFIL
Sbjct  193   AESSPLEDPTLLPKERKLIADNCASKEPVKSIPWRLILSKPPVWALIGCHFCHNWGTFIL  252

Query  949   LTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQT  770
             LTWMPTYYHQVLKFNL ESG+ +V PW+TMA SA AGGWIAD+LV +G SVT VRKIMQT
Sbjct  253   LTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGFSVTNVRKIMQT  312

Query  769   IGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSN  590
             IGFLGPAFFLTQL H+DSP MAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSN
Sbjct  313   IGFLGPAFFLTQLKHIDSPTMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSN  372

Query  589   TAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TAGVLAGV GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  373   TAGVLAGVLGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  424



>ref|XP_010414366.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=424

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/412 (83%), Positives = 371/412 (90%), Gaps = 3/412 (1%)
 Frame = -2

Query  1660  VIVLLCFSAFLLCNMD---RVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGG  1490
             V + L FS+      D   +VNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGG
Sbjct  13    VALFLSFSSLQYGQNDVFQQVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGG  72

Query  1489  IWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLS  1310
             IWADTVGGK VLGFGV+WWSIATILTP+AAKLGLP+L +VRAFMG+GEGVAMPAMNN+LS
Sbjct  73    IWADTVGGKRVLGFGVIWWSIATILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILS  132

Query  1309  KWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             KWVPV ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW  +WL+K
Sbjct  133   KWVPVQERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLILWLTK  192

Query  1129  AHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFIL  950
             A SSPL+DP LLP+E+KLI  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFIL
Sbjct  193   AESSPLEDPTLLPKERKLIADNCASKEPVKSIPWRLILSKPPVWALIGCHFCHNWGTFIL  252

Query  949   LTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQT  770
             LTWMPTYYHQVLKFNL ESG+ +V PW+TMA SA AGGWIAD+LV +G SVT VRKIMQT
Sbjct  253   LTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGFSVTNVRKIMQT  312

Query  769   IGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSN  590
             IGFLGPAFFLTQL H+DSP MAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSN
Sbjct  313   IGFLGPAFFLTQLKHIDSPTMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSN  372

Query  589   TAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             TAGVLAGV GTAATG+ILQHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  373   TAGVLAGVLGTAATGHILQHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  424



>gb|KHN47608.1| Sodium-dependent phosphate transport protein 1, chloroplastic 
[Glycine soja]
Length=401

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/383 (89%), Positives = 363/383 (95%), Gaps = 0/383 (0%)
 Frame = -2

Query  1618  MDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvV  1439
             MDRVNMSIAILPM++EY+W+P+TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGVV
Sbjct  1     MDRVNMSIAILPMSAEYNWNPSTVGLIQSSFFWGYLLTQIAGGIWADTVGGKQVLGFGVV  60

Query  1438  WWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYS  1259
             WWS+AT LTPIAAKLGLPFL + RAFMGIGEGVAMPAMNN+LSKWVPVSERSRSLA+VYS
Sbjct  61    WWSVATALTPIAAKLGLPFLLVARAFMGIGEGVAMPAMNNILSKWVPVSERSRSLALVYS  120

Query  1258  GMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekk  1079
             GMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW +VWLSKAHSSPL+DPEL PEEKK
Sbjct  121   GMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWCSVWLSKAHSSPLEDPELRPEEKK  180

Query  1078  LILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLT  899
             LI  N  SKEPVK+IPW+LILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+QVLKFNLT
Sbjct  181   LITANCSSKEPVKTIPWRLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLKFNLT  240

Query  898   ESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVD  719
             ESG+F VLPW  MA SA  GGWIAD+LV KG+SVT VRKIMQTIGFLGPAFFLTQLSHV+
Sbjct  241   ESGLFCVLPWFIMAISANVGGWIADTLVSKGLSVTRVRKIMQTIGFLGPAFFLTQLSHVN  300

Query  718   SPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYI  539
             SP MAVLCMTCSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGVFGTAATGYI
Sbjct  301   SPVMAVLCMTCSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVFGTAATGYI  360

Query  538   LQHGSWDDVFKVSVGLYLVGTVV  470
             LQHGSWDDVFKVSVGLYLVGTV+
Sbjct  361   LQHGSWDDVFKVSVGLYLVGTVI  383



>ref|XP_008342264.1| PREDICTED: probable anion transporter 2, chloroplastic [Malus 
domestica]
Length=610

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/461 (75%), Positives = 390/461 (85%), Gaps = 4/461 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG--GFPKRWVIVLLCFSAF  1631
             R  A  KS+   I++S  +SL   +   + +L   +   +      PKRWVIVLLCF+AF
Sbjct  150   RTCAYYKSEDNDITESEVDSLTSIEGSGEAILAAGNXRKVPSWWEIPKRWVIVLLCFTAF  209

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPMA E++W+  TVGLIQSSFFWGYLLTQI GGI AD +GGK VLG
Sbjct  210   LLCNMDRVNMSIAILPMAQEFNWNSATVGLIQSSFFWGYLLTQILGGILADKIGGKRVLG  269

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGV+WWS+ATILTPIAAK+ LPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSR+L+
Sbjct  270   FGVIWWSVATILTPIAAKISLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRALS  329

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VY+GMYLGSVTGLA SP+LI KF WPSVFYSFGSLG++W  +WL+KA+S+P +DPEL  
Sbjct  330   LVYTGMYLGSVTGLAVSPILIQKFKWPSVFYSFGSLGSIWLALWLNKAYSTPKEDPELSA  389

Query  1090  eekkLIL--RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQV  917
             EEK+LI+    + SKEPVK IPWKLILSK PVWALIV HFCHNWGTFILLTWMPTYY+QV
Sbjct  390   EEKELIMGGTGNTSKEPVKVIPWKLILSKTPVWALIVCHFCHNWGTFILLTWMPTYYNQV  449

Query  916   LKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLT  737
             LKFNLTESG+  VLPWLTMA  A  GGWIAD+LV KG SVT VRKIMQ+IGFLGPAF LT
Sbjct  450   LKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVSKGFSVTTVRKIMQSIGFLGPAFSLT  509

Query  736   QLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGT  557
              LS V +P MAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGT
Sbjct  510   LLSRVKTPXMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGT  569

Query  556   AATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             AATGYILQ GSWDDVFKVSV LY++GT++WNLFSTGEKILD
Sbjct  570   AATGYILQRGSWDDVFKVSVVLYIIGTLIWNLFSTGEKILD  610



>ref|XP_010510441.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X3 [Camelina sativa]
 ref|XP_010510442.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
isoform X4 [Camelina sativa]
Length=433

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/394 (85%), Positives = 364/394 (92%), Gaps = 0/394 (0%)
 Frame = -2

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
              +VNMSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGV+W
Sbjct  40    QQVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLGFGVIW  99

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WSIATILTP+AAKLGLP+L +VRAFMG+GEGVAMPAMNN+LSKWVPV ERSRSLA+VYSG
Sbjct  100   WSIATILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILSKWVPVQERSRSLALVYSG  159

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVW  +WL+KA SSPL+DP LLP+E+KL
Sbjct  160   MYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLILWLTKAESSPLEDPTLLPKERKL  219

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             I  N  SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPTYYHQVLKFNL E
Sbjct  220   IADNCASKEPVKSIPWRLILSKPPVWALIGCHFCHNWGTFILLTWMPTYYHQVLKFNLME  279

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+ +V PW+TMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGPAFFLTQL H+DS
Sbjct  280   SGLLSVFPWMTMAISANAGGWIADTLVSRGFSVTNVRKIMQTIGFLGPAFFLTQLKHIDS  339

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
             P MAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGV GTAATG+IL
Sbjct  340   PTMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVLGTAATGHIL  399

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             QHGSWDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  400   QHGSWDDVFTISVGLYLVGTVVWNLFSTGEKIID  433



>ref|XP_010469921.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
isoform X2 [Camelina sativa]
Length=390

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/390 (85%), Positives = 360/390 (92%), Gaps = 0/390 (0%)
 Frame = -2

Query  1603  MSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIA  1424
             MSIAILPM++EY W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGF V+WWSIA
Sbjct  1     MSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLGFAVIWWSIA  60

Query  1423  TILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLG  1244
             TILTP+AAKLGLP+L +VRAFMG+GEGVAMPAMNN+LSKWVPV ERSRSLA+VYSGMYLG
Sbjct  61    TILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILSKWVPVQERSRSLALVYSGMYLG  120

Query  1243  SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRN  1064
             SVTGLAFSP LIH+FGWPSVFYSFGSLGTVW  +WL+KA SSPL+DP LLP+E+KLI  N
Sbjct  121   SVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWLILWLTKAESSPLEDPTLLPKERKLIADN  180

Query  1063  SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMF  884
               SKEPVKSIPW+LILSKPPVWALI  HFCHNWGTFILLTWMPTYYHQVLKFNL ESG+ 
Sbjct  181   CASKEPVKSIPWRLILSKPPVWALIGCHFCHNWGTFILLTWMPTYYHQVLKFNLMESGLL  240

Query  883   AVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMA  704
             +V PW+TMA SA AGGWIAD+LV +G SVT VRKIMQTIGFLGPAFFLTQL H+DSP MA
Sbjct  241   SVFPWMTMAISANAGGWIADTLVSRGFSVTNVRKIMQTIGFLGPAFFLTQLKHIDSPTMA  300

Query  703   VLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGS  524
             VLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLSNTAGVLAGV GTAATG+ILQHGS
Sbjct  301   VLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVLGTAATGHILQHGS  360

Query  523   WDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             WDDVF +SVGLYLVGTVVWNLFSTGEKI+D
Sbjct  361   WDDVFTISVGLYLVGTVVWNLFSTGEKIID  390



>ref|XP_002979008.1| hypothetical protein SELMODRAFT_109981 [Selaginella moellendorffii]
 gb|EFJ19965.1| hypothetical protein SELMODRAFT_109981 [Selaginella moellendorffii]
Length=449

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/414 (79%), Positives = 367/414 (89%), Gaps = 1/414 (0%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRW IV LCF AFLLCNMDRVNMSIAILPMASE+HW+ TTVGL+QSSFFWGYLLTQIAG
Sbjct  36    PKRWQIVALCFFAFLLCNMDRVNMSIAILPMASEFHWNSTTVGLVQSSFFWGYLLTQIAG  95

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G+WAD++GGK VLGFGV+WWS+AT+LTP+AAKLGLP LF VRA MGIGEGVAMPAMNNLL
Sbjct  96    GVWADSIGGKKVLGFGVIWWSVATVLTPLAAKLGLPVLFAVRACMGIGEGVAMPAMNNLL  155

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             S+W+PV+ERSRSLA+VYSGMYLGSVTGLAFSP LIHK+ WPSVF++FGSLG VWFT W  
Sbjct  156   SRWIPVTERSRSLALVYSGMYLGSVTGLAFSPALIHKYNWPSVFFTFGSLGAVWFTFWQK  215

Query  1132  KAHSSplddpellpeekkLILRNSV-SKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
              A+SSP +D  L  EEK  IL +S   K  +  IPW  +LS+P VWALIV HFCHNWGTF
Sbjct  216   NAYSSPAEDLTLSEEEKNYILGDSAQEKVAIGEIPWGQLLSEPSVWALIVCHFCHNWGTF  275

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             ILLTWMPTYY+QVL FNL ESGMF+VLPWLTMA S+  GGWIAD+LV++GVSVT+VRK+M
Sbjct  276   ILLTWMPTYYNQVLGFNLMESGMFSVLPWLTMALSSNLGGWIADNLVKRGVSVTLVRKVM  335

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             Q+IGFLGPAFFLTQLSH+ SP+ AVLCM  SQG DAFSQSGLYSNHQDI PRY+GVL+GL
Sbjct  336   QSIGFLGPAFFLTQLSHIRSPSGAVLCMMASQGLDAFSQSGLYSNHQDIGPRYAGVLLGL  395

Query  595   SNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SNTAGVLAGV GTAATGYILQHG+WDDVFKV+V LYLVGTVVWNLFSTGE+++D
Sbjct  396   SNTAGVLAGVIGTAATGYILQHGTWDDVFKVAVALYLVGTVVWNLFSTGERVID  449



>ref|XP_002988408.1| hypothetical protein SELMODRAFT_128034 [Selaginella moellendorffii]
 gb|EFJ10498.1| hypothetical protein SELMODRAFT_128034 [Selaginella moellendorffii]
Length=479

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/414 (79%), Positives = 367/414 (89%), Gaps = 1/414 (0%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRW IV LCF AFLLCNMDRVNMSIAILPMASE+HW+ TTVGL+QSSFFWGYLLTQIAG
Sbjct  66    PKRWQIVALCFFAFLLCNMDRVNMSIAILPMASEFHWNSTTVGLVQSSFFWGYLLTQIAG  125

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G+WAD++GGK VLGFGV+WWS+AT+LTP+AAKLGLP LF VRA MGIGEGVAMPAMNNLL
Sbjct  126   GVWADSIGGKKVLGFGVIWWSVATVLTPLAAKLGLPVLFAVRACMGIGEGVAMPAMNNLL  185

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             S+W+PV+ERSRSLA+VYSGMYLGSVTGLAFSP LIHK+ WPSVF++FGSLG VWFT W  
Sbjct  186   SRWIPVTERSRSLALVYSGMYLGSVTGLAFSPALIHKYNWPSVFFTFGSLGAVWFTFWQK  245

Query  1132  KAHSSplddpellpeekkLILRNSV-SKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
              A+SSP +D  L  EEK  IL +S   K  +  IPW  +LS+P VWALIV HFCHNWGTF
Sbjct  246   NAYSSPAEDITLSEEEKNYILGDSAQEKVAIGEIPWGQLLSEPSVWALIVCHFCHNWGTF  305

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             ILLTWMPTYY+QVL FNL ESGMF+VLPWLTMA S+  GGWIAD+LV++GVSVT+VRK+M
Sbjct  306   ILLTWMPTYYNQVLGFNLMESGMFSVLPWLTMALSSNLGGWIADNLVKRGVSVTLVRKVM  365

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             Q+IGFLGPAFFLTQLSH+ SP+ AVLCM  SQG DAFSQSGLYSNHQDI PRY+GVL+GL
Sbjct  366   QSIGFLGPAFFLTQLSHIRSPSGAVLCMMASQGLDAFSQSGLYSNHQDIGPRYAGVLLGL  425

Query  595   SNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SNTAGVLAGV GTAATGYILQHG+WDDVFKV+V LYLVGTVVWNLFSTGE+++D
Sbjct  426   SNTAGVLAGVIGTAATGYILQHGTWDDVFKVAVALYLVGTVVWNLFSTGERVID  479



>gb|AIY53219.1| phosphate transporter [Manihot esculenta]
Length=492

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/429 (79%), Positives = 375/429 (87%), Gaps = 3/429 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R  A  KS+ Y I+++  +SLK  +   + VL E + +  S     FPKRWVIVLLCF A
Sbjct  52    RMRAYYKSEEYDITEAAVDSLKSAEGSAEAVLVEGNLQETSPWWQQFPKRWVIVLLCFMA  111

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYL+TQI GGIWAD +GGKLVL
Sbjct  112   FLLCNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLMTQIIGGIWADKLGGKLVL  171

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWS ATILTPIAA+LGLPFL ++RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  172   GFGVVWWSAATILTPIAARLGLPFLLMMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSL  231

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSP+LIHKFGWPSVFY+FGSLG++WF +WL KA+SSP DDP+L 
Sbjct  232   ALVYSGMYLGSVTGLAFSPILIHKFGWPSVFYAFGSLGSIWFALWLRKAYSSPKDDPDLC  291

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEKKLIL  S +KEPV  IPWKLILSK PVWALIVSHFCHNWGTFILLTWMPTYY+QVL
Sbjct  292   AEEKKLILGGSTAKEPVSVIPWKLILSKAPVWALIVSHFCHNWGTFILLTWMPTYYNQVL  351

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  352   KFNLTESGLFCVLPWLTMAVFANIGGWIADTLVSKGLSITAVRKIMQSIGFLGPAFFLTQ  411

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  412   LSHVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  471

Query  553   ATGYILQHG  527
             ATGYILQ G
Sbjct  472   ATGYILQRG  480



>gb|KDO66832.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis]
Length=466

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/533 (69%), Positives = 407/533 (76%), Gaps = 81/533 (15%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLI---  1820
             M+ARAL  S     P L   P  +   R+  SR+            L  RG  R L+   
Sbjct  1     MSARALFYS-----PILQSPPYIS--ARNKLSRAE-----------LRPRGLPRLLLGVL  42

Query  1819  ---RRTSWR-AWADVKSKTYGISDSVPESLKFEDALNDDVL-TED---DGETIS---GGF  1673
                R  S+R +  DVKS++Y +S+   +S+KFE+AL D  L +ED   D E++      F
Sbjct  43    SGDRVCSFRVSVRDVKSESYNVSE---KSVKFEEALKDIALRSEDLGVDSESLVPWWEEF  99

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRW IV+LCFSAFLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAG
Sbjct  100   PKRWFIVVLCFSAFLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAG  159

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             GIWADTVGGK VLGFGVVWWSIAT LTP+AAKLGLPFL +VR FMGIGEGVAMPAMNN+L
Sbjct  160   GIWADTVGGKAVLGFGVVWWSIATALTPVAAKLGLPFLLVVRVFMGIGEGVAMPAMNNIL  219

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWFTVWLS
Sbjct  220   SKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHRFGWPSVFYSFGSLGTVWFTVWLS  279

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFI  953
             KAHSSP +DP+L P EKKLI+ +  SKEPVK+IPW LILSKPPVWALIVSHFCHNWGTFI
Sbjct  280   KAHSSPAEDPQLRPAEKKLIVSSCASKEPVKTIPWGLILSKPPVWALIVSHFCHNWGTFI  339

Query  952   LLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQ  773
             LLTWMPTYY+Q                                              IMQ
Sbjct  340   LLTWMPTYYNQ----------------------------------------------IMQ  353

Query  772   TIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLS  593
             +IGFLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+GLS
Sbjct  354   SIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLS  413

Query  592   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGT VWNLFSTGEK++D
Sbjct  414   NTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTAVWNLFSTGEKVVD  466



>ref|XP_006605416.1| PREDICTED: probable anion transporter 2, chloroplastic-like isoform 
X2 [Glycine max]
Length=581

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/454 (74%), Positives = 386/454 (85%), Gaps = 19/454 (4%)
 Frame = -2

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG---GFPKRWVIVLLCFSAFLLCNM  1616
             KS+ + I+++  + L+  +   + +L E +   +S     FPKRWVIVLLCF+AFLLCNM
Sbjct  144   KSEEHDITEAKVDPLESTEGTGESILLEGNVPQVSSWWQQFPKRWVIVLLCFAAFLLCNM  203

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             DRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGKLVLGFGVVW
Sbjct  204   DRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQILGGIWADKIGGKLVLGFGVVW  263

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WS+AT+LTPIAA++GLP L I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSG
Sbjct  264   WSMATVLTPIAARIGLPCLLIMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSG  323

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSV GLAFSP+LI KFGWPSVFYSFGSLG++WF +WL KA+SSP DDP+L  EEK+L
Sbjct  324   MYLGSVVGLAFSPLLIQKFGWPSVFYSFGSLGSIWFALWLRKAYSSPKDDPDLGVEEKRL  383

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             IL  +VS  PV SIPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNL E
Sbjct  384   ILEGNVSNAPVSSIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLME  443

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+  VLPWLTMA  A  GGWIAD+LVRKG+S+TVVRKIMQ+IGFLGPAFFL+QLSHV +
Sbjct  444   SGLLCVLPWLTMAAFANIGGWIADTLVRKGLSITVVRKIMQSIGFLGPAFFLSQLSHVRT  503

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
             PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG+IL
Sbjct  504   PAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGFIL  563

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             Q                 GT+VWN+FSTGEK+LD
Sbjct  564   QR----------------GTLVWNVFSTGEKVLD  581



>gb|KFK30624.1| hypothetical protein AALP_AA6G006100 [Arabis alpina]
Length=538

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/429 (77%), Positives = 368/429 (86%), Gaps = 3/429 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R+ A  KS+   I++ V ESL   D   + +L E + +  S     FP+RWVIVLLCF++
Sbjct  103   RSRAYYKSEESDITEGVVESLPSADGSAEAILVEGNLQNASPWWQQFPRRWVIVLLCFAS  162

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ E+ W+  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VL
Sbjct  163   FLLCNMDRVNMSIAILPMSQEFGWNSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVL  222

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWS ATI+TPIAAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  223   GFGVVWWSFATIMTPIAAKLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  282

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGL FSPMLIHKFGWPSVFYSFGSLG++WF +WL  AHSSP DDP+L 
Sbjct  283   ALVYSGMYLGSVTGLGFSPMLIHKFGWPSVFYSFGSLGSIWFLLWLKYAHSSPKDDPDLS  342

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  343   EEEKKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVL  402

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+  VLPW TMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  403   KFNLTESGLLCVLPWFTMAVFANVGGWIADTLVSRGLSITSVRKIMQSIGFLGPAFFLTQ  462

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LS V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  463   LSRVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  522

Query  553   ATGYILQHG  527
              TGYILQHG
Sbjct  523   VTGYILQHG  531



>ref|XP_008220539.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
isoform X2 [Prunus mume]
Length=500

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/485 (73%), Positives = 388/485 (80%), Gaps = 33/485 (7%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSP-EATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRR  1814
             M ARAL+ S+ + P   H  P + + PKRS    S  HT F F       +      + R
Sbjct  1     MNARALIYSFSHKP---HIPPTDISAPKRSLCPDSRRHTPFRFRVQI---QNREHYWVLR  54

Query  1813  TSWR-----------AWADVKSKTYGISDSVPESLKFEDALND-----------DVLTED  1700
              S R            +ADVKS+ Y IS+SV    KFE  LND           + L   
Sbjct  55    VSGRDSGGGKRRGGKVFADVKSEAYDISESVD---KFEKGLNDVPSGKEEELEEEPLAVA  111

Query  1699  DGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFW  1520
             +   +   FPKRWVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+P TVGLIQSSFFW
Sbjct  112   EASWLEQ-FPKRWVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPGTVGLIQSSFFW  170

Query  1519  GYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGV  1340
             GYLLTQIAGGIWADTVGGK VL FGV+WWSIATILTP+AAK+GLPFL +VRAFMGIGEGV
Sbjct  171   GYLLTQIAGGIWADTVGGKQVLAFGVIWWSIATILTPVAAKVGLPFLLVVRAFMGIGEGV  230

Query  1339  AMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG  1160
             AMPAMNN+LSKW+PV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLG
Sbjct  231   AMPAMNNILSKWIPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLG  290

Query  1159  TVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSH  980
             TVWF VW+SKAHSSPL+DPEL P EKKLIL +SVSKEPVK IPWKLILSK PVWALIVSH
Sbjct  291   TVWFAVWISKAHSSPLEDPELRPAEKKLILASSVSKEPVKEIPWKLILSKAPVWALIVSH  350

Query  979   FCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVS  800
             FCHNWGTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG S
Sbjct  351   FCHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGFS  410

Query  799   VTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPR  620
             VT VRKIMQTIGFLGPAFFLTQLSH++SPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPR
Sbjct  411   VTRVRKIMQTIGFLGPAFFLTQLSHINSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPR  470

Query  619   YSGVL  605
             YS  L
Sbjct  471   YSECL  475



>emb|CDX74333.1| BnaA03g27140D [Brassica napus]
Length=520

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/484 (70%), Positives = 389/484 (80%), Gaps = 31/484 (6%)
 Frame = -2

Query  1882  HTLFEFGSPFLPGRGFR-RGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLT  1706
             H+   FG   LP R FR +G   R S+++    +S+  G  D +P +        + +L 
Sbjct  67    HSRRGFGCFLLPTRLFRFKGNTSRASYKS--SEESQGAGAVDPLPYA--------EAILV  116

Query  1705  EDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSF  1526
             + +       FP+RWVIVLLCF++FLLCNMDRVNMSIAILPM+ +Y+W+  TVGLIQSSF
Sbjct  117   QGNASWWQLQFPRRWVIVLLCFASFLLCNMDRVNMSIAILPMSQQYNWNSATVGLIQSSF  176

Query  1525  FWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGE  1346
             FWGYLLTQI GGIWAD  GGK+VLGFGVVWWSIAT++TPIAAKLGLPFL +VRAFMGIGE
Sbjct  177   FWGYLLTQILGGIWADKYGGKVVLGFGVVWWSIATVMTPIAAKLGLPFLLVVRAFMGIGE  236

Query  1345  GVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGS  1166
             GVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGL FSPMLI KFGWPSVFYSFGS
Sbjct  237   GVAMPAMNNMLSKWIPVSERSRSLALVYSGMYLGSVTGLGFSPMLIQKFGWPSVFYSFGS  296

Query  1165  LGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIV  986
             LG++WF +WL  A+SSP DDPEL  EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+
Sbjct  297   LGSIWFLLWLKYAYSSPKDDPELSEEEKKIILGGSKPREPVTVIPWKLILSKPPVWALII  356

Query  985   SHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKG  806
             SHFCHNWGTFILLTWMPTYY+Q        + +  VLPW TMA  A  GGWIAD+L    
Sbjct  357   SHFCHNWGTFILLTWMPTYYNQ--------AWLLCVLPWFTMAVLANVGGWIADTL----  404

Query  805   VSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIA  626
                     IMQ+IGFLGPAFFLTQLS V +PAMAVLCM CSQG+DAFSQSGLYSNHQDI 
Sbjct  405   --------IMQSIGFLGPAFFLTQLSRVKTPAMAVLCMACSQGADAFSQSGLYSNHQDIG  456

Query  625   PRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGE  446
             PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+VGLYL+GT+VWNLF+TGE
Sbjct  457   PRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVGLYLIGTLVWNLFATGE  516

Query  445   KILD  434
             K+LD
Sbjct  517   KVLD  520



>emb|CDY66200.1| BnaA09g51700D [Brassica napus]
Length=534

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/524 (66%), Positives = 403/524 (77%), Gaps = 28/524 (5%)
 Frame = -2

Query  1996  KAMTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIR  1817
             +AM   AL  +++   P+   S +A+        R+      + G+  L  R  R     
Sbjct  36    RAMFRYALCRNHHQ--PRKILSLQASLQHDLVVHRTSFGCFLQPGN--LEHRSLRFKNSN  91

Query  1816  RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLL  1646
             + + R +    S+   I++ V +SL   +   + +L + + +  S     FP+RWVIVLL
Sbjct  92    KNTSRPYYK-SSEESDITEEVVDSLSSAEGSAEAILVQGNLQNASPWWKQFPRRWVIVLL  150

Query  1645  CFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvgg  1466
             CF++FLLCNMDRVNMSIAILPM+ +Y+W+  TVGLIQSSFFWGYLLTQI GGIWAD  GG
Sbjct  151   CFASFLLCNMDRVNMSIAILPMSQQYNWNSATVGLIQSSFFWGYLLTQILGGIWADKYGG  210

Query  1465  klvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSER  1286
             K+VLGFGVVWWSIAT++TPIAAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSER
Sbjct  211   KVVLGFGVVWWSIATVMTPIAAKLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSER  270

Query  1285  SRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpldd  1106
             SRSLA+VYSGMYLGSVTGL FSPMLI KFGWPSVFYSFGSLG++WF +WL  A+SSP DD
Sbjct  271   SRSLALVYSGMYLGSVTGLGFSPMLIQKFGWPSVFYSFGSLGSIWFLLWLKYAYSSPKDD  330

Query  1105  pellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYY  926
             PEL  EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY
Sbjct  331   PELSEEEKKIILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYY  390

Query  925   HQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAF  746
             +Q        + +  VLPW TMA  A  GGWIAD+L            IMQ+IGFLGPAF
Sbjct  391   NQ--------AWLLCVLPWFTMAVLANVGGWIADTL------------IMQSIGFLGPAF  430

Query  745   FLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGV  566
             FLTQLS V +PAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGV
Sbjct  431   FLTQLSRVKTPAMAVLCMACSQGADAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGV  490

Query  565   FGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             FGTAATGYILQ GSWDDVFKV+VGLYL+GT+VWNLF+TGEK+LD
Sbjct  491   FGTAATGYILQRGSWDDVFKVAVGLYLIGTLVWNLFATGEKVLD  534



>ref|XP_002457997.1| hypothetical protein SORBIDRAFT_03g025190 [Sorghum bicolor]
 gb|EES03117.1| hypothetical protein SORBIDRAFT_03g025190 [Sorghum bicolor]
Length=395

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/395 (82%), Positives = 356/395 (90%), Gaps = 0/395 (0%)
 Frame = -2

Query  1618  MDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvV  1439
             MDRVNMSIAILPM+SE+ W+P TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLGFGVV
Sbjct  1     MDRVNMSIAILPMSSEFSWNPATVGLIQSSFFWGYLLTQILGGIWADRFGGKVVLGFGVV  60

Query  1438  WWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYS  1259
             WWS+AT+LTP+AAK+GLP L  VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYS
Sbjct  61    WWSLATVLTPLAAKIGLPCLLTVRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALVYS  120

Query  1258  GMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekk  1079
             GMYLGSVTGL FSP+LI +FGWPSVFY+FGSLGTVWF +W SKAHSSP DDPE+   EK+
Sbjct  121   GMYLGSVTGLGFSPLLISRFGWPSVFYAFGSLGTVWFALWQSKAHSSPDDDPEISKAEKR  180

Query  1078  LILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLT  899
              IL  S  KEPV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLT
Sbjct  181   HILGGSPLKEPVTSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLT  240

Query  898   ESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVD  719
             ESG+  VLPWLTMA  A  GGWIAD+LV++GVSVT VRKIMQ+IGFLGPA FLT LS V 
Sbjct  241   ESGLLCVLPWLTMAVFANIGGWIADTLVQRGVSVTNVRKIMQSIGFLGPALFLTLLSKVR  300

Query  718   SPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYI  539
             +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYI
Sbjct  301   TPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYI  360

Query  538   LQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             LQ GSWD VFKVSV LY+VGTVVWN+F+TGEK+L+
Sbjct  361   LQKGSWDSVFKVSVVLYIVGTVVWNVFATGEKVLE  395



>emb|CDX91912.1| BnaC03g32140D [Brassica napus]
Length=523

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/484 (70%), Positives = 388/484 (80%), Gaps = 31/484 (6%)
 Frame = -2

Query  1882  HTLFEFGSPFLPGRGFR-RGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLT  1706
             H+   FG   LP R FR +    R S++++ +  S+  G  D +P +        + +L 
Sbjct  70    HSRRGFGCFLLPTRLFRFKDNTYRASYKSFEE--SQGAGAIDPLPYA--------EAILV  119

