BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79217_g1_i1 len=1436 path=[1:0-1435]

Length=1436
                                                                      Score     E

ref|XP_004237503.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     613   0.0      
ref|XP_009777584.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    612   0.0      
ref|XP_009611210.1|  PREDICTED: GDSL esterase/lipase LTL1-like          608   0.0      
ref|XP_006340481.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     602   0.0      
gb|EYU39534.1|  hypothetical protein MIMGU_mgv1a008648mg                592   0.0      
ref|XP_007030304.1|  Li-tolerant lipase 1 isoform 1                     586   0.0      
ref|XP_011077073.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    584   0.0      
gb|KHG28666.1|  GDSL esterase/lipase LTL1 -like protein                 583   0.0      
ref|XP_008218370.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     583   0.0      
ref|XP_009591832.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     583   0.0      
ref|XP_010102187.1|  GDSL esterase/lipase                               583   0.0      
ref|XP_006443287.1|  hypothetical protein CICLE_v10020709mg             583   0.0      
ref|XP_007206865.1|  hypothetical protein PRUPE_ppb006257mg             581   0.0      
ref|XP_002522020.1|  zinc finger protein, putative                      581   0.0      Ricinus communis
ref|XP_009769587.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     580   0.0      
ref|XP_006340478.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     578   0.0      
ref|XP_010648948.1|  PREDICTED: GDSL esterase/lipase At5g33370          578   0.0      
emb|CBI28652.3|  unnamed protein product                                577   0.0      
ref|XP_011076887.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     575   0.0      
ref|XP_002325360.1|  hypothetical protein POPTR_0019s04130g             573   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009631850.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     573   0.0      
ref|XP_004237506.1|  PREDICTED: GDSL esterase/lipase At5g33370          573   0.0      
ref|XP_010243647.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     572   0.0      
ref|XP_009764127.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    572   0.0      
ref|XP_008370769.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     571   0.0      
ref|XP_008388755.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     571   0.0      
ref|XP_011002016.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     571   0.0      
ref|XP_010558733.1|  PREDICTED: GDSL esterase/lipase LTL1               569   0.0      
emb|CAN67727.1|  hypothetical protein VITISV_038832                     568   0.0      Vitis vinifera
ref|XP_004302114.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     568   0.0      
ref|XP_009348739.1|  PREDICTED: GDSL esterase/lipase LTL1-like          568   0.0      
ref|XP_002268296.2|  PREDICTED: GDSL esterase/lipase At5g33370          568   0.0      Vitis vinifera
ref|XP_003554732.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     567   0.0      
ref|XP_007147233.1|  hypothetical protein PHAVU_006G107100g             566   0.0      
ref|XP_007147234.1|  hypothetical protein PHAVU_006G107200g             567   0.0      
gb|KHN43145.1|  GDSL esterase/lipase                                    566   0.0      
ref|XP_004513280.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     566   0.0      
ref|XP_003554731.1|  PREDICTED: GDSL esterase/lipase LTL1-like          566   0.0      
gb|KHN35333.1|  GDSL esterase/lipase                                    565   0.0      
ref|XP_010263996.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     564   0.0      
ref|XP_003521783.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     563   0.0      
ref|XP_011002018.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     563   0.0      
ref|XP_011077072.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     563   0.0      
ref|XP_002522021.1|  zinc finger protein, putative                      563   0.0      Ricinus communis
ref|XP_006854343.1|  hypothetical protein AMTR_s00039p00143210          562   0.0      
ref|XP_009379726.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     561   0.0      
gb|ACR33100.1|  putative tea geometrid larvae-inducible protein         561   0.0      Camellia sinensis [black tea]
emb|CDP04255.1|  unnamed protein product                                561   0.0      
ref|XP_003521782.1|  PREDICTED: GDSL esterase/lipase LTL1-like is...    561   0.0      
ref|XP_002268826.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     561   0.0      Vitis vinifera
ref|XP_011038448.1|  PREDICTED: GDSL esterase/lipase At5g33370          560   0.0      
gb|KHN35332.1|  GDSL esterase/lipase LTL1                               560   0.0      
ref|XP_006371114.1|  hypothetical protein POPTR_0019s04150g             561   0.0      
ref|XP_007205392.1|  hypothetical protein PRUPE_ppa007427mg             560   0.0      
emb|CBI28654.3|  unnamed protein product                                559   0.0      
ref|XP_010435380.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     559   0.0      
ref|XP_004494760.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     559   0.0      
ref|XP_008218371.1|  PREDICTED: GDSL esterase/lipase LTL1-like          560   0.0      
ref|NP_198322.1|  GDSL esterase/lipase                                  558   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626495.1|  GDSL esterase/lipase                               558   0.0      
ref|XP_003520948.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    558   0.0      
ref|XP_010440676.1|  PREDICTED: GDSL esterase/lipase At5g33370 is...    558   0.0      
gb|EYU39770.1|  hypothetical protein MIMGU_mgv1a009318mg                556   0.0      
ref|XP_011002019.1|  PREDICTED: GDSL esterase/lipase LTL1-like          556   0.0      
emb|CAN66351.1|  hypothetical protein VITISV_039098                     556   0.0      Vitis vinifera
ref|XP_002868396.1|  GDSL-motif lipase/hydrolase family protein         556   0.0      
ref|XP_003555561.1|  PREDICTED: GDSL esterase/lipase At5g33370          556   0.0      
ref|XP_006283972.1|  hypothetical protein CARUB_v10005096mg             556   0.0      
gb|KHN04961.1|  GDSL esterase/lipase                                    556   0.0      
ref|XP_002319125.1|  hypothetical protein POPTR_0013s04790g             556   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006375868.1|  hypothetical protein POPTR_0013s04790g             556   0.0      
ref|XP_010918935.1|  PREDICTED: GDSL esterase/lipase LTL1               556   0.0      
gb|ABK95911.1|  unknown                                                 555   0.0      Populus trichocarpa [western balsam poplar]
emb|CDO99962.1|  unnamed protein product                                555   0.0      
gb|KDP23751.1|  hypothetical protein JCGZ_23584                         555   0.0      
gb|ACU23725.1|  unknown                                                 555   0.0      Glycine max [soybeans]
ref|XP_002319124.2|  hypothetical protein POPTR_0013s04780g             557   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006403052.1|  hypothetical protein EUTSA_v10003456mg             555   0.0      
ref|XP_008441804.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     555   0.0      
gb|KHN43144.1|  GDSL esterase/lipase                                    554   0.0      
ref|XP_010530492.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    554   0.0      
ref|XP_006577328.1|  PREDICTED: GDSL esterase/lipase LTL1-like is...    555   0.0      
ref|XP_006350943.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     553   0.0      
ref|XP_011084724.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     553   0.0      
ref|XP_003626492.1|  GDSL esterase/lipase                               553   0.0      
ref|XP_008810810.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     553   0.0      
gb|ACU23610.1|  unknown                                                 552   0.0      Glycine max [soybeans]
ref|XP_011038450.1|  PREDICTED: GDSL esterase/lipase LTL1-like          552   0.0      
ref|XP_011084387.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     551   0.0      
ref|XP_007143993.1|  hypothetical protein PHAVU_007G120000g             551   0.0      
ref|XP_004249922.1|  PREDICTED: GDSL esterase/lipase At5g33370          550   0.0      
ref|XP_004152806.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     551   0.0      
ref|XP_004302115.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     550   0.0      
ref|XP_007133949.1|  hypothetical protein PHAVU_010G005800g             550   0.0      
ref|XP_009108075.1|  PREDICTED: GDSL esterase/lipase At5g33370          550   0.0      
ref|XP_004494758.1|  PREDICTED: GDSL esterase/lipase LTL1-like          550   0.0      
ref|XP_008370770.1|  PREDICTED: GDSL esterase/lipase LTL1-like          550   0.0      
ref|XP_008796408.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     550   0.0      
ref|XP_010674245.1|  PREDICTED: GDSL esterase/lipase At5g33370          550   0.0      
ref|XP_003535381.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     550   0.0      
ref|XP_003521784.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     550   0.0      
emb|CDY12384.1|  BnaC08g08210D                                          550   0.0      
ref|XP_006437267.1|  hypothetical protein CICLE_v10033835mg             550   0.0      
emb|CDY47551.1|  BnaA08g07360D                                          550   0.0      
ref|XP_010043320.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     549   0.0      
ref|XP_004495557.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     549   0.0      
ref|NP_001237641.2|  uncharacterized LOC100500155 precursor             549   0.0      
ref|XP_006484791.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     549   0.0      
gb|KDO46628.1|  hypothetical protein CISIN_1g041652mg                   548   0.0      
ref|XP_008789479.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     548   0.0      
ref|XP_002522022.1|  zinc finger protein, putative                      548   0.0      Ricinus communis
ref|XP_004155142.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     551   0.0      
gb|KFK24279.1|  hypothetical protein AALP_AAs47157U000200               548   0.0      
ref|XP_008370782.1|  PREDICTED: GDSL esterase/lipase LTL1-like          547   0.0      
ref|XP_009348738.1|  PREDICTED: GDSL esterase/lipase LTL1-like          547   0.0      
ref|XP_008345728.1|  PREDICTED: GDSL esterase/lipase LTL1-like          547   0.0      
gb|EYU39533.1|  hypothetical protein MIMGU_mgv1a008571mg                547   0.0      
ref|XP_004489545.1|  PREDICTED: GDSL esterase/lipase LTL1-like          546   0.0      
ref|XP_002325359.2|  hypothetical protein POPTR_0019s04110g             548   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003589465.1|  GDSL esterase/lipase                               546   0.0      
ref|XP_002325361.2|  hypothetical protein POPTR_0019s04140g             546   0.0      Populus trichocarpa [western balsam poplar]
gb|KHN14896.1|  GDSL esterase/lipase                                    546   0.0      
ref|XP_010940685.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     544   0.0      
ref|XP_006443291.1|  hypothetical protein CICLE_v10020640mg             544   0.0      
ref|XP_010485798.1|  PREDICTED: GDSL esterase/lipase LTL1-like          545   0.0      
ref|XP_010463906.1|  PREDICTED: GDSL esterase/lipase LTL1               543   0.0      
gb|KCW61461.1|  hypothetical protein EUGRSUZ_H04197                     543   0.0      
ref|XP_002265999.1|  PREDICTED: GDSL esterase/lipase At4g28780          543   0.0      Vitis vinifera
gb|AAS75127.1|  GDSL-motif lipase                                       542   0.0      Agave americana [century plant]
gb|EYU33157.1|  hypothetical protein MIMGU_mgv1a008646mg                542   0.0      
ref|XP_003521785.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     541   0.0      
ref|XP_011002017.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     541   0.0      
ref|XP_010413520.1|  PREDICTED: GDSL esterase/lipase LTL1               541   0.0      
ref|XP_003553269.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     541   0.0      
ref|XP_010024922.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     541   0.0      
ref|NP_187079.1|  Li-tolerant lipase 1                                  541   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009348740.1|  PREDICTED: GDSL esterase/lipase LTL1-like          541   0.0      
gb|KDO52498.1|  hypothetical protein CISIN_1g017684mg                   541   0.0      
ref|XP_007030301.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    541   0.0      
ref|XP_009379724.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     541   0.0      
ref|XP_009389128.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     543   0.0      
ref|XP_003553249.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     540   0.0      
ref|XP_003554997.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     540   0.0      
ref|XP_006478980.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     540   0.0      
ref|XP_009134760.1|  PREDICTED: GDSL esterase/lipase LTL1               540   0.0      
ref|XP_006443290.1|  hypothetical protein CICLE_v10020515mg             541   0.0      
ref|XP_007151673.1|  hypothetical protein PHAVU_004G066300g             540   0.0      
ref|XP_010043319.1|  PREDICTED: GDSL esterase/lipase LTL1-like          540   0.0      
ref|XP_004494761.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     540   0.0      
ref|XP_002884438.1|  Li-tolerant lipase 1                               539   0.0      
gb|EPS65950.1|  hypothetical protein M569_08823                         538   0.0      
ref|XP_003541357.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     539   0.0      
gb|ACG37655.1|  anther-specific proline-rich protein APG                539   0.0      Zea mays [maize]
ref|XP_007151676.1|  hypothetical protein PHAVU_004G066600g             539   0.0      
gb|KFK37853.1|  hypothetical protein AALP_AA3G037800                    538   0.0      
emb|CDX92063.1|  BnaC03g33650D                                          538   0.0      
ref|XP_003524731.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     538   0.0      
gb|KHN14884.1|  GDSL esterase/lipase                                    538   0.0      
ref|XP_003553275.1|  PREDICTED: GDSL esterase/lipase At5g33370          538   0.0      
gb|KHG28665.1|  hypothetical protein F383_15485                         538   0.0      
ref|XP_004976167.1|  PREDICTED: GDSL esterase/lipase LTL1-like          536   0.0      
gb|KEH28987.1|  GDSL-like lipase/acylhydrolase                          536   0.0      
ref|XP_004494759.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     536   0.0      
ref|NP_001141295.1|  uncharacterized protein LOC100273386 precursor     536   0.0      Zea mays [maize]
ref|XP_007030303.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    536   0.0      
ref|XP_007151675.1|  hypothetical protein PHAVU_004G066500g             536   0.0      
gb|ACU23289.1|  unknown                                                 535   0.0      Glycine max [soybeans]
gb|KHN35335.1|  GDSL esterase/lipase                                    534   0.0      
gb|KCW85323.1|  hypothetical protein EUGRSUZ_B02163                     535   0.0      
ref|XP_003554733.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     535   0.0      
ref|XP_003533553.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     535   0.0      
gb|EYU19868.1|  hypothetical protein MIMGU_mgv1a008447mg                535   0.0      
ref|XP_006297961.1|  hypothetical protein CARUB_v10014002mg             534   0.0      
ref|XP_008388753.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     534   0.0      
ref|XP_002446760.1|  hypothetical protein SORBIDRAFT_06g021990          534   0.0      Sorghum bicolor [broomcorn]
ref|XP_009405750.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     532   0.0      
ref|XP_008677149.1|  PREDICTED: uncharacterized protein LOC100280...    532   0.0      
ref|XP_003552505.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     533   0.0      
ref|XP_010936081.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     532   0.0      
ref|XP_003626493.1|  GDSL esterase/lipase                               531   0.0      
ref|XP_003543915.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     532   0.0      
gb|KHN13664.1|  GDSL esterase/lipase                                    531   0.0      
ref|XP_009385316.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     531   0.0      
ref|XP_008350788.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     529   0.0      
ref|XP_007147237.1|  hypothetical protein PHAVU_006G107400g             530   0.0      
ref|XP_004953113.1|  PREDICTED: GDSL esterase/lipase LTL1-like          530   0.0      
ref|XP_008443761.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    530   0.0      
ref|NP_001053264.1|  Os04g0507700                                       530   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KHN41491.1|  GDSL esterase/lipase                                    529   0.0      
gb|ACU23502.1|  unknown                                                 528   0.0      Glycine max [soybeans]
ref|XP_011083094.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    528   0.0      
ref|XP_009589092.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     528   0.0      
gb|AES82718.2|  GDSL-like lipase/acylhydrolase                          528   0.0      
ref|XP_003590909.1|  GDSL esterase/lipase                               528   0.0      
ref|XP_003618755.1|  GDSL esterase/lipase                               528   0.0      
ref|XP_009766488.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     528   0.0      
ref|XP_009587010.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     528   0.0      
ref|NP_001241754.1|  anther-specific proline-rich protein APG pre...    528   0.0      
gb|EMT19317.1|  GDSL esterase/lipase                                    528   0.0      
ref|XP_009801786.1|  PREDICTED: GDSL esterase/lipase LTL1-like          527   0.0      
gb|KHN14886.1|  GDSL esterase/lipase                                    527   0.0      
ref|NP_001132075.1|  uncharacterized protein LOC100193489 precursor     526   0.0      Zea mays [maize]
dbj|BAK06471.1|  predicted protein                                      526   0.0      
dbj|BAK07334.1|  predicted protein                                      525   0.0      
gb|ABX75139.1|  lipase                                                  525   0.0      Gossypium hirsutum [American cotton]
emb|CDP03830.1|  unnamed protein product                                525   0.0      
ref|NP_001047441.1|  Os02g0617400                                       525   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY86703.1|  hypothetical protein OsI_08086                          525   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001146251.1|  hypothetical protein precursor                     525   0.0      Zea mays [maize]
ref|XP_004292262.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     524   0.0      
emb|CDY42916.1|  BnaC05g47350D                                          523   0.0      
ref|XP_003580102.1|  PREDICTED: GDSL esterase/lipase LTL1               524   0.0      
ref|XP_003554996.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     523   0.0      
ref|XP_004142546.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     523   0.0      
ref|XP_009124003.1|  PREDICTED: GDSL esterase/lipase LTL1-like          523   0.0      
emb|CDY49349.1|  BnaA05g33110D                                          522   2e-180   
ref|XP_006408203.1|  hypothetical protein EUTSA_v10020986mg             521   3e-180   
ref|XP_008810066.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     521   3e-180   
ref|XP_009386573.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     521   3e-180   
ref|XP_008235540.1|  PREDICTED: GDSL esterase/lipase At4g28780          519   3e-179   
ref|XP_004242381.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     518   4e-179   
ref|XP_006660400.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     519   4e-179   
ref|XP_006652494.1|  PREDICTED: GDSL esterase/lipase LTL1-like          519   5e-179   
emb|CDY35219.1|  BnaA01g08120D                                          516   1e-178   
ref|XP_009129278.1|  PREDICTED: GDSL esterase/lipase At4g28780          517   1e-178   
ref|XP_006352714.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     517   2e-178   
ref|XP_002303095.1|  GDSL-motif lipase/hydrolase family protein         517   3e-178   Populus trichocarpa [western balsam poplar]
ref|XP_002467122.1|  hypothetical protein SORBIDRAFT_01g020000          516   4e-178   Sorghum bicolor [broomcorn]
ref|XP_006412910.1|  hypothetical protein EUTSA_v10025523mg             516   5e-178   
ref|XP_010524958.1|  PREDICTED: GDSL esterase/lipase At5g18430          516   7e-178   
emb|CDY06871.1|  BnaC01g09700D                                          515   7e-178   
ref|XP_003573228.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     516   8e-178   
ref|XP_010447915.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     515   9e-178   
emb|CDP04257.1|  unnamed protein product                                514   1e-177   
gb|EMT08293.1|  GDSL esterase/lipase LTL1                               513   5e-177   
ref|XP_004982954.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     513   5e-177   
gb|KFK29417.1|  hypothetical protein AALP_AA7G132000                    513   5e-177   
gb|EMS62626.1|  GDSL esterase/lipase LTL1                               513   6e-177   
ref|XP_004489173.1|  PREDICTED: GDSL esterase/lipase LTL1-like          512   1e-176   
ref|XP_010528706.1|  PREDICTED: GDSL esterase/lipase LTL1-like          512   2e-176   
dbj|BAJ85303.1|  predicted protein                                      512   2e-176   
ref|XP_003574015.1|  PREDICTED: GDSL esterase/lipase LTL1               512   2e-176   
gb|ACR37591.1|  unknown                                                 511   3e-176   Zea mays [maize]
ref|XP_002869473.1|  GDSL-motif lipase/hydrolase family protein         510   5e-176   
gb|AFW63005.1|  hypothetical protein ZEAMMB73_059549                    511   6e-176   
ref|XP_007139614.1|  hypothetical protein PHAVU_008G044500g             510   8e-176   
gb|ACG46653.1|  anther-specific proline-rich protein APG precursor      511   1e-175   Zea mays [maize]
gb|KEH21597.1|  GDSL-like lipase/acylhydrolase                          509   1e-175   
ref|NP_001136990.1|  uncharacterized protein LOC100217152               510   3e-175   Zea mays [maize]
gb|EPS69813.1|  hypothetical protein M569_04951                         508   3e-175   
ref|XP_006350316.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     508   5e-175   
ref|XP_010438383.1|  PREDICTED: GDSL esterase/lipase At4g28780          508   6e-175   
ref|NP_001062538.1|  Os08g0565900                                       509   7e-175   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008382662.1|  PREDICTED: GDSL esterase/lipase At4g28780          508   1e-174   
gb|KHN48972.1|  GDSL esterase/lipase                                    507   2e-174   
ref|XP_010433162.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     506   5e-174   
gb|KGN66731.1|  hypothetical protein Csa_1G665920                       505   5e-174   
ref|XP_004247304.1|  PREDICTED: GDSL esterase/lipase At4g28780          506   5e-174   
ref|XP_010069682.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     506   8e-174   
ref|XP_003542450.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     505   1e-173   
ref|XP_006283981.1|  hypothetical protein CARUB_v10005104mg             504   1e-173   
ref|XP_006661836.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     504   3e-173   
ref|XP_002521156.1|  zinc finger protein, putative                      503   4e-173   Ricinus communis
ref|XP_003536954.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     503   6e-173   
ref|NP_194607.1|  GDSL esterase/lipase                                  503   9e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007144437.1|  hypothetical protein PHAVU_007G156000g             502   1e-172   
gb|KHN05905.1|  GDSL esterase/lipase                                    502   2e-172   
gb|ACU23670.1|  unknown                                                 502   2e-172   Glycine max [soybeans]
gb|ACG31868.1|  anther-specific proline-rich protein APG precursor      501   2e-172   Zea mays [maize]
gb|KEH42418.1|  GDSL-like lipase/acylhydrolase                          499   2e-171   
gb|AEY85024.1|  zinc finger protein                                     499   3e-171   
ref|XP_006400391.1|  hypothetical protein EUTSA_v10013876mg             498   1e-170   
ref|NP_001064786.1|  Os10g0463200                                       498   1e-170   Oryza sativa Japonica Group [Japonica rice]
gb|AAN05519.1|  putative early nodulin gene (Enod) related protein      497   2e-170   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010038336.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     496   4e-170   
ref|XP_004495029.1|  PREDICTED: GDSL esterase/lipase At4g28780-li...    496   4e-170   
ref|XP_009398857.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     496   5e-170   
gb|EYU46367.1|  hypothetical protein MIMGU_mgv1a008634mg                494   3e-169   
gb|KDO52499.1|  hypothetical protein CISIN_1g017684mg                   493   3e-169   
ref|XP_004304788.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     493   9e-169   
ref|XP_011024535.1|  PREDICTED: GDSL esterase/lipase At4g28780          492   2e-168   
ref|XP_004495028.1|  PREDICTED: GDSL esterase/lipase At4g28780-li...    490   7e-168   
ref|XP_008364335.1|  PREDICTED: GDSL esterase/lipase LTL1-like          489   2e-167   
gb|AFW58803.1|  hypothetical protein ZEAMMB73_832786                    487   2e-167   
ref|XP_008345732.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     489   3e-167   
ref|NP_197344.2|  GDSL esterase/lipase                                  486   2e-166   
ref|XP_004955275.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     487   6e-166   
ref|XP_002873894.1|  predicted protein                                  484   1e-165   
ref|XP_003570388.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     484   1e-165   
ref|XP_007201335.1|  hypothetical protein PRUPE_ppa007652mg             484   2e-165   
ref|XP_010530493.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    481   2e-165   
emb|CDY02631.1|  BnaC02g08040D                                          484   2e-165   
ref|XP_008643799.1|  PREDICTED: anther-specific proline-rich prot...    483   6e-165   
gb|EPS67986.1|  hypothetical protein M569_06783                         481   9e-165   
ref|NP_001151440.1|  anther-specific proline-rich protein APG pre...    482   2e-164   
ref|XP_009126251.1|  PREDICTED: GDSL esterase/lipase At5g18430          481   2e-164   
gb|EAY88013.1|  hypothetical protein OsI_09436                          481   4e-164   
ref|NP_001048510.1|  Os02g0816200                                       479   1e-163   
ref|XP_007162645.1|  hypothetical protein PHAVU_001G168200g             480   2e-163   
ref|XP_010492845.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     478   3e-163   
ref|XP_002454777.1|  hypothetical protein SORBIDRAFT_04g037130          478   6e-163   
gb|KFK26081.1|  hypothetical protein AALP_AA8G200400                    477   1e-162   
ref|XP_010454082.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     476   2e-162   
ref|XP_010420599.1|  PREDICTED: GDSL esterase/lipase At5g18430          476   2e-162   
gb|AFW64010.1|  hypothetical protein ZEAMMB73_688590                    476   4e-162   
gb|EMT04884.1|  GDSL esterase/lipase                                    472   5e-161   
dbj|BAJ90848.1|  predicted protein                                      473   8e-161   
gb|EMS53263.1|  GDSL esterase/lipase LTL1                               471   2e-160   
ref|XP_006287983.1|  hypothetical protein CARUB_v10001218mg             471   3e-160   
ref|XP_009777585.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    469   3e-160   
ref|XP_010684826.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     470   5e-160   
dbj|BAJ91997.1|  predicted protein                                      470   8e-160   
gb|EMT16609.1|  GDSL esterase/lipase                                    469   2e-159   
ref|XP_003590908.1|  GDSL esterase/lipase                               465   4e-158   
emb|CDX74196.1|  BnaA03g28510D                                          449   2e-152   
gb|EMT05671.1|  GDSL esterase/lipase                                    445   6e-151   
gb|KDO52501.1|  hypothetical protein CISIN_1g017684mg                   442   5e-150   
ref|XP_006443680.1|  hypothetical protein CICLE_v10020728mg             444   1e-149   
gb|EMT14508.1|  GDSL esterase/lipase                                    443   1e-149   
gb|EPS60817.1|  hypothetical protein M569_13984                         439   3e-149   
ref|XP_006443286.1|  hypothetical protein CICLE_v10020709mg             439   6e-149   
ref|XP_009371058.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    441   6e-149   
ref|XP_006443292.1|  hypothetical protein CICLE_v10020640mg             437   3e-148   
gb|KCW61468.1|  hypothetical protein EUGRSUZ_H04205                     434   9e-147   
ref|XP_003626500.1|  GDSL esterase/lipase                               432   3e-146   
ref|XP_002522023.1|  zinc finger protein, putative                      435   4e-146   
ref|XP_010440677.1|  PREDICTED: GDSL esterase/lipase At5g33370 is...    426   4e-143   
ref|NP_001078631.1|  GDSL esterase/lipase                               423   5e-142   
ref|XP_007147235.1|  hypothetical protein PHAVU_006G1073001g            420   1e-141   
ref|XP_006576592.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    420   6e-141   
gb|AFW63007.1|  hypothetical protein ZEAMMB73_059549                    410   3e-137   
gb|KDO52500.1|  hypothetical protein CISIN_1g017684mg                   407   6e-136   
ref|XP_008443762.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    402   7e-134   
ref|XP_011083095.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    395   1e-131   
gb|ABK25359.1|  unknown                                                 397   2e-131   
gb|ABK22816.1|  unknown                                                 394   2e-130   
ref|XP_003520622.2|  PREDICTED: GDSL esterase/lipase At4g28780-like     392   8e-130   
gb|KHN47677.1|  GDSL esterase/lipase                                    387   6e-129   
gb|KCW50155.1|  hypothetical protein EUGRSUZ_K03589                     375   1e-123   
gb|ABR17593.1|  unknown                                                 375   5e-123   
ref|XP_004173982.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     366   4e-121   
gb|ACU18148.1|  unknown                                                 348   8e-114   
ref|XP_002975076.1|  hypothetical protein SELMODRAFT_174517             328   2e-104   
gb|AFK40233.1|  unknown                                                 317   2e-102   
ref|XP_002988967.1|  hypothetical protein SELMODRAFT_129056             319   6e-101   
ref|XP_002988963.1|  hypothetical protein SELMODRAFT_128933             318   1e-100   
ref|XP_002988966.1|  hypothetical protein SELMODRAFT_128884             311   5e-98    
ref|XP_003589453.1|  GDSL esterase/lipase                               312   6e-98    
gb|ACU17474.1|  unknown                                                 303   8e-97    
gb|EAY78821.1|  hypothetical protein OsI_33925                          306   1e-96    
ref|XP_002975075.1|  hypothetical protein SELMODRAFT_232422             304   1e-95    
ref|XP_002522024.1|  carboxylic ester hydrolase, putative               300   3e-95    
gb|EPS72894.1|  hypothetical protein M569_01863                         296   1e-94    
ref|XP_002960678.1|  hypothetical protein SELMODRAFT_403122             301   3e-94    
gb|KHN14888.1|  GDSL esterase/lipase                                    291   2e-92    
ref|XP_002983359.1|  hypothetical protein SELMODRAFT_118141             296   2e-92    
tpg|DAA37013.1|  TPA: hypothetical protein ZEAMMB73_160387              290   1e-91    
ref|XP_001764401.1|  predicted protein                                  292   1e-90    
ref|XP_003626494.1|  GDSL esterase/lipase                               283   3e-89    
gb|AES61163.2|  GDSL-like lipase/acylhydrolase                          279   1e-87    
gb|KHN14798.1|  GDSL esterase/lipase                                    278   1e-87    
gb|ACU15087.1|  unknown                                                 277   5e-87    
ref|XP_001758743.1|  predicted protein                                  281   4e-86    
gb|ACU15164.1|  unknown                                                 271   8e-85    
ref|XP_011038584.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     267   2e-83    
ref|XP_009411706.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     273   4e-83    
gb|AAP35038.1|  putative GDSL-motif lipase                              265   7e-83    
ref|XP_006387004.1|  hypothetical protein POPTR_2251s00200g             264   2e-82    
gb|KHG07651.1|  hypothetical protein F383_34423                         268   2e-81    
emb|CDY54699.1|  BnaC01g42330D                                          268   5e-81    
ref|XP_006658083.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     268   5e-81    
ref|XP_009101821.1|  PREDICTED: GDSL esterase/lipase At3g50400          267   7e-81    
ref|XP_009366174.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     266   2e-80    
ref|XP_008339077.1|  PREDICTED: GDSL esterase/lipase At2g23540          266   2e-80    
ref|XP_009376483.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     266   3e-80    
ref|XP_003632456.1|  PREDICTED: GDSL esterase/lipase At2g23540          265   3e-80    
ref|XP_007047124.1|  Ankyrin repeat-containing protein isoform 1        266   4e-80    
ref|XP_010938710.1|  PREDICTED: GDSL esterase/lipase At2g23540          265   5e-80    
ref|XP_004145849.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     265   7e-80    
ref|XP_004509186.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     264   1e-79    
ref|XP_002972805.1|  hypothetical protein SELMODRAFT_232013             263   1e-79    
ref|XP_011085659.1|  PREDICTED: GDSL esterase/lipase At2g23540          263   3e-79    
dbj|BAK00337.1|  predicted protein                                      263   3e-79    
ref|XP_008796209.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     263   3e-79    
ref|XP_003562492.1|  PREDICTED: GDSL esterase/lipase At2g23540          263   4e-79    
gb|KHG08353.1|  hypothetical protein F383_35589                         263   4e-79    
ref|XP_010070488.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     262   7e-79    
ref|XP_001757546.1|  predicted protein                                  262   8e-79    
gb|EAZ05071.1|  hypothetical protein OsI_27261                          261   9e-79    
ref|XP_009367135.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     261   9e-79    
ref|XP_010028324.1|  PREDICTED: GDSL esterase/lipase At2g23540          261   9e-79    
ref|XP_010548387.1|  PREDICTED: GDSL esterase/lipase At2g23540          262   1e-78    
ref|XP_008241574.1|  PREDICTED: GDSL esterase/lipase At2g23540          261   1e-78    
ref|XP_008457023.1|  PREDICTED: GDSL esterase/lipase At5g37690          261   1e-78    
ref|XP_004300561.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     261   1e-78    
ref|XP_008381376.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     261   1e-78    
ref|XP_006414376.1|  hypothetical protein EUTSA_v10027022mg             261   2e-78    
ref|XP_009117276.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     261   3e-78    
ref|XP_002878691.1|  GDSL-motif lipase/hydrolase family protein         261   3e-78    
emb|CDX76857.1|  BnaC08g34430D                                          260   5e-78    
ref|NP_179935.1|  GDSL esterase/lipase                                  260   6e-78    
ref|XP_002531921.1|  zinc finger protein, putative                      259   7e-78    
ref|XP_007154385.1|  hypothetical protein PHAVU_003G114800g             259   8e-78    
ref|XP_007204479.1|  hypothetical protein PRUPE_ppa021185mg             258   2e-77    
ref|XP_010680502.1|  PREDICTED: GDSL esterase/lipase At2g23540          259   2e-77    
ref|XP_006384153.1|  hypothetical protein POPTR_0004s08520g             258   2e-77    
ref|XP_010088998.1|  GDSL esterase/lipase                               258   2e-77    
ref|XP_002870171.1|  hypothetical protein ARALYDRAFT_355138             258   3e-77    
ref|XP_010108989.1|  GDSL esterase/lipase                               257   3e-77    
gb|KEH20480.1|  GDSL-like lipase/acylhydrolase                          258   3e-77    
gb|EYU39392.1|  hypothetical protein MIMGU_mgv1a018005mg                257   6e-77    
ref|XP_010271296.1|  PREDICTED: GDSL esterase/lipase At5g37690          257   7e-77    
ref|XP_002984381.1|  hypothetical protein SELMODRAFT_120432             256   8e-77    
ref|XP_006372567.1|  hypothetical protein POPTR_0017s02870g             256   9e-77    
gb|KFK36130.1|  hypothetical protein AALP_AA4G081500                    255   9e-77    
gb|KDO50801.1|  hypothetical protein CISIN_1g041889mg                   256   1e-76    
gb|KHN36184.1|  GDSL esterase/lipase                                    256   1e-76    
ref|XP_006404839.1|  hypothetical protein EUTSA_v10000195mg             257   1e-76    
ref|XP_006404033.1|  hypothetical protein EUTSA_v10010459mg             256   1e-76    
ref|XP_006482381.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     255   1e-76    
ref|XP_007047125.1|  Ankyrin repeat-containing protein isoform 2        256   2e-76    
ref|NP_001240089.1|  uncharacterized protein LOC100795221 precursor     255   3e-76    
gb|ABR18010.1|  unknown                                                 255   3e-76    
gb|AFK33443.1|  unknown                                                 249   3e-76    
ref|NP_190609.1|  GDSL esterase/lipase                                  255   3e-76    
emb|CDX89578.1|  BnaC04g35970D                                          255   4e-76    
ref|XP_003518088.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     255   4e-76    
ref|XP_008457861.1|  PREDICTED: GDSL esterase/lipase At2g23540          255   4e-76    
ref|XP_002876029.1|  GDSL-motif lipase/hydrolase family protein         254   4e-76    
ref|XP_009789284.1|  PREDICTED: GDSL esterase/lipase At5g37690          254   5e-76    
ref|XP_006430582.1|  hypothetical protein CICLE_v10013564mg             254   5e-76    
ref|XP_010549002.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     254   5e-76    
ref|XP_007216510.1|  hypothetical protein PRUPE_ppa025674mg             254   6e-76    
ref|XP_002988284.1|  hypothetical protein SELMODRAFT_127685             253   6e-76    
ref|XP_009136755.1|  PREDICTED: GDSL esterase/lipase At4g16230          254   6e-76    
ref|XP_002968205.1|  hypothetical protein SELMODRAFT_89823              254   7e-76    
ref|XP_002963881.1|  hypothetical protein SELMODRAFT_80725              253   8e-76    
ref|XP_003537385.1|  PREDICTED: GDSL esterase/lipase At2g23540 is...    254   8e-76    
ref|XP_011001569.1|  PREDICTED: GDSL esterase/lipase At5g37690          253   8e-76    
ref|XP_011007241.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     253   8e-76    
ref|XP_006285255.1|  hypothetical protein CARUB_v10006620mg             254   9e-76    
emb|CDP02449.1|  unnamed protein product                                254   1e-75    
gb|KDP31854.1|  hypothetical protein JCGZ_12315                         254   1e-75    
emb|CDY38949.1|  BnaA04g13700D                                          254   1e-75    
ref|XP_002976172.1|  hypothetical protein SELMODRAFT_104120             253   1e-75    
emb|CDY09704.1|  BnaC07g33570D                                          253   1e-75    
ref|XP_010426585.1|  PREDICTED: GDSL esterase/lipase At3g50400-like     253   2e-75    
ref|XP_009140469.1|  PREDICTED: GDSL esterase/lipase At2g23540          254   2e-75    
ref|XP_010515402.1|  PREDICTED: GDSL esterase/lipase At3g50400-like     253   2e-75    
ref|XP_001753090.1|  predicted protein                                  252   2e-75    
ref|XP_010503713.1|  PREDICTED: GDSL esterase/lipase At3g50400          252   4e-75    
ref|XP_004148069.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     252   4e-75    
ref|XP_010549442.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     252   5e-75    
ref|XP_004958621.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     252   5e-75    
gb|KGN62048.1|  hypothetical protein Csa_2G292780                       252   6e-75    
ref|XP_007155978.1|  hypothetical protein PHAVU_003G248600g             252   6e-75    
ref|XP_003528618.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     251   7e-75    
ref|XP_006285681.1|  hypothetical protein CARUB_v10007145mg             251   8e-75    
ref|XP_010062263.1|  PREDICTED: GDSL esterase/lipase At5g37690          251   8e-75    
ref|XP_009384395.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     251   1e-74    
sp|O23470.2|GDL64_ARATH  RecName: Full=GDSL esterase/lipase At4g1...    250   2e-74    
ref|XP_009102834.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     250   2e-74    
gb|KDO71951.1|  hypothetical protein CISIN_1g047579mg                   250   2e-74    
ref|XP_009589693.1|  PREDICTED: GDSL esterase/lipase At5g37690          250   2e-74    
ref|XP_007032977.1|  SGNH hydrolase-type esterase superfamily pro...    251   2e-74    
ref|XP_001764592.1|  predicted protein                                  250   2e-74    
ref|XP_004232068.1|  PREDICTED: GDSL esterase/lipase At2g23540          249   4e-74    
ref|XP_006419373.1|  hypothetical protein CICLE_v10005252mg             249   4e-74    
ref|XP_007035821.1|  GDSL esterase/lipase isoform 2                     249   4e-74    
ref|XP_011039251.1|  PREDICTED: GDSL esterase/lipase At2g23540          249   5e-74    
ref|XP_009600015.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     249   5e-74    
emb|CDX94689.1|  BnaC07g09690D                                          249   5e-74    
ref|XP_006488836.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     249   6e-74    
ref|XP_006291327.1|  hypothetical protein CARUB_v10017460mg             249   8e-74    
ref|XP_002310763.2|  GDSL-motif lipase/hydrolase family protein         249   9e-74    
ref|XP_010434862.1|  PREDICTED: GDSL esterase/lipase At4g16230          249   9e-74    
gb|AAX20033.1|  GDSL-lipase protein                                     248   9e-74    
ref|XP_009412862.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     249   9e-74    
ref|XP_010528545.1|  PREDICTED: GDSL esterase/lipase At5g37690          248   1e-73    
ref|XP_002522360.1|  zinc finger protein, putative                      249   1e-73    
ref|XP_006573614.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     249   1e-73    
ref|XP_007156849.1|  hypothetical protein PHAVU_002G022600g             248   1e-73    
ref|XP_001759235.1|  predicted protein                                  247   1e-73    
ref|NP_001148291.1|  anther-specific proline-rich protein APG pre...    248   1e-73    
ref|XP_008228044.1|  PREDICTED: GDSL esterase/lipase At5g37690          248   1e-73    
ref|XP_002870554.1|  hypothetical protein ARALYDRAFT_493746             248   1e-73    
ref|XP_004250176.1|  PREDICTED: GDSL esterase/lipase At5g37690          248   2e-73    
ref|XP_006364625.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     248   2e-73    
ref|XP_010911116.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     248   2e-73    
ref|XP_010649507.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     247   2e-73    
ref|XP_009757598.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     247   3e-73    
ref|XP_010255082.1|  PREDICTED: GDSL esterase/lipase At2g23540          247   3e-73    
gb|KFK34289.1|  hypothetical protein AALP_AA5G125900                    254   3e-73    
ref|XP_010449833.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     247   4e-73    
ref|XP_010440190.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     247   4e-73    
emb|CDX90201.1|  BnaA08g17830D                                          246   4e-73    
ref|XP_009109657.1|  PREDICTED: GDSL esterase/lipase At1g29660          246   4e-73    
ref|XP_010687162.1|  PREDICTED: GDSL esterase/lipase At5g45670          246   5e-73    
ref|XP_006828510.1|  hypothetical protein AMTR_s00060p00187780          246   6e-73    
ref|XP_010540543.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     246   7e-73    