Query  1705  EDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSF  1526
             + +       FP+RWVIVLLCF++FLLCNMDRVNMS+AILPM+ +Y+W+  TVGLIQSSF
Sbjct  120   QGNTSWWQQQFPRRWVIVLLCFASFLLCNMDRVNMSVAILPMSQQYNWNSATVGLIQSSF  179

Query  1525  FWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGE  1346
             FWGYLLTQI GGIWAD  GGK+VLGFGVVWWSIAT++TPIAAKLGLPFL +VRAFMGIGE
Sbjct  180   FWGYLLTQILGGIWADKYGGKVVLGFGVVWWSIATVMTPIAAKLGLPFLLVVRAFMGIGE  239

Query  1345  GVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGS  1166
             GVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGL FSPMLI  FGWPSVFYSFGS
Sbjct  240   GVAMPAMNNMLSKWIPVSERSRSLALVYSGMYLGSVTGLGFSPMLIQNFGWPSVFYSFGS  299

Query  1165  LGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIV  986
             LG++WF +WL  A+SSP DDPEL  EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+
Sbjct  300   LGSIWFLLWLKYAYSSPKDDPELSEEEKKIILGGSKPREPVTVIPWKLILSKPPVWALII  359

Query  985   SHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKG  806
             SHFCHNWGTFILLTWMPTYY+Q        + +  VLPW TMA  A  GGWIAD+L    
Sbjct  360   SHFCHNWGTFILLTWMPTYYNQ--------AWLLCVLPWFTMAVLANVGGWIADTL----  407

Query  805   VSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIA  626
                     IMQ+IGFLGPAFFLTQLS V +PAMAVLCM CSQG+DAFSQSGLYSNHQDI 
Sbjct  408   --------IMQSIGFLGPAFFLTQLSRVKTPAMAVLCMACSQGADAFSQSGLYSNHQDIG  459

Query  625   PRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGE  446
             PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+VGLYL+GT+VWNLF+TGE
Sbjct  460   PRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVGLYLIGTLVWNLFATGE  519

Query  445   KILD  434
             K+LD
Sbjct  520   KVLD  523



>gb|KDO66838.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis]
 gb|KDO66839.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis]
Length=483

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/400 (82%), Positives = 361/400 (90%), Gaps = 10/400 (3%)
 Frame = -2

Query  1792  DVKSKTYGISDSVPESLKFEDALNDDVL-TED---DGETIS---GGFPKRWVIVLLCFSA  1634
             DVKS++Y +S+   +S+KFE+AL D  L +ED   D E++      FPKRW IV+LCFSA
Sbjct  56    DVKSESYNVSE---KSVKFEEALKDIALRSEDLGVDSESLVPWWEEFPKRWFIVVLCFSA  112

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VL
Sbjct  113   FLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKAVL  172

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWSIAT LTP+AAKLGLPFL +VR FMGIGEGVAMPAMNN+LSKWVPV+ERSRSL
Sbjct  173   GFGVVWWSIATALTPVAAKLGLPFLLVVRVFMGIGEGVAMPAMNNILSKWVPVAERSRSL  232

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWFTVWLSKAHSSP +DP+L 
Sbjct  233   ALVYSGMYLGSVTGLAFSPFLIHRFGWPSVFYSFGSLGTVWFTVWLSKAHSSPAEDPQLR  292

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
             P EKKLI+ +  SKEPVK+IPW LILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+QVL
Sbjct  293   PAEKKLIVSSCASKEPVKTIPWGLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVL  352

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
              FNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT VRKIMQ+IGFLGPAFFLTQ
Sbjct  353   HFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFFLTQ  412

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYS  614
             LSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYS
Sbjct  413   LSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYS  452



>gb|EMS64245.1| putative anion transporter 4, chloroplastic [Triticum urartu]
Length=513

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/418 (79%), Positives = 363/418 (87%), Gaps = 6/418 (1%)
 Frame = -2

Query  1684  SGGFPKRWVIVLL-CFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLL  1508
             + G  KR V+  + CF      + D VNMSIAILPM++E+ WSP TVGLIQSSFFWGYLL
Sbjct  101   NAGLVKRRVLSRVECF-----LSSDPVNMSIAILPMSAEFGWSPATVGLIQSSFFWGYLL  155

Query  1507  TQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPA  1328
             TQI GGIWAD  GGK+VLGFGVVWWSIATILTP AAKLGLPFL +VRAFMGIGEGVAMPA
Sbjct  156   TQILGGIWADRFGGKVVLGFGVVWWSIATILTPFAAKLGLPFLLVVRAFMGIGEGVAMPA  215

Query  1327  MNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWF  1148
             MNN+LSKW+PVSERSRSLA+VYSGMYLGSVTGLAFSP LI KFGWPSVFY FGSLG++WF
Sbjct  216   MNNILSKWIPVSERSRSLALVYSGMYLGSVTGLAFSPFLISKFGWPSVFYGFGSLGSIWF  275

Query  1147  TVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHN  968
             T+W  KA SSP +DPE+  +EK+ IL  S  KEPV SIPWKLILSKP VWALIVSHFCHN
Sbjct  276   TLWQLKARSSPSEDPEVTEDEKRHILGGSTLKEPVTSIPWKLILSKPAVWALIVSHFCHN  335

Query  967   WGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVV  788
             WGTFILLTWMPTYY+QVLKFNLTESG+  VLPWLTMA  A  GGWIAD+LV +GVS+T V
Sbjct  336   WGTFILLTWMPTYYNQVLKFNLTESGLLCVLPWLTMAVFANVGGWIADTLVARGVSITNV  395

Query  787   RKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGV  608
             RKIMQ+IGFLGPA FLT LS V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GV
Sbjct  396   RKIMQSIGFLGPALFLTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGV  455

Query  607   LMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             L+GLSNTAGVLAGVFGTAATGYILQ GSWD VF+V+V LY+VGTVVWN+FSTGE+IL+
Sbjct  456   LLGLSNTAGVLAGVFGTAATGYILQKGSWDSVFQVAVLLYIVGTVVWNVFSTGERILE  513



>gb|EMT01332.1| Putative anion transporter 4, chloroplastic [Aegilops tauschii]
Length=569

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/392 (82%), Positives = 352/392 (90%), Gaps = 0/392 (0%)
 Frame = -2

Query  1609  VNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWS  1430
             VNMSIAILPM++E+ WSP TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLGFGVVWWS
Sbjct  178   VNMSIAILPMSAEFGWSPATVGLIQSSFFWGYLLTQILGGIWADRFGGKVVLGFGVVWWS  237

Query  1429  IATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMY  1250
             IATILTP AAKLGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSGMY
Sbjct  238   IATILTPFAAKLGLPFLLVVRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALVYSGMY  297

Query  1249  LGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLIL  1070
             LGSVTGLAFSP LI KFGWPSVFY FGSLG++WFT+W  KA SSP +DPE+  +EK+ IL
Sbjct  298   LGSVTGLAFSPFLISKFGWPSVFYGFGSLGSIWFTLWQLKARSSPNEDPEVTEDEKRHIL  357

Query  1069  RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESG  890
               S  KEPV SIPWKLILSKP VWALIVSHFCHNWGTFILLTWMPTYY+QVLKFNLTESG
Sbjct  358   GGSTMKEPVSSIPWKLILSKPAVWALIVSHFCHNWGTFILLTWMPTYYNQVLKFNLTESG  417

Query  889   MFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPA  710
             +  VLPWLTMA  A  GGWIAD+LV +GVS+T VRKIMQ+IGFLGPA FLT LS V +PA
Sbjct  418   LLCVLPWLTMAVFANVGGWIADTLVARGVSITNVRKIMQSIGFLGPALFLTLLSKVRTPA  477

Query  709   MAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQH  530
             MAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATGYILQ 
Sbjct  478   MAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQK  537

Query  529   GSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GSWD VF+V+V LY+VGTVVWN+FSTGE+IL+
Sbjct  538   GSWDSVFQVAVLLYIVGTVVWNVFSTGERILE  569



>gb|KCW52549.1| hypothetical protein EUGRSUZ_J01933 [Eucalyptus grandis]
Length=492

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/470 (74%), Positives = 383/470 (81%), Gaps = 28/470 (6%)
 Frame = -2

Query  1993  AMTARALLLSYYNLPPKL-----HCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRR  1829
             AM ARA L SY   P  L       SP  T P++SF+S +  H            R   R
Sbjct  35    AMNARAFLCSYTPHPDSLLKQRTSLSPPPT-PRKSFASAARFHCQV---------RLISR  84

Query  1828  GLIRRTSWRAWAD---VKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKR  1664
             G  RR ++R  A    +KS+ Y ISD V E  KF+         ED G  +     FPKR
Sbjct  85    G--RRYTFRVSARNPGLKSEQYEISD-VREPAKFKTGE-----VEDGGVVVPWWEKFPKR  136

Query  1663  WVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIW  1484
             WVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+PTTVGLIQSSFFWGYLLTQIAGGIW
Sbjct  137   WVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPTTVGLIQSSFFWGYLLTQIAGGIW  196

Query  1483  ADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKW  1304
             ADTVGGKLVLGFGV+WWSIAT LTP+AAKLGLP+L +VRAFMGIGEGVAMPAMNN+LSKW
Sbjct  197   ADTVGGKLVLGFGVIWWSIATALTPVAAKLGLPYLLVVRAFMGIGEGVAMPAMNNILSKW  256

Query  1303  VPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAH  1124
             VPVSERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  WL+KA+
Sbjct  257   VPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFATWLNKAY  316

Query  1123  SSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT  944
             SSPLDDP+L PEEK+LIL NSV +EPV +IPW L+LS+PPVWALIV HFCHNWGTFILLT
Sbjct  317   SSPLDDPQLRPEEKRLILTNSVPREPVTTIPWGLLLSQPPVWALIVCHFCHNWGTFILLT  376

Query  943   WMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIG  764
             WMPTYY+QVLKFNLTESG+  VLPWLTMAFSA  GGWIAD+LV  G+SVT VRKIMQ+IG
Sbjct  377   WMPTYYNQVLKFNLTESGLICVLPWLTMAFSANLGGWIADTLVSNGLSVTTVRKIMQSIG  436

Query  763   FLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYS  614
             FLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQD+APRYS
Sbjct  437   FLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDLAPRYS  486



>ref|XP_001758228.1| predicted protein [Physcomitrella patens]
 gb|EDQ77050.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/395 (79%), Positives = 352/395 (89%), Gaps = 0/395 (0%)
 Frame = -2

Query  1618  MDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvV  1439
             MDRVNMSIAILPM++++ WSPTTVGL+QSSFFWGYLLTQIAGGIWAD +GGK VLGFGV+
Sbjct  1     MDRVNMSIAILPMSADFQWSPTTVGLVQSSFFWGYLLTQIAGGIWADRIGGKQVLGFGVI  60

Query  1438  WWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYS  1259
             WWS AT+LTPIAAKLGLP L  VRA MG+GEGVAMPAMNNLLS+WVPV ERSRSLA+VYS
Sbjct  61    WWSAATMLTPIAAKLGLPALLFVRACMGVGEGVAMPAMNNLLSRWVPVKERSRSLALVYS  120

Query  1258  GMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekk  1079
             GMYLGSVTGLAFSP LIH+F WPSVF+SFGSLG  WF  W   A+SSP DDP++  EEKK
Sbjct  121   GMYLGSVTGLAFSPGLIHRFNWPSVFFSFGSLGAFWFATWQQLAYSSPADDPKISEEEKK  180

Query  1078  LILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLT  899
             LI+ ++  + PV +IPWKL+LSK PVWALI+ HFCHNWGTFILLTWMPTYY+QVL FNL 
Sbjct  181   LIMGDTEPQAPVDNIPWKLLLSKAPVWALIICHFCHNWGTFILLTWMPTYYNQVLGFNLM  240

Query  898   ESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVD  719
             ESG+F+VLPWLTMA S+  GGWIAD+LV +GVSV +VRKIMQ+IGFLGPAFFL+QLSHV 
Sbjct  241   ESGLFSVLPWLTMAISSNVGGWIADTLVSRGVSVGLVRKIMQSIGFLGPAFFLSQLSHVK  300

Query  718   SPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYI  539
             SPAMAV CM CSQG DAFSQSGLYSNHQDI PRYSGVL+G+SNTAGVLAGV GTAATGYI
Sbjct  301   SPAMAVACMMCSQGFDAFSQSGLYSNHQDIGPRYSGVLLGMSNTAGVLAGVLGTAATGYI  360

Query  538   LQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             LQ+GSWDDVFKV+V LYL+GTV+WN+FS+GEKI D
Sbjct  361   LQNGSWDDVFKVAVALYLIGTVIWNVFSSGEKIFD  395



>ref|XP_010935848.1| PREDICTED: probable anion transporter 4, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=582

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/464 (70%), Positives = 374/464 (81%), Gaps = 37/464 (8%)
 Frame = -2

Query  1816  RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLL  1646
             R++ R  AD +S+ Y ++    +SL   +  ++ VL   D   +S     FPKRW+IVLL
Sbjct  153   RSAIRPHADFRSEQYEMTGPQMDSLNSSEVPSEAVLFGGDVRKVSHWWEQFPKRWLIVLL  212

Query  1645  CFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvgg  1466
             CF +FLLCNMDRVNMSIAILPM++E+ W+P T+GLIQSSFFWGYLLTQI GGIWAD +GG
Sbjct  213   CFFSFLLCNMDRVNMSIAILPMSTEFKWNPATMGLIQSSFFWGYLLTQIVGGIWADKIGG  272

Query  1465  klvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSER  1286
             KLVLGFGVVWWSIAT+LTPIAAK+GLPFL ++RAFMGIGEGVAMPAMNN+LSKW+PVSER
Sbjct  273   KLVLGFGVVWWSIATVLTPIAAKIGLPFLLVMRAFMGIGEGVAMPAMNNILSKWIPVSER  332

Query  1285  SRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSpldd  1106
             SRSLA VYSGMYLGSVTGLA SP+LIH FGWPSVFY+FGSLG++WF +W SKAHSSP  D
Sbjct  333   SRSLAFVYSGMYLGSVTGLALSPILIHNFGWPSVFYAFGSLGSIWFALWQSKAHSSPQQD  392

Query  1105  pellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYY  926
             PEL  EEK+LIL  +VSKEPV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY
Sbjct  393   PELSSEEKRLILGGNVSKEPVSSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYY  452

Query  925   HQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAF  746
             +QVLKFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRK            
Sbjct  453   NQVLKFNLTESGLFCVLPWLTMAVFANVGGWIADTLVGKGLSITTVRK------------  500

Query  745   FLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGV  566
                                   GSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGV
Sbjct  501   ----------------------GSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGV  538

Query  565   FGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             FGTAATGYILQ GSWDDVFKVSV LY++GT+VWN+F+TGEK+LD
Sbjct  539   FGTAATGYILQRGSWDDVFKVSVALYIIGTLVWNIFATGEKVLD  582



>ref|XP_004151590.1| PREDICTED: probable anion transporter 1, chloroplastic-like, 
partial [Cucumis sativus]
Length=356

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/356 (89%), Positives = 340/356 (96%), Gaps = 0/356 (0%)
 Frame = -2

Query  1501  IAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMN  1322
             IAGGIWADTVGGKLVLGFGV+WWS+AT+LTP+AAK+GLPFL +VRAFMGIGEGVAMPAMN
Sbjct  1     IAGGIWADTVGGKLVLGFGVIWWSVATVLTPVAAKIGLPFLLVVRAFMGIGEGVAMPAMN  60

Query  1321  NLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTV  1142
             N+LSKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH++GWPSVF+SFGSLG VWF V
Sbjct  61    NILSKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHQYGWPSVFFSFGSLGAVWFAV  120

Query  1141  WLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWG  962
             WL+KAHSSPLDDP+L P+EKKLI  +SVSKEPVKSIPW  ILSKPPVWALIVSHFCHNWG
Sbjct  121   WLNKAHSSPLDDPQLRPQEKKLIFASSVSKEPVKSIPWGTILSKPPVWALIVSHFCHNWG  180

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             TFILLTWMPTYYHQVLKFNLTESG+  VLPWLTMAFSA  GGWIAD+LV +G+SVT VRK
Sbjct  181   TFILLTWMPTYYHQVLKFNLTESGLLCVLPWLTMAFSANLGGWIADTLVSRGLSVTTVRK  240

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQ+IGFLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRYSGVL+
Sbjct  241   IMQSIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLL  300

Query  601   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD
Sbjct  301   GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  356



>gb|KCW52548.1| hypothetical protein EUGRSUZ_J01933 [Eucalyptus grandis]
Length=569

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/471 (73%), Positives = 383/471 (81%), Gaps = 29/471 (6%)
 Frame = -2

Query  1993  AMTARALLLSYYNLPPKL-----HCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRR  1829
             AM ARA L SY   P  L       SP  T P++SF+S +  H            R   R
Sbjct  35    AMNARAFLCSYTPHPDSLLKQRTSLSPPPT-PRKSFASAARFHCQV---------RLISR  84

Query  1828  GLIRRTSWRAWAD---VKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKR  1664
             G  RR ++R  A    +KS+ Y ISD V E  KF+         ED G  +     FPKR
Sbjct  85    G--RRYTFRVSARNPGLKSEQYEISD-VREPAKFKTGE-----VEDGGVVVPWWEKFPKR  136

Query  1663  WVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIW  1484
             WVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+PTTVGLIQSSFFWGYLLTQIAGGIW
Sbjct  137   WVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPTTVGLIQSSFFWGYLLTQIAGGIW  196

Query  1483  ADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKW  1304
             ADTVGGKLVLGFGV+WWSIAT LTP+AAKLGLP+L +VRAFMGIGEGVAMPAMNN+LSKW
Sbjct  197   ADTVGGKLVLGFGVIWWSIATALTPVAAKLGLPYLLVVRAFMGIGEGVAMPAMNNILSKW  256

Query  1303  VPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAH  1124
             VPVSERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  WL+KA+
Sbjct  257   VPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFATWLNKAY  316

Query  1123  SSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT  944
             SSPLDDP+L PEEK+LIL NSV +EPV +IPW L+LS+PPVWALIV HFCHNWGTFILLT
Sbjct  317   SSPLDDPQLRPEEKRLILTNSVPREPVTTIPWGLLLSQPPVWALIVCHFCHNWGTFILLT  376

Query  943   WMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIG  764
             WMPTYY+QVLKFNLTESG+  VLPWLTMAFSA  GGWIAD+LV  G+SVT VRKIMQ+IG
Sbjct  377   WMPTYYNQVLKFNLTESGLICVLPWLTMAFSANLGGWIADTLVSNGLSVTTVRKIMQSIG  436

Query  763   FLGPAFFLTQLSHVDSPAMAVLCMTCS-QGSDAFSQSGLYSNHQDIAPRYS  614
             FLGPAFFLTQLSHVDSPAMAVLCM CS QG+DAFSQSGLYSNHQD+APRYS
Sbjct  437   FLGPAFFLTQLSHVDSPAMAVLCMACSQQGTDAFSQSGLYSNHQDLAPRYS  487



>ref|XP_006491127.1| PREDICTED: probable anion transporter 2, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|KDO86199.1| hypothetical protein CISIN_1g007159mg [Citrus sinensis]
Length=579

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/460 (70%), Positives = 368/460 (80%), Gaps = 39/460 (8%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R  A  KS  Y I+++  +SL+  +  ++ VL + D +  S     FPKRWV+VLLCFSA
Sbjct  156   RICAFYKSDEYDITEAKVDSLQSTEIPSEAVLPDGDLQETSPWWEQFPKRWVVVLLCFSA  215

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDR                                    I GGIWAD  GGK VL
Sbjct  216   FLLCNMDR------------------------------------IVGGIWADKFGGKPVL  239

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGV+WWS+AT+LTP+AA++GLPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  240   GFGVIWWSVATVLTPVAARIGLPFLLIMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  299

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A VYSGMYLGSVTGLA SP+LI KFGWPSVFYSFGSLG++WF +WL KA+SSP +DPEL 
Sbjct  300   AFVYSGMYLGSVTGLAVSPILIQKFGWPSVFYSFGSLGSIWFALWLKKAYSSPKEDPELR  359

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEK+ IL  S+SKE V  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  360   AEEKRHILGGSISKEAVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVL  419

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  420   KFNLTESGLFCVLPWLTMAVFANMGGWIADTLVSKGLSITAVRKIMQSIGFLGPAFFLTQ  479

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             LSHV +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTA
Sbjct  480   LSHVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA  539

Query  553   ATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ATGYILQ GSWDDVFKV+V LY++GT+VWNLF+TGE++L+
Sbjct  540   ATGYILQRGSWDDVFKVAVVLYIIGTLVWNLFATGERVLE  579



>ref|XP_006605417.1| PREDICTED: probable anion transporter 2, chloroplastic-like isoform 
X3 [Glycine max]
Length=545

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/454 (67%), Positives = 353/454 (78%), Gaps = 55/454 (12%)
 Frame = -2

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG---GFPKRWVIVLLCFSAFLLCNM  1616
             KS+ + I+++  + L+  +   + +L E +   +S     FPKRWVIVLLCF+AFLLCNM
Sbjct  144   KSEEHDITEAKVDPLESTEGTGESILLEGNVPQVSSWWQQFPKRWVIVLLCFAAFLLCNM  203

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             DRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLT                       
Sbjct  204   DRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLT-----------------------  240

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
                                          +GVAMPAMNN+LSKW+PVSERSRSLA+VYSG
Sbjct  241   -----------------------------QGVAMPAMNNMLSKWIPVSERSRSLALVYSG  271

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSV GLAFSP+LI KFGWPSVFYSFGSLG++WF +WL KA+SSP DDP+L  EEK+L
Sbjct  272   MYLGSVVGLAFSPLLIQKFGWPSVFYSFGSLGSIWFALWLRKAYSSPKDDPDLGVEEKRL  331

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             IL  +VS  PV SIPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNL E
Sbjct  332   ILEGNVSNAPVSSIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLME  391

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+  VLPWLTMA  A  GGWIAD+LVRKG+S+TVVRKIMQ+IGFLGPAFFL+QLSHV +
Sbjct  392   SGLLCVLPWLTMAAFANIGGWIADTLVRKGLSITVVRKIMQSIGFLGPAFFLSQLSHVRT  451

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
             PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG+IL
Sbjct  452   PAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGFIL  511

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             Q GSW+DVFKV+V LY++GT+VWN+FSTGEK+LD
Sbjct  512   QRGSWNDVFKVAVALYIIGTLVWNVFSTGEKVLD  545



>gb|AFW79515.1| hypothetical protein ZEAMMB73_518182 [Zea mays]
Length=472

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/363 (83%), Positives = 326/363 (90%), Gaps = 0/363 (0%)
 Frame = -2

Query  1702  DDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFF  1523
             D  E   G FPKRW IV LCFSAFLLCNMDRVNMSIAILPM++E+ W+P TVGLIQSSFF
Sbjct  93    DSEEEEQGQFPKRWAIVFLCFSAFLLCNMDRVNMSIAILPMSAEFGWNPQTVGLIQSSFF  152

Query  1522  WGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEG  1343
             WGYLLTQIAGGIWADTVGGK VLGFGVVWWSIAT LTP+AA LGLPFL +VRAFMGIGEG
Sbjct  153   WGYLLTQIAGGIWADTVGGKTVLGFGVVWWSIATALTPVAAHLGLPFLLVVRAFMGIGEG  212

Query  1342  VAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSL  1163
             VAMPAMNN+LSKWVPVSERSRSL++VYSGMYLGSVTGLAFSP+LIHKFGWPSVF+SFGSL
Sbjct  213   VAMPAMNNILSKWVPVSERSRSLSLVYSGMYLGSVTGLAFSPLLIHKFGWPSVFFSFGSL  272

Query  1162  GTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVS  983
             G VWFT W +KA+SSPL+DP +   EKKLI   S + EPVK+IPW+LILSKPPVWALIVS
Sbjct  273   GLVWFTTWATKAYSSPLEDPGISAAEKKLIASQSTAGEPVKTIPWRLILSKPPVWALIVS  332

Query  982   HFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGV  803
             HFCHNWGTFILLTWMPTYY+QVLKFNL ESG+  VLPW TMA SA  GGWIAD+LV +GV
Sbjct  333   HFCHNWGTFILLTWMPTYYNQVLKFNLMESGLICVLPWFTMAVSANVGGWIADTLVSRGV  392

Query  802   SVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAP  623
             SVT VRKIMQ+IGFLGPAFFLTQLSHV+SPAMAVLCM CSQG+DAFSQSGLYSNHQDI P
Sbjct  393   SVTTVRKIMQSIGFLGPAFFLTQLSHVNSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGP  452

Query  622   RYS  614
             RY+
Sbjct  453   RYA  455



>dbj|BAJ92669.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/462 (68%), Positives = 355/462 (77%), Gaps = 27/462 (6%)
 Frame = -2

Query  1951  PPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRTSWRAWADVKSKTY  1772
             PP   C  +   P +      H +           G G R   +RR + R  ADV+  T 
Sbjct  18    PPPHRCFVDGGSPSQRTGPGLHANN----------GFGVR---VRRRALRG-ADVQPDTP  63

Query  1771  GISDSVPESLKFEDALNDD-----------VLTED--DGETISGGFPKRWVIVLLCFSAF  1631
                    + L  +    +D           +L ED   GE   G FPKRW IV LCFSAF
Sbjct  64    SSRRDGDKPLHADAQQGEDGGVELLDSVRKLLLEDAEPGEEEQGQFPKRWAIVFLCFSAF  123

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAI+PM+ EY W+P TVGLIQSSFFWGYLLTQIAGGIWAD VGGK VLG
Sbjct  124   LLCNMDRVNMSIAIMPMSVEYGWNPQTVGLIQSSFFWGYLLTQIAGGIWADKVGGKTVLG  183

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGV+WWS+AT LTP+AAKLGLPFL IVRAFMGIGEGVAMPAMNN+LSKWVPVSERSRSLA
Sbjct  184   FGVIWWSVATALTPVAAKLGLPFLLIVRAFMGIGEGVAMPAMNNILSKWVPVSERSRSLA  243

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGLAFSP LIHKFGWPSVFYSFGSLGTVWF  W +KA+S+PL+DP +  
Sbjct  244   LVYSGMYLGSVTGLAFSPFLIHKFGWPSVFYSFGSLGTVWFATWATKAYSTPLEDPGISS  303

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
             EEKKLI+  + S EPV +IPW +ILSKPPVWALI  HFCHNWGTFILLTWMPTYY+QVLK
Sbjct  304   EEKKLIISQTTSGEPVTTIPWGVILSKPPVWALIACHFCHNWGTFILLTWMPTYYNQVLK  363

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
             FNLTES +F VLPWLTMA SA  GGWIAD+LV +G SVT VRKIMQ+IGFLGPAFFL+QL
Sbjct  364   FNLTESSLFCVLPWLTMAISANVGGWIADTLVSRGTSVTTVRKIMQSIGFLGPAFFLSQL  423

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVL  605
             SH+DSPA+AVLCM CSQG+DAFSQSGLYSNHQDI PRY+ ++
Sbjct  424   SHIDSPALAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAVII  465



>ref|XP_010275628.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=622

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/397 (76%), Positives = 343/397 (86%), Gaps = 3/397 (1%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLL  1625
             AD K + + I++   + L   +  ++ VL E +   I+     FPKRWVIVLLCFSAFLL
Sbjct  169   ADYKPEHFDITEPNLDPLNSSEMSDEVVLVEGNMPKITYWWERFPKRWVIVLLCFSAFLL  228

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGIWAD +GGK VLGFG
Sbjct  229   CNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQIVGGIWADKIGGKFVLGFG  288

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWS+AT+LTP+AA++GLPFL I+RA MGIGEGVAMPAMNN+LSKW+PVSERSR+LA+V
Sbjct  289   VVWWSVATVLTPVAARIGLPFLLIMRALMGIGEGVAMPAMNNILSKWIPVSERSRALALV  348

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLA SP+LIHKFGWPSVFYSFGSLG++WFT+WL+KAHSSP +D EL  EE
Sbjct  349   YSGMYLGSVTGLALSPVLIHKFGWPSVFYSFGSLGSIWFTLWLNKAHSSPQEDLELRVEE  408

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KKLIL  S  K+PV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  409   KKLILGGSELKKPVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  468

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+F VLPWLTMA  A  GGWIAD+LV +G+S+T VRKIMQTIGFLGPAFFLTQLSH
Sbjct  469   LTESGLFCVLPWLTMAVFANIGGWIADTLVSRGLSITSVRKIMQTIGFLGPAFFLTQLSH  528

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYS  614
             V SPA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+
Sbjct  529   VRSPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYA  565



>ref|XP_006396239.1| hypothetical protein EUTSA_v10028551mg [Eutrema salsugineum]
 gb|ESQ37692.1| hypothetical protein EUTSA_v10028551mg [Eutrema salsugineum]
Length=499

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/397 (77%), Positives = 341/397 (86%), Gaps = 1/397 (0%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLL  1625
             R+ A  KS+   I++ V +SL   D   + VL + +       FP+RWVIVLLCF++FLL
Sbjct  102   RSRAYYKSEESDITEGVVDSLPSADGSAEAVLAQGNLPWWQQ-FPRRWVIVLLCFASFLL  160

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CNMDRVNMSIAILPM+ EY+W+  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLGFG
Sbjct  161   CNMDRVNMSIAILPMSQEYNWNSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVLGFG  220

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             VVWWSIATI+TPIAA+LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+V
Sbjct  221   VVWWSIATIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALV  280

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
             YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG++WF +WL  A+SSP DDPEL  EE
Sbjct  281   YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGSIWFLLWLKYAYSSPKDDPELSEEE  340

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
             KK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFN
Sbjct  341   KKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFN  400

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             LTESG+  VLPW TMA  A  GGWIAD+LV +G+S+T VRKIMQ+IGFLGPAFFLTQLS 
Sbjct  401   LTESGLLCVLPWFTMAVFANIGGWIADTLVSRGLSITAVRKIMQSIGFLGPAFFLTQLSR  460

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYS  614
             V +PAMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+
Sbjct  461   VKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYA  497



>ref|XP_010326199.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=426

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/435 (74%), Positives = 359/435 (83%), Gaps = 15/435 (3%)
 Frame = -2

Query  1990  MTARALLLSYYNL-PPKLHCSPEATFP-KRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIR  1817
             M+ +A LLS+Y+  PP +   P   F    SF   S + +    G            L++
Sbjct  1     MSGKAFLLSHYSFSPPNI---PRTNFNVHNSFYHTSESGSGRGRGRGRFGYGQRELLLVK  57

Query  1816  R--TSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLC  1643
             R  +S + WADVKSK + I++        +DAL       D+   +   FPKRWVIV+LC
Sbjct  58    RNSSSRKLWADVKSKPFKIAE--------DDALLRKKEDGDNSVGLPQEFPKRWVIVILC  109

Query  1642  FSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggk  1463
             FSAFLLCNMDRVNMSIAILPMASEY+W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK
Sbjct  110   FSAFLLCNMDRVNMSIAILPMASEYNWTPITVGLIQSSFFWGYLLTQIAGGIWADTVGGK  169

Query  1462  lvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERS  1283
              VLGFGV+WWS+AT+LTPIAAKLGLPFLF+VRAFMGIGEGVAMPAMNN+LSKWVPVSERS
Sbjct  170   AVLGFGVIWWSVATVLTPIAAKLGLPFLFVVRAFMGIGEGVAMPAMNNILSKWVPVSERS  229

Query  1282  RSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddp  1103
             RSLA+VYSGMYLGSVTGLAFSP LI +FGWPSVF+SFGS+GTVWF VWL+KA+SSPLDDP
Sbjct  230   RSLALVYSGMYLGSVTGLAFSPFLIKQFGWPSVFFSFGSVGTVWFAVWLNKAYSSPLDDP  289

Query  1102  ellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH  923
              L PEEKKLIL +SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH
Sbjct  290   TLRPEEKKLILCSSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYH  349

Query  922   QVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFF  743
             QVLKFNLTESG+FAVLPWLTMA +A  GGWIADSLVR+G SVTVVRKIMQTIGFLGPAFF
Sbjct  350   QVLKFNLTESGLFAVLPWLTMAATANVGGWIADSLVRRGTSVTVVRKIMQTIGFLGPAFF  409

Query  742   LTQLSHVDSPAMAVL  698
             LTQLS VDSPAMAVL
Sbjct  410   LTQLSRVDSPAMAVL  424



>gb|KCW52550.1| hypothetical protein EUGRSUZ_J01933 [Eucalyptus grandis]
 gb|KCW52551.1| hypothetical protein EUGRSUZ_J01933 [Eucalyptus grandis]
Length=509

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/458 (71%), Positives = 365/458 (80%), Gaps = 28/458 (6%)
 Frame = -2

Query  1993  AMTARALLLSYYNLPPKL-----HCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRR  1829
             AM ARA L SY   P  L       SP  T P++SF+S +  H            R   R
Sbjct  35    AMNARAFLCSYTPHPDSLLKQRTSLSPPPT-PRKSFASAARFHCQV---------RLISR  84

Query  1828  GLIRRTSWRAWAD---VKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKR  1664
             G  RR ++R  A    +KS+ Y ISD V E  KF+         ED G  +     FPKR
Sbjct  85    G--RRYTFRVSARNPGLKSEQYEISD-VREPAKFKTGE-----VEDGGVVVPWWEKFPKR  136

Query  1663  WVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIW  1484
             WVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+PTTVGLIQSSFFWGYLLTQIAGGIW
Sbjct  137   WVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPTTVGLIQSSFFWGYLLTQIAGGIW  196

Query  1483  ADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKW  1304
             ADTVGGKLVLGFGV+WWSIAT LTP+AAKLGLP+L +VRAFMGIGEGVAMPAMNN+LSKW
Sbjct  197   ADTVGGKLVLGFGVIWWSIATALTPVAAKLGLPYLLVVRAFMGIGEGVAMPAMNNILSKW  256

Query  1303  VPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAH  1124
             VPVSERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  WL+KA+
Sbjct  257   VPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFATWLNKAY  316

Query  1123  SSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT  944
             SSPLDDP+L PEEK+LIL NSV +EPV +IPW L+LS+PPVWALIV HFCHNWGTFILLT
Sbjct  317   SSPLDDPQLRPEEKRLILTNSVPREPVTTIPWGLLLSQPPVWALIVCHFCHNWGTFILLT  376

Query  943   WMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIG  764
             WMPTYY+QVLKFNLTESG+  VLPWLTMAFSA  GGWIAD+LV  G+SVT VRKIMQ+IG
Sbjct  377   WMPTYYNQVLKFNLTESGLICVLPWLTMAFSANLGGWIADTLVSNGLSVTTVRKIMQSIG  436

Query  763   FLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGL  650
             FLGPAFFLTQLSHVDSPAMAVLCM CSQ     ++S +
Sbjct  437   FLGPAFFLTQLSHVDSPAMAVLCMACSQVCLHLTESRM  474



>ref|XP_005849602.1| hypothetical protein CHLNCDRAFT_143059 [Chlorella variabilis]
 gb|EFN57500.1| hypothetical protein CHLNCDRAFT_143059 [Chlorella variabilis]
Length=541

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/415 (69%), Positives = 336/415 (81%), Gaps = 0/415 (0%)
 Frame = -2

Query  1678  GFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQI  1499
             G+ +RW ++ +CF AFLLCNMDRVNMSIAILP++  + W+  T+GL+QSSFFWGYLLTQ+
Sbjct  127   GWKRRWTMIAMCFVAFLLCNMDRVNMSIAILPISQHFQWNSATIGLVQSSFFWGYLLTQV  186

Query  1498  AGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNN  1319
             AGG+WAD  GGK VLGFGVVWWS+AT++TPIAA++ LP L   R  MGIGEGVAMPAMNN
Sbjct  187   AGGVWADRFGGKRVLGFGVVWWSLATVITPIAARVSLPVLLAARMCMGIGEGVAMPAMNN  246

Query  1318  LLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVW  1139
             LLSKWVP+ ERSRSL++VYSGMY GS+ GLA SP +I  +GW SVFY FG+ G  W+  W
Sbjct  247   LLSKWVPIKERSRSLSLVYSGMYTGSMLGLALSPQMIASWGWSSVFYVFGAAGLAWYAWW  306

Query  1138  LSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGT  959
                A +SP DDP +   E + I RN+ S +P+ SIPW+L+LSKP  WALIV HFCHNWGT
Sbjct  307   DRHAAASPQDDPAIDEAELRYITRNTASAQPLTSIPWRLLLSKPATWALIVCHFCHNWGT  366

Query  958   FILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKI  779
             FILLTWMPTYY+QVL  +L  SG F+VLPW+TMA SA  GGWIAD+LV +G SVT VRKI
Sbjct  367   FILLTWMPTYYNQVLGLDLKSSGFFSVLPWVTMAISANVGGWIADTLVERGWSVTSVRKI  426

Query  778   MQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMG  599
             MQTIGFLGPAFFLTQL ++ S + AV CM  SQG DAFSQSGLYSNH DI PRY+GVL+G
Sbjct  427   MQTIGFLGPAFFLTQLGNITSVSGAVACMMASQGLDAFSQSGLYSNHADIGPRYAGVLLG  486

Query  598   LSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             LSNTAGVLAGV GTAATG+ILQ GSW  V+ V+V LYLVGTVVWNLF+TGEK+ D
Sbjct  487   LSNTAGVLAGVLGTAATGFILQTGSWKQVWGVAVALYLVGTVVWNLFATGEKVFD  541



>ref|XP_010430991.1| PREDICTED: probable anion transporter 2, chloroplastic [Camelina 
sativa]
 ref|XP_010430995.1| PREDICTED: probable anion transporter 2, chloroplastic [Camelina 
sativa]
 ref|XP_010431001.1| PREDICTED: probable anion transporter 2, chloroplastic [Camelina 
sativa]
 ref|XP_010431006.1| PREDICTED: probable anion transporter 2, chloroplastic [Camelina 
sativa]
Length=366

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/390 (74%), Positives = 322/390 (83%), Gaps = 24/390 (6%)
 Frame = -2

Query  1603  MSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIA  1424
             MSIAILPM+ EY+WS  TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLGFGVVWWS A
Sbjct  1     MSIAILPMSQEYNWSSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVLGFGVVWWSFA  60

Query  1423  TILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLG  1244
             TI+TPIAA+LGLPFL +VRAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSGMYLG
Sbjct  61    TIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSGMYLG  120

Query  1243  SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRN  1064
             SV GLAFSP+LIHKFGW SVFYSFGSLG++WF +WL         + + +      IL  
Sbjct  121   SVRGLAFSPLLIHKFGWRSVFYSFGSLGSIWFMLWLKYDDPDLSAEEKKV------ILGG  174

Query  1063  SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMF  884
             S  +EPV  IPWKLILS+PPVWALI SHFCHNWGTFILLTWMPTYY+QVLKFNLTESG+ 
Sbjct  175   SKPREPVTVIPWKLILSEPPVWALIFSHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLL  234

Query  883   AVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMA  704
              VLPWLTMA  A    WIAD+LV +G+S+T VRKIMQ+IGFLGPAFFL+QLSHV +PAMA
Sbjct  235   CVLPWLTMAIFANIRCWIADTLVSRGLSITNVRKIMQSIGFLGPAFFLSQLSHVKTPAMA  294

Query  703   VLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGS  524
             VLCM CSQGSDAFSQSGLYSNHQDI PRY+G+L+GLS+TA                  GS
Sbjct  295   VLCMACSQGSDAFSQSGLYSNHQDIGPRYAGMLLGLSHTA------------------GS  336

Query  523   WDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             WDDVFKV+  LYL+GT+VWNLF+TGEKILD
Sbjct  337   WDDVFKVAEALYLIGTLVWNLFATGEKILD  366



>gb|KFM27578.1| Sodium-dependent phosphate transport protein 1, chloroplastic 
[Auxenochlorella protothecoides]
Length=490

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/457 (65%), Positives = 349/457 (76%), Gaps = 15/457 (3%)
 Frame = -2

Query  1759  SVPESLKFEDALNDDVLTEDDGETIS---------GGFPKRWVIVLLCFSAFLLCNMDRV  1607
             S+ +SL  + +L D         T++         G + +RW IV LCF AF+LCNMDRV
Sbjct  34    SLRQSLDLDGSLEDPGTPSAATGTVNPIHAVLTQPGAWRRRWTIVSLCFVAFMLCNMDRV  93

Query  1606  NMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSI  1427
             NMSIAILPMA +Y WS  T GL+QSSFFWGYLLTQ+AGG+WAD  GGKLVLG GV+WWS+
Sbjct  94    NMSIAILPMAEQYGWSSMTTGLVQSSFFWGYLLTQVAGGVWADKYGGKLVLGLGVLWWSL  153

Query  1426  ATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYL  1247
             AT LTP+AA +GLP L + RA MG+GEGVAMPAMN LLS+WVPV+ERSRSLA+VYSGMY 
Sbjct  154   ATALTPVAAHMGLPALLLARACMGVGEGVAMPAMNTLLSRWVPVAERSRSLALVYSGMYT  213

Query  1246  GSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLI--  1073
             GSV GLA +P LIH  GWP+VFY+FG LG VW  VW ++A SSP  DP +   E++ I  
Sbjct  214   GSVLGLAATPHLIHTVGWPTVFYAFGLLGVVWAVVWRARAASSPGQDPFISDAEREFISG  273

Query  1072  ---LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNL  902
                 + S  ++ V  IPW+ +LS+  VWALIV HFCHNWGTFILLTWMP+YY+QVL  +L
Sbjct  274   GVAEQASGREDRVAGIPWRRLLSERSVWALIVCHFCHNWGTFILLTWMPSYYNQVLGLDL  333

Query  901   TESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHV  722
               SG F+VLPW+TMA SA  GGW+AD+L+ +GVSVT VRK+MQTIGFLGPAFFLTQL  V
Sbjct  334   RASGFFSVLPWITMAISANIGGWLADTLIARGVSVTTVRKVMQTIGFLGPAFFLTQLGRV  393

Query  721   DSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGY  542
              +   AV CM  SQG DAFSQSGLYSNH DI PRY+GVL+GLSNTAGVLAGV GTAATG 
Sbjct  394   HTVRGAVACMMASQGLDAFSQSGLYSNHADIGPRYAGVLLGLSNTAGVLAGVLGTAATGA  453

Query  541   ILQH-GSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ILQ  GSWD V+ V+VGLYL+GTVVWNL STGE++ D
Sbjct  454   ILQSTGSWDQVWGVAVGLYLIGTVVWNLASTGERVFD  490



>gb|KDO66836.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis]
Length=309

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/309 (89%), Positives = 293/309 (95%), Gaps = 0/309 (0%)
 Frame = -2

Query  1360  MGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVF  1181
             MGIGEGVAMPAMNN+LSKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVF
Sbjct  1     MGIGEGVAMPAMNNILSKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHRFGWPSVF  60

Query  1180  YSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPV  1001
             YSFGSLGTVWFTVWLSKAHSSP +DP+L P EKKLI+ +  SKEPVK+IPW LILSKPPV
Sbjct  61    YSFGSLGTVWFTVWLSKAHSSPAEDPQLRPAEKKLIVSSCASKEPVKTIPWGLILSKPPV  120

Query  1000  WALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADS  821
             WALIVSHFCHNWGTFILLTWMPTYY+QVL FNLTESG+F VLPWLTMAFSA  GGWIAD+
Sbjct  121   WALIVSHFCHNWGTFILLTWMPTYYNQVLHFNLTESGLFCVLPWLTMAFSANLGGWIADT  180

Query  820   LVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSN  641
             LV KG+SVT VRKIMQ+IGFLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSN
Sbjct  181   LVSKGLSVTTVRKIMQSIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSN  240

Query  640   HQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNL  461
             HQDIAPRYSGVL+GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGT VWNL
Sbjct  241   HQDIAPRYSGVLLGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTAVWNL  300

Query  460   FSTGEKILD  434
             FSTGEK++D
Sbjct  301   FSTGEKVVD  309



>gb|KDO86200.1| hypothetical protein CISIN_1g007159mg [Citrus sinensis]
Length=534

 Score =   536 bits (1380),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 283/378 (75%), Positives = 323/378 (85%), Gaps = 3/378 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R  A  KS  Y I+++  +SL+  +  ++ VL + D +  S     FPKRWV+VLLCFSA
Sbjct  156   RICAFYKSDEYDITEAKVDSLQSTEIPSEAVLPDGDLQETSPWWEQFPKRWVVVLLCFSA  215

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ E++W+ TTVGLIQSSFFWGYLLTQI GGIWAD  GGK VL
Sbjct  216   FLLCNMDRVNMSIAILPMSKEFNWNSTTVGLIQSSFFWGYLLTQIVGGIWADKFGGKPVL  275

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGV+WWS+AT+LTP+AA++GLPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSL
Sbjct  276   GFGVIWWSVATVLTPVAARIGLPFLLIMRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSL  335

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A VYSGMYLGSVTGLA SP+LI KFGWPSVFYSFGSLG++WF +WL KA+SSP +DPEL 
Sbjct  336   AFVYSGMYLGSVTGLAVSPILIQKFGWPSVFYSFGSLGSIWFALWLKKAYSSPKEDPELR  395

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
              EEK+ IL  S+SKE V  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVL
Sbjct  396   AEEKRHILGGSISKEAVSVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVL  455

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
             KFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IGFLGPAFFLTQ
Sbjct  456   KFNLTESGLFCVLPWLTMAVFANMGGWIADTLVSKGLSITAVRKIMQSIGFLGPAFFLTQ  515

Query  733   LSHVDSPAMAVLCMTCSQ  680
             LSHV +PAMAVLCM CSQ
Sbjct  516   LSHVRTPAMAVLCMACSQ  533



>gb|KDO66837.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis]
Length=301

 Score =   526 bits (1356),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 267/301 (89%), Positives = 285/301 (95%), Gaps = 0/301 (0%)
 Frame = -2

Query  1336  MPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGT  1157
             MPAMNN+LSKWVPV+ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGT
Sbjct  1     MPAMNNILSKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHRFGWPSVFYSFGSLGT  60

Query  1156  VWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHF  977
             VWFTVWLSKAHSSP +DP+L P EKKLI+ +  SKEPVK+IPW LILSKPPVWALIVSHF
Sbjct  61    VWFTVWLSKAHSSPAEDPQLRPAEKKLIVSSCASKEPVKTIPWGLILSKPPVWALIVSHF  120

Query  976   CHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSV  797
             CHNWGTFILLTWMPTYY+QVL FNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SV
Sbjct  121   CHNWGTFILLTWMPTYYNQVLHFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSV  180

Query  796   TVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRY  617
             T VRKIMQ+IGFLGPAFFLTQLSHVDSPAMAVLCM CSQG+DAFSQSGLYSNHQDIAPRY
Sbjct  181   TTVRKIMQSIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRY  240

Query  616   SGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             SGVL+GLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGT VWNLFSTGEK++
Sbjct  241   SGVLLGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTAVWNLFSTGEKVV  300

Query  436   D  434
             D
Sbjct  301   D  301



>ref|XP_005648445.1| putative inorganic phosphate transporter [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23901.1| putative inorganic phosphate transporter [Coccomyxa subellipsoidea 
C-169]
Length=396

 Score =   529 bits (1362),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 279/396 (70%), Positives = 324/396 (82%), Gaps = 1/396 (0%)
 Frame = -2

Query  1618  MDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvV  1439
             MDRVNMSIAILPM+ ++ W   T+GL+QSSFFWGYL TQ+AGG+WAD  GGK VLGFGV+
Sbjct  1     MDRVNMSIAILPMSKQFGWDSATIGLVQSSFFWGYLTTQVAGGVWADKYGGKTVLGFGVI  60

Query  1438  WWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYS  1259
             WWSIAT LTP+AA LGLP L   RA MG+GEGVAMPAMNNLLS+WVPV ERSRSLA+VYS
Sbjct  61    WWSIATALTPLAASLGLPALLFARACMGVGEGVAMPAMNNLLSRWVPVQERSRSLALVYS  120

Query  1258  GMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekk  1079
             GMY GSV GLA SP LI    WPSVF+ FGS+G +WF +W  +A SSP +D     EEK 
Sbjct  121   GMYTGSVLGLAASPHLIEWLTWPSVFHIFGSVGVLWFLLWEWQASSSPDEDNRCSAEEKA  180

Query  1078  LILRNS-VSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNL  902
             L++ N+ +S+   + IPWKL+LSK PVWALIV HFCHNWGTFILLTWMP YY+QVL F+L
Sbjct  181   LLVANTPISRTRGEPIPWKLLLSKAPVWALIVCHFCHNWGTFILLTWMPMYYNQVLGFDL  240

Query  901   TESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHV  722
              +SG+F+VLPW+TMA  A  GGW+AD++V KGVSVT VRKIMQTIGF+GPA FLT+L  V
Sbjct  241   LKSGIFSVLPWITMAVFANVGGWLADTMVSKGVSVTRVRKIMQTIGFMGPAIFLTRLGSV  300

Query  721   DSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGY  542
              +P  AV CM  SQG D+FSQSGLYSNHQDI PRYSGVL+G+SNTAGVLAGV GTAATG 
Sbjct  301   STPMGAVACMMASQGLDSFSQSGLYSNHQDIGPRYSGVLLGMSNTAGVLAGVLGTAATGL  360

Query  541   ILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             IL +GSWDDV+ V+V LYLVGTVVWN+FSTGE+I D
Sbjct  361   ILANGSWDDVWGVAVALYLVGTVVWNVFSTGEQIFD  396



>ref|XP_003627568.1| Sodium-dependent phosphate transport protein [Medicago truncatula]
 gb|AET02044.1| anion transporter 4 [Medicago truncatula]
Length=507

 Score =   528 bits (1359),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 281/372 (76%), Positives = 317/372 (85%), Gaps = 3/372 (1%)
 Frame = -2

Query  1786  KSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNM  1616
             K++ Y  ++   + L+  D   + +L E +    S     FPKRWVIVLLCF+AFLLCNM
Sbjct  135   KAEEYEFAEPNIDGLQPTDGTGEAILLEGNLLQTSPWWQQFPKRWVIVLLCFTAFLLCNM  194

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             DRVNMSIAILPM+ +++W+  TVGLIQSSFFWGYLLTQIAGGIWAD VGGKLVLGFGVVW
Sbjct  195   DRVNMSIAILPMSQQFNWNSATVGLIQSSFFWGYLLTQIAGGIWADKVGGKLVLGFGVVW  254

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WSIAT+LTPIAAKLGLP+L ++RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA+VYSG
Sbjct  255   WSIATVLTPIAAKLGLPYLLVMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLALVYSG  314

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkL  1076
             MYLGSVTGL FSP LI KFGWPSVFYSFGSLG++WF +WL  A+S+P DDP L  EEK+L
Sbjct  315   MYLGSVTGLGFSPFLIQKFGWPSVFYSFGSLGSIWFALWLRNAYSTPKDDPNLGDEEKRL  374

Query  1075  ILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             IL  +VSKEPV  IPWKLILSK PVWALIVSHFCHNWGTFILLTWMPTYY+QVLKFNLTE
Sbjct  375   ILGGNVSKEPVTVIPWKLILSKAPVWALIVSHFCHNWGTFILLTWMPTYYNQVLKFNLTE  434

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+  VLPWLTMA  A  GGWIAD+LV KG S+T VRKIMQ+IGFLGPAFFLTQLS+V +
Sbjct  435   SGLLCVLPWLTMAVFANIGGWIADTLVSKGFSITTVRKIMQSIGFLGPAFFLTQLSNVRT  494

Query  715   PAMAVLCMTCSQ  680
             PAMAVLCM CSQ
Sbjct  495   PAMAVLCMACSQ  506



>gb|AAF02804.1|AF195115_24 weak similarity to phthalate permease family [Arabidopsis thaliana]
 gb|AAB62846.1| A_IG005I10.nn gene product [Arabidopsis thaliana]
 emb|CAB80795.1| AT4g00370 [Arabidopsis thaliana]
Length=413

 Score =   514 bits (1324),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 292/478 (61%), Positives = 328/478 (69%), Gaps = 100/478 (21%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLLCFSA  1634
             R+ A  KS+   I++ V  S    D   + +L E + +  S     FP+RWVIVLLCFS+
Sbjct  15    RSRAYYKSEESDITEGVVPS---ADGSAEAILVEGNLQNASPWWQQFPRRWVIVLLCFSS  71

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM+ EY+WS  TVGLIQSSFFWGYLLTQI GGIWAD        
Sbjct  72    FLLCNMDRVNMSIAILPMSQEYNWSSATVGLIQSSFFWGYLLTQILGGIWAD--------  123

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
                               K G             G+GVAMPAMNN+LSKW+PVSERSRSL
Sbjct  124   ------------------KFG-------------GKGVAMPAMNNMLSKWIPVSERSRSL  152

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSPMLI KFGWPSVFYSFGSLG++WF +WL  A+SSP DDP+L 
Sbjct  153   ALVYSGMYLGSVTGLAFSPMLITKFGWPSVFYSFGSLGSIWFLLWLKFAYSSPKDDPDLS  212

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQ--  920
              EEKK+IL  S  +EPV  IPWKLILSKPPVWALI+SHFCHNWGTFILLTWMPTYY+Q  
Sbjct  213   EEEKKVILGGSKPREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQAR  272

Query  919   ----------------VLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVV  788
                             VLKFNLTESG+  VLPWLTMA  A  GGWIAD+LV +G+S+T  
Sbjct  273   SSASVISLLFNIFCEQVLKFNLTESGLLCVLPWLTMAVFANIGGWIADTLVSRGLSIT--  330

Query  787   RKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGV  608
                                                 GSDAFSQSGLYSNHQDI PRY+GV
Sbjct  331   -----------------------------------NGSDAFSQSGLYSNHQDIGPRYAGV  355

Query  607   LMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             L+GLSNTAGVLAGVFGTAATGYILQ GSWDDVFKV+V LYL+GT+VWNLF+TGEKILD
Sbjct  356   LLGLSNTAGVLAGVFGTAATGYILQRGSWDDVFKVAVALYLIGTLVWNLFATGEKILD  413



>ref|XP_007146729.1| hypothetical protein PHAVU_006G0649001g, partial [Phaseolus vulgaris]
 gb|ESW18723.1| hypothetical protein PHAVU_006G0649001g, partial [Phaseolus vulgaris]
Length=392

 Score =   500 bits (1287),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 273/344 (79%), Positives = 302/344 (88%), Gaps = 8/344 (2%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG---GFPKRWVIVLLCFSA  1634
             + WA+VKS+      ++ ES K+ED +      EDD E        FPKRWVIV+LCFSA
Sbjct  54    KVWANVKSE-----KNLSESPKYEDVVLQKARGEDDMEEEGKWWQVFPKRWVIVVLCFSA  108

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM++EY WSP+TVGL+QSSFFWGYLLTQIAGGIWADTVGGK VL
Sbjct  109   FLLCNMDRVNMSIAILPMSAEYKWSPSTVGLVQSSFFWGYLLTQIAGGIWADTVGGKQVL  168

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGV+WWS+AT+LTPIAAKLGLPFL + RAFMGIGEGVAMPAMNN+LSKWVPVSERSRSL
Sbjct  169   GFGVIWWSVATVLTPIAAKLGLPFLLVARAFMGIGEGVAMPAMNNILSKWVPVSERSRSL  228

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF+VWLSKAHSSPL+DP+L 
Sbjct  229   ALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFSVWLSKAHSSPLEDPDLR  288

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
             PEEKKLI  + +SKEPVK+IPW+LILSK PVWALIVSHFCHNWGTFILLTWMPTYY+QVL
Sbjct  289   PEEKKLITTSCLSKEPVKTIPWRLILSKAPVWALIVSHFCHNWGTFILLTWMPTYYNQVL  348

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
             KFNLTESG+F VLPWL MA SA  GGWIAD+LV KGVSVT VRK
Sbjct  349   KFNLTESGLFCVLPWLIMALSANVGGWIADTLVSKGVSVTRVRK  392



>ref|XP_009804712.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=369

 Score =   489 bits (1260),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 282/375 (75%), Positives = 314/375 (84%), Gaps = 26/375 (7%)
 Frame = -2

Query  1990  MTARALLLSYYNLPPKLHCSPEATFPKRSFSSRSHT--------HTLFEFGSPFLPGRGF  1835
             MTA+A LLS+Y+  P   C+        SF+S  +T          LF+FGS        
Sbjct  1     MTAKAFLLSHYSCSPPKKCNSNIRGRNFSFTSLYYTTGIECRGAFRLFQFGS--------  52

Query  1834  RRGLIRRT--SWRAWADVKSKTYGISDSVPESLKFEDALNDDVL-TEDDGETISG-----  1679
              RGL+RR   SW+  ADVKSK + I++S  ESLKFED +++ +L  ++DG+++ G     
Sbjct  53    -RGLVRRNNDSWKVGADVKSKPFKITES-SESLKFEDPISEALLRKKEDGDSLDGPAWWE  110

Query  1678  GFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQI  1499
              FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHW PTTVGLIQSSFFWGYLLTQI
Sbjct  111   EFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWGPTTVGLIQSSFFWGYLLTQI  170

Query  1498  AGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNN  1319
             AGGIWADTVGGK VLGFGVVWWS+AT+LTPIAAKLGLPFLF+VRAFMGIGEGVAMPAMNN
Sbjct  171   AGGIWADTVGGKAVLGFGVVWWSVATVLTPIAAKLGLPFLFVVRAFMGIGEGVAMPAMNN  230

Query  1318  LLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVW  1139
             +LSKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP+LIH FGWPSVF+SFGSLGTVWF VW
Sbjct  231   ILSKWVPVSERSRSLALVYSGMYLGSVTGLAFSPLLIHNFGWPSVFFSFGSLGTVWFAVW  290

Query  1138  LSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGT  959
             L+KA+SSPLDDPEL PEEKKLIL +SVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGT
Sbjct  291   LNKAYSSPLDDPELRPEEKKLILSSSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGT  350

Query  958   FILLTWMPTYYHQVL  914
             FILLTWMPTYYHQV+
Sbjct  351   FILLTWMPTYYHQVV  365



>ref|NP_850136.1| phosphate transporter 4;1 [Arabidopsis thaliana]
 gb|AAN71994.1| putative Na+-dependent inorganic phosphate cotransporter [Arabidopsis 
thaliana]
 gb|AAP37848.1| At2g29650 [Arabidopsis thaliana]
 gb|AEC08285.1| sodium-dependent phosphate transport protein 1 [Arabidopsis thaliana]
Length=398

 Score =   479 bits (1234),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 257/319 (81%), Positives = 284/319 (89%), Gaps = 3/319 (1%)
 Frame = -2

Query  1723  NDDVLTEDDGETIS---GGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPT  1553
             N+DV+++     +      FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPM++EY W+P 
Sbjct  80    NNDVVSDSPSSIVLPWWEEFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPA  139

Query  1552  TVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFI  1373
             TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VLGFGV+WWSIATILTP+AAKLGLP+L +
Sbjct  140   TVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLGFGVIWWSIATILTPVAAKLGLPYLLV  199

Query  1372  VRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGW  1193
             VRAFMG+GEGVAMPAMNN+LSKWVPV ERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGW
Sbjct  200   VRAFMGVGEGVAMPAMNNILSKWVPVQERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGW  259

Query  1192  PSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILS  1013
             PSVFYSFGSLGTVW T+WL+KA SSPL+DP LLPEE+KLI  N  SKEPVKSIPW+LILS
Sbjct  260   PSVFYSFGSLGTVWLTLWLTKAESSPLEDPTLLPEERKLIADNCASKEPVKSIPWRLILS  319

Query  1012  KPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGW  833
             KPPVWALI  HFCHNWGTFILLTWMPTYYHQVLKFNL ESG+ +V PW+TMA SA AGGW
Sbjct  320   KPPVWALISCHFCHNWGTFILLTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGW  379

Query  832   IADSLVRKGVSVTVVRKIM  776
             IAD+LV +G SVT VRK +
Sbjct  380   IADTLVSRGFSVTNVRKFL  398



>gb|EMS45969.1| putative anion transporter 1, chloroplastic [Triticum urartu]
Length=383

 Score =   475 bits (1222),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 282/442 (64%), Positives = 313/442 (71%), Gaps = 71/442 (16%)
 Frame = -2

Query  1852  LPGRGFRRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGF  1673
             +PGR   RG I    W+    V+     + DSV   L  EDA        + G    G F
Sbjct  11    VPGR--IRGQIGGLIWQ----VEGSGVELLDSV-RKLLLEDA--------EPGVEEQGQF  55

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKRW IV LCFSAFLLCNMDRVNMSIAI+PM++EY W+P TVGLIQSSFFWGYLLTQIAG
Sbjct  56    PKRWAIVFLCFSAFLLCNMDRVNMSIAIMPMSAEYGWNPQTVGLIQSSFFWGYLLTQIAG  115

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             GIWAD VGGK VLGFGV+WWS+AT LTP+AAKLGLPFL +VRAFMGIGEGVAMPAMNN+L
Sbjct  116   GIWADKVGGKTVLGFGVIWWSVATALTPVAAKLGLPFLLVVRAFMGIGEGVAMPAMNNIL  175