>ref|XP_004237503.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum lycopersicum]
Length=367

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/356 (82%), Positives = 326/356 (92%), Gaps = 1/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+L +LA   + F RAE RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPTHRATGR
Sbjct  13    IVLLVLAFCDLPF-RAEGRAFFVFGDSLVDNGNNNYLVTSARADSPPYGIDYPTHRATGR  71

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISE+LGMEPTLP L+P L G++LLVGANFASAGVGILNDTG+QF NIIRI
Sbjct  72    FSNGLNIPDIISEQLGMEPTLPYLAPQLTGDRLLVGANFASAGVGILNDTGIQFFNIIRI  131

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
             G QLEYFE+YQRRVS LIGA + +QLVN AL+LITLGGNDFVNNYYLVPFSARSRQF++P
Sbjct  132   GKQLEYFEQYQRRVSGLIGAAQTEQLVNSALILITLGGNDFVNNYYLVPFSARSRQFSLP  191

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRKILQ+LYDLG RRV+VTGTGPIGCVPAELAQRSR+GEC+V+LQRAAALF
Sbjct  192   DYVVYLISEYRKILQKLYDLGGRRVLVTGTGPIGCVPAELAQRSRSGECSVELQRAAALF  251

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQLTQMLA+LNS++ A+VF+AANTY M+MDF+ NPQA+GFVTSK+ACCGQGPYNGIGLC
Sbjct  252   NPQLTQMLADLNSQIGANVFIAANTYTMNMDFVSNPQAYGFVTSKIACCGQGPYNGIGLC  311

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNRDIYAFWDPFHPSE+ANRIIVQ I +GS+ YM PMNLSTIM LDSRT
Sbjct  312   TPLSNLCPNRDIYAFWDPFHPSERANRIIVQQILTGSSQYMSPMNLSTIMALDSRT  367



>ref|XP_009777584.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Nicotiana 
sylvestris]
Length=370

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/352 (81%), Positives = 322/352 (91%), Gaps = 0/352 (0%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             +L+L      + E RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYP+HR TGRFSNG
Sbjct  19    MLSLFSFSLHKVEARAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPSHRPTGRFSNG  78

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             LNIPDIISE+LGMEPTLP LSP+L G+KLLVGANFASAGVGILNDTG+QF+NIIRIG QL
Sbjct  79    LNIPDIISEQLGMEPTLPYLSPELTGDKLLVGANFASAGVGILNDTGIQFLNIIRIGKQL  138

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
             EYFE+YQRRVS +IGA + +QLVN ALVLITLGGNDFVNNYYLVPFSARSRQF +PDYV 
Sbjct  139   EYFEQYQRRVSGVIGAEQTQQLVNSALVLITLGGNDFVNNYYLVPFSARSRQFALPDYVR  198

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQL  580
             +LI EYRKILQ+LY+LGARRV+VTGTGP+GCVPAELAQRSR GECAV+LQRAA+LFNPQL
Sbjct  199   YLIYEYRKILQKLYELGARRVLVTGTGPMGCVPAELAQRSRTGECAVELQRAASLFNPQL  258

Query  579   TQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQAS  400
             TQ+L++LN++L ADVFVAANTY MHMDF+ NPQA+GFVTSK+ACCGQGPYNGIGLCT  S
Sbjct  259   TQLLSDLNAQLAADVFVAANTYTMHMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLS  318

Query  399   NLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             NLCPNRD+YAFWDPFHPSEKANRIIVQ I +GS++YM+PMNLS+IM LDSRT
Sbjct  319   NLCPNRDLYAFWDPFHPSEKANRIIVQQILTGSSEYMNPMNLSSIMALDSRT  370



>ref|XP_009611210.1| PREDICTED: GDSL esterase/lipase LTL1-like [Nicotiana tomentosiformis]
Length=369

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/342 (83%), Positives = 317/342 (93%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             + E RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYP+HR TGRFSNGLNIPDIISE+
Sbjct  28    QVEARAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPSHRPTGRFSNGLNIPDIISEQ  87

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LGMEPTLP LSP+L G+KLL+GANFASAGVGILNDTG+QF+NIIRIG QLEYFE+YQRRV
Sbjct  88    LGMEPTLPYLSPELTGDKLLIGANFASAGVGILNDTGIQFLNIIRIGKQLEYFEQYQRRV  147

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             + +IGA + +QLVN ALVLITLGGNDFVNNYYLVPFSARSRQF +PDYV +LISEYRKIL
Sbjct  148   TAVIGAEQTQQLVNSALVLITLGGNDFVNNYYLVPFSARSRQFALPDYVRYLISEYRKIL  207

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
             Q+LY+LGARRV+VTGTGP+GCVPAELAQRS  GECAV+LQRAA+LFNPQLTQ+L++LNS+
Sbjct  208   QKLYELGARRVLVTGTGPMGCVPAELAQRSPTGECAVELQRAASLFNPQLTQLLSDLNSQ  267

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             L ADVFVAANTY MHMDF+ NPQA+GFVTSK+ACCGQGPYNGIGLCT  SNLCPNRD+YA
Sbjct  268   LAADVFVAANTYAMHMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDLYA  327

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWDPFHPSEKANRIIVQ I +GS+ YM+PMNLS+IM LDSRT
Sbjct  328   FWDPFHPSEKANRIIVQQILTGSSTYMNPMNLSSIMALDSRT  369



>ref|XP_006340481.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=367

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/342 (82%), Positives = 317/342 (93%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
               E RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPTHRATGRFSNGLNIPDIISE+
Sbjct  26    EVESRAFFVFGDSLVDNGNNNYLLTSARADSPPYGIDYPTHRATGRFSNGLNIPDIISEQ  85

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LGMEPTLP L+P L G++LLVGANFASAGVGILNDTG+QF NIIRIG QLEYFE+YQRRV
Sbjct  86    LGMEPTLPYLAPQLTGDRLLVGANFASAGVGILNDTGIQFFNIIRIGKQLEYFEQYQRRV  145

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIGA + +QLVN AL+LITLGGNDFVNNYYL+PFSARSRQF++PDYV +LISEYRKIL
Sbjct  146   SGLIGAEQTEQLVNSALILITLGGNDFVNNYYLIPFSARSRQFSLPDYVVYLISEYRKIL  205

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
             Q+LYDLG RRV+VTGTGPIGCVPAELAQRS +GEC+++LQRAAALFNPQLTQMLA+LNS+
Sbjct  206   QKLYDLGGRRVLVTGTGPIGCVPAELAQRSTSGECSIELQRAAALFNPQLTQMLADLNSQ  265

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             + A+VF+AANT+ M+M+F+ NPQA+GFVTSK+ACCGQGPYNGIGLCT  SNLCPNRDIYA
Sbjct  266   IGANVFIAANTFTMNMNFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDIYA  325

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWDPFHPSE+ANRIIVQ I +GS++YM+PMNLST+M LDSRT
Sbjct  326   FWDPFHPSERANRIIVQQILTGSSEYMNPMNLSTVMALDSRT  367



>gb|EYU39534.1| hypothetical protein MIMGU_mgv1a008648mg [Erythranthe guttata]
Length=367

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/341 (81%), Positives = 310/341 (91%), Gaps = 0/341 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             A+ RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPTHR TGRFSNGLNIPDIISE+L
Sbjct  27    ADARAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEQL  86

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             GMEPT+P LSP LKG+KLLVGANFASAGVGILNDTG+QF+NIIRIG Q+EYF++YQ RV+
Sbjct  87    GMEPTMPYLSPFLKGDKLLVGANFASAGVGILNDTGIQFLNIIRIGKQIEYFQQYQTRVA  146

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
               IG  + + LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++PDYV FLISEYRK+L 
Sbjct  147   GQIGPDQTRVLVNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRFLISEYRKVLT  206

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             +LYDLGARRV+VTGTGP+GCVPAELAQRSR GECAV+L RAAALFNPQLT+M++ +NSE+
Sbjct  207   KLYDLGARRVLVTGTGPLGCVPAELAQRSRGGECAVELMRAAALFNPQLTEMISSVNSEI  266

Query  546   KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAF  367
              ADVFVAANTY MHMDF+ NPQA+GF+TSK+ACCGQGPYNGIGLCT  SNLCPNRD+YAF
Sbjct  267   GADVFVAANTYTMHMDFVSNPQAYGFITSKIACCGQGPYNGIGLCTPLSNLCPNRDLYAF  326

Query  366   WDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             WDPFHPSE+ANRIIVQ I +G   YM PMNLSTI+ +DSRT
Sbjct  327   WDPFHPSERANRIIVQQILTGDNKYMKPMNLSTILAVDSRT  367



>ref|XP_007030304.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030305.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 gb|EOY10806.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 gb|EOY10807.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
Length=367

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/357 (79%), Positives = 319/357 (89%), Gaps = 1/357 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             ++LGLL        +AE  RAFFVFGDSLVDNGNNNYLATTARAD  PYGIDYPTHRATG
Sbjct  11    MILGLLLTLGNVAPQAEAARAFFVFGDSLVDNGNNNYLATTARADAYPYGIDYPTHRATG  70

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE++G EPTLP LSP+L G+KLLVGANFASAG+GILNDTG QF+NIIR
Sbjct  71    RFSNGLNIPDLISEQIGSEPTLPYLSPELTGQKLLVGANFASAGIGILNDTGFQFVNIIR  130

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYF++YQ+RVS LIG  + ++LVN+AL+L+TLGGNDFVNNYYLVPFSARSRQF++
Sbjct  131   ISKQLEYFQQYQQRVSALIGPEQTQRLVNQALILMTLGGNDFVNNYYLVPFSARSRQFSL  190

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV ++ISEYRKIL RL+ LGARRV+VTGTGP+GCVPAELAQ SRAGECAV+LQRAAAL
Sbjct  191   PDYVVYIISEYRKILVRLHGLGARRVLVTGTGPLGCVPAELAQHSRAGECAVELQRAAAL  250

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL QML  LN EL +D+F+AAN Y+MHMD+I NPQA+GFVTSKVACCGQGPYNGIGL
Sbjct  251   FNPQLVQMLNGLNRELGSDIFIAANAYDMHMDWISNPQAYGFVTSKVACCGQGPYNGIGL  310

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLCPNRDIYAFWDPFHPSE+ANR+IV+ I +GST YM+PMNLSTIMELDSR 
Sbjct  311   CTMASNLCPNRDIYAFWDPFHPSERANRLIVRQIATGSTKYMNPMNLSTIMELDSRV  367



>ref|XP_011077073.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g33370-like 
[Sesamum indicum]
Length=368

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/342 (80%), Positives = 306/342 (89%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             RA+ RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPTHR TGRFSNGLNIPDIIS K
Sbjct  27    RADARAFFVFGDSLVDNGNNNYLVTSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISNK  86

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LGMEPT+P LSP LKG+KLLVGANFASAGVGILNDTG+QF+NIIRI  QLEYF++YQ RV
Sbjct  87    LGMEPTMPYLSPLLKGQKLLVGANFASAGVGILNDTGIQFLNIIRINKQLEYFQQYQTRV  146

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             + LIGA   K LVN+ALVLITLGGNDFVNNYYLVP+SARS+QF++PD+V ++ISEYRKIL
Sbjct  147   TSLIGAERTKTLVNQALVLITLGGNDFVNNYYLVPYSARSQQFSLPDFVRYVISEYRKIL  206

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY+LGARRV+VTGTGP+GCVPAELAQRSRAGECA +L RAA LFNPQLT+ML  LNSE
Sbjct  207   ARLYELGARRVLVTGTGPMGCVPAELAQRSRAGECAAELTRAAGLFNPQLTEMLRSLNSE  266

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             L ADVFVAANTY MHMDFI NPQA GF+TSK+ACCGQGPYNG+GLCT  SNLCPNRD+YA
Sbjct  267   LGADVFVAANTYAMHMDFISNPQAHGFITSKIACCGQGPYNGVGLCTPVSNLCPNRDVYA  326

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWD FHPSE+ANRIIVQ I +G   YM+P+NL+TIM +DS T
Sbjct  327   FWDSFHPSERANRIIVQQILTGDNKYMNPINLTTIMAMDSMT  368



>gb|KHG28666.1| GDSL esterase/lipase LTL1 -like protein [Gossypium arboreum]
Length=365

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/339 (81%), Positives = 309/339 (91%), Gaps = 0/339 (0%)
 Frame = -3

Query  1260  CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGM  1081
              RAFFVFGDSLVDNGNNNYLATTARAD  PYGIDYPTHRATGRFSNGLNIPD+ISE++G 
Sbjct  27    ARAFFVFGDSLVDNGNNNYLATTARADAYPYGIDYPTHRATGRFSNGLNIPDLISEQIGS  86

Query  1080  EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDL  901
             EPTLP LSP+L G++LL+GANFASAG+GILNDTGVQF+NIIRIG QL+YF +YQ+RVS L
Sbjct  87    EPTLPYLSPELNGQRLLIGANFASAGIGILNDTGVQFVNIIRIGEQLQYFRQYQQRVSAL  146

Query  900   IGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRL  721
             IG  + ++LVN+ALVL+TLGGNDFVNNYYLVPFSARSRQF +PDYV ++ISEYRKIL RL
Sbjct  147   IGPEQTQRLVNEALVLMTLGGNDFVNNYYLVPFSARSRQFALPDYVVYIISEYRKILLRL  206

Query  720   YDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKA  541
             Y+LGARRV+VTGTGP+GCVPAELAQ SRAGECA++LQRA+ALFNPQL +ML+ LN+EL A
Sbjct  207   YELGARRVLVTGTGPLGCVPAELAQHSRAGECAIELQRASALFNPQLAEMLSGLNNELGA  266

Query  540   DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWD  361
             D+FVA NT  MHMD+I NPQ FGFVTSKVACCGQGPYNGIGLCT ASNLC NRDIYAFWD
Sbjct  267   DIFVAVNTNEMHMDWINNPQQFGFVTSKVACCGQGPYNGIGLCTIASNLCLNRDIYAFWD  326

Query  360   PFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             PFHPSE+ANR+IVQ I +GST YMHPMNLSTIMELDSR 
Sbjct  327   PFHPSERANRLIVQQIITGSTKYMHPMNLSTIMELDSRV  365



>ref|XP_008218370.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Prunus mume]
Length=363

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/356 (78%), Positives = 314/356 (88%), Gaps = 2/356 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+LGLL        RAE RAFFVFGDSLVDNGNN+YLATTARAD  PYGIDYPTHR TGR
Sbjct  10    IILGLLGACAS--RRAEARAFFVFGDSLVDNGNNDYLATTARADSYPYGIDYPTHRPTGR  67

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISE+LG EPTLP LSP L G+ LLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  68    FSNGLNIPDIISEQLGSEPTLPYLSPQLTGQNLLVGANFASAGIGILNDTGIQFLNIIRI  127

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYFE+YQ RV+ L+G  + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++P
Sbjct  128   YKQLEYFEQYQTRVAALVGPEQTQRLVNQALVLITLGGNDFVNNYYLVPFSARSRQFSLP  187

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRK+L RLY+LGARRV+VTGTGP+GCVPAELAQ SRAGEC+V+L+RAA+LF
Sbjct  188   DYVVYLISEYRKVLARLYELGARRVLVTGTGPLGCVPAELAQHSRAGECSVELERAASLF  247

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+  LNS++ +DVFVAAN Y MHMDFI +PQA+GFVTSK+ACCGQGPYNGIGLC
Sbjct  248   NPQLVQMINGLNSQIGSDVFVAANAYEMHMDFIADPQAYGFVTSKIACCGQGPYNGIGLC  307

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNRD+YAFWDPFHPSEKANRII Q I +GS  YM+PMNLSTI+ LDSRT
Sbjct  308   TVVSNLCPNRDLYAFWDPFHPSEKANRIIAQQILTGSNKYMNPMNLSTILALDSRT  363



>ref|XP_009591832.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana tomentosiformis]
Length=370

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/358 (77%), Positives = 313/358 (87%), Gaps = 3/358 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGR---AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRA  1141
             I + LL+L I+  G     E RAFFVFGDSLVDNGNNNYLAT+ARAD PPYG+DYPTHR 
Sbjct  12    IFMTLLSLAILQNGVIKGVEGRAFFVFGDSLVDNGNNNYLATSARADSPPYGVDYPTHRP  71

Query  1140  TGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNI  961
             TGRFSNGLNIPDIISEKLGMEPTLP LSP+L+G+KLLVGANFASAGVGILNDTG+QF+NI
Sbjct  72    TGRFSNGLNIPDIISEKLGMEPTLPYLSPELQGQKLLVGANFASAGVGILNDTGIQFVNI  131

Query  960   IRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQF  781
             IRIG Q+EYF EYQ+RV+ L+G  +AKQLV +ALVLITLGGNDFVNNYYLVPFS RS Q+
Sbjct  132   IRIGQQVEYFAEYQKRVAALVGTEKAKQLVKQALVLITLGGNDFVNNYYLVPFSLRSTQY  191

Query  780   TIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAA  601
              +PDYV F+ISEY+K+L +LY LGARRVIVTGTGP+GCVPAELAQRS+ G CA +LQ AA
Sbjct  192   ALPDYVTFVISEYKKVLAKLYSLGARRVIVTGTGPLGCVPAELAQRSQDGNCAAELQEAA  251

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             +LFNPQL +ML  LNSE+ + VF+AANT  MH+DF+ NPQAFGFVTSKVACCGQGPYNGI
Sbjct  252   SLFNPQLVEMLNGLNSEIGSHVFIAANTNQMHLDFVTNPQAFGFVTSKVACCGQGPYNGI  311

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             GLCT  SNLCPNRD YAFWDPFHPSEKANRIIVQ I +G+T YMHPMNLSTIM +DS+
Sbjct  312   GLCTPLSNLCPNRDEYAFWDPFHPSEKANRIIVQQILTGTTAYMHPMNLSTIMVMDSK  369



>ref|XP_010102187.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB93130.1| GDSL esterase/lipase [Morus notabilis]
Length=367

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/357 (77%), Positives = 316/357 (89%), Gaps = 1/357 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFG-RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             I+LG L +T+  FG +AE RAFFVFGDSLVDNGNNNYLATTARAD  PYGIDYPTHR TG
Sbjct  11    IVLGALVITLSSFGFQAEARAFFVFGDSLVDNGNNNYLATTARADNYPYGIDYPTHRPTG  70

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE +G EPTLP LSP+L GE LLVGANFASAG+G+LNDTG+QF+NIIR
Sbjct  71    RFSNGLNIPDLISEAIGSEPTLPYLSPELTGEGLLVGANFASAGIGVLNDTGIQFLNIIR  130