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKWVPVSERSRSLA+VYSGMYLGSVTGLAFSP LIHKFGWPSVFYSFGSLGTVWF  W +
Sbjct  176   SKWVPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHKFGWPSVFYSFGSLGTVWFATWAA  235

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFI  953
             KA+S+PL+DP +  EEKKLI+  + S EPV +IPW +ILSKPPVWALI  HFCHNWGTFI
Sbjct  236   KAYSTPLEDPRISAEEKKLIISQTTSGEPVTTIPWGVILSKPPVWALIACHFCHNWGTFI  295

Query  952   LLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQ  773
             LLTWMPTYY+QVLKFNLTES +F VLPWLTMA SA  GGWIAD+LV +G SVT VRK + 
Sbjct  296   LLTWMPTYYNQVLKFNLTESSLFCVLPWLTMAISANVGGWIADTLVSRGTSVTTVRKGV-  354

Query  772   TIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLS  593
                       L  LS+                                    +GVL G  
Sbjct  355   ----------LLGLSNT-----------------------------------AGVLAG--  367

Query  592   NTAGVLAGVFGTAATGYILQHG  527
                     VFGTAATGYILQHG
Sbjct  368   --------VFGTAATGYILQHG  381



>gb|KDO66840.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis]
Length=371

 Score =   437 bits (1124),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 240/302 (79%), Positives = 268/302 (89%), Gaps = 10/302 (3%)
 Frame = -2

Query  1792  DVKSKTYGISDSVPESLKFEDALNDDVL-TED---DGETIS---GGFPKRWVIVLLCFSA  1634
             DVKS++Y +S+   +S+KFE+AL D  L +ED   D E++      FPKRW IV+LCFSA
Sbjct  56    DVKSESYNVSE---KSVKFEEALKDIALRSEDLGVDSESLVPWWEEFPKRWFIVVLCFSA  112

Query  1633  FLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvl  1454
             FLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGGIWADTVGGK VL
Sbjct  113   FLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKAVL  172

Query  1453  gfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSL  1274
             GFGVVWWSIAT LTP+AAKLGLPFL +VR FMGIGEGVAMPAMNN+LSKWVPV+ERSRSL
Sbjct  173   GFGVVWWSIATALTPVAAKLGLPFLLVVRVFMGIGEGVAMPAMNNILSKWVPVAERSRSL  232

Query  1273  AMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpell  1094
             A+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWFTVWLSKAHSSP +DP+L 
Sbjct  233   ALVYSGMYLGSVTGLAFSPFLIHRFGWPSVFYSFGSLGTVWFTVWLSKAHSSPAEDPQLR  292

Query  1093  peekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
             P EKKLI+ +  SKEPVK+IPW LILSKPPVWALIVSHFCHNWGTFILLTWMPTYY+QV 
Sbjct  293   PAEKKLIVSSCASKEPVKTIPWGLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVS  352

Query  913   KF  908
              F
Sbjct  353   SF  354



>gb|KCW52552.1| hypothetical protein EUGRSUZ_J01933 [Eucalyptus grandis]
Length=417

 Score =   431 bits (1107),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 258/368 (70%), Positives = 289/368 (79%), Gaps = 28/368 (8%)
 Frame = -2

Query  1993  AMTARALLLSYYNLPPKL-----HCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRR  1829
             AM ARA L SY   P  L       SP  T P++SF+S +  H            R   R
Sbjct  35    AMNARAFLCSYTPHPDSLLKQRTSLSPPPT-PRKSFASAARFHCQV---------RLISR  84

Query  1828  GLIRRTSWRAWAD---VKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKR  1664
             G  RR ++R  A    +KS+ Y ISD V E  KF+         ED G  +     FPKR
Sbjct  85    G--RRYTFRVSARNPGLKSEQYEISD-VREPAKFKTGE-----VEDGGVVVPWWEKFPKR  136

Query  1663  WVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIW  1484
             WVIV+LCFSAFLLCNMDRVNMSIAILPM++EY+W+PTTVGLIQSSFFWGYLLTQIAGGIW
Sbjct  137   WVIVVLCFSAFLLCNMDRVNMSIAILPMSAEYNWNPTTVGLIQSSFFWGYLLTQIAGGIW  196

Query  1483  ADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKW  1304
             ADTVGGKLVLGFGV+WWSIAT LTP+AAKLGLP+L +VRAFMGIGEGVAMPAMNN+LSKW
Sbjct  197   ADTVGGKLVLGFGVIWWSIATALTPVAAKLGLPYLLVVRAFMGIGEGVAMPAMNNILSKW  256

Query  1303  VPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAH  1124
             VPVSERSRSLA+VYSGMYLGSVTGLAFSP LIH+FGWPSVFYSFGSLGTVWF  WL+KA+
Sbjct  257   VPVSERSRSLALVYSGMYLGSVTGLAFSPFLIHQFGWPSVFYSFGSLGTVWFATWLNKAY  316

Query  1123  SSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLT  944
             SSPLDDP+L PEEK+LIL NSV +EPV +IPW L+LS+PPVWALIV HFCHNWGTFILLT
Sbjct  317   SSPLDDPQLRPEEKRLILTNSVPREPVTTIPWGLLLSQPPVWALIVCHFCHNWGTFILLT  376

Query  943   WMPTYYHQ  920
             WMPTYY+Q
Sbjct  377   WMPTYYNQ  384



>ref|XP_005703857.1| MFS transporter, anion:cation symporter (ACS) family [Galdieria 
sulphuraria]
 gb|EME27337.1| MFS transporter, anion:cation symporter (ACS) family [Galdieria 
sulphuraria]
Length=530

 Score =   432 bits (1112),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 224/419 (53%), Positives = 297/419 (71%), Gaps = 7/419 (2%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             P+R+++VL+CF +F+LCNMDRVN+S+AILPM+ E+ WS +TVG+IQSSFFWGYL+TQI G
Sbjct  112   PERFLVVLMCFLSFVLCNMDRVNVSVAILPMSKEFGWSQSTVGVIQSSFFWGYLVTQIPG  171

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G  AD  GGKLVLG+GV+ WS+ T +TP AA    P L + RA +G GEGVAMPAMN ++
Sbjct  172   GYLADKYGGKLVLGWGVLAWSLMTFVTPYAASKSFPVLLLSRALLGFGEGVAMPAMNQVV  231

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKW+P  ERSRSLA++YSGMY GSV GL   P ++   GW SVF SFG+LG +W+ +W +
Sbjct  232   SKWIPSGERSRSLALIYSGMYFGSVIGLLLCPKMMSTLGWHSVFTSFGALGILWWLIWNA  291

Query  1132  KAHSSplddpellpeekkLILRNSVS-----KEPVKSIPWKLILSKPPVWALIVSHFCHN  968
                SSP     +  +EK  IL+   +         + IPWKL+ SK   WA+IV+HFC  
Sbjct  292   WIKSSPEKSNSISQDEKNYILKQRTTIGNKMDRTSRDIPWKLLFSKKATWAIIVAHFCTT  351

Query  967   WGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVV  788
             WG F+LLTW+PTY++Q L  NL  S   +VLPWL MA SA  GGW AD L+ KG S+T V
Sbjct  352   WGYFVLLTWLPTYFNQHLGLNLASSSFVSVLPWLAMALSANVGGWCADYLLSKGFSITFV  411

Query  787   RKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGV  608
             RK+MQT+G +GPA FL+ +S V  P  AVLCM  + G  +F+QSG+Y+NHQDI P Y+GV
Sbjct  412   RKLMQTMGLMGPALFLSIVSFVHHPVTAVLCMALALGLGSFAQSGVYANHQDIGPEYAGV  471

Query  607   LMGLSNTAGVLAGVFGTAATGYILQH--GSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             L+G+SN+   + G+ G A TG+IL    G+W  VF V++G Y++GTVV+N   TG+++ 
Sbjct  472   LLGISNSFAAIPGIVGVALTGFILDKTGGAWYIVFGVAIGFYILGTVVYNTMGTGKQVF  530



>ref|XP_001694351.1| major facilitator superfamily protein [Chlamydomonas reinhardtii]
 gb|EDP02784.1| major facilitator superfamily protein [Chlamydomonas reinhardtii]
Length=385

 Score =   417 bits (1071),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 221/397 (56%), Positives = 276/397 (70%), Gaps = 19/397 (5%)
 Frame = -2

Query  1603  MSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIA  1424
             MS+AILPMAS++ W   T+GL+QSSFFWGYLLTQ+AGG+ AD  GG+L+LG GV+WWS+A
Sbjct  1     MSVAILPMASQFGWDAATMGLVQSSFFWGYLLTQVAGGVLADRYGGRLILGLGVLWWSLA  60

Query  1423  TILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLG  1244
             T LTP+AA  GLP L + R  MGIGEGVAMPAMN LL+KWVP  ERSRSLA+VYSGM++G
Sbjct  61    TALTPVAAAAGLPTLLVARCLMGIGEGVAMPAMNALLAKWVPGGERSRSLALVYSGMFIG  120

Query  1243  SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRN  1064
             SV GL  SP +++ FGW SVFY FGS+G +        A   P          +     +
Sbjct  121   SVIGLGASPHMVNNFGWQSVFYVFGSMGVLCLHP-CQHAEQQPGKRACAAWPNRARAFGD  179

Query  1063  S----VSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTE  896
             +    +      +IPW+ +LS+  VWA+I++HFCHNWG FILLTWMP YY+QVL  NLT+
Sbjct  180   TDTAVMHARRAGNIPWRALLSRREVWAIILTHFCHNWGLFILLTWMPAYYNQVLGLNLTQ  239

Query  895   SGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDS  716
             SG+ +VLPW+  A  A   GW AD+LV +GVS+T VRK+   +GF           H  S
Sbjct  240   SGLLSVLPWVAQAVMANVAGWAADNLVERGVSITTVRKVRVVLGF-----------HTPS  288

Query  715   PAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL  536
                AVLCM  SQG DAFSQ+GLY+NHQDI PRY+GVL+GLSNTAGVLAGV G+  TG++L
Sbjct  289   ATGAVLCMIGSQGLDAFSQAGLYANHQDIGPRYAGVLLGLSNTAGVLAGVLGSLVTGFLL  348

Query  535   QHG---SWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             Q G    W +V+ V+VG YL GT +W   S+GEKI D
Sbjct  349   QAGGDAGWSNVWTVAVGFYLAGTAIWLSMSSGEKIFD  385



>ref|XP_005537971.1| probable Na+-dependent inorganic phosphate cotransporter [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM81935.1| probable Na+-dependent inorganic phosphate cotransporter [Cyanidioschyzon 
merolae strain 10D]
Length=602

 Score =   421 bits (1082),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 218/427 (51%), Positives = 292/427 (68%), Gaps = 14/427 (3%)
 Frame = -2

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FP+R  IV+LCF AFL+ N+DR+N+S+AILPM  E+ WS TTVG+IQS+FFWGYLLTQ+ 
Sbjct  176   FPERLRIVVLCFLAFLINNIDRINLSVAILPMRHEFGWSSTTVGIIQSAFFWGYLLTQLP  235

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GG  AD  GG+ VL FGVV WS+ T +TP+AA+  LP L   RA +G+GEGVAMPAMNNL
Sbjct  236   GGYLADRYGGRSVLAFGVVSWSLMTFVTPMAARSSLPILLGARALLGVGEGVAMPAMNNL  295

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             +S+WVP  ERSR+L+++YSGMY+GSV GL   P+L+   GW SVFY FG+LG VW+ +W 
Sbjct  296   VSRWVPNQERSRALSLIYSGMYMGSVIGLLLCPLLMRNLGWQSVFYVFGALGFVWYFLWE  355

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKS-----------IPWKLILSKPPVWALI  989
                  S   + +++  ++   LR  + +   K            +PWKL+LS P  WA++
Sbjct  356   RFTSGSSPKESKIIDPQELEYLRKQLGRRRNKETVPTTVPARARVPWKLLLSHPATWAIM  415

Query  988   VSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVR-  812
             + HFC  WG F+LL W+PTY++Q L F+L  S  F++LPWLTM   A   GWIAD L+  
Sbjct  416   IGHFCCTWGYFLLLAWLPTYFNQALGFDLNASAFFSILPWLTMFVGANVSGWIADYLLST  475

Query  811   KGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQD  632
             +  + T VRK+MQTIGFLGPA FL  +S    P  AV+ M  + G  +FSQSG+YSNH D
Sbjct  476   RKFTTTAVRKMMQTIGFLGPASFLALVSSTQDPYSAVIYMAAALGLASFSQSGIYSNHGD  535

Query  631   IAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ--HGSWDDVFKVSVGLYLVGTVVWNLF  458
             I P+Y+G+L+G+SNT   + G+ G A TG+IL    G+W  VF  ++  YL+GTVV+N F
Sbjct  536   IGPQYAGILLGMSNTLATVPGIVGVALTGWILDVTAGTWSIVFYTAIFFYLLGTVVYNAF  595

Query  457   STGEKIL  437
              TGE++ 
Sbjct  596   GTGERVF  602



>tpg|DAA59022.1| TPA: hypothetical protein ZEAMMB73_730146 [Zea mays]
Length=489

 Score =   399 bits (1025),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 224/322 (70%), Positives = 254/322 (79%), Gaps = 6/322 (2%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS--GGFPKRWVIVLLCFSAF  1631
             R  AD K++ Y I+ S    L   D   D V+  D  E       FPKRW +VLLCF AF
Sbjct  159   RTRADCKAEQYEITGS---PLSPSDVPADAVMIGDTNEISPWWQEFPKRWTVVLLCFFAF  215

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+SE+ W+P TVGLIQSSFFWGYLLTQI GGIWAD  GGK+VLG
Sbjct  216   LLCNMDRVNMSIAILPMSSEFSWNPATVGLIQSSFFWGYLLTQILGGIWADRFGGKVVLG  275

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGVVWWS AT+LTP+AAK+GLP L  +RAFMGIGEGVAMPAMNN+LSKW+PVSERSRSLA
Sbjct  276   FGVVWWSFATVLTPLAAKIGLPCLLTMRAFMGIGEGVAMPAMNNILSKWIPVSERSRSLA  335

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VYSGMYLGSVTGL+ SP+LI +FGWPSVFY+FGSLGTVWF +W SKAHSSP DDPEL  
Sbjct  336   LVYSGMYLGSVTGLSLSPLLISRFGWPSVFYAFGSLGTVWFALWQSKAHSSPDDDPELSK  395

Query  1090  eekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
              EK+ IL  S  KEPV SIPW+LILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QV  
Sbjct  396   AEKRHILGGSALKEPVTSIPWRLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVAT  455

Query  910   FNLTESGMFA-VLPWLTMAFSA  848
                 E+  F   L ++ +A+ A
Sbjct  456   MLCCETFDFPHYLNYIMIAYHA  477



>ref|XP_010923100.1| PREDICTED: probable anion transporter 1, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=461

 Score =   393 bits (1009),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 218/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  1138  LSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGT  959
             + +A+SSPL+DP L  EEKKLI   SV+ EPV++IPW+LILSKPPVWALIVSHFCHNWGT
Sbjct  227   IGEAYSSPLEDPGLRAEEKKLIESKSVANEPVRTIPWRLILSKPPVWALIVSHFCHNWGT  286

Query  958   FILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKI  779
             FILLTWMPTYY+QVLKFNLTESG+F VLPWLTMAFSA  GGWIAD+LV KG+SVT+VRKI
Sbjct  287   FILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAFSANIGGWIADTLVSKGLSVTMVRKI  346

Query  778   MQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMG  599
             MQ+IGFLGPAFFLTQLSH+ SPAMAVLCM CSQG+DAFSQSGLYSNHQDI PRY+GVL+G
Sbjct  347   MQSIGFLGPAFFLTQLSHIHSPAMAVLCMACSQGTDAFSQSGLYSNHQDIGPRYAGVLLG  406

Query  598   LSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             LSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSV LYL GTVVWNLFSTGEKILD
Sbjct  407   LSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVALYLAGTVVWNLFSTGEKILD  461


 Score =   193 bits (491),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 133/169 (79%), Gaps = 17/169 (10%)
 Frame = -2

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDV--------LTEDDGETIS------GGFPKRWV  1658
             AD++S+   +SDS PES+ F + L++ V          E+DG   +        FPKRWV
Sbjct  69    ADLQSE---VSDSSPESINFRETLSEAVSPPREEEEEEEEDGWVAAVSSLGLDKFPKRWV  125

Query  1657  IVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWAD  1478
             IV+LCFSAFLLCNMDRVNMSIAILPM++E++W+P TVGLIQSSFFWGYLLTQIAGG+WAD
Sbjct  126   IVILCFSAFLLCNMDRVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGVWAD  185

Query  1477  TvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMP  1331
             TVGGK VLGFGVVWWSIAT LTP+AAK+GLPFL +VRAFMGIGE  + P
Sbjct  186   TVGGKTVLGFGVVWWSIATALTPVAAKIGLPFLLVVRAFMGIGEAYSSP  234



>ref|XP_005712347.1| unnamed protein product [Chondrus crispus]
 emb|CDF77473.1| unnamed protein product [Chondrus crispus]
Length=482

 Score =   392 bits (1006),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/397 (52%), Positives = 266/397 (67%), Gaps = 6/397 (2%)
 Frame = -2

Query  1609  VNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWS  1430
             +N+S+AILPMA  Y WS TTVG+IQS+FFWGY+LTQI GG  AD  GGK VL  GVV WS
Sbjct  86    INISVAILPMAKYYGWSQTTVGVIQSAFFWGYVLTQIPGGYLADKYGGKQVLAAGVVVWS  145

Query  1429  IATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMY  1250
               TILTP+AA   L  L + RA +G+GEGVAMPAMNN++SKWVP +ERSRSL++ YSGMY
Sbjct  146   AMTILTPLAASTNLGVLLLARALLGVGEGVAMPAMNNMISKWVPETERSRSLSLTYSGMY  205

Query  1249  LGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL----SKAHSSplddpellpeek  1082
             LGSV GL   P  I  FGW SVFY FG+LG  W+  W     S    S     +      
Sbjct  206   LGSVVGLLLCPAFIVSFGWQSVFYFFGALGFFWWAAWQFWTKSTPELSTTMSEKERAYIN  265

Query  1081  kLILRNSVSKEPV-KSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
               +   + +K  +  S+PWKL+ SK   W +I++HFC  WG F+LL W+PTY++Q L F+
Sbjct  266   SKMRAGAANKSSLPTSVPWKLLFSKKATWGIIIAHFCATWGYFVLLIWLPTYFNQQLGFD  325

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             L  S   +V+PWL M  SA AGG+IAD++  + +S+T VRK MQ+IGFLGPA FL  +S 
Sbjct  326   LAASSFLSVMPWLAMFVSANAGGFIADAMRARNISITTVRKTMQSIGFLGPAAFLALVST  385

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
                PAMAV  MT +    +FSQSG+Y+NHQDI P +SG+L+G+SNT   + G+ G A TG
Sbjct  386   TTDPAMAVTYMTTALALGSFSQSGVYANHQDIGPAFSGILLGISNTGAAIPGIVGVALTG  445

Query  544   YILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             YIL   GSW  VF +++  YL GTV +N   TGE++ 
Sbjct  446   YILDTTGSWSLVFGIAIFFYLFGTVAYNALGTGERVF  482



>gb|ABR16151.1| unknown [Picea sitchensis]
Length=671

 Score =   393 bits (1010),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 227/252 (90%), Gaps = 0/252 (0%)
 Frame = -2

Query  1675  FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIA  1496
             FPKRW+IVLLCF AFLLCNMDRVNMSIAILPM+ E++WSP TVGL+QSSFFWGYLLTQ+A
Sbjct  188   FPKRWLIVLLCFFAFLLCNMDRVNMSIAILPMSREFNWSPATVGLVQSSFFWGYLLTQVA  247

Query  1495  GGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNL  1316
             GGIWAD VGGK VLGFGVVWWSIATILTPIAA++GLPFL +VRAFMGIGEGVAMPAMNN+
Sbjct  248   GGIWADKVGGKRVLGFGVVWWSIATILTPIAARVGLPFLLLVRAFMGIGEGVAMPAMNNI  307

Query  1315  LSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWL  1136
             LS+W+P  ERSRSLA+VYSGMYLGSV GLAFSP LI KF WPSVFYSFGSLGT+WF  W 
Sbjct  308   LSRWIPAKERSRSLALVYSGMYLGSVAGLAFSPFLIQKFSWPSVFYSFGSLGTIWFATWQ  367

Query  1135  SKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
               A SSPL+D E+ PEEK+ ILRNS  KEPVK+IPWKL+LSK PVWALIV HFCHNWGTF
Sbjct  368   RNAQSSPLEDLEIRPEEKEFILRNSELKEPVKTIPWKLLLSKAPVWALIVCHFCHNWGTF  427

Query  955   ILLTWMPTYYHQ  920
             ILLTWMPTYY+Q
Sbjct  428   ILLTWMPTYYNQ  439


 Score =   390 bits (1003),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  1153  WFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFC  974
             W   + ++A SSPL+D E+ PEEK+ ILRNS  KEPVK+IPWKL+LSK PVWALIV HFC
Sbjct  432   WMPTYYNQAQSSPLEDLEIRPEEKEFILRNSELKEPVKTIPWKLLLSKAPVWALIVCHFC  491

Query  973   HNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVT  794
             HNWGTFILLTWMPTYY+QVLKFNLTESG+F VLPWLTMA SA  GGWIAD+LV +GVS+T
Sbjct  492   HNWGTFILLTWMPTYYNQVLKFNLTESGIFCVLPWLTMALSANLGGWIADTLVSRGVSIT  551

Query  793   VVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYS  614
              VRK+MQ+IGFLGPAFFLTQLSHV SPAMAVLCMTCSQG DAFSQSGLYSNHQDI PRY+
Sbjct  552   TVRKVMQSIGFLGPAFFLTQLSHVRSPAMAVLCMTCSQGCDAFSQSGLYSNHQDIGPRYA  611

Query  613   GVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             GVL+GLSNTAGVLAGVFGTAATGYILQ+GSWDDVFKV+VGLYLVGTVVWNLF+TGE++ D
Sbjct  612   GVLLGLSNTAGVLAGVFGTAATGYILQNGSWDDVFKVAVGLYLVGTVVWNLFATGERVFD  671



>ref|XP_009367836.1| PREDICTED: probable anion transporter 2, chloroplastic [Pyrus 
x bretschneideri]
Length=451

 Score =   385 bits (988),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 211/300 (70%), Positives = 246/300 (82%), Gaps = 4/300 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISG--GFPKRWVIVLLCFSAF  1631
             R  A  KS+   I++S  +SL   +   + VL   +   +      PKRWVIVLLCF+AF
Sbjct  150   RTCAYYKSEENDITESEVDSLTSIEGSGEAVLAARNVRKVPSWWEIPKRWVIVLLCFTAF  209

Query  1630  LLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlg  1451
             LLCNMDRVNMSIAILPM+ E++W+  TVGLIQSSFFWGYLLTQI GGI AD +GGK VLG
Sbjct  210   LLCNMDRVNMSIAILPMSQEFNWNSATVGLIQSSFFWGYLLTQILGGILADKIGGKRVLG  269

Query  1450  fgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLA  1271
             FGV+WWS+ATILTPIAAK+ LPFL I+RAFMGIGEGVAMPAMNN+LSKW+PVSERSR+L+
Sbjct  270   FGVIWWSVATILTPIAAKISLPFLLIMRAFMGIGEGVAMPAMNNILSKWIPVSERSRALS  329

Query  1270  MVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellp  1091
             +VY+GMYLGSVTGLA SP+LI KF WPSVFYSFGSLG++W  +WL+KA+S+P +DPEL  
Sbjct  330   LVYTGMYLGSVTGLAVSPILIEKFKWPSVFYSFGSLGSIWLALWLNKAYSTPKEDPELSA  389

Query  1090  eekkLIL--RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQV  917
             EEK LI+    + SKEPVK IPWKLILSK PVWALIV HFCHNWGTFILLTWMPTYY+QV
Sbjct  390   EEKGLIMGGTGNTSKEPVKVIPWKLILSKTPVWALIVCHFCHNWGTFILLTWMPTYYNQV  449



>ref|XP_002952950.1| hypothetical protein VOLCADRAFT_105756 [Volvox carteri f. nagariensis]
 gb|EFJ45872.1| hypothetical protein VOLCADRAFT_105756 [Volvox carteri f. nagariensis]
Length=644

 Score =   357 bits (916),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 217/441 (49%), Positives = 265/441 (60%), Gaps = 92/441 (21%)
 Frame = -2

Query  1678  GFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQI  1499
             G+ KRW +V LCF AF+LCN+DRVNMSIAILPMA ++ WS TT+GL+QSSFFWGYLLTQI
Sbjct  166   GWRKRWTVVGLCFVAFVLCNLDRVNMSIAILPMAEQFGWSTTTMGLVQSSFFWGYLLTQI  225

Query  1498  AGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNN  1319
              GG+ AD  GGK VLGFGV+WWS+AT  TP AA+ GLP L + R  MGIGEGVA+PAMN+
Sbjct  226   LGGVLADRWGGKSVLGFGVLWWSLATAATPAAAQAGLPALLLARCMMGIGEGVALPAMNS  285

Query  1318  LLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVW  1139
             +L KWVP  ERSRSLA+VYSGM+ GSV GL  SP ++  FGWP+VF+SFGSLG +W+ +W
Sbjct  286   MLVKWVPAEERSRSLALVYSGMFTGSVLGLGASPQVLAAFGWPAVFWSFGSLGVLWYFIW  345

Query  1138  LSKAHSSplddpellpeekkLILRNSVSKEPVK---------------------------  1040
                  S+P DD      E   +  N++S E                              
Sbjct  346   QGSVTSAPSDDASTNLTELATMDSNTLSPENGSSTTAATAAAAAAGGSAASVVVPEGGQA  405

Query  1039  --------SIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMF  884
                      +PW L+LS+  VWALI+ HFCHNWG FILLTWMP YY+QVL  NL +SG+ 
Sbjct  406   GFDSSSFGGVPWSLLLSRKEVWALILCHFCHNWGLFILLTWMPAYYNQVLGLNLMQSGVL  465

Query  883   AVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMA  704
             +VLPW+ MA  A   GW AD+LV +G S+TVVRK                          
Sbjct  466   SVLPWVAMAVMANVAGWAADALVARGTSITVVRK--------------------------  499

Query  703   VLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ---  533
                                    DI PRY+GVL+GLSNTAGVLAGV G+  TG++LQ   
Sbjct  500   -----------------------DIGPRYAGVLLGLSNTAGVLAGVLGSLVTGWLLQPGG  536

Query  532   -----HGSWDDVFKVSVGLYL  485
                   G W  V+ V+V LYL
Sbjct  537   VGDAAVGGWSQVWAVAVVLYL  557



>ref|XP_008338054.1| PREDICTED: probable anion transporter 2, chloroplastic [Malus 
domestica]
Length=388

 Score =   340 bits (871),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -2

Query  1036  IPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMA  857
             IPWKLILSKPPVW LIV HFCHNWGTFILLTWMPTYY+QVLK NLTESG+  VLPWLTMA
Sbjct  130   IPWKLILSKPPVWTLIVCHFCHNWGTFILLTWMPTYYNQVLKSNLTESGLLCVLPWLTMA  189

Query  856   FSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQG  677
               A  GGWIA++LV KG SVT VRKIMQ+IGFL PAFFLT +S V +P M VLC+ CSQG
Sbjct  190   IFANIGGWIANALVSKGFSVTTVRKIMQSIGFLRPAFFLTLMSRVKTPVMGVLCIACSQG  249

Query  676   SDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSV  497
             SDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGT ATGYILQ G WDDVFKVSV
Sbjct  250   SDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTDATGYILQRGFWDDVFKVSV  309

Query  496   GLYLVGTVVWNLFSTGEKILD  434
              LY++GT++WNLFSTGEKI+D
Sbjct  310   VLYIMGTLIWNLFSTGEKIID  330



>ref|XP_002961092.1| hypothetical protein SELMODRAFT_70488, partial [Selaginella moellendorffii]
 gb|EFJ38631.1| hypothetical protein SELMODRAFT_70488, partial [Selaginella moellendorffii]
Length=420

 Score =   335 bits (859),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 266/403 (66%), Gaps = 6/403 (1%)
 Frame = -2

Query  1627  LCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgf  1448
             LCN  RV MS+AI+P+++ ++WS    G+IQSSF WGYLL+ I GG  AD  GGK V+G+
Sbjct  19    LCNAVRVIMSVAIVPLSATHNWSSGFAGIIQSSFLWGYLLSPIPGGALADRFGGKSVMGW  78

Query  1447  gvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAM  1268
             GV +WSIAT++TP AA   L  L  VR FMG+ EGVAMP+MNN++S+W P SER++++A+
Sbjct  79    GVFFWSIATLITPWAASRSLGLLLAVRVFMGLAEGVAMPSMNNMVSRWFPSSERAKAVAI  138

Query  1267  VYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpe  1088
                G +LG+V+GL  +P+L+ +FG    FY+FG++G  W ++W     S    +   +  
Sbjct  139   AMGGFHLGNVSGLLLTPILMSRFGIDGPFYAFGTVGLAWLSLWYMHI-SKDPQNHGTITR  197

Query  1087  ekkLILRNSVSKEPVKSI----PWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQ  920
              + L ++N   K  V +     P++L+LSK P WA+I ++  +NWG FI+LTWMP Y+++
Sbjct  198   NELLFIQNGTDKRKVTARVAMPPFRLLLSKLPSWAIIAANAMNNWGYFIILTWMPVYFNR  257

Query  919   VLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFL  740
             VL  NL ++  F+ +PW TMA S Y  G  +D ++  G+ V  VRKIMQ+IGFLGPA  L
Sbjct  258   VLGVNLKQAAWFSAVPWATMAASGYFAGAWSDLMISSGMRVLTVRKIMQSIGFLGPAVAL  317

Query  739   TQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFG  560
               L+    PA+A   +T +    AFSQ+G   N+Q+IAP Y+GVL GLSNTAG  A +  
Sbjct  318   IGLNSTRHPAIASTWLTIAVALSAFSQAGYLVNYQEIAPSYAGVLHGLSNTAGTFAAIVS  377

Query  559   TAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             T  TGY++Q  GS+  V  ++ G+Y+V T+ WN  +TGEKI D
Sbjct  378   TVGTGYLVQWLGSFQAVLLLTSGMYIVSTLFWNSCATGEKIFD  420



>ref|XP_002966917.1| hypothetical protein SELMODRAFT_144419 [Selaginella moellendorffii]
 gb|EFJ31516.1| hypothetical protein SELMODRAFT_144419 [Selaginella moellendorffii]
Length=409

 Score =   333 bits (853),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 185/403 (46%), Positives = 265/403 (66%), Gaps = 6/403 (1%)
 Frame = -2

Query  1627  LCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgf  1448
             LCN  RV MS+AI+P+++ ++WS    G+IQSSF WGYLL+ I GG  AD  GGK V+G+
Sbjct  8     LCNAVRVIMSVAIVPLSATHNWSSGFAGIIQSSFLWGYLLSPIPGGALADRFGGKSVMGW  67

Query  1447  gvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAM  1268
             GV +WSIAT++TP AA   L  L  VR FMG+ EGVAMP+MNN++S+W P SER++++A+
Sbjct  68    GVFFWSIATLITPWAASRSLGLLLAVRVFMGLAEGVAMPSMNNMVSRWFPSSERAKAVAI  127

Query  1267  VYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpe  1088
                G +LG+V+GL  +P+L+ +FG    FY+FG++G  W ++W     S    +   +  
Sbjct  128   AMGGFHLGNVSGLLLTPILMSRFGIDGPFYAFGTVGLAWLSLWYMHI-SKDPQNHGTITR  186

Query  1087  ekkLILRNSVSKEPVKSI----PWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQ  920
              + L ++N   K  V +     P++L+LSK P WA+I ++  +NWG FI+LTWMP Y+++
Sbjct  187   NELLFIQNGTDKRKVTARVGMPPFRLLLSKLPSWAIIAANAMNNWGYFIILTWMPVYFNR  246

Query  919   VLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFL  740
             VL  NL ++  F+ +PW TMA S Y  G  +D ++  G+    VRKIMQ+IGFLGPA  L
Sbjct  247   VLGVNLKQAAWFSAVPWATMAASGYFAGAWSDLMISSGMRALTVRKIMQSIGFLGPAVAL  306

Query  739   TQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFG  560
               L+    PA+A   +T +    AFSQ+G   N+Q+IAP Y+GVL GLSNTAG  A +  
Sbjct  307   IGLNSTRHPAIASTWLTIAVALSAFSQAGYLVNYQEIAPSYAGVLHGLSNTAGTFAAIVS  366

Query  559   TAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             T  TGY++Q  GS+  V  ++ G+Y+V T+ WN  +TGEKI D
Sbjct  367   TVGTGYLVQWLGSFQAVLLLTSGMYIVSTLFWNSCATGEKIFD  409



>ref|XP_004137735.1| PREDICTED: probable anion transporter 3, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004156595.1| PREDICTED: probable anion transporter 3, chloroplastic-like [Cucumis 
sativus]
 gb|KGN58795.1| hypothetical protein Csa_3G732520 [Cucumis sativus]
Length=518

 Score =   331 bits (848),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/459 (40%), Positives = 277/459 (60%), Gaps = 5/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLL  1625
             R  A V+    GI  S+P   +   +  +D      G  ++ G P+R+ +V L      L
Sbjct  62    RGSAVVRCTAEGIERSIPFGRRSIGSTAEDRAAAAAG--VAFGLPERFKVVALTAFVMCL  119

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CN DRV MS+AI+P+A++Y WS + +G++QSSF WGY+ + + GG   D  GGK V+ +G
Sbjct  120   CNADRVVMSVAIVPLAAKYGWSSSFLGIVQSSFLWGYIFSSVVGGALVDRYGGKRVMAWG  179

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             V  WS+AT+LTP+AA      L  +RAF G+ EGVA+P+M+ LLS+W P  ER+ ++ M 
Sbjct  180   VALWSLATLLTPLAANHSTTSLLAIRAFFGLAEGVALPSMSTLLSRWFPGHERASAVGMS  239

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
              +G +LG+V GL  +P+++   G    F  F SLG VW T W+    ++P D   +   E
Sbjct  240   MAGFHLGNVIGLLLTPIMLSSIGVTGPFLLFSSLGLVWLTSWIPGVTNNPRDSQNISTSE  299

Query  1084  kkLILRNSV--SKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
              +LI    V  S+     +P   +LSK P WA+I ++  +NWG F+LL+WMP Y+  V  
Sbjct  300   LRLIEAGKVDSSRHNATHLPLSRLLSKLPTWAIIFANMTNNWGYFVLLSWMPVYFKTVFN  359

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
              NL ++  F+ +PW TMA S Y  G ++D+L++ G  VT+VRKIMQ+IGF+GP   L  L
Sbjct  360   VNLKQAAWFSAIPWGTMAVSGYFAGTMSDALIKSGYPVTLVRKIMQSIGFIGPGLGLLCL  419

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             +   +P +A + MT +    +FSQ+G   N QDIAP+++G L G+SN+AG LA +  T  
Sbjct  420   NFATTPTVAAVLMTVALSLSSFSQAGFLLNMQDIAPQHAGFLHGISNSAGTLAAIVSTIG  479

Query  550   TGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             TGY ++  GS+     V+  +Y +  + WNLF+TGE++ 
Sbjct  480   TGYFVEWLGSFQAFLTVTAMVYFMAAIFWNLFATGEQVF  518



>ref|XP_004514542.1| PREDICTED: probable anion transporter 3, chloroplastic-like [Cicer 
arietinum]
Length=514

 Score =   330 bits (847),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 196/517 (38%), Positives = 291/517 (56%), Gaps = 27/517 (5%)
 Frame = -2

Query  1966  SYYNLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLP-GRGFRRGLIRRTSWRAWAD  1790
             ++Y   P          P  SF S  H +   +F S  L   RG R  L R+   R    
Sbjct  18    TFYKRYPCYRGHSSFELPHLSFVS--HRNVKLDFESKKLEWKRGRREELERK---RTKLS  72

Query  1789  VKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDR  1610
             VK    GI   +             ++ ED    +    P+R+ +V L      LCN DR
Sbjct  73    VKCTAEGIDGGM-------------IVGEDGINNVISNIPERYKVVCLVACVMCLCNADR  119

Query  1609  VNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWS  1430
             V MS+A++P+A+++ WS + +G++QSSF WGY+ + + GG   D  GGK V+  GV+ WS
Sbjct  120   VVMSVAVVPLAAKHGWSSSFLGIVQSSFLWGYIFSSVIGGALVDRYGGKRVMACGVLLWS  179

Query  1429  IATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMY  1250
             +AT+LTP+AA      L  +RAF G+ EGVA+P+M+ LLS+W P +ER+ +  +  +G +
Sbjct  180   LATLLTPLAANHSTIALLAIRAFFGLAEGVALPSMSTLLSRWFPNNERATAFGISMAGFH  239

Query  1249  LGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKA-----HSSplddpellpee  1085
             +G+V GL  +P+++   G    F  F  LG +W   W  +       S+ +   EL   +
Sbjct  240   IGNVIGLLITPIMLSSIGIYGPFILFSFLGLLWVMAWTHQVTDDPLESNFISRSELRLIQ  299

Query  1084  kkLILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
                IL  S  K   K  P  LILSK P WA+I ++  +NWG F+LL+WMP Y+  V   N
Sbjct  300   AGKIL--STKKSNNKFPPLGLILSKLPSWAIIFANATNNWGYFVLLSWMPVYFKSVYNVN  357

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             L ++  F+ +PW TMAFS Y  G  +D L+  G   T VRK+MQTIGF+GPA  L  L++
Sbjct  358   LKQAAWFSAVPWATMAFSGYLAGTASDFLINAGYPTTFVRKLMQTIGFIGPAVTLLCLNY  417

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
              ++P +A   +T +    +FSQ+G   N QDIAP+Y+G+L G++N+AG LA +  T  TG
Sbjct  418   ANTPTIAATLLTAALSLSSFSQAGFMLNIQDIAPQYAGILHGIANSAGTLAAIISTIGTG  477

Query  544   YILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             Y +Q  GS+     ++ GLY+V T+ WNLF+TG+++L
Sbjct  478   YFVQWLGSFQAFLTITSGLYVVTTIFWNLFATGDQVL  514



>ref|XP_008442468.1| PREDICTED: probable anion transporter 3, chloroplastic [Cucumis 
melo]
Length=518

 Score =   326 bits (835),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 182/459 (40%), Positives = 273/459 (59%), Gaps = 5/459 (1%)
 Frame = -2

Query  1804  RAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLL  1625
             R  A V+    GI  S+P   +   +  +D      G     G P+R+ +V L      L
Sbjct  62    RGSAVVRCTAEGIERSIPFGRRSIGSTAEDRAAAVGGVVF--GLPERFKVVALTAFVMCL  119

Query  1624  CNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfg  1445
             CN DRV MS+AI+P+A++Y WS + +G++QSSF WGY+ + + GG   D  GGK V+ +G
Sbjct  120   CNADRVVMSVAIVPLAAKYGWSSSFLGIVQSSFLWGYIFSSVVGGALVDRYGGKRVMAWG  179

Query  1444  vVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMV  1265
             V  WS+AT+LTP+AA      L  +RAF G+ EGVA+P+M+ LLS+W P  ER+ ++ M 
Sbjct  180   VALWSLATLLTPMAANHSTTSLLAIRAFFGLAEGVALPSMSTLLSRWFPGHERASAVGMS  239

Query  1264  YSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpee  1085
              +G +LG+V GL  +P+++   G    F  F SLG VW   W+    ++P D   +   E
Sbjct  240   MAGFHLGNVVGLLLTPIMLSSIGVTGPFLLFSSLGLVWLMSWIPGVANNPRDSQNISTSE  299

Query  1084  kkLILRNSV--SKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLK  911
              +LI    V  ++     +P   +LSK P WA+I ++  +NWG F+LL+WMP Y+  V  
Sbjct  300   LRLIEAGKVDSTRHNATHLPLSRLLSKLPTWAIIFANMTNNWGYFVLLSWMPVYFKTVFN  359

Query  910   FNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQL  731
              NL ++  F+ +PW TMA S Y  G  +D+L++ G  VT+VRKIMQ+IGF+GP   L  L
Sbjct  360   VNLKQAAWFSAIPWGTMAVSGYFAGTTSDALIKSGYPVTLVRKIMQSIGFIGPGLGLLCL  419

Query  730   SHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAA  551
             +   +P +A + MT +    +FSQ+G   N QDIAP+++G L G+SN+AG LA +  T  
Sbjct  420   NFATTPTVAAVLMTVALSLSSFSQAGFLLNMQDIAPQHAGFLHGISNSAGTLAAIVSTIG  479

Query  550   TGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             TGY ++  GS+     V+  +Y +  + WNLF+TGE++ 
Sbjct  480   TGYFVEWLGSFQAFLTVTAMVYFMAAIFWNLFATGEQVF  518



>ref|XP_009602210.1| PREDICTED: probable anion transporter 3, chloroplastic [Nicotiana 
tomentosiformis]
Length=514

 Score =   325 bits (832),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 194/530 (37%), Positives = 292/530 (55%), Gaps = 43/530 (8%)
 Frame = -2

Query  1957  NLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLI--RRTSWRAWADVK  1784
              L  K H  P +++P  S+ S +H                   GLI  R+T       ++
Sbjct  5     KLGNKFH--PHSSYPNSSYFSNTHL------------------GLIKFRKTHIGFEPKIQ  44

Query  1783  SKTYGISDSVPESLK---FEDALNDDVLTEDDGETISGGF--------------PKRWVI  1655
              K   +S S  E LK   F +    D   +   E I  G                +R+ +
Sbjct  45    KKWTSLSLSGGERLKEEIFLEKKQRDFSVKCTAEGIERGLLVGGRSDEEREFVVAERFKV  104

Query  1654  VLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADT  1475
             V L      LCN DRV MS+AI+P+A++Y WS + +G++QSSF WGY+ + + GG   D 
Sbjct  105   VALMACVMCLCNADRVVMSVAIVPLAAKYGWSSSFLGIVQSSFLWGYIFSSVIGGALVDK  164

Query  1474  vggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPV  1295
              GGK V+ +G   WS+AT+LTP AA      L  +RAF G+ EGVA+P+MN LLS+W P 
Sbjct  165   YGGKKVIAWGAALWSLATLLTPWAANHSTISLLAIRAFFGLAEGVALPSMNTLLSRWFPC  224

Query  1294  SERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSp  1115
              ER+ ++ +   G +LG+V GL  +P+ +   G    F  F SLG +W T W+++  + P
Sbjct  225   HERATAVGISMGGFHLGNVVGLVLTPLFMSSVGISGPFILFSSLGLLWLTTWINRVTNDP  284

Query  1114  lddpellpeekkLILRNSVSKEPVKS---IPWKLILSKPPVWALIVSHFCHNWGTFILLT  944
              +   +   E +LI        P+K     P +L+LSK P WA+I ++  +NWG F+LL+
Sbjct  285   QESNSITKAELRLIQAGKSDSPPLKKGELPPLRLLLSKMPTWAIIFANITNNWGYFVLLS  344

Query  943   WMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIG  764
             WMP Y+  V   NL ++  F+ +PW TMAFS Y  G  +D L++ G S+T VRK+MQ+IG
Sbjct  345   WMPVYFKTVFNVNLKQAAWFSAVPWGTMAFSGYVAGAASDFLIKAGYSLTFVRKVMQSIG  404

Query  763   FLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTA  584
             F+GP   L  L++  +P +A + +T +    +FSQ+G   N QDIAP+Y+G L G+SN+A
Sbjct  405   FIGPGVSLLCLNYAKTPEVAAVMITIALSFSSFSQAGFLLNMQDIAPQYAGFLHGISNSA  464

Query  583   GVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             G LA +  T  TG+ +Q  GS+     ++  LY V  + WN+++TGE++ 
Sbjct  465   GTLAAIISTIGTGFFVQWLGSFQAFLSLTACLYFVTAIFWNVYATGERVF  514



>ref|NP_181341.2| phosphate transporter 4;2 [Arabidopsis thaliana]
 sp|Q7XJR2.2|ANTR3_ARATH RecName: Full=Probable anion transporter 3, chloroplastic; AltName: 
Full=Phosphate transporter PHT4;2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEC09485.1| phosphate transporter 4;2 [Arabidopsis thaliana]
Length=512

 Score =   324 bits (830),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 203/517 (39%), Positives = 293/517 (57%), Gaps = 22/517 (4%)
 Frame = -2

Query  1957  NLPPKLHCSPEATFPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRTSWRAWADVKSK  1778
             +L P  H S  ++FP+    +R      F F S        R+  IR  + R  ++   K
Sbjct  6     SLKPLHHSSCSSSFPRNPIVNRKALLG-FVFDSA-------RKNQIRCENLRYSSESDGK  57

Query  1777  TYGIS----DSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDR  1610
                 +    +  PE    E  L     +E   E +    P+R  +V+L      LCN DR
Sbjct  58    RRNAAAKKRNQSPERCAAEGVLTGGGGSEAIAE-VRTMMPERIKVVILTACMMCLCNADR  116

Query  1609  VNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWS  1430
             V MS+A++P+A +  WS + +G++QSSF WGY+ + + GG   D  GGK VL +GV  WS
Sbjct  117   VVMSVAVVPLADKLGWSSSFLGVVQSSFLWGYIFSSVIGGALVDRYGGKRVLAWGVALWS  176

Query  1429  IATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMY  1250
             +AT+LTP AA      L  VRAF G+ EGVAMP+M  LLS+W P+ ER+ ++ +  +G +
Sbjct  177   LATLLTPWAAAHSTLALLCVRAFFGLAEGVAMPSMTTLLSRWFPMDERASAVGISMAGFH  236

Query  1249  LGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLIL  1070
             +G+V GL  +P+++   G    F  F SLG +W + W S   ++P D P +   E +LI 
Sbjct  237   MGNVVGLLLTPLMLSSIGISGPFILFASLGLLWVSTWSSGVTNNPQDSPFITRSELRLIQ  296

Query  1069  R------NSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKF  908
                    +++S +P  S+  +L+LSK P WA+I ++  +NWG F+LL+WMP Y+  V   
Sbjct  297   AGKPVQPSTISPKPNPSL--RLLLSKLPTWAIIFANVTNNWGYFVLLSWMPVYFQTVFNV  354

Query  907   NLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLS  728
             NL ++  F+ LPW TMA S Y  G  +D L+R G SVT VRKIMQ+IGF+GP   L  L+
Sbjct  355   NLKQAAWFSALPWATMAISGYYAGAASDFLIRTGHSVTSVRKIMQSIGFMGPGLSLLCLN  414

Query  727   HVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAAT  548
                SP+ A + MT +    +FSQ+G   N QDIAP+Y+G L G+SN AG LA +  T  T
Sbjct  415   FAKSPSCAAVFMTIALSLSSFSQAGFLLNMQDIAPQYAGFLHGISNCAGTLAAIVSTIGT  474

Query  547   GYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
             GY +Q  GS+     V+  LY   TV W LF+TGE++
Sbjct  475   GYFVQWLGSFQAFLTVTAFLYFATTVFWLLFATGERV  511



>emb|CDP06516.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   320 bits (821),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 178/413 (43%), Positives = 260/413 (63%), Gaps = 3/413 (1%)
 Frame = -2

Query  1669  KRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGG  1490
             +R+ +V L  S   LCN DRV MS+AI+P+A+++ WS + +G++QSSF WGY+ + + GG
Sbjct  4     ERFKVVALVASIMCLCNADRVVMSVAIVPLAAQHGWSSSFLGIVQSSFLWGYIFSSVIGG  63

Query  1489  IWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLS  1310
                D  GGK V+ +G   WS+AT+LTP AA      L  VRAF G+ EGVA+P+MN LLS
Sbjct  64    ALVDKYGGKRVIAWGGALWSLATLLTPWAANHSTASLLAVRAFFGLAEGVALPSMNTLLS  123

Query  1309  KWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             +W P  ER+ ++ +   G +LG+V GL  +P+++   G    F  F SLG +W T W+ +
Sbjct  124   RWFPSHERATAVGISMGGFHLGNVVGLVLTPLVMSSVGISGPFILFSSLGLLWLTTWVYR  183

Query  1129  AHSSplddpellpeekkLIL--RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTF  956
               + P D   +   E +LI   ++  S    K  P  LILSK P WA+I+++  +NWG F
Sbjct  184   VTNDPQDSSTIRKSELRLIQAGKSDSSATKGKLPPLGLILSKLPAWAIILANVTNNWGYF  243

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             +LL+WMP Y+  V   NL ++  F+ +PW TMA S Y  G I+D L++ G S+T+VRKIM
Sbjct  244   VLLSWMPVYFKTVFGVNLKQAAWFSAVPWGTMAISGYIAGAISDYLIKAGYSLTLVRKIM  303

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             Q+IGF+GP   L  L+   +P +A + +T +    +FSQ+G   N QDIAP+Y+G L G+
Sbjct  304   QSIGFIGPGVALLCLNFAKTPEVAAVFITVALSLSSFSQAGFLLNMQDIAPQYAGFLHGI  363

Query  595   SNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
             SN+AG LA +  T  TG+ +Q  GS+     V+  LY V T+ WNL++TGEK+
Sbjct  364   SNSAGTLAAIISTIGTGFFVQWLGSFQAFLTVTACLYFVTTIFWNLYATGEKV  416



>ref|XP_010101818.1| putative anion transporter 3 [Morus notabilis]
 gb|EXB89955.1| putative anion transporter 3 [Morus notabilis]
Length=519

 Score =   323 bits (828),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 174/416 (42%), Positives = 259/416 (62%), Gaps = 5/416 (1%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             P+R  +V +      LCN DRV MS+A++P+A++  WS + +G++QSSF WGY+ + + G
Sbjct  103   PERMKVVAMVACVMCLCNADRVVMSVAVVPLAAKLGWSSSFLGIVQSSFLWGYIFSSVIG  162

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G  AD  GGK V+ +GV +WS+AT+LTP AA      L  VRAF G+ EGVAMP M+ LL
Sbjct  163   GALADRYGGKRVMAWGVAFWSLATLLTPWAANHSTASLLAVRAFFGLAEGVAMPCMSTLL  222

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             S+W P  ER+ ++ +  +G +LG+V GL  +P+++   G    F  F S+G +W T W  
Sbjct  223   SRWFPSQERASAIGISMAGFHLGNVVGLLLTPIMLSSMGISGPFTLFSSIGMLWLTTWAF  282

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIPWK---LILSKPPVWALIVSHFCHNWG  962
             K  S+   +   + + +  +++   +  PVKS  +     +LSK P WA+I ++  +NWG
Sbjct  283   KV-SNDPRESRFISQSELRLIQAGKTDSPVKSNKFPTLWFLLSKLPTWAIIFANITNNWG  341

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
              F+LL+WMP Y+  V   NL ++  F+ +PW TMA S Y  G  +D L+ KG S+T+VRK
Sbjct  342   YFVLLSWMPVYFKTVFNVNLKQAAWFSAVPWGTMAVSGYIAGATSDYLISKGYSLTLVRK  401

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQ+IGF+GP   L  L++  +P +A + MT +    +FSQ+G   N QDIAP+Y+G L 
Sbjct  402   IMQSIGFIGPGVALLCLNYAKTPVVAAVLMTIALSLSSFSQAGFLLNMQDIAPQYAGYLH  461

Query  601   GLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             G+SN+AG LA +  T  TGY +Q  GS+     V+  LY V  + WNLF+TGE++ 
Sbjct  462   GISNSAGTLAAIVSTVGTGYFVQWLGSFQAFLSVTAVLYFVTAIFWNLFATGERVF  517



>gb|KEH23123.1| anion transporter 4, putative [Medicago truncatula]
Length=506

 Score =   323 bits (827),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 187/469 (40%), Positives = 281/469 (60%), Gaps = 18/469 (4%)
 Frame = -2

Query  1834  RRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVI  1655
             +RG  RR   R W+ VK    GI   +    K          + ++G  +S   P+R+ +
Sbjct  53    KRG--RREELRKWS-VKCTAEGIDGGMFVGRK----------SRENGIVVS--IPERYKV  97

Query  1654  VLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADT  1475
             VLL      LCN DRV MS+A++P+A+++ WS + +G++QSSF WGY+ + + GG   D 
Sbjct  98    VLLLACVMCLCNADRVVMSVAVVPLAAKHGWSSSFLGIVQSSFLWGYIFSSVIGGALVDR  157

Query  1474  vggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPV  1295
              GGK V+ +GV+ WS+AT+LTP+AA      L  +RAF G+ EGVA+P+M+ LLS+W P 
Sbjct  158   YGGKRVMAWGVLLWSLATLLTPLAANHSTIALLAIRAFFGLAEGVALPSMSTLLSRWFPN  217

Query  1294  SERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSp  1115
             +ER+ +  +  +G ++G+V GL  +P+++   G    F  F  +G +W   W  +    P
Sbjct  218   NERATAFGISMAGFHIGNVIGLLITPIMLSTIGIFGPFILFSFIGLLWAMTWSYQVTDDP  277

Query  1114  lddpellpeekkLIL--RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTW  941
              +   +   E +LI   + +  K+  K  P  LILSK P WA+I ++  +NWG F+LL+W
Sbjct  278   SESNFINRSELRLIQAGKTASPKKSNKLPPIGLILSKLPSWAIIFANATNNWGYFVLLSW  337

Query  940   MPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGF  761
             MP Y+  V   NL ++  F+ +PW TMA S Y  G  +D L+  G   T VRKIMQTIGF
Sbjct  338   MPVYFKSVYNVNLKQAAWFSAVPWATMAVSGYLAGTASDFLINAGYPTTFVRKIMQTIGF  397

Query  760   LGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAG  581
             +GPA  L  L++ ++P MA   +T +    +FSQ+G   N QDIAP+Y+G+L G+SN+AG
Sbjct  398   MGPAVTLICLNYANTPTMAATLLTAALSLSSFSQAGFMLNIQDIAPQYAGILHGISNSAG  457

Query  580   VLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
              LA +  T  TGY +Q  GS+     ++  LY+V T+ WNLF+TGE++L
Sbjct  458   TLAAIISTIGTGYFVQWLGSFQAFLTITACLYVVTTIFWNLFATGEQVL  506



>gb|AES64609.2| anion transporter 4 [Medicago truncatula]
Length=262

 Score =   313 bits (803),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  1072  LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTES  893
             L +S+SK PV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTES
Sbjct  59    LVHSISKTPVSDIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTES  118

Query  892   GMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSP  713
             G+  VLPWLTMA  A  GGWIAD+LV KGVS+T VRKIMQ+IGFLGPAFFLTQLSHV +P
Sbjct  119   GLLCVLPWLTMAVFANIGGWIADTLVSKGVSITTVRKIMQSIGFLGPAFFLTQLSHVKTP  178

Query  712   AMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             AMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  179   AMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  234



>ref|XP_003594358.1| Vesicular glutamate transporter 2.1 [Medicago truncatula]
Length=258

 Score =   313 bits (801),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  1072  LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTES  893
             L +S+SK PV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTES
Sbjct  55    LVHSISKTPVSDIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTES  114

Query  892   GMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSP  713
             G+  VLPWLTMA  A  GGWIAD+LV KGVS+T VRKIMQ+IGFLGPAFFLTQLSHV +P
Sbjct  115   GLLCVLPWLTMAVFANIGGWIADTLVSKGVSITTVRKIMQSIGFLGPAFFLTQLSHVKTP  174

Query  712   AMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             AMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  175   AMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  230



>gb|ABN08856.1| Putative transporter C20orf59 homolog, related [Medicago truncatula]
Length=210

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  1072  LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTES  893
             L +S+SK PV  IPWKLILSK PVWALI+SHFCHNWGTFILLTWMPTYY+QVLKFNLTES
Sbjct  7     LVHSISKTPVSDIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTES  66

Query  892   GMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSP  713
             G+  VLPWLTMA  A  GGWIAD+LV KGVS+T VRKIMQ+IGFLGPAFFLTQLSHV +P
Sbjct  67    GLLCVLPWLTMAVFANIGGWIADTLVSKGVSITTVRKIMQSIGFLGPAFFLTQLSHVKTP  126

Query  712   AMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
             AMAVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTAGVLAGVFGTAATG
Sbjct  127   AMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATG  182



>ref|XP_009803867.1| PREDICTED: probable anion transporter 3, chloroplastic [Nicotiana 
sylvestris]
Length=514

 Score =   321 bits (823),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 170/415 (41%), Positives = 257/415 (62%), Gaps = 4/415 (1%)
 Frame = -2

Query  1669  KRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGG  1490
             +R+ +V L      LCN DRV MS+AI+P+A++Y WS + +G++QSSF WGY+ + + GG
Sbjct  100   ERFKVVALMACVMCLCNADRVVMSVAIVPLAAKYGWSSSFLGIVQSSFLWGYIFSSVIGG  159

Query  1489  IWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLS  1310
                D  GGK V+ +G   WS+AT+LTP AA      L  +RAF G+ EGVA+P+MN LLS
Sbjct  160   ALVDKYGGKKVIAWGAALWSLATLLTPWAANHSTISLLAIRAFFGLAEGVALPSMNTLLS  219

Query  1309  KWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             +W P  ER+ ++ +   G +LG+V GL  +P+ +   G    F  F SLG +W T W+++
Sbjct  220   RWFPSHERATAVGISMGGFHLGNVVGLVLTPLFMSSVGISGPFILFSSLGLLWLTTWINR  279

Query  1129  AHSSplddpellpeekkLILRNSVSKEPVKS---IPWKLILSKPPVWALIVSHFCHNWGT  959
               + P +   +   E +LI        P+K     P +L+LSK P WA+I ++  +NWG 
Sbjct  280   VTNDPQESNSITKAELRLIQAGKSDSPPLKKGELPPLRLLLSKMPTWAIIFANVTNNWGY  339

Query  958   FILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKI  779
             F+LL+WMP Y+  V   NL ++  F+ +PW TMAFS Y  G  +D L++ G S+T VRK+
Sbjct  340   FVLLSWMPVYFKTVFNVNLKQAAWFSAVPWGTMAFSGYVAGAASDFLIKAGYSLTFVRKV  399

Query  778   MQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMG  599
             MQ+IGF+GP   L  L++  +P +A + +T +    +FSQ+G   N QDIAP+Y+G L G
Sbjct  400   MQSIGFIGPGVSLLCLNYAKTPEVAAVMITIALSFSSFSQAGFLLNMQDIAPQYAGFLHG  459

Query  598   LSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             +SN+AG LA +  T  TG+ +Q  GS+     ++  LY V  + WN+++TGE++ 
Sbjct  460   ISNSAGTLAAIISTIGTGFFVQWLGSFQAFLTLTACLYFVTAIFWNIYATGERVF  514



>ref|XP_003529140.1| PREDICTED: probable anion transporter 3, chloroplastic-like [Glycine 
max]
 gb|KHN47880.1| Putative anion transporter 3, chloroplastic [Glycine soja]
Length=504

 Score =   320 bits (821),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 260/435 (60%), Gaps = 3/435 (1%)
 Frame = -2

Query  1732  DALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPT  1553
             D ++  +      E      P+R  +V L      LCN DRV MS+AI+P+A+++ WS +
Sbjct  70    DGIDGGMFLGGRKEGAGVSIPERLKVVSLIACVMCLCNADRVVMSVAIVPLAAKHGWSNS  129

Query  1552  TVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFI  1373
              +G++QSSF WGY+ + + GG   D  GGK VL  GV  WS+ATILTP+AA      L  
Sbjct  130   FLGIVQSSFLWGYIFSSVIGGALVDRYGGKRVLACGVFMWSLATILTPLAANHSTVSLLA  189

Query  1372  VRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGW  1193
             +RAF G+ EGVA P+M+ LLS+W P +ER+ +L M  +G +LG+V GL  +P+++   G 
Sbjct  190   IRAFFGLAEGVAFPSMSTLLSRWFPTNERASALGMSMAGFHLGNVIGLLLTPIMLSTMGI  249

Query  1192  PSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLIL--RNSVSKEPVKSIPWKLI  1019
                F  F SLG +W   W  +    P +   +   E++LI   +    K+  K  P +L+
Sbjct  250   SGPFILFSSLGLLWVITWAYRVTDDPTESNFISRLEQRLIQAGKTGSPKKSNKFPPIRLL  309

Query  1018  LSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAG  839
             LSK P WA+I ++  +NWG F+LL+WMP Y+  V   NL ++  F+ +PW TMA S Y  
Sbjct  310   LSKLPSWAIIFANATNNWGYFVLLSWMPVYFKSVYNVNLKQAAWFSAVPWATMAMSGYLA  369

Query  838   GWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQ  659
             G  +D L+  G     VRK MQTIGF+GPA  L  L++ ++PA+A   MT +    +FSQ
Sbjct  370   GVASDFLINAGYPTIFVRKFMQTIGFIGPAVTLLCLNYANTPAVAATLMTIALSLSSFSQ  429

Query  658   SGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLV  482
             +G   N QDIAP+Y+G+L G+SN AG +A +  T  TGY +Q  GS+     ++  LY V
Sbjct  430   AGFMLNIQDIAPQYAGILHGISNCAGTIAAIISTIGTGYFVQWLGSFQAFLTITACLYFV  489