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYF++YQ RVS LIGA + ++LVN+AL+LITLGGNDFVNNYYLVPFSARSRQ+++
Sbjct  131   IYKQLEYFQQYQTRVSALIGAEQTERLVNEALILITLGGNDFVNNYYLVPFSARSRQYSL  190

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV ++ISEY+K+L RLY+LGARRV+VTGTGP+GCVPAELA RS  G+CAV+LQRAA L
Sbjct  191   PDYVVYVISEYQKVLARLYELGARRVLVTGTGPLGCVPAELAMRSPNGQCAVELQRAAGL  250

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL QM+  LNS++ +DVFVAAN + MHMDFI NPQA+GFVTSKVACCGQGPYNG+GL
Sbjct  251   FNPQLVQMINRLNSDIGSDVFVAANAFEMHMDFISNPQAYGFVTSKVACCGQGPYNGLGL  310

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLCPNRDIYAFWD FHPSE+ANRIIV+ I  G + YMHPMNLSTIM LDSRT
Sbjct  311   CTIASNLCPNRDIYAFWDAFHPSERANRIIVRNILEGDSKYMHPMNLSTIMALDSRT  367



>ref|XP_006443287.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
 ref|XP_006478978.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
 gb|ESR56527.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
 gb|KDO52496.1| hypothetical protein CISIN_1g017552mg [Citrus sinensis]
Length=369

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/342 (80%), Positives = 311/342 (91%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +AE RAFFVFGDSLVDNGNN+YLATTARAD  PYGIDYPTHR TGRFSNGLNIPD+ISE+
Sbjct  28    QAEARAFFVFGDSLVDNGNNDYLATTARADSYPYGIDYPTHRPTGRFSNGLNIPDLISEQ  87

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +GME TLP LSP+L G++LLVGANFASAG+GILNDTG QF+NIIRI  Q+EYF++YQ+RV
Sbjct  88    IGMESTLPYLSPELTGQRLLVGANFASAGIGILNDTGFQFINIIRISKQIEYFQQYQQRV  147

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIGA + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++PDYV +LISEYRKIL
Sbjct  148   SALIGAEQTERLVNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKIL  207

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              R+Y+LGARRV+VTGTGP+GCVPAELAQR   GEC+V+LQRAA LFNPQL QML ELNS+
Sbjct  208   ARIYELGARRVLVTGTGPLGCVPAELAQRGVNGECSVELQRAADLFNPQLVQMLNELNSQ  267

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             + +DVFVAAN + MHMDFI +PQA+GFVTSK+ACCGQGPYNGIGLCT ASNLCPNRD+YA
Sbjct  268   IGSDVFVAANAFAMHMDFIHDPQAYGFVTSKIACCGQGPYNGIGLCTIASNLCPNRDLYA  327

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWDPFHPSEKANRIIVQ I SGS+ YM+PMNLSTIM LDSR 
Sbjct  328   FWDPFHPSEKANRIIVQRIASGSSKYMNPMNLSTIMALDSRV  369



>ref|XP_007206865.1| hypothetical protein PRUPE_ppb006257mg [Prunus persica]
 gb|EMJ08064.1| hypothetical protein PRUPE_ppb006257mg [Prunus persica]
Length=363

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/356 (78%), Positives = 313/356 (88%), Gaps = 2/356 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+LGLL        RAE RAFFVFGDSLVDNGNN+YLATTARAD  PYGIDYPTHR TGR
Sbjct  10    IILGLLGACAS--RRAEARAFFVFGDSLVDNGNNDYLATTARADSYPYGIDYPTHRPTGR  67

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISE+LG EPTLP LSP L G+ LLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  68    FSNGLNIPDIISEQLGSEPTLPYLSPHLTGQNLLVGANFASAGIGILNDTGIQFLNIIRI  127

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYFE+YQ RV+ L+G  + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++P
Sbjct  128   FKQLEYFEQYQTRVAALVGPEQTERLVNQALVLITLGGNDFVNNYYLVPFSARSRQFSLP  187

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRK+L RLY+LGARRV+VTGTGP+GCVPAELAQ SRAGEC+V+L+RAA+LF
Sbjct  188   DYVVYLISEYRKVLARLYELGARRVLVTGTGPLGCVPAELAQHSRAGECSVELERAASLF  247

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+  LNS+L +DVFVAAN Y MHMDFI NP+A+GFVTSK+ACCGQGPYNGIGLC
Sbjct  248   NPQLVQMINGLNSQLGSDVFVAANAYEMHMDFISNPRAYGFVTSKIACCGQGPYNGIGLC  307

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNRD+YAFWD FHPSEKANRII Q I +GS  YM+PMNLSTI+ LDSRT
Sbjct  308   TMVSNLCPNRDLYAFWDAFHPSEKANRIIAQQILTGSNKYMNPMNLSTILALDSRT  363



>ref|XP_002522020.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40424.1| zinc finger protein, putative [Ricinus communis]
Length=364

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/356 (77%), Positives = 316/356 (89%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ++LGL+          E RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGR
Sbjct  9     MILGLVLTLGSVAHVTEARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRPTGR  68

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPD+ISE +G EPTLP LSP+L GE+LLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  69    FSNGLNIPDLISEAIGSEPTLPYLSPELTGERLLVGANFASAGIGILNDTGIQFLNIIRI  128

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF++YQ+RVS LIG  + ++LVN+ALVL+TLGGNDFVNNYYLVPFSARSRQF++P
Sbjct  129   YKQLEYFQQYQQRVSALIGPEQTQRLVNQALVLMTLGGNDFVNNYYLVPFSARSRQFSLP  188

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRK+L R+Y+LGARRV+VTGTGP+GCVPAELA RSR GEC+V+LQRAA LF
Sbjct  189   DYVVYLISEYRKVLLRVYELGARRVLVTGTGPLGCVPAELAMRSRNGECSVELQRAAGLF  248

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+ E+N+++ +DVFVAAN Y M+MDFI +PQA+GFVTSK+ACCGQGPYNGIGLC
Sbjct  249   NPQLVQMINEVNNQIGSDVFVAANAYQMNMDFISDPQAYGFVTSKIACCGQGPYNGIGLC  308

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T ASNLCPNRDIYAFWDPFHPSE+ANRIIV+ I  GS+ YM+PMNLSTIMELDSRT
Sbjct  309   TIASNLCPNRDIYAFWDPFHPSERANRIIVRQILIGSSKYMNPMNLSTIMELDSRT  364



>ref|XP_009769587.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana sylvestris]
Length=369

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/339 (80%), Positives = 303/339 (89%), Gaps = 0/339 (0%)
 Frame = -3

Query  1263  ECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLG  1084
             E RAFFVFGDSLVDNGNNNYLAT+ARAD PPYG+DYPTHR TGRFSNGLNIPDIISEKLG
Sbjct  30    EGRAFFVFGDSLVDNGNNNYLATSARADSPPYGVDYPTHRPTGRFSNGLNIPDIISEKLG  89

Query  1083  MEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSD  904
             MEPTLP LSP+L+G+KLLVGANFASAGVGILNDTG+QF+NIIRIG QLEYF EYQ+RV+ 
Sbjct  90    MEPTLPYLSPELQGQKLLVGANFASAGVGILNDTGIQFVNIIRIGQQLEYFAEYQKRVAA  149

Query  903   LIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQR  724
             L+G  +AKQLV +ALVLITLGGNDFVNNYYLVPFS RS Q+ +PDYV F+ISEY+ +L +
Sbjct  150   LVGTEKAKQLVKEALVLITLGGNDFVNNYYLVPFSLRSTQYALPDYVTFVISEYKHVLAK  209

Query  723   LYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELK  544
             LY LGARRVIVTGTGP+GCVPAELAQRS+ G CA +LQ AA+LFNPQL +ML  LNSE+ 
Sbjct  210   LYSLGARRVIVTGTGPLGCVPAELAQRSQDGNCAAELQEAASLFNPQLVEMLNGLNSEIG  269

Query  543   ADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFW  364
             + VF+AANT  MH+DF+ NPQAFGFVTSKVACCGQGPYNGIGLCT  SNLCPNRD YAFW
Sbjct  270   SHVFIAANTNQMHLDFVTNPQAFGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDEYAFW  329

Query  363   DPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             DPFHPSEKANRIIVQ I +G+T YMHPMNLSTIM +DS+
Sbjct  330   DPFHPSEKANRIIVQQILTGTTAYMHPMNLSTIMVMDSK  368



>ref|XP_006340478.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=360

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/355 (78%), Positives = 311/355 (88%), Gaps = 1/355 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+L ++ +  V  G AE RAFFVFGDSLVD GNNNYLAT+ARAD PPYGIDYPTHR TGR
Sbjct  6     IILMMIMVLRVVEGAAE-RAFFVFGDSLVDTGNNNYLATSARADSPPYGIDYPTHRPTGR  64

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISEKLG+EPTLP LSP+L+GEKLLVGANFASAGVG+LNDTG+QF+NIIRI
Sbjct  65    FSNGLNIPDIISEKLGIEPTLPYLSPELQGEKLLVGANFASAGVGVLNDTGIQFVNIIRI  124

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
             G QLEYF EYQ+RV  LIG+ +AKQLV + LVLITLGGNDFVNNYYLVPFS RSRQ+ +P
Sbjct  125   GQQLEYFAEYQKRVGALIGSEKAKQLVKEGLVLITLGGNDFVNNYYLVPFSVRSRQYMLP  184

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV ++ISEY+ +LQ+LY LGARRVIVTGTGP+GCVPAELAQRSR G CA DLQ+AA LF
Sbjct  185   DYVSYVISEYKNVLQKLYSLGARRVIVTGTGPLGCVPAELAQRSRDGSCADDLQQAAVLF  244

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL +ML  LNSE+   VFVAANT  MH+DFI +PQAFGFVTSKVACCGQGPYNG+GLC
Sbjct  245   NPQLVEMLNGLNSEIGNHVFVAANTNQMHLDFITDPQAFGFVTSKVACCGQGPYNGMGLC  304

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             T  SNLC NRD YAFWDPFHP+EKANRIIV+ I +G+TDYMHPMNLSTIM +DS+
Sbjct  305   TPLSNLCSNRDEYAFWDPFHPTEKANRIIVEQILTGTTDYMHPMNLSTIMVMDSK  359



>ref|XP_010648948.1| PREDICTED: GDSL esterase/lipase At5g33370 [Vitis vinifera]
 emb|CAN67726.1| hypothetical protein VITISV_038831 [Vitis vinifera]
Length=369

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/342 (79%), Positives = 308/342 (90%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +A  RAFFVFGDSLVD+GNN+YL TTARAD PPYGIDYPTHR TGRFSNGLNIPDIISE+
Sbjct  28    QAHARAFFVFGDSLVDSGNNDYLVTTARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEQ  87

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G +PTLP LSP+L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  QLEYF++YQ+RV
Sbjct  88    IGEQPTLPYLSPELTGERLLVGANFASAGIGILNDTGIQFLNIIRIYKQLEYFQQYQQRV  147

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             + LIGA + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++PDYV +LISEYRK+L
Sbjct  148   TTLIGAAQTERLVNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLISEYRKVL  207

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
             +RLY+LGARRV+VTGTGP+GCVPAELA RSR GECAV+LQRAA LFNPQL QM+  LN+E
Sbjct  208   RRLYELGARRVLVTGTGPMGCVPAELAMRSRNGECAVELQRAADLFNPQLVQMINGLNNE  267

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             +  DVF+AAN + MHMDFI NP A+GFVTSK+ACCGQGPYNG+GLCT ASNLC NRDIYA
Sbjct  268   IGGDVFIAANAFRMHMDFISNPGAYGFVTSKIACCGQGPYNGLGLCTIASNLCANRDIYA  327

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWD FHPSE+ANR IV+ I SGSTDYMHPMNLS IM LDSRT
Sbjct  328   FWDAFHPSERANRYIVRQILSGSTDYMHPMNLSNIMALDSRT  369



>emb|CBI28652.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/342 (79%), Positives = 308/342 (90%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +A  RAFFVFGDSLVD+GNN+YL TTARAD PPYGIDYPTHR TGRFSNGLNIPDIISE+
Sbjct  26    QAHARAFFVFGDSLVDSGNNDYLVTTARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEQ  85

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G +PTLP LSP+L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  QLEYF++YQ+RV
Sbjct  86    IGEQPTLPYLSPELTGERLLVGANFASAGIGILNDTGIQFLNIIRIYKQLEYFQQYQQRV  145

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             + LIGA + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++PDYV +LISEYRK+L
Sbjct  146   TTLIGAAQTERLVNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLISEYRKVL  205

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
             +RLY+LGARRV+VTGTGP+GCVPAELA RSR GECAV+LQRAA LFNPQL QM+  LN+E
Sbjct  206   RRLYELGARRVLVTGTGPMGCVPAELAMRSRNGECAVELQRAADLFNPQLVQMINGLNNE  265

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             +  DVF+AAN + MHMDFI NP A+GFVTSK+ACCGQGPYNG+GLCT ASNLC NRDIYA
Sbjct  266   IGGDVFIAANAFRMHMDFISNPGAYGFVTSKIACCGQGPYNGLGLCTIASNLCANRDIYA  325

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWD FHPSE+ANR IV+ I SGSTDYMHPMNLS IM LDSRT
Sbjct  326   FWDAFHPSERANRYIVRQILSGSTDYMHPMNLSNIMALDSRT  367



>ref|XP_011076887.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=369

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/356 (78%), Positives = 313/356 (88%), Gaps = 1/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ILL   ++TI+   RAE RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPTHR TGR
Sbjct  13    ILLSFFSVTILIGLRAEARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTHRPTGR  72

Query  1131  FSNGLNIPDIISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             FSNGLNIPDIISE +G  E  LP LSP+L G KLLVGANFASAGVGIL+DTG QF+NIIR
Sbjct  73    FSNGLNIPDIISESIGQSESPLPYLSPELTGPKLLVGANFASAGVGILSDTGAQFVNIIR  132

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QL YF++YQRRVS LIGA EA++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQFT+
Sbjct  133   ISQQLSYFQQYQRRVSALIGAEEAQRLVNEALVLITLGGNDFVNNYYLVPFSARSRQFTL  192

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEYRKIL RLY+LGARRV+VTGTGP+GCVPAELA RSR GECA +LQ+AAAL
Sbjct  193   PDYVRYLISEYRKILSRLYELGARRVLVTGTGPLGCVPAELAMRSRNGECAPELQQAAAL  252

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQLT+ML  LNS+L +DVF+AANT  M+ DFI +PQAFGF+TSKVACCGQG YNG+GL
Sbjct  253   FNPQLTEMLLSLNSQLGSDVFIAANTQLMNSDFIRDPQAFGFITSKVACCGQGLYNGLGL  312

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             CTQ SNLCPNRD+YAFWDPFHPSE+ANR IV+ I +GS+ YM PMNLSTI+ LDSR
Sbjct  313   CTQLSNLCPNRDVYAFWDPFHPSERANRFIVRQIMTGSSAYMTPMNLSTIIALDSR  368



>ref|XP_002325360.1| hypothetical protein POPTR_0019s04130g [Populus trichocarpa]
 gb|EEE99741.1| hypothetical protein POPTR_0019s04130g [Populus trichocarpa]
Length=367

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/356 (76%), Positives = 311/356 (87%), Gaps = 1/356 (0%)
 Frame = -3

Query  1308  LLGLL-ALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             L+GL+ A+   F  +AE RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGR
Sbjct  12    LIGLVVAMATTFVPQAEARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTRRPTGR  71

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGL+IPD IS+ LG E TLP LSP+L G++LLVGANFASAG+GILNDTG+QF+NIIR+
Sbjct  72    FSNGLSIPDFISQHLGSELTLPYLSPELTGQRLLVGANFASAGIGILNDTGIQFLNIIRM  131

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYFE+YQRRV+ L+GA + +QLVN AL LIT+GGNDFVNNYYLVPFSARSRQF +P
Sbjct  132   YKQLEYFEQYQRRVTALVGAQQTQQLVNGALTLITVGGNDFVNNYYLVPFSARSRQFRLP  191

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRKIL RLYDLGARRV+VTGTGP+GCVPAELAQRS  G+C+ +LQRAA+L+
Sbjct  192   DYVRYLISEYRKILMRLYDLGARRVLVTGTGPMGCVPAELAQRSPNGQCSAELQRAASLY  251

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQLTQML +LN +  AD+F+AANT  M  DF++NPQA+GFVTSK+ACCGQGPYNG+GLC
Sbjct  252   NPQLTQMLGQLNDQYGADIFIAANTRQMTADFVYNPQAYGFVTSKIACCGQGPYNGLGLC  311

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T ASNLCPNRD+YAFWDPFHPSE+AN I+VQ I +G   YMHPMNLSTI+ LDSRT
Sbjct  312   TPASNLCPNRDLYAFWDPFHPSERANGIVVQQILNGDATYMHPMNLSTILALDSRT  367



>ref|XP_009631850.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana tomentosiformis]
Length=380

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/355 (76%), Positives = 310/355 (87%), Gaps = 1/355 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I   L  +  V   +AE RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT RATGR
Sbjct  24    IFFSLFLILGVAISQAEARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRATGR  83

Query  1131  FSNGLNIPDIISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             FSNG NIPDIIS+++G  E  LP LSP+L G++LLVGANFASAG+GILNDTG+QF+NI+R
Sbjct  84    FSNGFNIPDIISQQIGSSESPLPYLSPELNGQRLLVGANFASAGIGILNDTGIQFINIVR  143

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYF +YQ RVS LIG    KQLVN+ALVLITLGGNDFVNNYYLVP SARSRQ+ +
Sbjct  144   IPQQLEYFRQYQSRVSALIGEASTKQLVNQALVLITLGGNDFVNNYYLVPNSARSRQYAL  203

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYVPFLISEYRKIL RLY+LGARRV+VTGTGP+GCVPAELAQRSR GECA++LQRAAAL
Sbjct  204   PDYVPFLISEYRKILMRLYNLGARRVLVTGTGPLGCVPAELAQRSRNGECAIELQRAAAL  263

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQLTQML  LNS+L +++F+AANT  MH DFI NPQA+GF+TSKVACCGQGPYNG+GL
Sbjct  264   FNPQLTQMLQNLNSQLGSNIFIAANTQQMHTDFITNPQAYGFITSKVACCGQGPYNGLGL  323

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD++AFWDPFHPSE+AN+IIVQ I +GS++YM+PMNLSTI+ +DS
Sbjct  324   CTPLSNLCPNRDLFAFWDPFHPSERANKIIVQQIMTGSSEYMNPMNLSTILAMDS  378



>ref|XP_004237506.1| PREDICTED: GDSL esterase/lipase At5g33370 [Solanum lycopersicum]
Length=363

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/340 (80%), Positives = 304/340 (89%), Gaps = 0/340 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             A+ RAFFVFGDSLVDNGNNNYLAT+ARAD PPYGIDYPTHR TGRFSNGLNIPDIISEKL
Sbjct  23    ADERAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKL  82

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G+E TLP LSP+L+G KLLVGANFASAGVG+LNDTGVQF+NIIRIG QLEYF EYQ+RV 
Sbjct  83    GLERTLPYLSPELQGGKLLVGANFASAGVGVLNDTGVQFVNIIRIGQQLEYFAEYQKRVG  142

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
              LIG+ +AK+LV + LVLITLGGNDFVNNYYLVPFS RSRQ+ +PDYV ++ISEY+ +LQ
Sbjct  143   ALIGSEKAKKLVKEGLVLITLGGNDFVNNYYLVPFSVRSRQYMLPDYVSYVISEYKNVLQ  202

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             +LY+LGARRVIVTGTGP+GCVPAELAQRSR G CA DLQ+AA LFNPQL +ML  LNSE+
Sbjct  203   KLYNLGARRVIVTGTGPLGCVPAELAQRSRDGSCADDLQQAAVLFNPQLVEMLNGLNSEI  262

Query  546   KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAF  367
                VFVAANT  MH+DFI +PQAFGFVTSKVACCGQGPYNG+GLCT  SNLCPNRD YAF
Sbjct  263   GTHVFVAANTNQMHLDFITDPQAFGFVTSKVACCGQGPYNGMGLCTPLSNLCPNRDEYAF  322

Query  366   WDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             WDPFHP+EKANRIIV+ I +G+TDYMHPMNLSTIM +DS+
Sbjct  323   WDPFHPTEKANRIIVEQIMTGTTDYMHPMNLSTIMVMDSK  362



>ref|XP_010243647.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nelumbo nucifera]
Length=368

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/354 (76%), Positives = 311/354 (88%), Gaps = 0/354 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             +L+GL A       +AE RAFFVFGDSLVDNGNNNYLAT+ARAD  PYGIDYP+HRATGR
Sbjct  11    LLVGLAAPLCSLVPQAEARAFFVFGDSLVDNGNNNYLATSARADSYPYGIDYPSHRATGR  70

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD+IS+ +G E TLP LSP+L G++LL GANFASAGVG+LNDTG+QF+NIIRI
Sbjct  71    FSNGFNIPDLISQAIGEESTLPYLSPELTGQRLLNGANFASAGVGVLNDTGIQFLNIIRI  130

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF++YQ+RVS LIG  + +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQF++P
Sbjct  131   FKQLEYFQQYQQRVSALIGEEQTQQLVNRALVLITLGGNDFVNNYYLIPFSARSRQFSLP  190

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV ++ISEY+KIL R+Y+LGARRV+VTGTGP+GCVPAELA  S  GECA++LQRAAALF
Sbjct  191   DYVRYVISEYKKILMRVYELGARRVLVTGTGPLGCVPAELALHSVNGECAIELQRAAALF  250

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL Q + ELNSE+ +DVFVAANT  M MDF+ NPQA+GFVTSK+ACCGQGPYNGIGLC
Sbjct  251   NPQLAQTINELNSEIGSDVFVAANTNRMTMDFVSNPQAYGFVTSKIACCGQGPYNGIGLC  310

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             T ASNLCPNRD+YAFWDPFHPSE+ANRIIVQ I +GS DYMHPMNLSTIM +D+
Sbjct  311   TSASNLCPNRDVYAFWDPFHPSERANRIIVQQILAGSNDYMHPMNLSTIMAVDA  364



>ref|XP_009764127.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764128.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X2 [Nicotiana 
sylvestris]
Length=378

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/345 (78%), Positives = 308/345 (89%), Gaps = 1/345 (0%)
 Frame = -3

Query  1281  VFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDI  1102
             V   + E RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT RATGRFSNG NIPDI
Sbjct  32    VAISQTEARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRATGRFSNGFNIPDI  91

Query  1101  ISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEE  925
             IS+++G  E  LP LSP+L G++LLVGANFASAG+GILNDTG+QF+NIIRI  QLEYF +
Sbjct  92    ISQQIGASESPLPYLSPELNGQRLLVGANFASAGIGILNDTGIQFINIIRIPQQLEYFRQ  151

Query  924   YQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISE  745
             YQ RVS LIG    KQLVN+ALVL+TLGGNDFVNNYYLVP SARSRQ+ +PDYVPFLISE
Sbjct  152   YQSRVSALIGEESTKQLVNQALVLMTLGGNDFVNNYYLVPNSARSRQYALPDYVPFLISE  211

Query  744   YRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLA  565
             YRKIL R+YDLGARRV+VTGTGP+GCVPAELAQRSR GECAV+LQ+AAALFNPQLTQML 
Sbjct  212   YRKILMRVYDLGARRVLVTGTGPLGCVPAELAQRSRNGECAVELQQAAALFNPQLTQMLQ  271

Query  564   ELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPN  385
             +LNSEL +++F+AANT  MH+DFI NPQA+GF+TSKVACCGQGPYNG+GLCT  SNLCPN
Sbjct  272   DLNSELGSNIFIAANTQQMHIDFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNLCPN  331

Query  384   RDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             RD++AFWDPFHPSE+AN+IIVQ I +GS++YM+PMNLSTI+ +DS
Sbjct  332   RDVFAFWDPFHPSERANKIIVQQIMTGSSEYMNPMNLSTILAMDS  376



>ref|XP_008370769.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
 ref|XP_008345729.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=362

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/357 (76%), Positives = 314/357 (88%), Gaps = 4/357 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGR-AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             ++LGLLA      GR AE RAFFVFGDSLVD+GNN+YLATTARAD  PYGIDYPTHR TG
Sbjct  9     VVLGLLAACA---GRQAEARAFFVFGDSLVDSGNNDYLATTARADSYPYGIDYPTHRPTG  65

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE++G EPTLP LSP L G+ LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  66    RFSNGLNIPDLISEQIGSEPTLPYLSPQLTGQXLLVGANFASAGIGILNDTGIQFLNIIR  125

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYF++YQ RVS L+G  +A++LVN+AL LITLGGNDFVNNYYL+PFSARSRQF++
Sbjct  126   IYKQLEYFQQYQTRVSALVGPEQAQRLVNEALYLITLGGNDFVNNYYLLPFSARSRQFSL  185

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEYRK+L+RLY+LGAR+V+VTGTGP+GCVPAELAQ S  GECAV+LQRAA+L
Sbjct  186   PDYVVYLISEYRKVLERLYELGARKVLVTGTGPLGCVPAELAQHSTNGECAVELQRAASL  245

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL  M+  LNS+  +D FVAAN Y MHMDF+ +PQA+GFVTSK+ACCGQGPYNGIGL
Sbjct  246   FNPQLVDMINSLNSQFGSDAFVAANAYEMHMDFVSDPQAYGFVTSKIACCGQGPYNGIGL  305

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLCPNRD+YAFWDPFHPSEKANRIIVQ I +GS  YM+PMNLSTI+ LD++T
Sbjct  306   CTFASNLCPNRDLYAFWDPFHPSEKANRIIVQQILTGSNKYMNPMNLSTILALDTKT  362



>ref|XP_008388755.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=362

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/357 (76%), Positives = 315/357 (88%), Gaps = 4/357 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGR-AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             ++LGLLA      GR AE RAFFVFGDSLVD+GNN+YLATTARAD  PYGIDYPTHR TG
Sbjct  9     VVLGLLAACA---GRQAEARAFFVFGDSLVDSGNNDYLATTARADNYPYGIDYPTHRPTG  65

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE++G EPTLP LSP L G+KLLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  66    RFSNGLNIPDLISEQIGSEPTLPYLSPHLTGQKLLVGANFASAGIGILNDTGIQFLNIIR  125

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QL+YF++YQ RV+ L+G  +A++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++
Sbjct  126   IYKQLKYFQQYQTRVNALVGPEQAQRLVNEALVLITLGGNDFVNNYYLVPFSARSRQFSL  185

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEYRK+L RLY+LGAR+V+VTGTGP+GC PAELAQRSR GECAV+LQRAA+L
Sbjct  186   PDYVVYLISEYRKVLARLYELGARKVLVTGTGPLGCAPAELAQRSRRGECAVELQRAASL  245

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL  M+  LN ++ +DVFVAAN + MHMDFI NPQA+GFVTSK+ACCGQGPYNGIGL
Sbjct  246   FNPQLVDMINSLNGQIGSDVFVAANAFQMHMDFISNPQAYGFVTSKIACCGQGPYNGIGL  305

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLCPNRD+YAFWD FHPSEKA+RII Q I +GS  YM+PMNLSTI+ LDS+T
Sbjct  306   CTIASNLCPNRDLYAFWDAFHPSEKASRIIAQQILTGSNKYMNPMNLSTILALDSKT  362



>ref|XP_011002016.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Populus euphratica]
Length=368

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/357 (75%), Positives = 311/357 (87%), Gaps = 1/357 (0%)
 Frame = -3

Query  1311  ILLGLL-ALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             +L+GL+ A+   F  +AE RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPT R TG
Sbjct  12    VLIGLVVAMATTFVPQAEARAFFVFGDSLVDNGNNNYLVTSARADSPPYGIDYPTRRPTG  71

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD IS++LG EPTLP LSP L G++LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  72    RFSNGLNIPDFISQQLGSEPTLPYLSPQLTGQRLLVGANFASAGIGILNDTGIQFLNIIR  131

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  QL+YFE+YQRRV+ L+GA + +QLVN AL LIT+GGNDFVNNYYLVPFSARSRQF +
Sbjct  132   MYRQLDYFEQYQRRVAALLGAQQTQQLVNGALSLITVGGNDFVNNYYLVPFSARSRQFRL  191

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEYRKIL RLYDLG RRV+VTGTGP+GCVPAELAQRS  G+CAV+LQRAA+L
Sbjct  192   PDYVRYLISEYRKILMRLYDLGVRRVLVTGTGPMGCVPAELAQRSTNGQCAVELQRAASL  251

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQLTQML +LN++  AD+F+AANT  M  +F+ NPQA+GFVTSK+ACCGQGPYNG+GL
Sbjct  252   YNPQLTQMLGQLNNQYGADIFIAANTGQMTANFVDNPQAYGFVTSKIACCGQGPYNGLGL  311

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLCPNRD+YAFWDPFHP+E+AN II Q I +G   YMHPMNLSTI+ LDSRT
Sbjct  312   CTLASNLCPNRDLYAFWDPFHPTERANSIIAQQILTGDATYMHPMNLSTILALDSRT  368



>ref|XP_010558733.1| PREDICTED: GDSL esterase/lipase LTL1 [Tarenaya hassleriana]
Length=366

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/356 (75%), Positives = 307/356 (86%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             +L+  L +      + +CRAFFVFGDSLVDNGNNNYLATTARAD  PYGID P HRATGR
Sbjct  9     LLVSSLVIVTFLAPQVKCRAFFVFGDSLVDNGNNNYLATTARADNYPYGIDLPNHRATGR  68

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISE+LGM  TLP LSP L GE+LLVGANFASAG+GILNDTGVQF+NIIRI
Sbjct  69    FSNGLNIPDIISEQLGMPSTLPYLSPGLTGERLLVGANFASAGIGILNDTGVQFVNIIRI  128

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
             G QLEYFE+YQRRVS +IG  + ++LVN+ALVL+TLGGNDFVNNYYLVP+SARSRQ+ +P
Sbjct  129   GKQLEYFEQYQRRVSAMIGPAQTQKLVNEALVLMTLGGNDFVNNYYLVPYSARSRQYALP  188

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +++SEYRKIL R+Y+LGARRV+VTGTGP+GCVPAELA  SR GEC V+L RAAALF
Sbjct  189   DYVVYIVSEYRKILTRVYELGARRVLVTGTGPMGCVPAELALHSRNGECGVELMRAAALF  248

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL  M+ +LNSE+ +DVF+AAN   MH+DF+ NPQ FGFVTSKVACCGQGPYNGIGLC
Sbjct  249   NPQLVDMINQLNSEIGSDVFIAANANEMHLDFVTNPQQFGFVTSKVACCGQGPYNGIGLC  308

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNRD+YAFWDPFHPSEKANRIIVQ + +GS+ YMHPMNLST + LDS +
Sbjct  309   TPLSNLCPNRDLYAFWDPFHPSEKANRIIVQQMLTGSSKYMHPMNLSTALLLDSSS  364



>emb|CAN67727.1| hypothetical protein VITISV_038832 [Vitis vinifera]
 emb|CBI28653.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/353 (76%), Positives = 313/353 (89%), Gaps = 0/353 (0%)
 Frame = -3

Query  1305  LGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFS  1126
             LGL+    +   +AE RAFFVFGDSLVD+GNN+YL TTARAD PPYGIDYPT R TGRFS
Sbjct  14    LGLVLAWALVAPQAEARAFFVFGDSLVDSGNNDYLFTTARADSPPYGIDYPTGRPTGRFS  73

Query  1125  NGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGN  946
             NGLNIPDI+SE++G EPTLP LSP+L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  
Sbjct  74    NGLNIPDILSEQIGSEPTLPYLSPELTGERLLVGANFASAGIGILNDTGIQFLNIIRIWK  133

Query  945   QLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDY  766
             QLEYF +YQ+RVS LIG  + ++LVN+ALVLITLGGNDFVNNYYLVP+SARSRQF++PDY
Sbjct  134   QLEYFRQYQQRVSGLIGVEQTQRLVNQALVLITLGGNDFVNNYYLVPYSARSRQFSLPDY  193

Query  765   VPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNP  586
             V +LISEYRK+L RL++LGARRV+VT TGP+GCVPAELA RSR GECA++LQRAA LFNP
Sbjct  194   VRYLISEYRKVLIRLFELGARRVLVTATGPLGCVPAELALRSRTGECAIELQRAAGLFNP  253

Query  585   QLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQ  406
             QL QML  LN+E+ + VF+AAN + MHMDFI NPQA+GFVTSKVACCGQGPYNG+GLCT 
Sbjct  254   QLFQMLDGLNNEIGSQVFIAANAFGMHMDFISNPQAYGFVTSKVACCGQGPYNGLGLCTV  313

Query  405   ASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             AS+LCPNR++YAFWD FHPSE+ANRIIVQ I +GST+YM+PMNLSTIM+LDSR
Sbjct  314   ASSLCPNRNLYAFWDAFHPSERANRIIVQRILTGSTEYMYPMNLSTIMDLDSR  366



>ref|XP_004302114.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/343 (78%), Positives = 303/343 (88%), Gaps = 1/343 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +AE RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPTHR TGRFSNGLNIPD+ISE 
Sbjct  23    QAEARAFFVFGDSLVDNGNNDYLITTARADSYPYGIDYPTHRPTGRFSNGLNIPDLISES  82

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG EPTLP LSP L GEKLLVGANFASAG+GILNDTG+QF+NIIRI  QLEYFE+YQ RV
Sbjct  83    LGSEPTLPYLSPQLNGEKLLVGANFASAGIGILNDTGIQFLNIIRITKQLEYFEQYQTRV  142

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG  + K LVN ALVLITLGGNDFVNNYYLVP+SARSRQ+++PDYV +LISEYRKIL
Sbjct  143   SALIGPDQTKSLVNGALVLITLGGNDFVNNYYLVPYSARSRQYSLPDYVVYLISEYRKIL  202

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY+LGAR+V+VTGTG +GCVPAELA RSR GEC+V+LQRAA+LFNPQL QM+  LNSE
Sbjct  203   NRLYELGARQVLVTGTGSLGCVPAELAMRSRNGECSVELQRAASLFNPQLVQMIGSLNSE  262

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             + A+VF+A+N+  MHMDFI +P A+GFVTSK+ACCGQGPYNGIGLCT  SNLCPNRD+YA
Sbjct  263   IGANVFIASNSNEMHMDFISDPGAYGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDLYA  322

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD-SRT  244
             FWDPFHPSEKANR+IVQ I +GS  YMHPMNLST++ LD SRT
Sbjct  323   FWDPFHPSEKANRLIVQQILTGSDKYMHPMNLSTMLSLDNSRT  365



>ref|XP_009348739.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=362

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/357 (76%), Positives = 314/357 (88%), Gaps = 4/357 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGR-AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             ++LGLLA      GR AE RAFFVFGDSLVDNGNN+YLATTARAD  PYGIDYPTH  TG
Sbjct  9     VVLGLLAACT---GRQAEARAFFVFGDSLVDNGNNDYLATTARADSYPYGIDYPTHLPTG  65

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE++G EPTLP LSP L G+ LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  66    RFSNGLNIPDLISEQIGSEPTLPYLSPQLTGQNLLVGANFASAGIGILNDTGIQFLNIIR  125

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYF++YQ RVS L+G  +A++LVN+AL+LITLGGNDFVNNYYL+PFSARSRQF++
Sbjct  126   IYKQLEYFQQYQTRVSALVGPEQAQRLVNEALILITLGGNDFVNNYYLLPFSARSRQFSL  185

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEYRK+L+RLY+LGAR+V+VTGTGP+GCVPAELA  SR GECAV+LQRAA+L
Sbjct  186   PDYVVYLISEYRKVLERLYELGARKVLVTGTGPLGCVPAELALHSRNGECAVELQRAASL  245

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL  M+  LNS+  +D FVAAN Y M+MDF+ +PQA+GFVTSK+ACCGQGPYNGIGL
Sbjct  246   FNPQLVDMINSLNSQFGSDAFVAANAYEMNMDFVSDPQAYGFVTSKIACCGQGPYNGIGL  305

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLCPNRD+YAFWD FHPSEKANRIIVQ IF+GS  YM+PMNLSTI+ LD++T
Sbjct  306   CTIASNLCPNRDLYAFWDAFHPSEKANRIIVQNIFTGSNKYMNPMNLSTILALDTKT  362



>ref|XP_002268296.2| PREDICTED: GDSL esterase/lipase At5g33370 [Vitis vinifera]
Length=384

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/353 (76%), Positives = 313/353 (89%), Gaps = 0/353 (0%)
 Frame = -3

Query  1305  LGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFS  1126
             LGL+    +   +AE RAFFVFGDSLVD+GNN+YL TTARAD PPYGIDYPT R TGRFS
Sbjct  31    LGLVLAWALVAPQAEARAFFVFGDSLVDSGNNDYLFTTARADSPPYGIDYPTGRPTGRFS  90

Query  1125  NGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGN  946
             NGLNIPDI+SE++G EPTLP LSP+L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  
Sbjct  91    NGLNIPDILSEQIGSEPTLPYLSPELTGERLLVGANFASAGIGILNDTGIQFLNIIRIWK  150

Query  945   QLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDY  766
             QLEYF +YQ+RVS LIG  + ++LVN+ALVLITLGGNDFVNNYYLVP+SARSRQF++PDY
Sbjct  151   QLEYFRQYQQRVSGLIGVEQTQRLVNQALVLITLGGNDFVNNYYLVPYSARSRQFSLPDY  210

Query  765   VPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNP  586
             V +LISEYRK+L RL++LGARRV+VT TGP+GCVPAELA RSR GECA++LQRAA LFNP
Sbjct  211   VRYLISEYRKVLIRLFELGARRVLVTATGPLGCVPAELALRSRTGECAIELQRAAGLFNP  270

Query  585   QLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQ  406
             QL QML  LN+E+ + VF+AAN + MHMDFI NPQA+GFVTSKVACCGQGPYNG+GLCT 
Sbjct  271   QLFQMLDGLNNEIGSQVFIAANAFGMHMDFISNPQAYGFVTSKVACCGQGPYNGLGLCTV  330

Query  405   ASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             AS+LCPNR++YAFWD FHPSE+ANRIIVQ I +GST+YM+PMNLSTIM+LDSR
Sbjct  331   ASSLCPNRNLYAFWDAFHPSERANRIIVQRILTGSTEYMYPMNLSTIMDLDSR  383



>ref|XP_003554732.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/338 (78%), Positives = 302/338 (89%), Gaps = 0/338 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVD+GNN++LATTARAD PPYGIDYPTHR TGRFSNGLNIPD+IS +LG+E
Sbjct  28    RAFFVFGDSLVDSGNNDFLATTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISLELGLE  87

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             PTLP LSP L GEKLL+GANFASAG+GILNDTG+QF+NII I  QL+ F EYQ R+S  I
Sbjct  88    PTLPYLSPLLVGEKLLIGANFASAGIGILNDTGIQFLNIIHIQKQLKLFHEYQERLSLHI  147

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             GA  A+ LVN+ALVLITLGGNDFVNNYYLVP+SARSRQF++PDYV +LISEYRK+L+RLY
Sbjct  148   GAEGARNLVNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLY  207

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             DLG RRV+VTGTGP+GCVPAELA RSR G+C V+LQRAA+LFNPQL +ML  LN EL AD
Sbjct  208   DLGTRRVLVTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVEMLNGLNQELGAD  267

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AAN   MHMDF+ NP+A+GFVTSK+ACCGQGPYNG+GLCT ASNLCPNRD+YAFWDP
Sbjct  268   VFIAANAQRMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTAASNLCPNRDLYAFWDP  327

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FHPSEKA+RIIVQ I  G+T+YMHPMNLSTIM +DSRT
Sbjct  328   FHPSEKASRIIVQQILRGTTEYMHPMNLSTIMAIDSRT  365



>ref|XP_007147233.1| hypothetical protein PHAVU_006G107100g [Phaseolus vulgaris]
 gb|ESW19227.1| hypothetical protein PHAVU_006G107100g [Phaseolus vulgaris]
Length=369

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/360 (75%), Positives = 313/360 (87%), Gaps = 4/360 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVF----FGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHR  1144
             + L LL + I++      +AE RAFFVFGDSLVDNGNNNYL TTARAD  PYGIDYPTHR
Sbjct  10    MFLSLLVILIIWNNNVVPQAEARAFFVFGDSLVDNGNNNYLLTTARADAYPYGIDYPTHR  69

Query  1143  ATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMN  964
             ATGRFSNGLNIPDIISEK+G EPTLP LSP L GE+LLVGANFASAG+GILNDTG+QF+N
Sbjct  70    ATGRFSNGLNIPDIISEKIGSEPTLPYLSPALNGERLLVGANFASAGIGILNDTGIQFIN  129

Query  963   IIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQ  784
             IIRIG QL+YFE+YQ+RVS LIGA +A++LVN+ALVLITLGGNDFVNNY+LVPFSARSRQ
Sbjct  130   IIRIGRQLQYFEQYQQRVSALIGAEQAQRLVNQALVLITLGGNDFVNNYFLVPFSARSRQ  189

Query  783   FTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRA  604
             F +PDYV ++ISEYRKIL RLY+LGARRV+VTGTGP+GCVPAELAQ SR GECA +LQ+A
Sbjct  190   FALPDYVVYIISEYRKILLRLYELGARRVLVTGTGPLGCVPAELAQHSRNGECAAELQQA  249

Query  603   AALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNG  424
             +ALFNPQL Q++ +LNSE+ + +FV+AN +  +MDFI NPQA+GF+TSKVACCGQG +NG
Sbjct  250   SALFNPQLVQLVNQLNSEIGSVIFVSANAFESNMDFISNPQAYGFITSKVACCGQGRFNG  309

Query  423   IGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             IGLCT  SNLCPNRD++AFWDPFHPSE+ANRIIV     G   YM+PMNLSTIM LDSRT
Sbjct  310   IGLCTPISNLCPNRDVFAFWDPFHPSERANRIIVDTFMIGDNKYMNPMNLSTIMHLDSRT  369



>ref|XP_007147234.1| hypothetical protein PHAVU_006G107200g [Phaseolus vulgaris]
 gb|ESW19228.1| hypothetical protein PHAVU_006G107200g [Phaseolus vulgaris]
Length=389

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/338 (78%), Positives = 303/338 (90%), Gaps = 0/338 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVD+GNN++LATTARAD PPYGID+P+HR TGRFSNGLNIPD+IS +LG+E
Sbjct  52    RAFFVFGDSLVDSGNNDFLATTARADAPPYGIDFPSHRPTGRFSNGLNIPDLISLELGLE  111

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             PTLP LSP L GEKLLVGANFASAG+GILNDTG+QF+NII I  QL+ F EYQ R+S  I
Sbjct  112   PTLPYLSPLLVGEKLLVGANFASAGIGILNDTGIQFLNIIHIYKQLKLFHEYQLRLSAHI  171

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             GA   + LVN+ALVLITLGGNDFVNNYYLVP+SARSRQF++PDYV +LISEYRK+L+RLY
Sbjct  172   GAEGTRNLVNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLY  231

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             DLG RRV+VTGTGP+GCVPAELA RSR G+C V+LQRAAALFNPQL QML  LN EL ++
Sbjct  232   DLGTRRVLVTGTGPMGCVPAELAMRSRTGDCDVELQRAAALFNPQLVQMLNGLNQELGSE  291

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AAN Y MHMDF+ NP+A+GFVTSK+ACCGQGPYNGIGLCT ASNLCPNRD+YAFWDP
Sbjct  292   VFIAANAYRMHMDFVSNPRAYGFVTSKIACCGQGPYNGIGLCTPASNLCPNRDLYAFWDP  351

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FHPSE+A+RIIVQ I  G+T+YMHPMNL+TIMELDSRT
Sbjct  352   FHPSERASRIIVQQILRGTTEYMHPMNLTTIMELDSRT  389



>gb|KHN43145.1| GDSL esterase/lipase [Glycine soja]
Length=365

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/338 (78%), Positives = 301/338 (89%), Gaps = 0/338 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVD+GNN++LATTARAD PPYGIDYPTHR TGRFSNGLNIPD+IS  LG+E
Sbjct  28    RAFFVFGDSLVDSGNNDFLATTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISLGLGLE  87

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             PTLP LSP L GEKLL+GANFASAG+GILNDTG+QF+NII I  QL+ F EYQ R+S  I
Sbjct  88    PTLPYLSPLLVGEKLLIGANFASAGIGILNDTGIQFLNIIHIQKQLKLFHEYQERLSLHI  147

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             GA  A+ LVN+ALVLITLGGNDFVNNYYLVP+SARSRQF++PDYV +LISEYRK+L+RLY
Sbjct  148   GAEGARNLVNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLY  207

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             DLG RRV+VTGTGP+GCVPAELA RSR G+C V+LQRAA+LFNPQL +ML  LN EL AD
Sbjct  208   DLGTRRVLVTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVEMLNGLNQELGAD  267

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AAN   MHMDF+ NP+A+GFVTSK+ACCGQGPYNG+GLCT ASNLCPNRD+YAFWDP
Sbjct  268   VFIAANAQRMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTAASNLCPNRDLYAFWDP  327

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FHPSEKA+RIIVQ I  G+T+YMHPMNLSTIM +DSRT
Sbjct  328   FHPSEKASRIIVQQILRGTTEYMHPMNLSTIMAIDSRT  365



>ref|XP_004513280.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=368

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/342 (77%), Positives = 302/342 (88%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             + E RAFFVFGDSLVDNGNNNYLATTARAD  PYGID P HRA+GRFSNGLN+ D+ISEK
Sbjct  27    QVEARAFFVFGDSLVDNGNNNYLATTARADSYPYGIDSPAHRASGRFSNGLNMADLISEK  86

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G EPTLP LSP+L GEKLL GANFASAG+GILNDTG+QF+NIIRI  QL YF++YQ+RV
Sbjct  87    IGEEPTLPYLSPELDGEKLLAGANFASAGIGILNDTGIQFINIIRITAQLAYFKQYQQRV  146

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG  EAK+LVN+ALVLITLGGNDFVNNYYLVPFSARSR+F +PDYV FLISEYRKIL
Sbjct  147   SALIGENEAKKLVNEALVLITLGGNDFVNNYYLVPFSARSREFALPDYVVFLISEYRKIL  206

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
             + +Y+LGARRV+VTGTGP+GCVPAELA  SR GECA +LQRA  LFNPQL Q++ +LNS+
Sbjct  207   ENMYELGARRVLVTGTGPLGCVPAELAMHSRNGECATELQRAVNLFNPQLVQLINQLNSQ  266

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
               +DVF++AN + MH+DF+ +PQA+GFVTSKVACCGQG YNGIGLCT ASNLCPNRD+YA
Sbjct  267   FGSDVFISANAFTMHLDFVNDPQAYGFVTSKVACCGQGAYNGIGLCTPASNLCPNRDLYA  326

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWDPFHPSEKANR+IV    +GST+YMHPMNLSTI+ LDSRT
Sbjct  327   FWDPFHPSEKANRLIVDKFMTGSTEYMHPMNLSTIIALDSRT  368



>ref|XP_003554731.1| PREDICTED: GDSL esterase/lipase LTL1-like [Glycine max]
 gb|KHN43146.1| GDSL esterase/lipase LTL1 [Glycine soja]
Length=376

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/356 (75%), Positives = 312/356 (88%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ++L +    +V   +AE RAFFVFGDSLVDNGNNNYL TTARAD  PYG+DYPTHRATGR
Sbjct  19    LVLMIWNKIVVVVPQAEARAFFVFGDSLVDNGNNNYLFTTARADSYPYGVDYPTHRATGR  78

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISEK+G EPTLP LS +L GE+LLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  79    FSNGLNIPDIISEKIGSEPTLPYLSRELDGERLLVGANFASAGIGILNDTGIQFINIIRI  138

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL+YFE+YQ+RVS LIG  + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF +P
Sbjct  139   TRQLQYFEQYQQRVSALIGPEQTQRLVNQALVLITLGGNDFVNNYYLVPFSARSRQFALP  198

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             +YV +LISEYRKIL RLY+LGARRV+VTGTGP+GCVPAELAQRSR GECA +LQ+A+ALF
Sbjct  199   NYVVYLISEYRKILVRLYELGARRVLVTGTGPLGCVPAELAQRSRNGECAAELQQASALF  258

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL Q++ +LNSE+ +DVF++AN +  +MDFI NPQA+GF+TSKVACCGQGPYNGIGLC
Sbjct  259   NPQLVQLVNQLNSEIGSDVFISANAFQSNMDFISNPQAYGFITSKVACCGQGPYNGIGLC  318

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T ASNLCPNRD+YAFWDPFHPSE+ANR+IV     G + YMHPMNLST++ LDS +
Sbjct  319   TPASNLCPNRDVYAFWDPFHPSERANRLIVDTFMIGDSKYMHPMNLSTMLLLDSTS  374



>gb|KHN35333.1| GDSL esterase/lipase, partial [Glycine soja]
Length=368

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/338 (78%), Positives = 301/338 (89%), Gaps = 0/338 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVD+GNN++L TTARAD PPYGIDYPTHR TGRFSNGLNIPD+IS +LG+E
Sbjct  31    RAFFVFGDSLVDSGNNDFLVTTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISLELGLE  90

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             PTLP LSP L GEKLL+GANFASAG+GILNDTG+QF+NII I  QL+ F EYQ R+S  I
Sbjct  91    PTLPYLSPLLVGEKLLIGANFASAGIGILNDTGIQFLNIIHIQKQLKLFHEYQERLSLHI  150

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             GA   + LVN+ALVLITLGGNDFVNNYYLVP+SARSRQF++PDYV +LISEYRK+L+RLY
Sbjct  151   GAEGTRNLVNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLY  210

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             DLGARRV+VTGTGP+GCVPAELA RSR G+C V+LQRAA+LFNPQL QML  LN EL AD
Sbjct  211   DLGARRVLVTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVQMLNGLNQELGAD  270

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AAN   MHMDF+ NP+A+GFVTSK+ACCGQGPYNG+GLCT ASNLCPNRD+YAFWDP
Sbjct  271   VFIAANAQRMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTPASNLCPNRDLYAFWDP  330

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FHPSEKA+RIIVQ I  G+T+YMHPMNLSTIM +DS+T
Sbjct  331   FHPSEKASRIIVQQILRGTTEYMHPMNLSTIMAIDSKT  368



>ref|XP_010263996.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nelumbo nucifera]
Length=368

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/355 (77%), Positives = 315/355 (89%), Gaps = 0/355 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             +++GL         +AE RAFFVFGDSLVDNGNNNYLATTARAD  PYGIDYPTHR TGR
Sbjct  11    LVVGLAVTLCTLAPQAEARAFFVFGDSLVDNGNNNYLATTARADSYPYGIDYPTHRPTGR  70

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISE +G E TLP LSP+L+G+KLLVGANFASAGVG+LNDTG+QF++IIRI
Sbjct  71    FSNGLNIPDIISEAMGEESTLPYLSPELRGKKLLVGANFASAGVGVLNDTGIQFVSIIRI  130

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL+YF++YQRRVS +IG  + +QLVN+ALVLITLGGNDFVNNYYLVPFSARSRQ+++P
Sbjct  131   NQQLQYFQQYQRRVSKMIGEEQTQQLVNQALVLITLGGNDFVNNYYLVPFSARSRQYSLP  190

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV F+ISEY+K+L RLY+LGARRV+VTGTGP+GCVPAELA RS  GEC V+LQRAA LF
Sbjct  191   DYVRFVISEYKKVLARLYELGARRVLVTGTGPMGCVPAELAMRSVNGECVVELQRAADLF  250

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQLT+++ +LNSE+ +D F+AANT  MHMDFI NPQAFGFVTSK+ACCGQGPYNGIGLC
Sbjct  251   NPQLTEIIKQLNSEIGSDNFIAANTNRMHMDFISNPQAFGFVTSKIACCGQGPYNGIGLC  310

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             T ASNLCPNRD+YAFWDPFHPSE+ANRIIVQ I +GSTDYMHPMNLST+M LD++
Sbjct  311   TAASNLCPNRDVYAFWDPFHPSERANRIIVQQILAGSTDYMHPMNLSTVMALDAK  365



>ref|XP_003521783.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/338 (78%), Positives = 300/338 (89%), Gaps = 0/338 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVD+GNN++L TTARAD PPYGIDYPTHR TGRFSNGLNIPD+IS +LG+E
Sbjct  28    RAFFVFGDSLVDSGNNDFLVTTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISLELGLE  87

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             PTLP LSP L GEKLL+GANFASAG+GILNDTG+QF+NII I  QL+ F EYQ R+S  I
Sbjct  88    PTLPYLSPLLVGEKLLIGANFASAGIGILNDTGIQFLNIIHIQKQLKLFHEYQERLSLHI  147

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             GA   + LVN+ALVLITLGGNDFVNNYYLVP+SARSRQF++PDYV +LISEYRK+L+RLY
Sbjct  148   GAEGTRNLVNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLY  207

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             DLGARRV+VTGTGP+GCVPAELA RSR G+C V+LQRAA+LFNPQL QML  LN EL AD
Sbjct  208   DLGARRVLVTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVQMLNGLNQELGAD  267

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AAN   MHMDF+ NP+A+GFVTSK+ACCGQGPYNG+GLCT  SNLCPNRD+YAFWDP
Sbjct  268   VFIAANAQRMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTPTSNLCPNRDLYAFWDP  327

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FHPSEKA+RIIVQ I  G+T+YMHPMNLSTIM +DS+T
Sbjct  328   FHPSEKASRIIVQQILRGTTEYMHPMNLSTIMAIDSKT  365



>ref|XP_011002018.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Populus euphratica]
Length=368

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/360 (73%), Positives = 313/360 (87%), Gaps = 0/360 (0%)
 Frame = -3

Query  1323  NNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHR  1144
             +++ ++LGL  +      RA+ RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT +
Sbjct  9     SSYWVVLGLAVVLAAIVHRADARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRQ  68

Query  1143  ATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMN  964
             ATGRFSNGLNIPDIISE++G E  LP LSP+L+G++LLVGANFASAG+GILNDTGVQF+N
Sbjct  69    ATGRFSNGLNIPDIISEQMGSESPLPYLSPELRGQRLLVGANFASAGIGILNDTGVQFIN  128

Query  963   IIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQ  784
             IIR+  QLEYF++YQ+RV  LIGA +AK+LVN+ALVLIT+GGNDFVNNYYLVP SARSRQ
Sbjct  129   IIRMHRQLEYFQQYQQRVGALIGAEQAKRLVNQALVLITVGGNDFVNNYYLVPSSARSRQ  188

Query  783   FTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRA  604
             + +PDYV +LISEYR++L +LY+LGARRV+VTGTGP+GCVPAELA RS  G C+ +LQRA
Sbjct  189   YDLPDYVKYLISEYRELLMKLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSEELQRA  248

Query  603   AALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNG  424
             AAL+NPQL  M+ ++N ++ ++VF+AANT+ MH DF+ NPQA+GF TSK ACCGQGPYNG
Sbjct  249   AALYNPQLESMIKDVNRKIGSNVFIAANTHQMHTDFVSNPQAYGFTTSKTACCGQGPYNG  308

Query  423   IGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             IGLCT  SNLCPNRD+YAFWDPFHPSEKA+RIIVQ I +GST YM PMNLSTIM LDSR+
Sbjct  309   IGLCTTLSNLCPNRDLYAFWDPFHPSEKASRIIVQQIMTGSTQYMKPMNLSTIMALDSRS  368



>ref|XP_011077072.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=367

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/341 (77%), Positives = 300/341 (88%), Gaps = 0/341 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             R E RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPTHR TGRFSNGLNIPD+ISE+
Sbjct  26    RVEARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISEQ  85

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G E T+P L+P+L G+KLLVGANFASAGVG+LNDTG QF+NIIRI  QL +F++YQ+RV
Sbjct  86    MGWEATMPYLNPELTGQKLLVGANFASAGVGVLNDTGFQFVNIIRIYEQLNFFQQYQQRV  145

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG  E K+LV ++LVL+TLGGNDFVNNYYLVP+SARSRQFT+  YVP+++SEY+K+L
Sbjct  146   SALIGEEETKKLVKESLVLMTLGGNDFVNNYYLVPYSARSRQFTLQKYVPYVVSEYKKVL  205

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RL+DLG RRVIVTGTGP+GCVPAELA  S  GECA +LQ+AAALFNPQL QML ELN +
Sbjct  206   MRLHDLGPRRVIVTGTGPLGCVPAELALHSTNGECAEELQKAAALFNPQLVQMLNELNQQ  265

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             L ++VF+AANT  MHMDFI NPQAFGF TSK+ACCGQGPYNG+GLCT  SNLCPNRD+Y 
Sbjct  266   LGSNVFIAANTNQMHMDFISNPQAFGFTTSKIACCGQGPYNGLGLCTPFSNLCPNRDLYV  325

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FWDPFHPSE+AN++IVQ I +GST YMHPMNLSTIM LDSR
Sbjct  326   FWDPFHPSERANKLIVQQILAGSTAYMHPMNLSTIMALDSR  366



>ref|XP_002522021.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40425.1| zinc finger protein, putative [Ricinus communis]
Length=368

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/341 (78%), Positives = 297/341 (87%), Gaps = 0/341 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +AE RAFFVFGDSLVDNGNNNYLATTARAD PPYGID+PTHR TGRFSNGLNIPD IS+ 
Sbjct  27    QAEARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDFPTHRPTGRFSNGLNIPDFISQA  86

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G +  LP LSP L GE LLVGANFASAG+GILNDTGVQF NIIR+  Q EYFEEYQRRV
Sbjct  87    IGTDFLLPYLSPQLTGENLLVGANFASAGIGILNDTGVQFANIIRMFQQYEYFEEYQRRV  146

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             + LIGA   +QLVN ALVLIT+GGNDFVNNYYLVPFSARSRQ+++PDYV FLISEY+K+L
Sbjct  147   AALIGAERTQQLVNDALVLITVGGNDFVNNYYLVPFSARSRQYSLPDYVRFLISEYKKLL  206

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLYDLGARRV+VTGTGP+GCVPAELA RS  GECA +LQRAAALFNPQLTQML +LNS+
Sbjct  207   MRLYDLGARRVLVTGTGPLGCVPAELAMRSSNGECAAELQRAAALFNPQLTQMLRQLNSQ  266

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
               +D+F+AANT  M  DFI NP AFGFVTSKVACCGQGPYNG+GLCT  SNLCPNRD+YA
Sbjct  267   YGSDIFIAANTGQMSADFISNPGAFGFVTSKVACCGQGPYNGLGLCTGLSNLCPNRDVYA  326

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FWDPFHPSE+AN  I + I +G+TDYM+PMNLSTIM LDSR
Sbjct  327   FWDPFHPSERANSYIARQILTGTTDYMNPMNLSTIMALDSR  367