Query  481   GTVVWNLFSTGEKIL  437
              T+ WNLF+T E+IL
Sbjct  490   TTIFWNLFATSEQIL  504



>ref|XP_007140393.1| hypothetical protein PHAVU_008G108000g [Phaseolus vulgaris]
 gb|ESW12387.1| hypothetical protein PHAVU_008G108000g [Phaseolus vulgaris]
Length=504

 Score =   320 bits (821),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 177/435 (41%), Positives = 262/435 (60%), Gaps = 3/435 (1%)
 Frame = -2

Query  1732  DALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPT  1553
             D ++  +      E      P+R  +V L      LCN DRV MS+AI+P+A++Y WS +
Sbjct  70    DGIDGGMFVRGREEGTGLSIPERLKVVSLVACVMCLCNADRVVMSVAIVPLAAKYGWSNS  129

Query  1552  TVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFI  1373
              +G++QSSF WGY+ + + GG   D  GGK VL +GV  WS+AT+LTP+AA      L  
Sbjct  130   FLGIVQSSFLWGYIFSSVIGGALVDKYGGKRVLAWGVFLWSLATLLTPLAANHSTVSLLA  189

Query  1372  VRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGW  1193
             +RAF G+ EGVA P+M+ LLS+W P +ER+ +L M  +G +LG+V GL  +P+++   G 
Sbjct  190   IRAFFGLAEGVAFPSMSTLLSRWFPTNERASALGMSMAGFHLGNVVGLLLTPIMLSTTGI  249

Query  1192  PSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLIL--RNSVSKEPVKSIPWKLI  1019
                F+ F SLG +W   W  +    P +   +   E++LI   +    K+  K  P  L+
Sbjct  250   SGPFFIFSSLGLLWVMTWAYRVTDDPAESNFISRAEQRLIQAGKTGSQKKSNKFPPVHLL  309

Query  1018  LSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAG  839
             LSK P WA+I ++  +NWG F+LL+WMP Y+  V   NL ++  F+ +PW TMA S Y  
Sbjct  310   LSKLPSWAIIFANATNNWGYFVLLSWMPVYFKSVYNVNLKQAAWFSAVPWATMAMSGYIA  369

Query  838   GWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQ  659
             G  +D L+ +G     VRK MQTIGF+GPA  L  L++ ++P +A   +T +    +FSQ
Sbjct  370   GLASDFLINEGYPTIFVRKFMQTIGFIGPALTLLCLNYANTPTIAATLLTIALSLSSFSQ  429

Query  658   SGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLV  482
             +G   N QDIAP+Y+G+L G+SN AG +A +  T  TGY +Q  GS+     V+ GLY+V
Sbjct  430   AGYMLNIQDIAPQYAGILHGISNCAGTVAAIISTIGTGYFVQWLGSFQAFLTVTAGLYIV  489

Query  481   GTVVWNLFSTGEKIL  437
              T+ WNLF+  +++L
Sbjct  490   TTIFWNLFAISDQVL  504



>ref|XP_011012355.1| PREDICTED: probable anion transporter 3, chloroplastic [Populus 
euphratica]
Length=513

 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/416 (41%), Positives = 256/416 (62%), Gaps = 5/416 (1%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             P+R+ +  L      LCN DRV MS+ ++P+A+++ WS + +G++QSSF WGY+ + + G
Sbjct  99    PERFKVAALMACVMCLCNADRVVMSVTVVPLATKFGWSSSFLGIVQSSFLWGYIFSSVIG  158

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G   D  GGK V+ +GV  WS+AT+LTP AA      L  VRAF G+ EGVA+P+M+ L 
Sbjct  159   GALVDRYGGKRVMAWGVALWSLATLLTPWAANHSTVALLAVRAFFGLAEGVALPSMSTLS  218

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             S+W P  ER+ ++ +  +G +LG+V GL  +P+++   G    F  F SLG +W T W +
Sbjct  219   SRWFPSDERASAVGISMAGFHLGNVIGLLLTPIMLSTIGISGPFILFSSLGLLWLTRW-A  277

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKS---IPWKLILSKPPVWALIVSHFCHNWG  962
                +S   D   +   +  +++   +  P       P  L+LSK P WA+I ++  +NWG
Sbjct  278   NGVTSDPRDSPFVSNSELRLIQAGKTDSPASDGQFPPLGLLLSKAPSWAIIFANITNNWG  337

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
              F+LL+WMP Y++ V K NL ++  F+ +PW TMA S Y  G ++DSL++ G S+T+VRK
Sbjct  338   YFVLLSWMPVYFNTVFKVNLKQAAWFSAVPWGTMAVSGYVAGALSDSLIKAGYSLTIVRK  397

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQ+IGF+GP   L  L++  +P  A   MT +    +FSQ+G   N QDIAP+Y+G L 
Sbjct  398   IMQSIGFIGPGVSLLCLNYAKTPVTAAALMTVALSLSSFSQAGFLLNMQDIAPQYAGFLH  457

Query  601   GLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             G++N AG LA +  T  TGY +Q  GS     +V+ GLY V  + WNL++TGE++ 
Sbjct  458   GIANAAGTLAAIISTIGTGYFVQWSGSSQAFLRVTAGLYFVTAIFWNLYATGERVF  513



>ref|XP_002527859.1| Sialin, putative [Ricinus communis]
 gb|EEF34490.1| Sialin, putative [Ricinus communis]
Length=501

 Score =   319 bits (817),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 174/422 (41%), Positives = 261/422 (62%), Gaps = 3/422 (1%)
 Frame = -2

Query  1696  GETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWG  1517
             GE +    P+R+ +V L      LCN DRV MS+A++P+A++Y WS + +G++QSSF WG
Sbjct  79    GEAVRVSIPERYKVVALTACVMCLCNADRVVMSVAVVPLAAKYGWSSSFLGIVQSSFLWG  138

Query  1516  YLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVA  1337
             Y+ + + GG   D  GGK VL +GV  WS+AT+LTP AA      L  VRAF G+ EGVA
Sbjct  139   YIFSSVIGGALVDKYGGKRVLAWGVGLWSLATLLTPWAANHSTASLLAVRAFFGLAEGVA  198

Query  1336  MPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGT  1157
             +P+M+ LLS+W P +ER+ ++ +  +G +LG+V GL  +P+++   G    F  F SLG 
Sbjct  199   LPSMSTLLSRWFPTNERASAIGLSMAGFHLGNVAGLLLTPIMLSTIGIAGPFILFSSLGL  258

Query  1156  VWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSI--PWKLILSKPPVWALIVS  983
             +W + W +   S P D P +   E +LI          K    P +L+ SK P WA+I +
Sbjct  259   LWVSRWTNGVTSDPRDSPFVSKSELRLIQAGKTDSSTNKGQLPPLRLLFSKLPTWAIIFA  318

Query  982   HFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGV  803
             +  +NWG F+LL+WMP Y+  V   NL ++  F+ +PW TMA S Y  G  +D L++ G 
Sbjct  319   NVTNNWGYFVLLSWMPVYFKTVFNVNLKQAAWFSAVPWGTMAVSGYIAGAASDFLIKAGY  378

Query  802   SVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAP  623
             S+T+VRK+MQ+IGF+GP   L  L++  +P  A + +T +    +FSQ+G   N QDIAP
Sbjct  379   SLTLVRKVMQSIGFIGPGVSLLCLNYAKTPVTAAIFITAALSLSSFSQAGFLLNMQDIAP  438

Query  622   RYSGVLMGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGE  446
             +Y+G L G++N+AG LA +  T  TGY +Q  GS+     V+ GLY + T+ W +++TGE
Sbjct  439   QYAGFLHGIANSAGTLAAIVSTIGTGYFVQWLGSFQAFLTVTAGLYFITTIFWIMYATGE  498

Query  445   KI  440
             ++
Sbjct  499   RV  500



>emb|CEF99668.1| Major facilitator superfamily domain, general substrate transporter 
[Ostreococcus tauri]
Length=472

 Score =   317 bits (811),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 269/459 (59%), Gaps = 16/459 (3%)
 Frame = -2

Query  1762  DSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILP  1583
             D   +  +       D      G  + G    R+V+V L   A +LCN DRV MS+A +P
Sbjct  14    DGSRDDARTRTRTAADATDGSKGVDVGGKTGYRFVVVGLVAFALMLCNADRVIMSVASVP  73

Query  1582  MASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIA  1403
             +A+   W    VGL+QSSF WGY LT + GG  ADT GGK+VLG G+  WS+AT+ TP A
Sbjct  74    LAAANGWGERAVGLVQSSFLWGYALTPLVGGWLADTYGGKVVLGGGIAIWSLATLFTPFA  133

Query  1402  AKL-GLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLA  1226
             A    L  L + RA MG+GEGVA+P MNN++S+WVP +ERSR++A+   G   GS+ GL 
Sbjct  134   ASAESLAPLLVTRATMGLGEGVALPCMNNIISRWVPRAERSRAVAVSMGGFQSGSMIGLL  193

Query  1225  FSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILR-------  1067
              +P+L+ + G P  F  FG LG VW  +W   A + P     +  +E + I+        
Sbjct  194   AAPVLLARAGVPGPFVVFGVLGLVWAIIWQLAATTYPKQCKMVGADELRHIVDFPGGALT  253

Query  1066  --NSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTES  893
                 V +    + P+KL+LSK P WA I+++F +NWG FILL WMP Y+ QV+  NL  +
Sbjct  254   EAERVDRSTRGTPPFKLLLSKAPTWACIIANFVNNWGIFILLAWMPLYFKQVIGVNLRTA  313

Query  892   GMFAVLPWLTMAFSAYAGGWIADSLVR-KGVSVTVVRKIMQTIGFLGPAFFLTQLSHVD-  719
               F+ LPW TMA S    G +AD+L+  +G + T  RK +Q +GF+GP+  L  L+    
Sbjct  314   AWFSALPWATMAASGIVAGTLADNLINIRGWTTTRTRKFIQGVGFIGPSLCLLVLAVNGA  373

Query  718   --SPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
               + A AV  +T + G  +FSQ+G   N Q+I P+Y+GVL G++NTAG +AG+ GT ATG
Sbjct  374   NMTAARAVATLTVACGCMSFSQAGFLVNFQEIGPKYAGVLHGMANTAGSIAGMVGTYATG  433

Query  544   YILQH--GSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
              +L+   G+W  V  V+  +Y +G   W   STGE++ D
Sbjct  434   AVLEATGGNWSAVLYVTAFVYALGATTWLAMSTGERVFD  472



>ref|XP_001775235.1| predicted protein [Physcomitrella patens]
 gb|EDQ59971.1| predicted protein [Physcomitrella patens]
Length=545

 Score =   318 bits (816),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 182/455 (40%), Positives = 270/455 (59%), Gaps = 10/455 (2%)
 Frame = -2

Query  1792  DVKSKTYGISDSVPESLKFEDALNDDVLTED-DGETIS-GGFPKRWVIVLLCFSAFLLCN  1619
             DV  +   + D      K +    D  LT++  G + S    P R+ ++L    AF++CN
Sbjct  89    DVPVREIDVQDGEENGEKSQVVPEDIKLTQELQGSSKSWRSLPPRYKLILTTAFAFVICN  148

Query  1618  MDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvV  1439
             MD+VNMS+AI+PM+ E  WS TT GL+QSSFFWGY ++Q+ GG  A    G+ VL  GV+
Sbjct  149   MDKVNMSVAIIPMSHELGWSSTTAGLVQSSFFWGYCISQLPGGWLAKAFSGQRVLRAGVL  208

Query  1438  WWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYS  1259
              WS+AT + P  A++ LP L   R  +G+GEGV+  A  +L+++ +PVSERSR++A V+ 
Sbjct  209   IWSLATAIVPSTARI-LPLLLFSRFAVGLGEGVSPSAATDLIARAMPVSERSRAVATVFG  267

Query  1258  GMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekk  1079
             G+ +GSV GL  +P++I  FGW SVFY+FG LG VW+    S  +   L    +     K
Sbjct  268   GLNVGSVVGLLLAPIMIEIFGWESVFYAFGFLGVVWYG---SHLNPECLKTQSMEVSNDK  324

Query  1078  LILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLT  899
               L    +    K+IPWK       VWA+I +HFC NWG + LL+W+PTY+ Q L  +LT
Sbjct  325   SQLSAEANTSTDKNIPWKAFFKSSAVWAMIYAHFCGNWGHYTLLSWLPTYFSQELHLDLT  384

Query  898   ESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFL--TQLSH  725
              + + ++LP L           +AD  + +G  +T+VRK+ Q+IGFL PA  +    LS 
Sbjct  385   HAALVSILPPLASVAVTSVAAPLADHFISRGYDITLVRKVCQSIGFLSPAACMAFAALSP  444

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
               +P + V  +T   G  +F+ +GLY  HQDI+P+Y+ VL+G++N+ G + GV G A  G
Sbjct  445   KFNPWVDVAILTAGLGLSSFTLAGLYCTHQDISPKYASVLLGITNSIGAIPGVLGVALVG  504

Query  544   YILQH-GSWD-DVFKVSVGLYLVGTVVWNLFSTGE  446
              IL    SW+  +F  S+  YL G +VWN+F++ +
Sbjct  505   IILDRTQSWNLALFVPSIFFYLTGALVWNIFASSK  539



>ref|XP_002509245.1| major facilitator superfamily [Micromonas sp. RCC299]
 gb|ACO70503.1| major facilitator superfamily [Micromonas sp. RCC299]
Length=398

 Score =   313 bits (803),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 182/398 (46%), Positives = 247/398 (62%), Gaps = 8/398 (2%)
 Frame = -2

Query  1603  MSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIA  1424
             MS+A +P+A  + W    +GL+QSSF WGY+LT + GG+ AD  GGK VLG G++ WS+A
Sbjct  1     MSVAGVPLAQAHGWGERAIGLVQSSFLWGYMLTPLLGGVLADRYGGKAVLGGGILVWSLA  60

Query  1423  TILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLG  1244
             T+ TP+AA   LP L + RA MG+GEGVA+P MNNL ++WVP +ERSR++A    G   G
Sbjct  61    TMATPLAAATSLPALLLTRAVMGLGEGVALPCMNNLTARWVPKAERSRAVAACMGGFQSG  120

Query  1243  SVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLI---  1073
             S+ GL  +P ++   G    F  FG  G +W  VW   A + P D P +   E  LI   
Sbjct  121   SMVGLLAAPAMLAWGGVSGPFAVFGLSGVLWAVVWAFAATTYPRDSPSVSRRELALIEDG  180

Query  1072  --LRNSVSKEPV--KSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFN  905
               + +S  K+    +  P++L+LSK PVWA IV++F +NWG FILL WMP Y+ QV+   
Sbjct  181   GSVADSTGKDGFVPEPTPFRLLLSKAPVWACIVANFVNNWGYFILLAWMPLYFKQVMGLE  240

Query  904   LTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSH  725
             L  S  F+ LPW TMA S    G +ADSL+ +GVSVT VRK +Q +GF+GPA  L  L+ 
Sbjct  241   LARSSYFSALPWATMAASGVFAGTLADSLIGRGVSVTTVRKFIQGVGFIGPALMLVLLTF  300

Query  724   VDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATG  545
               +   A+  +T + G  AF+Q+G   N Q+I PRY G L G++NTAG  AG+ GT  TG
Sbjct  301   QTTANGALAVLTVAVGCTAFTQAGFLVNFQEIGPRYVGALHGMANTAGSFAGIVGTYMTG  360

Query  544   YILQH-GSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
              IL+  GSW  V  ++ G+Y  G   W  FSTGE++ D
Sbjct  361   VILESTGSWRAVLFITAGVYAFGAATWLAFSTGERVFD  398



>ref|XP_006363062.1| PREDICTED: probable anion transporter 3, chloroplastic-like [Solanum 
tuberosum]
Length=510

 Score =   317 bits (811),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/415 (41%), Positives = 254/415 (61%), Gaps = 4/415 (1%)
 Frame = -2

Query  1669  KRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGG  1490
             +R+ +V L      LCN DRV MS+AI+P+A+++ WS   +G++QSSF WGY+ + + GG
Sbjct  96    ERFKVVALMACVMCLCNADRVVMSVAIVPLAAKHGWSNAFLGIVQSSFLWGYIFSSVIGG  155

Query  1489  IWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLS  1310
                D  GGK V+ +G   WS+AT+LTP AA      L  +RAF G+ EGVA+P+MN LLS
Sbjct  156   ALVDKYGGKKVIAWGAALWSLATLLTPWAANHSTISLLAIRAFFGLAEGVALPSMNTLLS  215

Query  1309  KWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             +W P  ER+ ++ +   G +LG+V GL  +P+ +   G    F  F SLG +W T W+S+
Sbjct  216   RWFPCHERATAVGISMGGFHLGNVVGLVLTPLFMTSVGISGPFILFASLGLLWLTTWISR  275

Query  1129  AHSSplddpellpeekkLILRNSVSKEPVKS---IPWKLILSKPPVWALIVSHFCHNWGT  959
               + P +   +   E +LI         +K     P +L+LSK P WA+I ++  +NWG 
Sbjct  276   VTNDPQESNSITKAELRLIQAGKSDSSSLKKGELPPLRLLLSKMPTWAIIFANVTNNWGY  335

Query  958   FILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKI  779
             F+LL+WMP Y+  V   NL ++  F+ +PW TMA S YA G  +D L++ G S+T VRK+
Sbjct  336   FVLLSWMPVYFKTVFNVNLKQAAWFSAVPWGTMAISGYAAGAASDFLIKAGYSLTFVRKV  395

Query  778   MQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMG  599
             MQ+IGF+GP   L  L+   +P +A + +T +    AFSQ+G   N QDIAP+Y+G L G
Sbjct  396   MQSIGFIGPGVALLCLNFAKTPEVASVLITIALSFSAFSQAGFLLNMQDIAPQYAGFLHG  455

Query  598   LSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             +SN+AG LA +  T  TG+ +Q  GS+     ++  LY V  + WN+++TGE++ 
Sbjct  456   ISNSAGTLAAIISTIGTGFFVQWLGSFQAFLTLTACLYFVTAIFWNVYATGERVF  510



>ref|XP_009141716.1| PREDICTED: probable anion transporter 3, chloroplastic [Brassica 
rapa]
 emb|CDY18408.1| BnaA04g21790D [Brassica napus]
Length=515

 Score =   317 bits (812),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 180/417 (43%), Positives = 251/417 (60%), Gaps = 5/417 (1%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             P+R  +V+L      LCN DRV MS+A++P+A +  WS + +G++QSSF WGY+ + + G
Sbjct  99    PERMKVVMLTACMMCLCNADRVVMSVAVVPLAEKLGWSSSFLGVVQSSFLWGYIFSSVIG  158

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G   D  GGK VL +GV  WS AT+LTP AA      L  VRAF G+ EGVAMP+M  LL
Sbjct  159   GALVDRYGGKRVLAWGVALWSFATLLTPWAAAHSTVALLCVRAFFGLAEGVAMPSMTTLL  218

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             S+W P+ ER+ ++ +  +G ++G+V GL  +P+++   G    F  F SLG +W + W S
Sbjct  219   SRWFPMDERASAVGISMAGFHMGNVVGLLLTPLMLSSIGISGPFILFASLGLLWVSTWAS  278

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIP----WKLILSKPPVWALIVSHFCHNW  965
                ++P D P +   E + I        P  S       +L+LSK P WA+I ++  +NW
Sbjct  279   GVTNNPQDSPFITRSELRQIQAGKPVHHPTSSSKPNPSLRLLLSKLPTWAIIFANVTNNW  338

Query  964   GTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVR  785
             G F+LL+WMP Y+  V   NL ++  F+ LPW TMA S Y  G  +D L+R G SVT VR
Sbjct  339   GYFVLLSWMPVYFQTVFNVNLKQAAWFSALPWATMAVSGYFAGSASDFLIRTGHSVTSVR  398

Query  784   KIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVL  605
             KIMQ+IGF+GP   L  L++  SP+ A + MT +    +FSQ+G   N QDIAP Y+G L
Sbjct  399   KIMQSIGFMGPGLSLLCLNYAKSPSCAAILMTVALSLSSFSQAGFLLNMQDIAPEYAGFL  458

Query  604   MGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
              G+SN AG LA +  T  TGY +Q  GS+     V+  LY   TV W LF+TGE++ 
Sbjct  459   HGISNCAGTLAAIVSTIGTGYFVQWLGSFQAFLTVTAFLYFATTVFWILFATGERVF  515



>ref|XP_008239628.1| PREDICTED: probable anion transporter 3, chloroplastic [Prunus 
mume]
Length=525

 Score =   317 bits (812),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/416 (40%), Positives = 261/416 (63%), Gaps = 5/416 (1%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             P+R+ +V L      LCN DRV MS+AI+P+A++  W+ + +G++QSSF WGY+ + + G
Sbjct  111   PERFKVVALLACVMCLCNADRVVMSVAIVPLAAKNGWTSSFLGVVQSSFLWGYIFSSVIG  170

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G   D  GGK V+ +GV  WS+AT+LTP AA      L  VRAF G+ EGVA+P+M+ LL
Sbjct  171   GALVDKYGGKRVMAWGVAMWSLATLLTPWAANHSTTSLLAVRAFFGLAEGVALPSMSTLL  230

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             S+W P  ER+ ++ +  +G ++G+V GL  +P+++   G    F  F S+G +W T+W +
Sbjct  231   SRWFPTQERASAVGISMAGFHIGNVIGLLLTPVMLSSIGISGPFILFSSIGLLWLTIW-A  289

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKS---IPWKLILSKPPVWALIVSHFCHNWG  962
                ++   +   + + +  +++   S  PV S    P +L+LSK P W +I+++  +NWG
Sbjct  290   YTVTNDPRESYCISKSELRLIQAGKSDSPVNSGKLPPLRLLLSKLPTWTIILANITNNWG  349

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
              F+LL+WMP Y+  V   NL ++  F+ +PW TMA S+Y  G  +DSL++ G S+T+VRK
Sbjct  350   YFVLLSWMPVYFKTVFGVNLKQAAWFSAVPWGTMAVSSYIAGAASDSLIKAGYSLTLVRK  409

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQ+IGF+GP   L  L++ ++P  A + +T +    +FSQ+G   N QDIAP+Y+G L 
Sbjct  410   IMQSIGFIGPGVSLLCLNYANTPTDAAVLLTAALCFSSFSQAGFLLNIQDIAPQYAGFLH  469

Query  601   GLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             G+SN+AG  A +  T  TGY +Q  GS+     V+  LY    + WNLF+TGE++ 
Sbjct  470   GISNSAGTFAAIVSTIGTGYFVQWLGSFQAFLTVTAALYFATAIFWNLFATGERVF  525



>ref|XP_004302645.1| PREDICTED: probable anion transporter 3, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=522

 Score =   317 bits (812),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 192/518 (37%), Positives = 293/518 (57%), Gaps = 24/518 (5%)
 Frame = -2

Query  1966  SYYNLPPKLHCSPEAT---FPKRSFSSRSHTHTLFEFGSPFLPGRGFRRGLIRRTSWRAW  1796
             S+++  P    S  AT   F  R       T  +  FG      RG R   ++R  W   
Sbjct  21    SHFSASPSNLISARATQLGFRPRLLHQAKPTKWVEGFGYGLGRNRGSRTDRLQRKPW---  77

Query  1795  ADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS-GGFPKRWVIVLLCFSAFLLCN  1619
               VK    GI   +    +           E  GE       P+R+ +V+L      LCN
Sbjct  78    -VVKCTAEGIERGMFVGRR-----------ERGGEAKQLVRVPERFKVVVLLACVMCLCN  125

Query  1618  MDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvV  1439
              DRV MS+AI+P+A++  W+ + +G++QSSF WGY+ + + GG   D  GGK V+ +GV 
Sbjct  126   ADRVVMSVAIVPLAAQKGWTSSFLGVVQSSFLWGYIFSSVIGGALVDRYGGKRVMAWGVA  185

Query  1438  WWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYS  1259
              WS+AT+LTP AA      L  VRAF G+ EGVA+P+M+ LLS+W P  ER+ ++ +  +
Sbjct  186   MWSLATLLTPWAANHSTTSLLAVRAFFGLAEGVALPSMSTLLSRWFPTHERASAVGISMA  245

Query  1258  GMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekk  1079
             G +LG+VTGL  +P+++   G    F  F SLG +W T+W S   ++   + + + + + 
Sbjct  246   GFHLGNVTGLLLTPVMLSSMGINGPFILFSSLGLLWSTIWASTV-TNDPRESDFISKSEL  304

Query  1078  LILRNSVSKEPV---KSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKF  908
              +++   S  PV   K  P +L+LSK P W++I ++  +NWG F+LL+WMP Y+  V   
Sbjct  305   RLIQAGKSDSPVSNDKFPPLRLLLSKLPTWSIIFANITNNWGYFVLLSWMPVYFKTVFNV  364

Query  907   NLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLS  728
             NL ++  F+ +PW +MA S+   G  +D L++ G S+T+VRKIMQ+IGF+GP   L  L+
Sbjct  365   NLKQAAWFSAVPWGSMAISSCIAGTASDCLIKAGYSLTIVRKIMQSIGFIGPGVSLLCLN  424

Query  727   HVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAAT  548
             +V++P  A + +T +    +FSQ+G   N QDIAP  +G L G+SN+AG  A +  T  T
Sbjct  425   YVNTPTAAAVLLTVALCLSSFSQAGFLLNIQDIAPESAGFLHGISNSAGTFAAIVSTIGT  484

Query  547   GYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             GY +Q  GS+     V+  LY + T+ WNLF+TGE++ 
Sbjct  485   GYFVQWLGSFQAFLTVTAALYFMTTIFWNLFATGERVF  522



>ref|XP_006429293.1| hypothetical protein CICLE_v10011514mg [Citrus clementina]
 ref|XP_006480959.1| PREDICTED: probable anion transporter 3, chloroplastic-like [Citrus 
sinensis]
 gb|ESR42533.1| hypothetical protein CICLE_v10011514mg [Citrus clementina]
Length=512

 Score =   317 bits (811),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 180/424 (42%), Positives = 263/424 (62%), Gaps = 5/424 (1%)
 Frame = -2

Query  1702  DDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFF  1523
             +  ETI  G  +R+ +V L      LCN DRV MS+A++P+A+++ WS + +G++QSSF 
Sbjct  90    ESRETILVG--ERYKVVALLACVMCLCNADRVVMSVAVVPLAAKFGWSSSFLGIVQSSFL  147

Query  1522  WGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEG  1343
             WGY+ + + GG   D  GGK VL +GV  WS++T+LTP AA      L  VRAF G+ EG
Sbjct  148   WGYIFSSVIGGALVDKYGGKKVLAWGVALWSLSTLLTPWAATHSTASLLAVRAFFGLAEG  207

Query  1342  VAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSL  1163
             VAMPAM+ L S+W P  ER+ ++ +   G +LG+V GL  +P+++   G    F  F SL
Sbjct  208   VAMPAMSTLTSRWFPSHERASAIGICMGGFHLGNVVGLLLTPIMLSTIGISGPFILFSSL  267

Query  1162  GTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSIPWKL--ILSKPPVWALI  989
             G +W + W SK  + P + P +   E +LI          K  P  L  +LSK P W +I
Sbjct  268   GLLWLSTWTSKVTNDPCNSPFVSKSELRLIQAGKSDSVAKKGNPPSLQHLLSKLPSWTVI  327

Query  988   VSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRK  809
             +++  +NWG F+LL+WMP Y++ V   NL ++  F+ +PW TMA S Y  G  +DSL++ 
Sbjct  328   IANITNNWGYFVLLSWMPIYFNTVFNVNLKQAAWFSAVPWGTMAVSGYMAGKASDSLIKA  387

Query  808   GVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDI  629
             G S+T+VRKIMQ+IGF+GP   L  L++  SPA+A + +T +    +FSQ+G   N Q+I
Sbjct  388   GYSLTLVRKIMQSIGFIGPGVSLLCLNYAKSPAVAAVLITIALSLSSFSQAGYLLNIQEI  447

Query  628   APRYSGVLMGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFST  452
             AP  +G L G++N+AG LA +  T  TGY +Q  GS+     V+ GLY V T+ WNL+ST
Sbjct  448   APDCAGFLHGIANSAGTLAAIISTIGTGYFVQWLGSFQAFLTVTAGLYFVTTIFWNLYST  507

Query  451   GEKI  440
             GE++
Sbjct  508   GERV  511



>ref|XP_007208741.1| hypothetical protein PRUPE_ppa015356mg [Prunus persica]
 gb|EMJ09940.1| hypothetical protein PRUPE_ppa015356mg [Prunus persica]
Length=437

 Score =   313 bits (803),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 168/415 (40%), Positives = 260/415 (63%), Gaps = 5/415 (1%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             P+R+ +V L      LCN DRV MS+AI+P+A++  W+ + +G++QSSF WGY+ + + G
Sbjct  23    PERFKVVALLACVMCLCNADRVVMSVAIVPLAAKNGWTSSFLGVVQSSFLWGYIFSSVIG  82

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G   D  GGK V+ +GV  WS+AT+LTP AA      L  VRAF G+ EGVA+P+M+ LL
Sbjct  83    GALVDKYGGKRVMAWGVAMWSLATLLTPWAANHSTTSLLAVRAFFGLAEGVALPSMSTLL  142

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             S+W P  ER+ ++ +  +G ++G+V GL  +P+++   G    F  F S+G +W T+W +
Sbjct  143   SRWFPTQERASAVGISMAGFHIGNVIGLLLTPVMLSSIGISGPFILFSSIGLLWLTIW-A  201

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKS---IPWKLILSKPPVWALIVSHFCHNWG  962
                ++   +   + + +  +++   S  PV S    P +L+LSK P W +I+++  +NWG
Sbjct  202   YTVTNDPGESYCISKSELRLIQAGKSDSPVNSGKLPPLRLLLSKLPTWTIILANITNNWG  261

Query  961   TFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRK  782
              F+LL+WMP Y+  V   NL ++  F+ +PW TMA S+Y  G  +DSL++ G S+T VRK
Sbjct  262   YFVLLSWMPVYFKTVFGVNLKQAAWFSAVPWGTMAVSSYIAGAASDSLIKAGYSLTSVRK  321

Query  781   IMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLM  602
             IMQ+IGF+GP   L  L++ ++P  A + +T +    +FSQ+G   N QDIAP+Y+G L 
Sbjct  322   IMQSIGFIGPGVSLLCLNYANTPTDAAVLLTAALCFSSFSQAGFLLNIQDIAPQYAGFLH  381