>ref|XP_006854343.1| hypothetical protein AMTR_s00039p00143210 [Amborella trichopoda]
 gb|ERN15810.1| hypothetical protein AMTR_s00039p00143210 [Amborella trichopoda]
Length=362

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/353 (75%), Positives = 310/353 (88%), Gaps = 2/353 (1%)
 Frame = -3

Query  1308  LLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRF  1129
             LLGL+  T V    +E RAFFVFGDSLVDNGNN+YLATTARAD PPYGIDYPTHR TGRF
Sbjct  11    LLGLVLSTQV--ATSEARAFFVFGDSLVDNGNNDYLATTARADNPPYGIDYPTHRPTGRF  68

Query  1128  SNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIG  949
             SNGLNIPDIISE +G EPTLP L+P+L G+KLLVGANFASAG+GILNDTG+QF+NIIRI 
Sbjct  69    SNGLNIPDIISENMGTEPTLPYLAPELTGQKLLVGANFASAGIGILNDTGIQFLNIIRIS  128

Query  948   NQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPD  769
              QLEYF++YQ+RV+ LIGA + ++LVN+ALVLITLGGNDFVNNYYLVP+SARSRQF++PD
Sbjct  129   KQLEYFQQYQQRVTTLIGAAQTQRLVNQALVLITLGGNDFVNNYYLVPYSARSRQFSLPD  188

Query  768   YVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFN  589
             YV +LI EY KIL RLY+LGARRV+VTGTGP+GCVPAELA RSR G+C  +LQRA+ALFN
Sbjct  189   YVRYLIPEYSKILARLYELGARRVLVTGTGPMGCVPAELAMRSRNGQCDPELQRASALFN  248

Query  588   PQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCT  409
             PQL QML +LN++  ++VF++AN +NMHMDFI NP AFGFVTSKVACCGQGPYNG+GLCT
Sbjct  249   PQLVQMLGQLNNQFGSNVFISANAFNMHMDFISNPGAFGFVTSKVACCGQGPYNGLGLCT  308

Query  408   QASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
               SNLC +R  YAFWDPFHPSE A+RIIV+   +G+T+YMHPMNLSTI+++D+
Sbjct  309   ALSNLCADRSKYAFWDPFHPSESASRIIVRQFMTGTTEYMHPMNLSTILQMDN  361



>ref|XP_009379726.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Pyrus x bretschneideri]
Length=362

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/357 (75%), Positives = 311/357 (87%), Gaps = 4/357 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGR-AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             +LLGLLA      GR AE RAF VFGDSLVD+GNN+YLATTARAD  PYGIDYPT R TG
Sbjct  9     VLLGLLAACA---GRQAEARAFLVFGDSLVDSGNNDYLATTARADSYPYGIDYPTRRPTG  65

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE +G EPTLP LSP L G+ LLVGANFASAG+GILNDTG QF+NIIR
Sbjct  66    RFSNGLNIPDLISEHIGSEPTLPYLSPQLTGQNLLVGANFASAGIGILNDTGFQFLNIIR  125

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYF++YQ RVS L+G  + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++
Sbjct  126   IYKQLEYFQQYQTRVSALVGPEQTQRLVNEALVLITLGGNDFVNNYYLVPFSARSRQFSL  185

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEYRK+L RLY+LGARRV+VTGTGP+GCVPAELAQRSR GECAV+LQRAA+L
Sbjct  186   PDYVVYLISEYRKVLARLYELGARRVLVTGTGPLGCVPAELAQRSRRGECAVELQRAASL  245

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL  M+  LN+++ +DVF+ A+ + MHM+FI NPQA+GFVTSK+ACCGQGPYNG+GL
Sbjct  246   FNPQLADMVNSLNNQIGSDVFIYADAFRMHMNFISNPQAYGFVTSKIACCGQGPYNGVGL  305

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT  SNLCPNRD+YAFWD FHPSEKANRIIVQ I +GS +YM+PMNLSTI+ LDS+T
Sbjct  306   CTIVSNLCPNRDLYAFWDSFHPSEKANRIIVQIILTGSNEYMNPMNLSTILALDSKT  362



>gb|ACR33100.1| putative tea geometrid larvae-inducible protein [Camellia sinensis]
Length=367

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/354 (75%), Positives = 305/354 (86%), Gaps = 0/354 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             +L  +L L      +AE RAFFVFGDSLVD+GNN+YLATTARAD PPYGIDYPTHR TGR
Sbjct  12    VLCLVLVLGSALAPQAEARAFFVFGDSLVDSGNNDYLATTARADNPPYGIDYPTHRPTGR  71

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDI+SE++G EPTLP LSP+L G++LL+GANFASAGVGILNDTG QF+NIIRI
Sbjct  72    FSNGLNIPDILSEQIGSEPTLPYLSPELTGDRLLIGANFASAGVGILNDTGFQFLNIIRI  131

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF++YQ RVS LIG  E + LVN+ LVLITLGGNDFVNNYYLVPFSARSRQF++P
Sbjct  132   YKQLEYFQQYQTRVSRLIGPAETQTLVNQGLVLITLGGNDFVNNYYLVPFSARSRQFSLP  191

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRK+L RLY+LGARRV+VTGTGP+GCVPAELAQRSR GEC V+LQRAA LF
Sbjct  192   DYVRYLISEYRKVLVRLYELGARRVLVTGTGPLGCVPAELAQRSRTGECVVELQRAAGLF  251

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+  LNS++ + VF+AAN   MHMDFI +PQA+GFVTSK+ACCGQGPYNG+GLC
Sbjct  252   NPQLIQMVNGLNSQIGSTVFIAANAQRMHMDFISDPQAYGFVTSKIACCGQGPYNGLGLC  311

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             T  SNLCPNRDIYAFWDPFHP E+ANR +VQ I +GS +YM PMNLS I+ LDS
Sbjct  312   TPLSNLCPNRDIYAFWDPFHPFERANRFVVQQILTGSPNYMSPMNLSPILALDS  365



>emb|CDP04255.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/343 (77%), Positives = 302/343 (88%), Gaps = 1/343 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             RA+ RAFF+FGDSLVDNGNNNYL T+ARAD PPYGIDYPTHR TGRFSNGLNIPDIISE+
Sbjct  27    RADARAFFIFGDSLVDNGNNNYLLTSARADAPPYGIDYPTHRPTGRFSNGLNIPDIISER  86

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +GM+  LP L+P+  G++LL GANFASAGVGILNDTG QF+NIIRI  QLEY++++Q RV
Sbjct  87    MGMQSPLPYLAPENTGQRLLNGANFASAGVGILNDTGFQFLNIIRITKQLEYYQQFQTRV  146

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
               LIG  +  QLVN+ LVLITLGGNDFVNNYYLVPFSARSRQF +PDYV +LISEYRKIL
Sbjct  147   GSLIGEQQTTQLVNQGLVLITLGGNDFVNNYYLVPFSARSRQFALPDYVRYLISEYRKIL  206

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY+LG+R+VIVTGTGPIGCVPAELAQRSR GEC+ +LQ AA+LFNPQL Q+++++NS+
Sbjct  207   MRLYELGSRKVIVTGTGPIGCVPAELAQRSRNGECSAELQHAASLFNPQLAQLISDINSQ  266

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             L ++VF+AANT  MHMDF+ NPQAFGFVTSK+ACCGQGPYNGIGLCT  SNLCPNRDIYA
Sbjct  267   LGSNVFMAANTMAMHMDFVSNPQAFGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDIYA  326

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD-SRT  244
             FWDPFHPSE+ANRIIVQ IFSGS  YMHPMNLS  + +D SRT
Sbjct  327   FWDPFHPSERANRIIVQQIFSGSPQYMHPMNLSAALAMDTSRT  369



>ref|XP_003521782.1| PREDICTED: GDSL esterase/lipase LTL1-like isoform X1 [Glycine 
max]
Length=376

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/349 (76%), Positives = 307/349 (88%), Gaps = 2/349 (1%)
 Frame = -3

Query  1284  IVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPD  1105
             +V   +AE RAFFVFGDSLVDNGNNNYL TTARAD  PYGIDYPTHRATGRFSNGLNIPD
Sbjct  28    VVVVPQAEARAFFVFGDSLVDNGNNNYLFTTARADSYPYGIDYPTHRATGRFSNGLNIPD  87

Query  1104  IISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEE  925
             IISEK+G EPTLP LS +L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  QL+YFE+
Sbjct  88    IISEKIGSEPTLPYLSRELDGERLLVGANFASAGIGILNDTGIQFINIIRISRQLQYFEQ  147

Query  924   YQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISE  745
             YQ+RVS LIG  + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF +P+YV +LISE
Sbjct  148   YQQRVSALIGPEQTQRLVNQALVLITLGGNDFVNNYYLVPFSARSRQFALPNYVVYLISE  207

Query  744   YRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLA  565
             YRKIL RLY+LGARRV+VTGTGP+GCVPAELAQRSR GECA +LQ A+ALFNPQL Q++ 
Sbjct  208   YRKILVRLYELGARRVLVTGTGPLGCVPAELAQRSRNGECAAELQEASALFNPQLVQLVN  267

Query  564   ELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPN  385
             +LNSE+ + VF++AN +  +MDFI NPQA+GF+TSKVACCGQGPYNGIGLCT ASNLCPN
Sbjct  268   QLNSEIGSVVFISANAFESNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNLCPN  327

Query  384   RDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD--SRT  244
             RD++AFWDPFHPSE+ANR+IV     G + YMHPMNLST++ LD  SRT
Sbjct  328   RDVFAFWDPFHPSERANRLIVDTFMIGDSKYMHPMNLSTVLLLDATSRT  376



>ref|XP_002268826.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Vitis vinifera]
Length=368

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/362 (73%), Positives = 308/362 (85%), Gaps = 0/362 (0%)
 Frame = -3

Query  1329  LPNNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPT  1150
             + N+  +++ L+AL        E RAFFVFGDSLVD+GNNNYL T+ARAD PPYGIDYPT
Sbjct  7     MANSSVLVMVLMALLGTLAPLTEARAFFVFGDSLVDSGNNNYLVTSARADSPPYGIDYPT  66

Query  1149  HRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQF  970
             HRATGRFSNGLNIPDIIS+ +  E TLP LSP L G+KLLVGANFASAG+GILNDTG+QF
Sbjct  67    HRATGRFSNGLNIPDIISQTIKSESTLPYLSPQLTGKKLLVGANFASAGIGILNDTGIQF  126

Query  969   MNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARS  790
             +NIIRI  QLEYF++YQ++++ L+GA +A+ +VN+ALVLITLGGNDFVNNYYLVP SARS
Sbjct  127   LNIIRIYRQLEYFQQYQQKLTALVGAQKARGIVNQALVLITLGGNDFVNNYYLVPNSARS  186

Query  789   RQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQ  610
             RQF +P+YV +LISEY+KIL RLY LGARRV+VTGTGP+GCVPAE A RSR GECA +LQ
Sbjct  187   RQFALPNYVRYLISEYQKILMRLYKLGARRVLVTGTGPMGCVPAERAMRSRNGECAAELQ  246

Query  609   RAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPY  430
             +A+ALFNPQL QML  LN +  ADVF+AANT+ MHMDFI +PQAFGF TSK+ACCGQGPY
Sbjct  247   QASALFNPQLVQMLQGLNKKFHADVFIAANTHEMHMDFITDPQAFGFTTSKIACCGQGPY  306

Query  429   NGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             NG+GLCT  SNLCPNR  YAFWD FHPSEKANR+IVQ I +GST YM+PMNLSTIM LDS
Sbjct  307   NGLGLCTVLSNLCPNRGQYAFWDAFHPSEKANRLIVQQIMTGSTMYMNPMNLSTIMALDS  366

Query  249   RT  244
             RT
Sbjct  367   RT  368



>ref|XP_011038448.1| PREDICTED: GDSL esterase/lipase At5g33370 [Populus euphratica]
 ref|XP_011038449.1| PREDICTED: GDSL esterase/lipase At5g33370 [Populus euphratica]
Length=368

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/360 (72%), Positives = 313/360 (87%), Gaps = 0/360 (0%)
 Frame = -3

Query  1323  NNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHR  1144
             +++ ++ GL  +      +A+ RAF VFGDSLVD+GNNNYLATTARAD  PYGIDYPTHR
Sbjct  9     SSYWVISGLALVLGAIVHQADARAFLVFGDSLVDSGNNNYLATTARADSYPYGIDYPTHR  68

Query  1143  ATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMN  964
             ATGRFSNGLNIPD+ISE++G E  LP LSP+L+G+KLLVGANFASAG+GILNDTG+QF+N
Sbjct  69    ATGRFSNGLNIPDLISEQIGSESPLPYLSPELRGQKLLVGANFASAGIGILNDTGIQFIN  128

Query  963   IIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQ  784
             IIR+  QLEYF++YQ+RV  LIGA +AKQLVN+AL+L+T+GGNDFVNNYYLVP+SARSRQ
Sbjct  129   IIRMHRQLEYFQQYQQRVGALIGAEKAKQLVNQALILLTVGGNDFVNNYYLVPYSARSRQ  188

Query  783   FTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRA  604
             + +PDYV +LISEY+K+L RLY+LGARRV+VTGTGP+GCVPAELA RS  G C+ +LQRA
Sbjct  189   YDLPDYVKYLISEYKKLLMRLYNLGARRVLVTGTGPLGCVPAELAMRSANGGCSAELQRA  248

Query  603   AALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNG  424
             AAL+NPQL  M+ ++N ++ +DVF+AANT+ MH+DF  NPQA+GF TSK+ACCGQGPYNG
Sbjct  249   AALYNPQLESMIIDVNRKIGSDVFIAANTHQMHVDFFSNPQAYGFTTSKIACCGQGPYNG  308

Query  423   IGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             +GLCT  SNLCPNRD+YAFWDPFHPSEKAN+IIVQ I +GST YM PMNLSTIM LDSRT
Sbjct  309   LGLCTLFSNLCPNRDLYAFWDPFHPSEKANKIIVQQIMTGSTRYMKPMNLSTIMALDSRT  368



>gb|KHN35332.1| GDSL esterase/lipase LTL1 [Glycine soja]
Length=376

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/349 (76%), Positives = 307/349 (88%), Gaps = 2/349 (1%)
 Frame = -3

Query  1284  IVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPD  1105
             +V   +AE RAFFVFGDSLVDNGNNNYL TTARAD  PYG+DYPTHRATGRFSNGLNIPD
Sbjct  28    VVVVPQAEARAFFVFGDSLVDNGNNNYLFTTARADSYPYGVDYPTHRATGRFSNGLNIPD  87

Query  1104  IISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEE  925
             IISEK+G EPTLP LS +L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  QL+YFE+
Sbjct  88    IISEKIGSEPTLPYLSRELDGERLLVGANFASAGIGILNDTGIQFINIIRISRQLQYFEQ  147

Query  924   YQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISE  745
             YQ+RVS LIG  + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF +P+YV +LISE
Sbjct  148   YQQRVSALIGPEQTQRLVNQALVLITLGGNDFVNNYYLVPFSARSRQFALPNYVLYLISE  207

Query  744   YRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLA  565
             YRKIL RLY+LGARRV+VTGTGP+GCVPAELAQRSR GECA +LQ A+ALFNPQL Q++ 
Sbjct  208   YRKILVRLYELGARRVLVTGTGPLGCVPAELAQRSRNGECAAELQEASALFNPQLVQLVN  267

Query  564   ELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPN  385
             +LNSE+ + VF++AN +  +MDFI NPQA+GF+TSKVACCGQGPYNGIGLCT ASNLCPN
Sbjct  268   QLNSEIGSVVFISANAFESNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNLCPN  327

Query  384   RDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD--SRT  244
             RD++AFWDPFHPSE+ANR+IV     G + YMHPMNLST++ LD  SRT
Sbjct  328   RDVFAFWDPFHPSERANRLIVDTFMIGDSKYMHPMNLSTVLLLDATSRT  376



>ref|XP_006371114.1| hypothetical protein POPTR_0019s04150g [Populus trichocarpa]
 gb|ERP48911.1| hypothetical protein POPTR_0019s04150g [Populus trichocarpa]
Length=395

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/360 (72%), Positives = 313/360 (87%), Gaps = 0/360 (0%)
 Frame = -3

Query  1323  NNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHR  1144
             +++ ++LGL  +      RA+ RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT +
Sbjct  36    SSYWVVLGLAVVLAAIVHRADARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRQ  95

Query  1143  ATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMN  964
             ATGRFSNGLNIPDIISE++G E  LP LSP+L+G++LLVGANFASAG+GILNDTGVQF+N
Sbjct  96    ATGRFSNGLNIPDIISEQMGSESPLPFLSPELRGQRLLVGANFASAGIGILNDTGVQFIN  155

Query  963   IIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQ  784
             IIR+  QLEYF++YQ+RV  LIGA +AK+LVN+ALVLIT+GGNDFVNNYYLVP SARSRQ
Sbjct  156   IIRMYAQLEYFQQYQQRVGALIGAEQAKRLVNQALVLITVGGNDFVNNYYLVPSSARSRQ  215

Query  783   FTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRA  604
             + +PDYV +LISEYR++L +LY+LGARRV+VTGTGP+GCVPAELA RS  G C+ +LQRA
Sbjct  216   YDLPDYVKYLISEYRELLMKLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSEELQRA  275

Query  603   AALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNG  424
             AAL+NPQL  M+ ++N ++ ++VF++ANT+ MH DF+ NPQA+GF TSK+ACCGQG YNG
Sbjct  276   AALYNPQLESMINDVNRKIGSNVFISANTHQMHTDFVSNPQAYGFTTSKIACCGQGSYNG  335

Query  423   IGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             +GLCT  SNLCPNRD+YAFWDPFHPSEKANRIIVQ I +GST YM PMNLSTIM LDSR+
Sbjct  336   LGLCTILSNLCPNRDVYAFWDPFHPSEKANRIIVQQIMTGSTQYMKPMNLSTIMALDSRS  395



>ref|XP_007205392.1| hypothetical protein PRUPE_ppa007427mg [Prunus persica]
 gb|EMJ06591.1| hypothetical protein PRUPE_ppa007427mg [Prunus persica]
Length=368

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/342 (77%), Positives = 297/342 (87%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +AE RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGRFSNG NIPD IS++
Sbjct  27    QAEGRAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTGRPTGRFSNGFNIPDFISQQ  86

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG E TLP LSP+L G+KLLVGANFASAG+GILNDTG+QF+NIIR+  QLEYF++YQ+RV
Sbjct  87    LGAESTLPYLSPELTGQKLLVGANFASAGIGILNDTGIQFVNIIRMSRQLEYFQQYQQRV  146

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG    KQLVN+ALVL+T+GGNDFVNNYYLVPFSARSRQ+ +PDYV  LISE +K+L
Sbjct  147   SALIGTQRTKQLVNQALVLLTVGGNDFVNNYYLVPFSARSRQYDLPDYVKLLISELKKLL  206

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              R+YDLG RRV+VTGTGP+GCVPAELAQRSR GEC+ +LQRAA+L+NPQL QML  LNS+
Sbjct  207   LRMYDLGTRRVLVTGTGPLGCVPAELAQRSRNGECSAELQRAASLYNPQLVQMLKSLNSQ  266

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             L +DVF+AANT     DFI NPQAFGF TSK+ACCGQGPYNG+GLCT ASNLCPNR  YA
Sbjct  267   LGSDVFIAANTQQTRNDFISNPQAFGFSTSKIACCGQGPYNGLGLCTVASNLCPNRGRYA  326

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWD FHPSEKAN++IVQ I +GST YM PMNLSTI+ LDSRT
Sbjct  327   FWDAFHPSEKANKLIVQNILTGSTKYMDPMNLSTILALDSRT  368



>emb|CBI28654.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/362 (73%), Positives = 308/362 (85%), Gaps = 0/362 (0%)
 Frame = -3