Query  601   GLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
             G+SN+AG  A +  T  TGY +Q  GS+     V+  LY    + WNLF+TGE++
Sbjct  382   GISNSAGTFAAIVSTIGTGYFVQWLGSFQAFLTVTAALYFATAIFWNLFATGERV  436



>ref|XP_004246342.1| PREDICTED: probable anion transporter 3, chloroplastic [Solanum 
lycopersicum]
Length=511

 Score =   316 bits (809),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 170/415 (41%), Positives = 256/415 (62%), Gaps = 4/415 (1%)
 Frame = -2

Query  1669  KRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGG  1490
             +R+ +V L      LCN DRV MS+AI+P+A+++ WS   +G++QSSF WGY+ + + GG
Sbjct  97    ERFKVVALMACVMCLCNADRVVMSVAIVPLAAKHGWSSAFLGIVQSSFLWGYIFSSVIGG  156

Query  1489  IWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLS  1310
                D  GGK V+ +G   WS+AT+LTP AA      L  +RAF G+ EGVA+P+MN LLS
Sbjct  157   ALVDKYGGKKVIAWGAALWSLATLLTPWAANHSTVSLLAIRAFFGLAEGVALPSMNTLLS  216

Query  1309  KWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             +W P  ER+ ++ +   G +LG+V GL  +P+ +   G    F  F SLG +W T W+S+
Sbjct  217   RWFPCHERATAIGISMGGFHLGNVVGLVLTPLFMTSIGISGPFILFASLGLLWLTTWVSR  276

Query  1129  AHSSplddpellpeekkLIL---RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGT  959
               + P +   +   E +LI     +S S +  +  P +L+LSK P WA+I ++  +NWG 
Sbjct  277   VTNDPQESNSITKAELRLIQAGKSDSPSSKKGELPPLRLLLSKMPTWAIIFANVTNNWGY  336

Query  958   FILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKI  779
             F+LL+WMP Y+  V   NL ++  F+ +PW TMA S Y  G  +D L++ G S+T VRK+
Sbjct  337   FVLLSWMPVYFKTVFNVNLKQAAWFSAVPWGTMAISGYVAGAASDFLIKAGYSLTFVRKV  396

Query  778   MQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMG  599
             MQ+IGF+GP   L  L+   +P +A + +T +    AFSQ+G   N QDIAP+Y+G L G
Sbjct  397   MQSIGFIGPGVALLCLNFAKTPEVASVLITIALSFSAFSQAGFLLNMQDIAPQYAGFLHG  456

Query  598   LSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             +SN+AG LA +  T  TG+ +Q  GS+     ++  LY V  + WN+++TGE++ 
Sbjct  457   ISNSAGTLAAIISTIGTGFFVQWLGSFQAFLTLTACLYFVTAIFWNVYATGERVF  511



>gb|KFK36704.1| hypothetical protein AALP_AA4G158500 [Arabis alpina]
Length=495

 Score =   314 bits (805),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 178/416 (43%), Positives = 255/416 (61%), Gaps = 5/416 (1%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             P+R  +V+L      LCN DRV MS+A++P+A +  WS + +G++QSSF WGY+ + + G
Sbjct  79    PERIKVVVLTACMMCLCNADRVVMSVAVVPLAEKLVWSSSFLGVVQSSFLWGYIFSSVIG  138

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G   D  GGK VL +GV  WS+AT+LTP AA      L  VRAF G+ EGVAMP+M  LL
Sbjct  139   GALVDRYGGKRVLAWGVALWSLATLLTPWAAAHSTLALLCVRAFFGLAEGVAMPSMTTLL  198

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             S+W P  +R+ ++ +  +G ++G+V GL  +P+++   G    F  F SLG +W + W +
Sbjct  199   SRWFPTDKRASAVGISMAGFHMGNVVGLLLTPVMLSSIGISGPFILFASLGLLWVSTWST  258

Query  1132  KAHSSplddpellpeekkLILRNSVSKEPVKSIP----WKLILSKPPVWALIVSHFCHNW  965
                ++P D P +   E +LI        P  +       +L+LSK P WA+I+++  +NW
Sbjct  259   GVTNNPQDSPFITRSELRLIQAGKPVHPPTNAAKPNPSLRLLLSKMPTWAIILANVTNNW  318

Query  964   GTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVR  785
             G F+LL+WMP Y+  V   NL ++  F+ LPW TMA S Y  G  +D L+R G SVT VR
Sbjct  319   GYFVLLSWMPVYFQTVFNVNLKQAAWFSALPWATMAVSGYFAGSASDFLIRTGHSVTSVR  378

Query  784   KIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVL  605
             KIMQ+IGF+GP   L  L++  SP+ A + MT +    +FSQ+G   N QDIAP+Y+G L
Sbjct  379   KIMQSIGFMGPGLSLLCLNYAKSPSCAAVFMTIALSLSSFSQAGFLLNMQDIAPQYAGFL  438

Query  604   MGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
              G+SN AG +A +  T  TGY +Q  GS+     V+  LY   TV WNLF+TGE++
Sbjct  439   HGISNCAGTMAAIVSTIGTGYFVQWLGSFQAFLTVTAFLYFATTVFWNLFATGERV  494



>ref|WP_007236306.1| ABC transporter permease [marine gamma proteobacterium HTCC2080]
 gb|EAW39528.1| major facilitator superfamily MFS_1 [marine gamma proteobacterium 
HTCC2080]
Length=423

 Score =   312 bits (799),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 180/416 (43%), Positives = 257/416 (62%), Gaps = 3/416 (1%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             PKR  +V L F A  +C +DRVN+S+AI+PMA++  W     GL+ SSFF GY+L Q+ G
Sbjct  8     PKRVHVVGLSFLAVFICYIDRVNISVAIIPMAADLGWGMQQQGLVLSSFFIGYVLLQVVG  67

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G  AD  GGK VLG GV+ WS+ T+LTP AA LG   L + R  MG+GE V  PA+ +  
Sbjct  68    GRLADRYGGKAVLGMGVILWSLFTMLTPPAAALGFTVLILTRIAMGMGEAVTFPAIYSTF  127

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             SKW+P  ERSR++ ++ S + LG++  L  +P+++  +GW   FYSFG++G VWF  W  
Sbjct  128   SKWIPSVERSRAIGLINSAIPLGTIFALVTTPIIVQIWGWQWAFYSFGAVGIVWFFFWQR  187

Query  1132  KAHSSplddpellpeekkLI-LRNSVSKEPVK-SIPWKLILSKPPVWALIVSHFCHNWGT  959
                S+P    ++   E  LI L N V  +  + S PW   L   PVWA++V+HFC+NW  
Sbjct  188   LVTSTPQQHADITDHELALIALDNDVPVDDEQTSPPWHHFLRSMPVWAIVVAHFCNNWSL  247

Query  958   FILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKI  779
             F+LL+WMPTY ++ L  +    G+ A++P +   F     G +AD L++ G++V  VRK+
Sbjct  248   FVLLSWMPTYINKGLGVDYASVGLLAIIPSIASVFFLNIAGNLADRLIKNGIAVGKVRKL  307

Query  778   MQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMG  599
             MQTIGF G    L  + H+D+  MA+  MT      AF   G   NH D+APR++G LMG
Sbjct  308   MQTIGFGGLTAALVTVGHLDTVWMAIATMTVGSALGAFVTGGFAVNHMDVAPRHAGTLMG  367

Query  598   LSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             ++NTAG + G+ G   TG IL+  GSW  VF ++ G+ L G V + +F++GEK+ D
Sbjct  368   ITNTAGAIPGIIGVFVTGLILELTGSWIIVFSLAGGVTLFGLVFYLMFASGEKLFD  423



>ref|XP_007026793.1| Phosphate transporter 4,2 [Theobroma cacao]
 gb|EOY07295.1| Phosphate transporter 4,2 [Theobroma cacao]
Length=515

 Score =   315 bits (807),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 182/424 (43%), Positives = 270/424 (64%), Gaps = 6/424 (1%)
 Frame = -2

Query  1696  GETISG-GFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFW  1520
             GET S    P+R+ +V L      LCN DRV MS+AI+P+A + +WS + +G++QSSF W
Sbjct  92    GETASSVRVPERFKVVALMACVMCLCNADRVVMSVAIVPLADKLNWSNSFLGVVQSSFLW  151

Query  1519  GYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGV  1340
             GY+ +   GG   D  GGK VL +GV  WS+AT+LTP AA      L  +RAF G+ EGV
Sbjct  152   GYIFSSAIGGALVDKYGGKKVLAWGVALWSLATLLTPWAANHSTIALLAIRAFFGLAEGV  211

Query  1339  AMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG  1160
             A+P+M+ LLS+W P  ER+ ++ +  +G +LG+V GL  +P+L+   G    F  F SLG
Sbjct  212   ALPSMSTLLSRWFPGDERASAVGVSMAGFHLGNVVGLLLTPILLSSIGISGPFILFSSLG  271

Query  1159  TVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPV---KSIPWKLILSKPPVWALI  989
              +W + W+ K  +S   +   + + +  +++   +  PV   +S P +LILSK P WA+I
Sbjct  272   LLWLSSWVYKV-TSDPRESPFVSKSELRLIQTGKTHPPVSTGESPPIRLILSKLPTWAII  330

Query  988   VSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRK  809
              ++  +NWG F+LL+WMP Y+  V   NL ++  F+ +PW TMA S Y  G ++DSL+++
Sbjct  331   FANVTNNWGYFVLLSWMPVYFRTVFNVNLKQAAWFSAVPWGTMAVSGYIAGAVSDSLIKE  390

Query  808   GVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDI  629
             G S+T+VRKIMQ+IGF+GP   L  L+   SPA+A L +T +    +FSQ+G   N QDI
Sbjct  391   GYSITLVRKIMQSIGFIGPGVSLLCLNFAKSPAVAALFITVALSFSSFSQAGFLLNMQDI  450

Query  628   APRYSGVLMGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFST  452
             AP+Y+G + G++N+AG LA +  T  TGY +Q  GS+     V+ GLY + T+ WNLF+T
Sbjct  451   APQYAGFVHGIANSAGTLAAIISTIGTGYFVQWLGSFQAFLSVTAGLYFITTIFWNLFAT  510

Query  451   GEKI  440
             GE++
Sbjct  511   GERV  514



>emb|CDX93332.1| BnaC04g45640D [Brassica napus]
Length=513

 Score =   314 bits (805),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 186/444 (42%), Positives = 257/444 (58%), Gaps = 10/444 (2%)
 Frame = -2

Query  1753  PESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMAS  1574
             PE    E  L      E   E I    P+R  +V+L      LCN DRV MS+A++P+A 
Sbjct  73    PERCAAEGILIGGGEVEVARELI----PERMKVVMLTACMMCLCNADRVVMSVAVVPLAE  128

Query  1573  EYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKL  1394
             +  WS + +G++QSSF WGY+ + + GG   D  GGK VL +GV  WS AT+LTP AA  
Sbjct  129   KLGWSSSFLGVVQSSFLWGYIFSSVIGGALVDRYGGKRVLAWGVALWSFATLLTPWAAAH  188

Query  1393  GLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPM  1214
                 L   RAF G+ EGVAMP+M  LLS+W P+ ER+ ++ +  +G ++G+V GL  +P+
Sbjct  189   STVALLCARAFFGLAEGVAMPSMTTLLSRWFPMDERASAVGISMAGFHMGNVVGLLLTPL  248

Query  1213  LIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKSI  1034
             ++   G    F  F SLG +W + W S   ++P D P +   E + I        P  S 
Sbjct  249   MLSSIGISGPFILFASLGLLWVSTWASGVTNNPQDSPFITRSELRQIQAGKPVHTPTSST  308

Query  1033  P----WKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWL  866
                   +L+LSK P WA+I ++  +NWG F+LL+WMP Y+  V   NL ++  F+ LPW 
Sbjct  309   KPNPSLRLLLSKLPTWAIIFANVTNNWGYFVLLSWMPVYFQTVFNVNLKQAAWFSALPWA  368

Query  865   TMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTC  686
             TMA S Y  G  +D L+R G SVT VRKIMQ+IGF+GP   L  L++  SP+ A + MT 
Sbjct  369   TMAVSGYFAGSASDCLIRTGHSVTSVRKIMQSIGFIGPGLSLLCLNYAKSPSCAAILMTI  428

Query  685   SQGSDAFSQSGLYSN-HQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ-HGSWDDV  512
             +    +FSQ+G   N  QDIAP Y+G L G+SN AG LA +  T  TGY +Q  GS+   
Sbjct  429   ALSLSSFSQAGFLLNMQQDIAPEYAGFLHGISNCAGTLAAIVSTIGTGYFVQWLGSFQAF  488

Query  511   FKVSVGLYLVGTVVWNLFSTGEKI  440
               V+  LY   TV W LF+TGE++
Sbjct  489   LTVTAFLYFATTVFWILFATGERV  512



>ref|XP_001420334.1| MFS family transporter: sugar, partial [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO98627.1| MFS family transporter: sugar, partial [Ostreococcus lucimarinus 
CCE9901]
Length=429

 Score =   311 bits (798),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 263/426 (62%), Gaps = 15/426 (4%)
 Frame = -2

Query  1666  RWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGI  1487
             R V+V L   A +LCN DRV M++A +P+A+   W    VGL+QSSF WGY LT + GG+
Sbjct  4     RMVVVSLVAFALMLCNADRVIMAVAGVPLAAANGWGERAVGLVQSSFLWGYALTPLVGGM  63

Query  1486  WADTvggklvlgfgvVWWSIATILTPIAAKLG-LPFLFIVRAFMGIGEGVAMPAMNNLLS  1310
              AD  GGK+VLG G+  WS+AT+ TP AA  G L  L + RA MG+GEGVA+P MNN++S
Sbjct  64    LADRYGGKVVLGAGIAVWSLATVATPFAATSGGLAPLLVARAVMGLGEGVALPCMNNVIS  123

Query  1309  KWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             +WVP +ERSR++A+   G   GS+ GL  +P L+ + G P  F  FG+LG  W  +W   
Sbjct  124   RWVPRTERSRAVAISMGGFQSGSMIGLLAAPALLARGGVPGPFILFGALGLAWAAIWHFA  183

Query  1129  AHSSplddpellpeekkLIL--------RNSVSKEPVKSIPWKLILSKPPVWALIVSHFC  974
             A + P D   +   E   I+         +S + +     P+KL+LSK P WA I+++F 
Sbjct  184   ATTYPKDCKMVGARELNYIVDSPGGALTSSSSTLKDAAPPPFKLLLSKAPTWACIIANFV  243

Query  973   HNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVR-KGVSV  797
             +NWG FILL WMP Y+ QV+  NL E+  F+ LPW TMA S    G +AD+L+  +G SV
Sbjct  244   NNWGFFILLAWMPLYFKQVVGLNLREAAWFSALPWATMAASGVVAGTLADNLINSRGWSV  303

Query  796   TVVRKIMQTIGFLGPAFFLTQLSHVDS---PAMAVLCMTCSQGSDAFSQSGLYSNHQDIA  626
             T  RK +Q +GF+GPA  L  L+   +    A AV  +T + G  AF+Q+G   N Q+I 
Sbjct  304   TATRKFIQGVGFIGPAICLIILAAYGAQMTAARAVTTLTVACGCTAFTQAGFLVNFQEIG  363

Query  625   PRYSGVLMGLSNTAGVLAGVFGTAATGYILQH--GSWDDVFKVSVGLYLVGTVVWNLFST  452
             P+Y+GVL G++NTAG +AG+ GT ATG +L+   G+W  V  ++  +Y +G   W   ST
Sbjct  364   PKYAGVLHGMANTAGSIAGMVGTYATGAVLEATGGNWSAVLYITAVVYALGAATWLTMST  423

Query  451   GEKILD  434
             GE++ D
Sbjct  424   GERVFD  429



>gb|EYU41835.1| hypothetical protein MIMGU_mgv1a007449mg [Erythranthe guttata]
Length=407

 Score =   310 bits (794),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 170/399 (43%), Positives = 251/399 (63%), Gaps = 3/399 (1%)
 Frame = -2

Query  1627  LCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgf  1448
             LCN DRV MS+AI+P+A+++ WS + +G++QSSF WGY+ + I GG   D  GGK V+ +
Sbjct  8     LCNADRVVMSVAIVPLAAKHGWSSSFLGIVQSSFLWGYMCSSIIGGALVDKYGGKKVIAW  67

Query  1447  gvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAM  1268
             G   WS+AT+LTP AA      L I+RAF G+ EGVA+P+MNNLLS+W P  ER+ ++ +
Sbjct  68    GAALWSLATLLTPWAANHSTASLLIMRAFFGLAEGVALPSMNNLLSRWFPTHERATAVGI  127

Query  1267  VYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpe  1088
                G  +G+V GL  +P+++   G    F  F SLG +W   W+ K  + P D   +   
Sbjct  128   SMGGFQIGNVVGLVLTPVMMSSIGISGPFILFTSLGLLWLVTWIFKVTNDPQDCASISDS  187

Query  1087  ekkLILRNSVSKEPVKS-IP-WKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
             E +LI         +K+ IP   L+LSK P WA+I+++  +NWG F+LL+WMP Y+  V 
Sbjct  188   ELRLIQAGKSDSNEIKAKIPSLTLLLSKLPTWAIILANVTNNWGYFVLLSWMPVYFKTVF  247

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
               NL ++  F+ +PW TMA S Y  G  +D+L++ G S+T  RKIMQ+IGF+GP   L  
Sbjct  248   DVNLKQAAWFSAVPWGTMAISGYIAGAASDNLIQSGYSITSARKIMQSIGFIGPGVALLC  307

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             L++V +P +A + +T +    +FSQ+G   N QDIAP+ +G L G+SN+AG LA +  T 
Sbjct  308   LNYVKTPTVAAVFLTIALSLSSFSQAGFLLNMQDIAPQCAGYLHGISNSAGTLAAIISTI  367

Query  553   ATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
              TG+ +Q  GS+     ++  LY   TV WNL++TGE++
Sbjct  368   GTGFFVQWLGSFQAFLTLTACLYFATTVFWNLYATGERV  406



>ref|XP_010256679.1| PREDICTED: probable anion transporter 3, chloroplastic [Nelumbo 
nucifera]
Length=518

 Score =   313 bits (803),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/418 (41%), Positives = 259/418 (62%), Gaps = 7/418 (2%)
 Frame = -2

Query  1678  GFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQI  1499
             G P+R  +V+L      LCN DRV MS++I+P+A  + WS + +G++QSSF WGY+ + +
Sbjct  102   GVPERLKVVVLVAFVMCLCNADRVVMSVSIVPLAVRHGWSTSFLGIVQSSFLWGYVFSSV  161

Query  1498  AGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNN  1319
              GG   D  GGK V+ +GV  WS+AT+LTP AA   +  L   RA  G+ EGVA+P+MN 
Sbjct  162   IGGALVDRYGGKRVMAWGVAVWSMATLLTPWAADHSIGMLLATRAIFGLAEGVALPSMNT  221

Query  1318  LLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVW  1139
             LLS+W P +ER+ ++ +  +G +LG+V  L  +P+L+   G    F  F SLG +W T+W
Sbjct  222   LLSRWFPNNERATAVGISMAGFHLGNVVSLLLTPILMSMTGVSGPFTLFSSLGLLWLTIW  281

Query  1138  LSKAHSSplddpellpeekkLILRNSVSKEPVKSI----PWKLILSKPPVWALIVSHFCH  971
                  + P +  ++   E +LI   S   EP+++     P + +LSK P WA+I ++  +
Sbjct  282   AYGVTNDPRESNDISKTELRLI--QSGKSEPLENKKQLPPLRQLLSKLPAWAIIFANVTN  339

Query  970   NWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTV  791
             NWG F+LL+WMP Y+  V   NL ++  F+ +PW  MA S Y  G I+DSL++ G S+T+
Sbjct  340   NWGYFVLLSWMPVYFKTVFNVNLKQAAWFSAIPWGMMALSGYIAGAISDSLIKAGYSITL  399

Query  790   VRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSG  611
             VRKIMQ+IGF+GP   L  L+   +  +A + MT +    +FSQ+G   N QDIAP+Y+G
Sbjct  400   VRKIMQSIGFIGPGVLLLCLNFAKTADVAAIFMTVALSLSSFSQAGFLLNMQDIAPQYAG  459

Query  610   VLMGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
              L G++N+ G +A +  T  TGY +Q  GS+     V+  LY V T+ WNL++TGE+I
Sbjct  460   FLHGITNSVGTVAAIISTIGTGYFVQWLGSFQAFLTVTAALYFVTTIFWNLYATGERI  517



>ref|XP_001762770.1| predicted protein [Physcomitrella patens]
 gb|EDQ72569.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   310 bits (795),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 181/415 (44%), Positives = 260/415 (63%), Gaps = 14/415 (3%)
 Frame = -2

Query  1636  AFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklv  1457
             A  LCN DRV MS+AI+PM++ + WS +  G++QSSF WGYLL+ I GG  AD  GGK V
Sbjct  5     AMALCNADRVVMSVAIVPMSAAHGWSQSFAGVVQSSFLWGYLLSPIPGGALADRYGGKAV  64

Query  1456  lgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRS  1277
             + +GV  WS+AT+LTP AA   L  L  VR  MG+ EGV MP MNN++S+W P +ERSR+
Sbjct  65    MAWGVAIWSLATLLTPWAASHSLSALLAVRVLMGLAEGVTMPCMNNMISRWFPRTERSRA  124

Query  1276  LAMVYSGMYLGSVTGLAFSPMLIH-KFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpe  1100
             + M  +G +LGSV GL  +P L+    G  + F +FG  G VW  VWL++   +P   P 
Sbjct  125   VGMTMAGFHLGSVAGLVITPTLLATSSGINAPFVAFGVSGFVWLFVWLAEIARNPQSQPR  184

Query  1099  llpeekkLI-----------LRNSVSKEPVKSIP-WKLILSKPPVWALIVSHFCHNWGTF  956
             +  EE + I           + +S +  P  +IP ++L+LSK P WA+I+++F +NWG F
Sbjct  185   ISREEYQYIKQGNEDLSVGTVESSSAIPPRSAIPPFRLLLSKLPTWAIIIANFMNNWGYF  244

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             ILL WMP Y++ VL  NL ++  F+ +PW  MA   +  G  +D LV+ GVS+T  RK+M
Sbjct  245   ILLGWMPVYFNTVLGVNLKDAAWFSAVPWAMMAAVGFIAGASSDFLVQSGVSLTTTRKLM  304

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             Q+IGFLGPA  L  L+ V  P +A   +T + G  +FSQ+G   N+Q+I P+Y+GVL G+
Sbjct  305   QSIGFLGPAAALLGLNAVRDPMVAAAWLTAAVGLSSFSQAGFLVNYQEIGPKYAGVLHGM  364

Query  595   SNTAGVLAGVFGTAATG-YILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             SNTAG +A +  T  TG +I + GS+     ++  +Y+  T+ W   +TGE++  
Sbjct  365   SNTAGTMAAIISTLGTGLFIERLGSFQSFLTLTSVMYIASTLFWVFNATGERVFQ  419



>ref|XP_004246962.1| PREDICTED: probable anion transporter 4, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=525

 Score =   313 bits (803),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 178/446 (40%), Positives = 271/446 (61%), Gaps = 9/446 (2%)
 Frame = -2

Query  1750  ESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASE  1571
              S +   + ND    +  G  +     +R  +V +   +  LCN DRV MS+AI+P++  
Sbjct  72    RSNRIRTSSNDSQSVQQQGSFVEFITSERVKVVAMLALSLALCNADRVVMSVAIVPLSLS  131

Query  1570  YHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLG  1391
             + W  +  G++QSSF WGYL++ IAGG   D  GGKLV+ +GV  WS+AT+LTP AA++ 
Sbjct  132   HGWRQSFAGVVQSSFLWGYLISPIAGGTLVDYYGGKLVMAWGVALWSMATLLTPWAAEVS  191

Query  1390  LPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPML  1211
             L  L  +R  +GI EGVA+P MNN++++W P +ERSR++ +  +G  LGS  GL FSP+L
Sbjct  192   LWALLAMRMLLGIAEGVALPCMNNMIARWFPPTERSRAVGLAMAGFQLGSAIGLTFSPIL  251

Query  1210  IHKFGWPSVFYSFGSLGTVWFTVWLSKA-----HSSplddpellpeekkLILRNSV---S  1055
             + + G    F  FG  G +W  VW+S       HS  +   EL   + K  + N V   S
Sbjct  252   MSQGGLFGPFVIFGLSGFLWVLVWVSATSSTPEHSRQISIHELRYIQNKGQIHNIVEGKS  311

Query  1054  KEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVL  875
             K      P++ +LSK P W++IV++  H+WG F++L+WMP Y+  +   +L ++  F+ +
Sbjct  312   KSSKGIPPFRRLLSKLPTWSIIVANAMHSWGFFVILSWMPIYFKTIYHVDLRQAAWFSAV  371

Query  874   PWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLC  695
             PW  MA + Y  G+++D ++++G+SVT+ RK+MQ++GF GP F L  L+   SP++A   
Sbjct  372   PWSMMALTGYFAGFLSDMMIQRGISVTLTRKVMQSVGFFGPGFSLIGLTTAPSPSIASAW  431

Query  694   MTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQH-GSWD  518
             +T + G  AFS  G   N Q+IAP+YSGVL G+SNTAG LA + GT   G+ ++  GS+ 
Sbjct  432   LTLAVGLKAFSHCGFLVNLQEIAPQYSGVLHGISNTAGTLAAIIGTVGAGFFVELVGSFK  491

Query  517   DVFKVSVGLYLVGTVVWNLFSTGEKI  440
                 ++  LY    V WN+FSTGE++
Sbjct  492   GFLVLTSVLYFSAAVFWNVFSTGERV  517



>ref|XP_011077593.1| PREDICTED: probable anion transporter 3, chloroplastic [Sesamum 
indicum]
Length=513

 Score =   313 bits (801),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 170/428 (40%), Positives = 261/428 (61%), Gaps = 6/428 (1%)
 Frame = -2

Query  1711  LTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQS  1532
             +   DG  ++    +R+ +V L  +   LCN DRV MS+A++P+A+++ WS + +G++QS
Sbjct  89    VARRDGGVMA---EERFKVVALVAAVMCLCNADRVVMSVAVVPLAAKHGWSSSFLGIVQS  145

Query  1531  SFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGI  1352
             SF WGY+ + + GG   D  GGK V+ +G   WS+AT+LTP AA      L  VRAF G+
Sbjct  146   SFLWGYMCSSVIGGALVDKYGGKRVIAWGAALWSLATLLTPWAANHSTASLLAVRAFFGL  205

Query  1351  GEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSF  1172
              EGVA+P+MNNLLS+W P +ER+ ++ +   G  LG+V GL  +P+ +   G    F  F
Sbjct  206   AEGVALPSMNNLLSRWFPTNERATAVGISMGGFQLGNVVGLVLTPLAMSSIGISGPFILF  265

Query  1171  GSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVSKEPVKS-IP-WKLILSKPPVW  998
              SLG +W   W+++  + P +   +   E +LI         +KS +P   L+ SK P W
Sbjct  266   TSLGFLWLMTWINRVANDPQESNSISKAELRLIQAGKSDSHVIKSKLPSLALLFSKLPTW  325

Query  997   ALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSL  818
             A++ ++  +NWG F+LL+WMP Y+  V   NL ++  F+ +PW TMA S YA G  +D L
Sbjct  326   AIVFANITNNWGYFVLLSWMPVYFKTVFGVNLKQAAWFSAVPWGTMAISGYAAGAASDYL  385

Query  817   VRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNH  638
             ++ G S T  RKIMQ+IGF+GP   L  L++  +P++A + +T +    +FSQ+G   N 
Sbjct  386   IKTGYSTTSARKIMQSIGFIGPGIALLFLNYAKTPSIAAVFITMALSLSSFSQAGFLLNM  445

Query  637   QDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNL  461
             QDIAP+Y+G L G+SN+AG LA +  T  TG+ +Q  GS+     ++  LY   T+ WNL
Sbjct  446   QDIAPQYAGFLHGISNSAGTLAAIISTIGTGFFVQWLGSFQAFLTLTACLYFATTIFWNL  505

Query  460   FSTGEKIL  437
             ++TGE++ 
Sbjct  506   YATGERVF  513



>ref|XP_010935849.1| PREDICTED: probable anion transporter 2, chloroplastic isoform 
X3 [Elaeis guineensis]
Length=546

 Score =   312 bits (800),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 194/232 (84%), Gaps = 3/232 (1%)
 Frame = -2

Query  1816  RTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETIS---GGFPKRWVIVLL  1646
             R++ R  AD +S+ Y ++    +SL   +  ++ VL   D   +S     FPKRW+IVLL
Sbjct  153   RSAIRPHADFRSEQYEMTGPQMDSLNSSEVPSEAVLFGGDVRKVSHWWEQFPKRWLIVLL  212

Query  1645  CFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvgg  1466
             CF +FLLCNMDRVNMSIAILPM++E+ W+P T+GLIQSSFFWGYLLTQI GGIWAD +GG
Sbjct  213   CFFSFLLCNMDRVNMSIAILPMSTEFKWNPATMGLIQSSFFWGYLLTQIVGGIWADKIGG  272

Query  1465  klvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSER  1286
             KLVLGFGVVWWSIAT+LTPIAAK+GLPFL ++RAFMGIGEGVAMPAMNN+LSKW+PVSER
Sbjct  273   KLVLGFGVVWWSIATVLTPIAAKIGLPFLLVMRAFMGIGEGVAMPAMNNILSKWIPVSER  332

Query  1285  SRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             SRSLA VYSGMYLGSVTGLA SP+LIH FGWPSVFY+FGSLG++WF +W SK
Sbjct  333   SRSLAFVYSGMYLGSVTGLALSPILIHNFGWPSVFYAFGSLGSIWFALWQSK  384


 Score =   286 bits (731),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = -2

Query  943  WMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIG  764
            W   +  +VLKFNLTESG+F VLPWLTMA  A  GGWIAD+LV KG+S+T VRKIMQ+IG
Sbjct  377  WFALWQSKVLKFNLTESGLFCVLPWLTMAVFANVGGWIADTLVGKGLSITTVRKIMQSIG  436

Query  763  FLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTA  584
            FLGPAFFLTQLSHV +PA+AVLCM CSQGSDAFSQSGLYSNHQDI PRY+GVL+GLSNTA
Sbjct  437  FLGPAFFLTQLSHVRTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTA  496

Query  583  GVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
            GVLAGVFGTAATGYILQ GSWDDVFKVSV LY++GT+VWN+F+TGEK+LD
Sbjct  497  GVLAGVFGTAATGYILQRGSWDDVFKVSVALYIIGTLVWNIFATGEKVLD  546



>ref|XP_002273820.1| PREDICTED: probable anion transporter 3, chloroplastic [Vitis 
vinifera]
Length=507

 Score =   311 bits (797),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 178/414 (43%), Positives = 259/414 (63%), Gaps = 3/414 (1%)
 Frame = -2

Query  1672  PKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAG  1493
             P+R+ +V L      LCN DRV MS+AI+P+A+E+ WS + +G++QSSF WGY+ + + G
Sbjct  92    PERFKVVTLLAMVMCLCNADRVVMSVAIVPLAAEHGWSSSFLGIVQSSFLWGYVFSSVIG  151

Query  1492  GIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLL  1313
             G+  D  GGK V+  GV  WS+AT+LTP AA      L  VRAF G+ EGVA+PAM+ L+
Sbjct  152   GVLVDRYGGKKVMACGVALWSLATLLTPWAATHSTLSLLAVRAFFGLAEGVALPAMSTLV  211

Query  1312  SKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLS  1133
             S+W P++ER+ ++ +  +G +LG+VTGL  +P++I   G    F  F SLG +W T+W  
Sbjct  212   SRWFPINERASAVGISMAGFHLGNVTGLLVTPIVISSIGISGPFVLFSSLGLLWLTMWGY  271

Query  1132  KAHSSplddpellpeekkLIL--RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGT  959
              A S P +   +   E +LI   +   S    K +P +L+LSK P WA+I ++  +NWG 
Sbjct  272   GATSDPRESHLISQSELRLIQAGKTESSARNGKFLPLRLLLSKLPTWAIIFANITNNWGY  331

Query  958   FILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKI  779
             F+LL+WMP Y+  V   NL ++  F+  PW  MA S Y  G ++D L++ G  +T+VRKI
Sbjct  332   FVLLSWMPVYFKSVFDINLKQAAWFSAAPWGMMAISGYIAGVVSDYLIKVGYPLTLVRKI  391

Query  778   MQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMG  599
             MQ+IGF+GP   L  L+H  +P  A + +T      +FSQ+G   N QDIAP+Y+G L G
Sbjct  392   MQSIGFIGPGVSLLCLNHAKTPVTAAMFLTAGLSLSSFSQAGFLLNMQDIAPQYAGFLHG  451

Query  598   LSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
             +SN+AG LA +  T  TGY +Q  GS+     V+  LY   T+ WN F+TGE++
Sbjct  452   ISNSAGTLAAIVSTIGTGYFVQWLGSFQAFLTVTALLYFATTIFWNAFATGERV  505



>gb|EPS69350.1| hypothetical protein M569_05413, partial [Genlisea aurea]
Length=438

 Score =   308 bits (789),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 184/449 (41%), Positives = 260/449 (58%), Gaps = 23/449 (5%)
 Frame = -2

Query  1765  SDSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMDRVNMSIAIL  1586
             S+ VPE    E+ +  +                R  +V +   A  LCN DRV MS+AI+
Sbjct  4     SEKVPEPSYLEEFITSE----------------RVKVVAMLALALALCNADRVVMSVAIV  47

Query  1585  PMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPI  1406
             P++    W  +  G++QSSF WGYL++ IAGG   D  GGK+V+  GV  WS+AT LTP 
Sbjct  48    PLSMSRGWRQSFAGVVQSSFLWGYLISPIAGGALVDRYGGKVVMALGVALWSLATYLTPW  107

Query  1405  AAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLA  1226
             AA+  L  L + R  +GI EGVA+P MNN+++KW P +ERSR++ +  +G  LGS  GL 
Sbjct  108   AAEASLGALIVTRMMLGIAEGVALPCMNNMIAKWFPTTERSRAVGLAMAGFQLGSAIGLM  167

Query  1225  FSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLILRNSVS-KE  1049
              SP+L+ K G    F  FG  G +W  VW+S   S+P    ++   E + I  N  +   
Sbjct  168   LSPVLMSKGGIFGPFVIFGLSGFLWVLVWISAISSTPDLCSQISSYELRYIKNNKTAVTS  227

Query  1048  PVKSI----PWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFA  881
             P KS     P+K +LSK P W+LIV++  H+WG F++L+WMP Y+  +   +L ++  F+
Sbjct  228   PSKSTSVVPPFKSLLSKLPTWSLIVANAMHSWGFFVILSWMPIYFKTIHHVDLRQAAWFS  287

Query  880   VLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAV  701
              +PW+ MA + Y  G I+D ++  GVSVT  RKIMQ+IGF+GP   L  L+   SP  A 
Sbjct  288   AVPWIMMAVAGYFAGVISDRMIEIGVSVTSTRKIMQSIGFIGPGLALICLTQAKSPLAAS  347

Query  700   LCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQH--G  527
               +T + G  AFS SG   N Q+IAP YSGVL G+SNTAG LA + GT   G+ ++   G
Sbjct  348   SWLTVAVGLKAFSHSGFLVNLQEIAPEYSGVLHGMSNTAGTLAAIAGTVGAGFFVETVGG  407

Query  526   SWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
             S+     ++  LY      WN FSTGE++
Sbjct  408   SFKGFLILTAFLYFSAAAFWNAFSTGERV  436



>gb|EYU26642.1| hypothetical protein MIMGU_mgv1a007147mg [Erythranthe guttata]
Length=417

 Score =   305 bits (782),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/414 (41%), Positives = 251/414 (61%), Gaps = 3/414 (1%)
 Frame = -2

Query  1669  KRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGG  1490
             +R+ +V L      LCN DRV MS+AI+P+A+E+ W    +G++QSSF WGY+ + + GG
Sbjct  4     ERFKVVALVAGVMCLCNADRVVMSVAIVPLAAEHGWDSYFLGIVQSSFLWGYMFSSVIGG  63

Query  1489  IWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLS  1310
                D  GGK V+G+G   WS+AT+LTP+AA      LF VR F G+ EGVA+P+MNNL+S
Sbjct  64    ALVDKYGGKRVIGWGAALWSLATLLTPLAASHSTVSLFAVRVFFGLAEGVALPSMNNLIS  123

Query  1309  KWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             +W P +ER+ ++ M   G  LG+V GL  SP+ +   G    F  F  LG VW   W+ +
Sbjct  124   RWFPSNERATAVGMSMGGFQLGNVVGLVVSPLAMSTIGISGPFVLFSFLGYVWLLTWIFR  183

Query  1129  AHSSplddpellpeekkLILRNSVSKEPVK-SIP-WKLILSKPPVWALIVSHFCHNWGTF  956
               + P D   +   E +LI         +K  +P   L+ SK P WA+++++  +NWG F
Sbjct  184   VENDPQDSTSISKAELRLIQAGKSDSHAIKGKLPSLALLFSKLPTWAIVLANVTNNWGYF  243

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             +LL+WMP Y+  V   NL ++  F+ +PW TMA S Y  G  +D L++   S+T VRK+M
Sbjct  244   VLLSWMPVYFKTVFGVNLKQAAWFSAVPWGTMAISGYVAGATSDYLIKSDYSITSVRKMM  303

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             Q+IGF+GP   L  L++V +P +A + MT +    +FSQ+G   N  +IAP+Y+G L G+
Sbjct  304   QSIGFMGPGVALLCLNYVTTPTVAAIFMTMALSLSSFSQAGFLLNMHEIAPQYAGFLHGI  363

Query  595   SNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             SN+AG LA +  T   G+ +Q  GS+     ++  LY   T+ WNL++TGE++ 
Sbjct  364   SNSAGTLAAIISTIGAGFFVQWLGSFQAFLTLTACLYFATTIFWNLYATGERVF  417



>ref|XP_003061512.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
 gb|EEH54142.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
Length=393

 Score =   304 bits (778),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 173/394 (44%), Positives = 245/394 (62%), Gaps = 5/394 (1%)
 Frame = -2

Query  1603  MSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWWSIA  1424
             MS+  LP+A+   WSP+ VGL+QSSF WGY LT + GG+ AD +GG  VL +G+  WS+A
Sbjct  1     MSVVGLPLANLNGWSPSVVGLVQSSFLWGYALTPLVGGVLADKIGGDAVLMYGITLWSLA  60

Query  1423  TILTPIAA-KLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGMYL  1247
             TI TP AA    LP L + RA MG+GEGVA+P MNNL+++W P  ERSR++++   G   
Sbjct  61    TIATPFAATSASLPLLLLTRAVMGLGEGVALPCMNNLVARWAPTRERSRAVSVCMGGFQS  120

Query  1246  GSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekk--LI  1073
             GS+ GL  +P ++   G    F +FG+LG  W    +S A  S ++D   + EEK+    
Sbjct  121   GSMVGLLAAPHMLRVGGVHGPFVAFGALGLTWAGR-VSDAELSLIEDGGAVTEEKQWQQS  179

Query  1072  LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTES  893
                  + +    +P++L+LSK P WA +V++F +NWG FILL WMP Y+ +V+  +L  +
Sbjct  180   EEGGTNGKGGGKVPFRLLLSKMPTWACVVANFVNNWGYFILLAWMPLYFREVVGLDLASA  239

Query  892   GMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSP  713
               F+ LPW TMA      G +AD ++ +GVS T  RK++Q +GFLGPA  L  L+   +P
Sbjct  240   SYFSALPWATMAVVGVCAGALADWMIARGVSTTTTRKLIQGVGFLGPAAALVALTFTSTP  299

Query  712   AMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYIL-  536
             A A+  +T + G  AF+Q+G   N Q+I PRY G L G++NTAG  AG+ GT   G IL 
Sbjct  300   AQALTALTVAIGCTAFTQAGFLVNFQEIGPRYVGALHGMANTAGSAAGIVGTYGAGVILG  359

Query  535   QHGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD  434
             + GSW  V  ++ G+Y  G V W  FSTGE++ D
Sbjct  360   KTGSWSAVLLITAGVYAFGAVFWLAFSTGERVFD  393



>ref|XP_006345319.1| PREDICTED: probable anion transporter 4, chloroplastic-like [Solanum 
tuberosum]
Length=515

 Score =   307 bits (787),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 194/520 (37%), Positives = 297/520 (57%), Gaps = 26/520 (5%)
 Frame = -2

Query  1957  NLPPKL-HCSPEATFPK-RSFSSRSHTHTLFEFGSPFLPGRGFRRGLIR-RTSWRAWADV  1787
             N P  L + SP ++F K  SF  +   +        F P       LI   T +R    V
Sbjct  2     NSPATLRYLSPSSSFRKPNSFGKQLVFNIKLPSNCKFPPNHNCCFQLITANTFFRTEVPV  61

Query  1786  KSKTYGIS--DSVPESLKFEDALNDDVLTEDDGETISGGFPKRWVIVLLCFSAFLLCNMD  1613
             +S     S  DS  +S++ + +  + + +E           +  V+ +L  S   LCN D
Sbjct  62    RSNRIRASSNDSQSQSVQRQGSFVEFITSE-----------RVKVVAMLALS-LALCNAD  109

Query  1612  RVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWW  1433
             RV MS+AI+P++  + W  +  G++QSSF WGYL++ IAGG   D  GGKLV+ +GV  W
Sbjct  110   RVVMSVAIVPLSLSHGWRQSFAGVVQSSFLWGYLISPIAGGTLVDYYGGKLVMAWGVALW  169

Query  1432  SIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGM  1253
             S+AT+LTP AA+  L  L  +R  +GI EGVA+P MNN++++W P +ERSR++ +  +G 
Sbjct  170   SMATLLTPWAAEASLWALLAMRMLLGIAEGVALPCMNNMIARWFPPTERSRAVGLAMAGF  229

Query  1252  YLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpeekkLI  1073
              LGS  GL FSP+L+ + G    F  FG  G +W  VW+S   S+P    ++   E + I
Sbjct  230   QLGSAIGLTFSPILMSQGGLFGPFVIFGLSGFLWILVWVSATSSTPEHSQQISIHELRYI  289

Query  1072  --------LRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQV  917
                     +    SK      P++ +LSK P W++IV++  H+WG F++L+WMP Y+  +
Sbjct  290   QNKGQIHTIVEGKSKTSKGIPPFRRLLSKLPTWSIIVANAMHSWGFFVILSWMPIYFKTI  349

Query  916   LKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLT  737
                +L ++  F+ +PW  MA + Y  G ++D ++++G+SVT+ RK+MQ++GF GP F L 
Sbjct  350   YHVDLRQAAWFSAVPWSMMALTGYFAGVLSDLMIQRGISVTLTRKVMQSVGFFGPGFALI  409

Query  736   QLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGT  557
              L+   SP++A   +T + G  AFS  G   N Q+IAP+YSGVL G+SNTAG LA + GT
Sbjct  410   GLTTAPSPSIASAWLTLAVGLKAFSHCGFLVNLQEIAPQYSGVLHGISNTAGTLAAIIGT  469

Query  556   AATGYILQH-GSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
                G+ ++  GS+     ++  LY    V WN+FSTGE++
Sbjct  470   VGAGFFVELVGSFKGFLVLTSVLYFAAAVFWNVFSTGERV  509



>ref|XP_010687864.1| PREDICTED: probable anion transporter 6, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=536

 Score =   308 bits (788),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 185/461 (40%), Positives = 267/461 (58%), Gaps = 26/461 (6%)
 Frame = -2

Query  1768  ISDSVPESLKFEDALNDDVLTEDDGETISG---------GFPKRWVIVLLCFSAFLLCNM  1616
             + D V +SL    A  D    E D E   G           PKR+ ++     AF++CNM
Sbjct  74    VEDDVDQSLPLVAASKD----EFDHEREEGFEWKWPPWKNLPKRYKLIGTTSLAFVICNM  129

Query  1615  DRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVW  1436
             D+VN+S+AI+PM+ ++ W+ +  GL+QSSFFWGY L+Q+ GG  +   GG+ VL  GV+ 
Sbjct  130   DKVNLSVAIIPMSHQFGWNASVAGLVQSSFFWGYALSQLPGGWLSKIFGGRQVLALGVLA  189

Query  1435  WSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSG  1256
             WS+AT   P+ A   +P L   R  +GIGEGV+  A  +L+++ +P+ ERSR++A V+ G
Sbjct  190   WSLATAFVPVLAGY-MPGLIFSRILVGIGEGVSPSAATDLIARTIPLEERSRAVAFVFGG  248

Query  1255  MYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFT----VWLSKAHSSplddpellpe  1088
             + +GSV GL  +P +I  FGW SVFY FG LG VWF     +   +A S+    P +   
Sbjct  249   LSVGSVAGLLLAPPIIQNFGWESVFYLFGLLGVVWFLGFQYIEDGEAKSAASSMPSVESV  308

Query  1087  ekkLILRNSVS--KEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
               K +  NS+   K  +K +PWK     P VWA+I +HFC +WG +  L+W+PTY+ + L
Sbjct  309   SNKKVSFNSLEELKSSLKDVPWKAFFRSPAVWAMIYAHFCGSWGHYTCLSWLPTYFSEEL  368

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
               NLTE+   AVLP L    +       AD L+ +G+  T VRKI QTI F+ PAF +T 
Sbjct  369   DLNLTEAAGVAVLPPLASVITTNFAAQFADYLIARGIDTTTVRKICQTIAFVSPAFCMT-  427

Query  733   LSHVD---SPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVF  563
             LS +D    P   V  +T      +F+ SGLY  HQDI+  Y+ +L+G++NT G + G+ 
Sbjct  428   LSSIDLGLPPWEVVGLLTSGLALSSFALSGLYCTHQDISREYASILLGITNTVGAVPGIV  487

Query  562   GTAATGYILQHG-SWD-DVFKVSVGLYLVGTVVWNLFSTGE  446
             G A TG++L    SW   +F  S+  YL GTVVW  F++ +
Sbjct  488   GIALTGFLLDSTHSWSISLFAPSIFFYLTGTVVWLAFASSK  528



>ref|XP_002881562.1| hypothetical protein ARALYDRAFT_482813 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57821.1| hypothetical protein ARALYDRAFT_482813 [Arabidopsis lyrata subsp. 
lyrata]
Length=517

 Score =   306 bits (785),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 196/487 (40%), Positives = 282/487 (58%), Gaps = 24/487 (5%)
 Frame = -2

Query  1846  GRGFRRGLIRRTSWRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGG---  1676
             G G R+  IR  +  + ++   K  G  ++V  + K  +   +    E  G  I GG   
Sbjct  36    GFGPRKNQIRCDNLLSSSESDGKRRG--EAVVAAAKKRNQSPERCAAE--GRLIGGGASE  91

Query  1675  --------FPKRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFW  1520
                      P+R  +V+L      LCN DRV MS+A++P+A +  WS + +G++QSSF W
Sbjct  92    AITEVRTMMPERIKVVILTACMMCLCNADRVVMSVAVVPLADKLGWSSSFLGVVQSSFLW  151

Query  1519  GYLLTQIAGGIWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGV  1340
             GY+ + + GG   D  GGK VL +GV  WS+AT+LTP AA      L  VRAF G+ EGV
Sbjct  152   GYIFSSVIGGALVDRYGGKRVLAWGVALWSLATLLTPWAAAHSTLALLCVRAFFGLAEGV  211

Query  1339  AMPAMNNLLSKWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLG  1160
             A+P+M  LLS+W P  ER+ ++ +  +G ++G+V GL  +P+L+   G    F  F SLG
Sbjct  212   ALPSMTTLLSRWFPTDERASAVGISMAGFHMGNVVGLLLTPLLLSSIGISGPFILFASLG  271

Query  1159  TVWFTVWLSKAHSSplddpellpeekkLILR------NSVSKEPVKSIPWKLILSKPPVW  998
              +W + W S   ++P D P +   E +LI        ++ S +P  S+  +L+LSK P W
Sbjct  272   LLWVSTWSSGVTNNPQDSPFITRSELRLIQAGKPVQPSTNSTKPNPSL--RLLLSKLPTW  329

Query  997   ALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSL  818
             A+I+++  +NWG F+LL+WMP Y+  V   NL ++  F+ LPW TMA S Y  G  +D L
Sbjct  330   AIILANVTNNWGYFVLLSWMPVYFQTVFNVNLKQAAWFSALPWATMAISGYYAGAASDFL  389

Query  817   VRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNH  638
             +R G SVT VRKIMQ+IGF+GP   L  L+   SP+ A + MT +    +FSQ+G   N 
Sbjct  390   IRTGHSVTSVRKIMQSIGFMGPGLSLLCLNFAKSPSCAAVFMTIALSLSSFSQAGFLLNM  449

Query  637   QDIAPRYSGVLMGLSNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNL  461
             QDIAP+Y+G L G+SN AG LA +  T  TGY +Q  GS+     V+  LY   TV W L
Sbjct  450   QDIAPQYAGFLHGISNCAGTLAAIVSTIGTGYFVQWLGSFQAFLTVTAFLYFATTVFWIL  509

Query  460   FSTGEKI  440
             F+TGE++
Sbjct  510   FATGERV  516



>ref|XP_009370209.1| PREDICTED: LOW QUALITY PROTEIN: probable anion transporter 3, 
chloroplastic [Pyrus x bretschneideri]
Length=481

 Score =   305 bits (782),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/474 (37%), Positives = 273/474 (58%), Gaps = 18/474 (4%)
 Frame = -2

Query  1807  WRAWADVKSKTYGISDSVPESLKFEDALNDDVLTEDDGETISGG-------------FPK  1667
             W+    ++ K    S+  P     +     D     DGE   GG              P+
Sbjct  9     WKKQRRMEKKNGRGSEGAPTGGGGDVYGGGDRERNTDGEKQXGGGGAREVVAEEIVSVPE  68

Query  1666  RWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGI  1487
             R+ +  L      LCN DRV MS+AI+P+A++  WS + +G++QSSF WGY+ + + GG 
Sbjct  69    RFKVAALVACVMCLCNADRVVMSVAIVPLAAKNGWSSSFLGVVQSSFLWGYIFSSVIGGA  128

Query  1486  WADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSK  1307
               D  GGK V+ +GV  WS+AT+LTP AA      L  VRAF G+ EGVA+P+M+ LLS+
Sbjct  129   LVDRYGGKRVMAWGVAMWSLATLLTPWAANHSTTSLLAVRAFFGLSEGVALPSMSTLLSR  188

Query  1306  WVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKA  1127
             W P  ER+ ++ +  +G +LG+V GL  +P+++   G    F  F S+G +W T+W +  
Sbjct  189   WFPSHERASAVGISMAGFHLGNVVGLLLTPVMLSTMGLSGPFILFSSIGLLWLTIW-AYT  247

Query  1126  HSSplddpellpeekkLILRNSVSKEPVK--SIP-WKLILSKPPVWALIVSHFCHNWGTF  956
              ++   +   +   +  +++   S  P K   +P  +L+ SK P WA+I ++  +NWG F
Sbjct  248   VTNDPSESRYISNSEIRMIQAGKSDSPKKGGKLPSMRLLFSKLPTWAIICANITNNWGYF  307

Query  955   ILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIM  776
             +LL+WMP Y+  V   NL ++  F+ +PW +MA S+Y  G  +DSL++ G S+T VRKIM
Sbjct  308   VLLSWMPVYFKTVFGVNLKQAAWFSAVPWGSMAISSYIAGAASDSLIKAGYSLTTVRKIM  367

Query  775   QTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGL  596
             Q+IGF+GP   L  L++  +P  A + +T +    +FSQ+G   N QDIAP+ +G L G+
Sbjct  368   QSIGFIGPGVSLLGLNYAKTPEAAAVLLTAALCLSSFSQAGFLLNIQDIAPQSAGFLHGI  427

Query  595   SNTAGVLAGVFGTAATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKIL  437
             +N+AG +A +  T  TGY +Q  GS+     V+ GLY   T+ WNLF+TGE++ 
Sbjct  428   TNSAGTVAAIISTIGTGYFVQWLGSFQAFLTVTAGLYFATTIFWNLFATGERVF  481



>emb|CBI30430.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   302 bits (774),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 174/399 (44%), Positives = 252/399 (63%), Gaps = 3/399 (1%)
 Frame = -2

Query  1627  LCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgf  1448
             LCN DRV MS+AI+P+A+E+ WS + +G++QSSF WGY+ + + GG+  D  GGK V+  
Sbjct  5     LCNADRVVMSVAIVPLAAEHGWSSSFLGIVQSSFLWGYVFSSVIGGVLVDRYGGKKVMAC  64

Query  1447  gvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAM  1268
             GV  WS+AT+LTP AA      L  VRAF G+ EGVA+PAM+ L+S+W P++ER+ ++ +
Sbjct  65    GVALWSLATLLTPWAATHSTLSLLAVRAFFGLAEGVALPAMSTLVSRWFPINERASAVGI  124

Query  1267  VYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSKAHSSplddpellpe  1088
               +G +LG+VTGL  +P++I   G    F  F SLG +W T+W   A S P +   +   
Sbjct  125   SMAGFHLGNVTGLLVTPIVISSIGISGPFVLFSSLGLLWLTMWGYGATSDPRESHLISQS  184

Query  1087  ekkLIL--RNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVL  914
             E +LI   +   S    K +P +L+LSK P WA+I ++  +NWG F+LL+WMP Y+  V 
Sbjct  185   ELRLIQAGKTESSARNGKFLPLRLLLSKLPTWAIIFANITNNWGYFVLLSWMPVYFKSVF  244

Query  913   KFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQ  734
               NL ++  F+  PW  MA S Y  G ++D L++ G  +T+VRKIMQ+IGF+GP   L  
Sbjct  245   DINLKQAAWFSAAPWGMMAISGYIAGVVSDYLIKVGYPLTLVRKIMQSIGFIGPGVSLLC  304

Query  733   LSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTA  554
             L+H  +P  A + +T      +FSQ+G   N QDIAP+Y+G L G+SN+AG LA +  T 
Sbjct  305   LNHAKTPVTAAMFLTAGLSLSSFSQAGFLLNMQDIAPQYAGFLHGISNSAGTLAAIVSTI  364

Query  553   ATGYILQ-HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
              TGY +Q  GS+     V+  LY   T+ WN F+TGE++
Sbjct  365   GTGYFVQWLGSFQAFLTVTALLYFATTIFWNAFATGERV  403



>gb|KFK26277.1| hypothetical protein AALP_AA8G225900 [Arabis alpina]
Length=521

 Score =   306 bits (784),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 200/516 (39%), Positives = 278/516 (54%), Gaps = 40/516 (8%)
 Frame = -2

Query  1912  KRSFSSRSHTHT---LFEFGSPFLPGRGFRRGLIRRTSWRAWADVKSKTYGISDSVPESL  1742
              R FSS +HTH    L  + + F P   +   L  R S      VK  T G      E L
Sbjct  10    NRFFSSPTHTHNQSFLSVYTTRFFPHHHYHNPLKSRVS-----RVKCSTSGT-----ERL  59

Query  1741  KFEDALNDDVLTED---------DGETIS--------GGFPKRWVIVLLCFSAFLLCNMD  1613
             +    L D+   +D         D E +S           P+R+ ++     AF++CNMD
Sbjct  60    RETKKLPDNPPIKDPPQLPNPDSDSEELSTEQNWPPWKNVPERYKLIGATSLAFVICNMD  119

Query  1612  RVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGGIWADTvggklvlgfgvVWW  1433
             +VN+SIAI+PM+ ++ WS +  GL+QSSFFWGY L+Q+ GG  +   GG+ VL  GV  W
Sbjct  120   KVNLSIAIIPMSHQFGWSSSVAGLVQSSFFWGYALSQLPGGWLSKIFGGRKVLEIGVFTW  179

Query  1432  SIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLSKWVPVSERSRSLAMVYSGM  1253
             S AT L P+ A   +P L   R  +GIGEGV+  A  +L+++ +PV ERSR++  V+ G+
Sbjct  180   SFATALVPLLAGF-MPGLIFSRILVGIGEGVSPSAATDLIARTIPVKERSRAVGFVFGGL  238

Query  1252  YLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFT--VWLSKAHSSplddpellpeekk  1079
              LGSV GL  +P +I  F W SVFY FG LG  WF    +LS+   S   D     ++ +
Sbjct  239   SLGSVMGLLLAPPIIQTFNWESVFYLFGVLGVAWFIGFQFLSEEEISYKGDGTTTSDKPE  298

Query  1078  LILRNSVSKEPVKSIPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYHQVLKFNLT  899
                R  +    +K IPWK       VWA+I +HFC +WG +  L+W+PTY+ + L  NL 
Sbjct  299   KATREEMGNS-LKEIPWKSFFQSSAVWAMIYTHFCGSWGHYTCLSWLPTYFSEALNLNLR  357

Query  898   ESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSVTVVRKIMQTIGFLGPAFFLTQLSHVD  719
             E+   ++LP L            AD L+  GV  T VRKI QTI FL PA  +T LS VD
Sbjct  358   EAAWVSILPPLASILVTSLASQFADYLISNGVDTTKVRKICQTIAFLAPAICMT-LSSVD  416

Query  718   ---SPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRYSGVLMGLSNTAGVLAGVFGTAAT  548
                 P   V  +T      +F+ SGLY  HQDI+P Y+ +L+G++NT G + G+ G A T
Sbjct  417   IGLPPWEIVGILTAGLALSSFALSGLYCTHQDISPEYASILLGITNTVGAVPGIVGVALT  476

Query  547   GYILQHG-SWD-DVFKVSVGLYLVGTVVWNLFSTGE  446
             G++L    SW   +F  S+  YL GTVVW  F++ E
Sbjct  477   GFLLDSTHSWTMSLFVPSIFFYLTGTVVWLAFASSE  512



>ref|XP_009402283.1| PREDICTED: probable anion transporter 3, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=535

 Score =   306 bits (785),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 175/420 (42%), Positives = 261/420 (62%), Gaps = 12/420 (3%)
 Frame = -2

Query  1669  KRWVIVLLCFSAFLLCNMDRVNMSIAILPMASEYHWSPTTVGLIQSSFFWGYLLTQIAGG  1490
             +R  +V +   A  LCN DRV MS+AI+P++  + W+ +  G++QSSF WGYL++ I GG
Sbjct  99    ERVKVVAMLGLALALCNADRVVMSVAIVPLSRAHGWTQSFSGIVQSSFLWGYLMSPIVGG  158

Query  1489  IWADTvggklvlgfgvVWWSIATILTPIAAKLGLPFLFIVRAFMGIGEGVAMPAMNNLLS  1310
                D  GGKLV+ +GV  WS+AT LTP AA+  L  L  +R  +G+ EGVA+P+MNN++S
Sbjct  159   ALVDYYGGKLVMAWGVALWSLATFLTPWAAETSLWTLLAMRVLLGVAEGVALPSMNNMVS  218

Query  1309  KWVPVSERSRSLAMVYSGMYLGSVTGLAFSPMLIHKFGWPSVFYSFGSLGTVWFTVWLSK  1130
             +W P SERSR++ +  +G  LGS  GL  SP+++ + G    F  FG  G +W  VW S 
Sbjct  219   RWFPRSERSRAVGIAMAGFQLGSAAGLLISPIIMSRTGVFGPFIIFGLFGFLWVLVWASA  278

Query  1129  AHSSplddpellpeekkLILRNSVSKEPVKSI---------PWKLILSKPPVWALIVSHF  977
               S+P   P++   E   I +    K+PV  I         P+K +LSK P WALI ++ 
Sbjct  279   TSSTPERHPQISKSELDYIGQRE--KQPVSKIKKPEKIMIPPFKKLLSKLPTWALIFANS  336

Query  976   CHNWGTFILLTWMPTYYHQVLKFNLTESGMFAVLPWLTMAFSAYAGGWIADSLVRKGVSV  797
              H+WG F++L+WMP Y++ V + +L ++  F+ LPW+ MA   Y  G  +D L++ G SV
Sbjct  337   MHSWGYFVILSWMPIYFNTVYRVDLRQAAWFSALPWVMMAVLGYFAGAWSDMLIQNGFSV  396

Query  796   TVVRKIMQTIGFLGPAFFLTQLSHVDSPAMAVLCMTCSQGSDAFSQSGLYSNHQDIAPRY  617
             T  RK+MQ+IGFLGP   L  L+   SP++A   +T + G  +FS +G   N Q++APR+
Sbjct  397   TFTRKLMQSIGFLGPGISLLGLNVAKSPSVASSWLTAAVGLSSFSHAGFLVNLQEVAPRF  456

Query  616   SGVLMGLSNTAGVLAGVFGTAATGYILQH-GSWDDVFKVSVGLYLVGTVVWNLFSTGEKI  440
             +GVL G+SNTAG +A + GT   G+ ++  GS+     ++  LY + T+ W+LF+TGE+I
Sbjct  457   AGVLHGMSNTAGTMAAIMGTVGAGFFVERMGSFQGFLILTSLLYFISTLFWDLFATGERI  516



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6446538126602