Query  1329  LPNNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPT  1150
             + N+  +++ L+AL        E RAFFVFGDSLVD+GNNNYL T+ARAD PPYGIDYPT
Sbjct  1     MANSSVLVMVLMALLGTLAPLTEARAFFVFGDSLVDSGNNNYLVTSARADSPPYGIDYPT  60

Query  1149  HRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQF  970
             HRATGRFSNGLNIPDIIS+ +  E TLP LSP L G+KLLVGANFASAG+GILNDTG+QF
Sbjct  61    HRATGRFSNGLNIPDIISQTIKSESTLPYLSPQLTGKKLLVGANFASAGIGILNDTGIQF  120

Query  969   MNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARS  790
             +NIIRI  QLEYF++YQ++++ L+GA +A+ +VN+ALVLITLGGNDFVNNYYLVP SARS
Sbjct  121   LNIIRIYRQLEYFQQYQQKLTALVGAQKARGIVNQALVLITLGGNDFVNNYYLVPNSARS  180

Query  789   RQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQ  610
             RQF +P+YV +LISEY+KIL RLY LGARRV+VTGTGP+GCVPAE A RSR GECA +LQ
Sbjct  181   RQFALPNYVRYLISEYQKILMRLYKLGARRVLVTGTGPMGCVPAERAMRSRNGECAAELQ  240

Query  609   RAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPY  430
             +A+ALFNPQL QML  LN +  ADVF+AANT+ MHMDFI +PQAFGF TSK+ACCGQGPY
Sbjct  241   QASALFNPQLVQMLQGLNKKFHADVFIAANTHEMHMDFITDPQAFGFTTSKIACCGQGPY  300

Query  429   NGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             NG+GLCT  SNLCPNR  YAFWD FHPSEKANR+IVQ I +GST YM+PMNLSTIM LDS
Sbjct  301   NGLGLCTVLSNLCPNRGQYAFWDAFHPSEKANRLIVQQIMTGSTMYMNPMNLSTIMALDS  360

Query  249   RT  244
             RT
Sbjct  361   RT  362



>ref|XP_010435380.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Camelina sativa]
Length=366

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/352 (74%), Positives = 304/352 (86%), Gaps = 0/352 (0%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             +L +  +   +A  RAF VFGDSLVDNGNN++LATTARAD  PYGID+PTHR TGRFSNG
Sbjct  15    ILQVMSLLLPQANARAFLVFGDSLVDNGNNDFLATTARADNYPYGIDFPTHRPTGRFSNG  74

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             LNIPD+ISE LG E  +P LSP LK EKLLVGANFASAG+GILNDTG+QF+NIIRI  QL
Sbjct  75    LNIPDLISEHLGQESPMPYLSPMLKKEKLLVGANFASAGIGILNDTGIQFLNIIRITKQL  134

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
             EYFE+Y+ RVS L+G  E  +LVN ALVLITLGGNDFVNNYYLVPFSARSRQF++PDYV 
Sbjct  135   EYFEQYKLRVSGLVGEEEMNRLVNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVV  194

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQL  580
             F+ISEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR GECA +LQRAA+LFNPQL
Sbjct  195   FIISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQL  254

Query  579   TQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQAS  400
              QM+ ELN+E+ +  F+AANT  MHMDFI +PQA+GFVTSKVACCGQGPYNGIGLCT  S
Sbjct  255   VQMITELNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLS  314

Query  399   NLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             NLCPNRD++AFWDPFHPSEKA+RII Q I +GS +YMHPMNLST++ +D  T
Sbjct  315   NLCPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTVLTVDLMT  366



>ref|XP_004494760.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=371

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/358 (75%), Positives = 312/358 (87%), Gaps = 1/358 (0%)
 Frame = -3

Query  1317  HGILLGLLALTIVFFG-RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRA  1141
             H +++ ++A++  F G  A  RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R 
Sbjct  13    HVVIIFMVAMSTGFKGTEAAPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRP  72

Query  1140  TGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNI  961
             TGRFSNGLNIPD IS +LG E TLP LSP+L G++LLVGANFASAG+GILNDTG+QF+NI
Sbjct  73    TGRFSNGLNIPDFISRELGAESTLPYLSPELNGQRLLVGANFASAGIGILNDTGIQFVNI  132

Query  960   IRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQF  781
             IRI  QLEYFEEYQ+RVS LIGA   ++LVN ALVLITLGGNDFVNNYYLVPFSARSRQ+
Sbjct  133   IRIYRQLEYFEEYQQRVSGLIGAEGTRRLVNGALVLITLGGNDFVNNYYLVPFSARSRQY  192

Query  780   TIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAA  601
              +P+YV +LISEY+KIL+RLYDLGARRV+VTGTGP+GCVPAELAQRS  GEC+ +L RAA
Sbjct  193   PLPNYVKYLISEYKKILRRLYDLGARRVLVTGTGPLGCVPAELAQRSVNGECSPELMRAA  252

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             +LFNPQL QM+ +LN E+ +++FV ANT  M ++F+ NPQA+GFVTSKVACCGQGPYNG+
Sbjct  253   SLFNPQLVQMIQQLNGEIGSNIFVGANTRQMSINFVNNPQAYGFVTSKVACCGQGPYNGL  312

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             GLCT ASNLCPNRD YAFWDPFHPSE+AN IIVQ I SG+T+YM+PMNLSTI+ LDS+
Sbjct  313   GLCTVASNLCPNRDQYAFWDPFHPSERANSIIVQQIMSGNTEYMYPMNLSTILALDSK  370



>ref|XP_008218371.1| PREDICTED: GDSL esterase/lipase LTL1-like [Prunus mume]
Length=405

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/342 (76%), Positives = 299/342 (87%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +AE RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGRFSNG NIPD IS++
Sbjct  64    QAEGRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSNGFNIPDFISQQ  123

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G E TLP LSP+L G+KLLVGANFASAG+GILNDTG+QF+NIIR+  QLEYF++YQ+RV
Sbjct  124   IGAESTLPYLSPELTGQKLLVGANFASAGIGILNDTGIQFVNIIRMSRQLEYFQQYQQRV  183

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIGA   KQLVN ALVL+T+GGNDFVNNYYLVPFSARSRQ+ +PDYV  L+SE +K+L
Sbjct  184   SALIGAQRTKQLVNGALVLLTVGGNDFVNNYYLVPFSARSRQYDLPDYVKLLMSELKKLL  243

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              R+YDLG RRV+VTGTGP+GCVPAELAQRSR GEC+ +LQRAA+L+NPQL Q+L  LNS+
Sbjct  244   LRMYDLGTRRVLVTGTGPLGCVPAELAQRSRNGECSAELQRAASLYNPQLVQLLKSLNSQ  303

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             L +DVF+AANT     DFI NPQAFGF TSK+ACCGQGPYNG+GLCT ASNLCPNRD YA
Sbjct  304   LGSDVFIAANTQQTRNDFISNPQAFGFSTSKIACCGQGPYNGLGLCTVASNLCPNRDRYA  363

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWD FHPSEKAN++IVQ I +GST YM+PMNLSTI+ LDSRT
Sbjct  364   FWDAFHPSEKANKLIVQNILTGSTKYMNPMNLSTILALDSRT  405



>ref|NP_198322.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8LB81.1|GDL79_ARATH RecName: Full=GDSL esterase/lipase At5g33370; AltName: Full=Extracellular 
lipase At5g33370; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM64916.1| putative GDSL-motif lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AAO42146.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50514.1| unknown protein [Arabidopsis thaliana]
 gb|AED93898.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=366

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/357 (74%), Positives = 308/357 (86%), Gaps = 2/357 (1%)
 Frame = -3

Query  1308  LLG--LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             LLG  +L +T +   +A  RAF VFGDSLVDNGNN++LATTARAD  PYGID+PTHR TG
Sbjct  10    LLGFCILQVTSLLVPQANARAFLVFGDSLVDNGNNDFLATTARADNYPYGIDFPTHRPTG  69

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE LG E  +P LSP LK +KLL GANFASAG+GILNDTG+QF+NIIR
Sbjct  70    RFSNGLNIPDLISEHLGQESPMPYLSPMLKKDKLLRGANFASAGIGILNDTGIQFLNIIR  129

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYFE+Y+ RVS L+G  E  +LVN ALVLITLGGNDFVNNYYLVPFSARSRQF++
Sbjct  130   ITKQLEYFEQYKVRVSGLVGEEEMNRLVNGALVLITLGGNDFVNNYYLVPFSARSRQFSL  189

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV F+ISEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR GECA +LQRAA+L
Sbjct  190   PDYVVFVISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECATELQRAASL  249

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL QM+ +LN+E+ +  F+AANT  MHMDFI +PQA+GFVTSKVACCGQGPYNGIGL
Sbjct  250   FNPQLIQMITDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGL  309

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT  SNLCPNRD++AFWDPFHPSEKA+RII Q I +GS +YMHPMNLSTI+ +DS T
Sbjct  310   CTPLSNLCPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTILTVDSMT  366



>ref|XP_003626495.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82713.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=371

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/355 (74%), Positives = 307/355 (86%), Gaps = 0/355 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             +++ ++ALT  F G    RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGR
Sbjct  15    VIILMVALTSCFKGTVAQRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRPTGR  74

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD IS+ LG EPTLP LSP+L GE LLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  75    FSNGYNIPDFISQALGAEPTLPYLSPELNGEALLVGANFASAGIGILNDTGIQFINIIRI  134

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF++YQ+RVS LIG  + + LVN ALVLITLGGNDFVNNYYLVPFSARSRQ+ +P
Sbjct  135   FRQLEYFQQYQQRVSGLIGPEQTQSLVNGALVLITLGGNDFVNNYYLVPFSARSRQYNLP  194

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV ++ISEY+KIL+RLYDLGARRVIVTGTGPIGCVPAELAQR   G C+V+LQRAAALF
Sbjct  195   DYVRYIISEYKKILRRLYDLGARRVIVTGTGPIGCVPAELAQRGTNGGCSVELQRAAALF  254

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL Q++ +LN+E+ ++VF+ ANT  M +DF+ NPQA+GFVTS++ACCGQGPYNG+GLC
Sbjct  255   NPQLIQIIQQLNNEIGSNVFMGANTRQMALDFVNNPQAYGFVTSQIACCGQGPYNGLGLC  314

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             T  SNLCPNRD YAFWD FHPSEKAN +IVQ I SG+TDYM+PMNLST++ LDS+
Sbjct  315   TPLSNLCPNRDEYAFWDAFHPSEKANSLIVQQILSGTTDYMYPMNLSTVLALDSK  369



>ref|XP_003520948.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Glycine 
max]
 gb|KHN27241.1| GDSL esterase/lipase [Glycine soja]
Length=372

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/349 (75%), Positives = 304/349 (87%), Gaps = 1/349 (0%)
 Frame = -3

Query  1287  TIVFFGRAEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNI  1111
             +I+   +AE  RAFFVFGDSLVDNGNNN+LATTARAD  PYGID  +HRA+GRFSNGLN+
Sbjct  24    SIIVAPQAEAARAFFVFGDSLVDNGNNNFLATTARADSYPYGIDSASHRASGRFSNGLNM  83

Query  1110  PDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYF  931
             PD+ISEK+G EPTLP LSP L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  QL YF
Sbjct  84    PDLISEKIGSEPTLPYLSPQLNGERLLVGANFASAGIGILNDTGIQFINIIRITEQLAYF  143

Query  930   EEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLI  751
             ++YQ+RVS LIG  + + LVNKALVLITLGGNDFVNNYYLVPFSARSR++ +PDYV FLI
Sbjct  144   KQYQQRVSALIGEEQTRNLVNKALVLITLGGNDFVNNYYLVPFSARSREYALPDYVVFLI  203

Query  750   SEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQM  571
             SEYRKIL  LY+LGARRV+VTGTGP+GCVPAELA  S+ GECA +LQRA  LFNPQL Q+
Sbjct  204   SEYRKILANLYELGARRVLVTGTGPLGCVPAELAMHSQNGECATELQRAVNLFNPQLVQL  263

Query  570   LAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLC  391
             L ELN+++ +DVF++AN + MH+DF+ NPQA+GFVTSKVACCGQG YNGIGLCT ASNLC
Sbjct  264   LHELNTQIGSDVFISANAFTMHLDFVSNPQAYGFVTSKVACCGQGAYNGIGLCTPASNLC  323

Query  390   PNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             PNRD+YAFWDPFHPSE+ANR+IV    +GST+YMHPMNLSTI+ LDS T
Sbjct  324   PNRDLYAFWDPFHPSERANRLIVDKFMTGSTEYMHPMNLSTIIALDSTT  372



>ref|XP_010440676.1| PREDICTED: GDSL esterase/lipase At5g33370 isoform X1 [Camelina 
sativa]
 ref|XP_010450323.1| PREDICTED: GDSL esterase/lipase At5g33370 isoform X1 [Camelina 
sativa]
Length=366

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/352 (74%), Positives = 304/352 (86%), Gaps = 0/352 (0%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             +L +  +   +A  RAF VFGDSLVDNGNN++LATTARAD  PYGID+PTHR TGRFSNG
Sbjct  15    MLQVMSLLVPQANARAFLVFGDSLVDNGNNDFLATTARADNYPYGIDFPTHRPTGRFSNG  74

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             LNIPD+ISE LG E  +P LSP LK EKLLVGANFASAG+GILNDTG+QF+NIIRI  QL
Sbjct  75    LNIPDLISEHLGQESPMPYLSPMLKKEKLLVGANFASAGIGILNDTGIQFLNIIRITKQL  134

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
             EYFE+Y+ RVS L+G  E  +LVN ALVLITLGGNDFVNNYYLVPFSARSRQF++PDYV 
Sbjct  135   EYFEQYKLRVSGLVGEEEMNRLVNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVV  194

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQL  580
             F+ISEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR GECA +LQRAA+LFNPQL
Sbjct  195   FIISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQL  254

Query  579   TQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQAS  400
              QM+ +LN+E+ +  F+AANT  MHMDFI +PQA+GFVTSKVACCGQGPYNGIGLCT  S
Sbjct  255   VQMITDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLS  314

Query  399   NLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             NLCPNRD++AFWDPFHPSEKA+RII Q I +GS +YMHPMNLST++ +D  T
Sbjct  315   NLCPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTVLTVDLMT  366



>gb|EYU39770.1| hypothetical protein MIMGU_mgv1a009318mg [Erythranthe guttata]
Length=345

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/341 (76%), Positives = 298/341 (87%), Gaps = 0/341 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
              AE RAFFVFGDSLVDNGNNNYL TTARAD  PYGIDYP+H+ATGRFSNGLNIPDIISE 
Sbjct  4     HAEARAFFVFGDSLVDNGNNNYLVTTARADAYPYGIDYPSHQATGRFSNGLNIPDIISES  63

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G EPTLP LSP L  +KLL+GANFASAGVG+LNDTG+QF+NIIRI  QL YFEEY++RV
Sbjct  64    MGWEPTLPYLSPQLVEQKLLIGANFASAGVGVLNDTGIQFVNIIRIYQQLNYFEEYKQRV  123

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S+LIG  E ++LV ++LVLITLGGNDFVNNY+LVP+SARSRQ+++P YVPF+ISEY+K+L
Sbjct  124   SELIGEDETQKLVKESLVLITLGGNDFVNNYFLVPYSARSRQYSLPKYVPFVISEYKKVL  183

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
             +RLY LG RRVIVTGTGP+GCVPAELAQ S  GECA +LQ+AA+LFNPQL +ML +LN  
Sbjct  184   KRLYKLGFRRVIVTGTGPLGCVPAELAQHSTDGECAKELQKAASLFNPQLDKMLKQLNHG  243

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             L  DVF+AANT  MHMDFI NP  FGFVTSK+ACCGQGPYNG+GLCT  SNLCPNRD+YA
Sbjct  244   LGKDVFIAANTNLMHMDFIANPTRFGFVTSKIACCGQGPYNGLGLCTPLSNLCPNRDLYA  303

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FWDPFHPSEKANR+IVQ + +GS  YMHPMNLSTIM +DSR
Sbjct  304   FWDPFHPSEKANRMIVQQMLTGSNLYMHPMNLSTIMAMDSR  344



>ref|XP_011002019.1| PREDICTED: GDSL esterase/lipase LTL1-like [Populus euphratica]
Length=367

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/354 (76%), Positives = 314/354 (89%), Gaps = 0/354 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ++LGL+          E RAFFVFGDSLVDNGNNNYL TTARAD PPYG+DYPTHRATGR
Sbjct  12    LILGLVITLSSVTPEVEARAFFVFGDSLVDNGNNNYLVTTARADAPPYGVDYPTHRATGR  71

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPD+IS+ +G EPTLP LSP+L+GEKLLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  72    FSNGLNIPDLISQAIGSEPTLPYLSPELRGEKLLVGANFASAGIGILNDTGIQFLNIIRI  131

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
             G QL+YF++YQ+RVS LIG+ +A++LVN+ALVL+TLGGNDFVNNYYLVPFSARSRQF +P
Sbjct  132   GRQLQYFQQYQQRVSALIGSEQAQRLVNQALVLVTLGGNDFVNNYYLVPFSARSRQFALP  191

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRKIL R+Y+LGARRV+VTGTGP+GCVPAE A RSR GECA +LQRAAALF
Sbjct  192   DYVVYLISEYRKILVRVYELGARRVLVTGTGPLGCVPAERAMRSRNGECAAELQRAAALF  251

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QML ELN E+ +DVF+AAN ++ +MDF+ NPQA+GFVTS+VACCGQG +NGIGLC
Sbjct  252   NPQLVQMLMELNREIGSDVFIAANAFDANMDFVTNPQAYGFVTSQVACCGQGRFNGIGLC  311

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             T ASNLCPNR+I+AFWDPFHP+E+ANRIIV  I +GST YM+PMNLSTIM LDS
Sbjct  312   TIASNLCPNREIFAFWDPFHPTERANRIIVSSIVTGSTKYMNPMNLSTIMALDS  365



>emb|CAN66351.1| hypothetical protein VITISV_039098 [Vitis vinifera]
Length=354

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/352 (75%), Positives = 302/352 (86%), Gaps = 0/352 (0%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             L+AL        E RAFFVFGDSLVD+GNNNYL T+ARAD PPYGIDYPTHRATGRFSNG
Sbjct  3     LMALLGTLAPLTEARAFFVFGDSLVDSGNNNYLVTSARADSPPYGIDYPTHRATGRFSNG  62

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             LNIPDIIS+ +  E TLP LSP L G+KLLVGANFASAG+GILNDTG+QF+NIIRI  QL
Sbjct  63    LNIPDIISQTIKSESTLPYLSPQLTGKKLLVGANFASAGIGILNDTGIQFLNIIRIYRQL  122

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
             EYF++YQ++++ L+GA +A+ +VN+ALVLITLGGNDFVNNYYLVP SARSRQF +P+YV 
Sbjct  123   EYFQQYQQKLTALVGAQKARGIVNQALVLITLGGNDFVNNYYLVPNSARSRQFALPNYVR  182

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQL  580
             +LISEY+KIL RLY LGARRV+VTGTGP+GCVPAE A RSR GECA +LQ+A+ALFNPQL
Sbjct  183   YLISEYQKILMRLYKLGARRVLVTGTGPMGCVPAERAMRSRNGECAAELQQASALFNPQL  242

Query  579   TQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQAS  400
              QML  LN +  ADVF+AANT+ MHMDFI +PQA+GF TSK+ACCGQGPYNG+GLCT  S
Sbjct  243   VQMLQGLNKKFHADVFIAANTHEMHMDFITDPQAYGFTTSKIACCGQGPYNGLGLCTVLS  302

Query  399   NLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             NLCPNR  YAFWD FHPSEKANR+IVQ I +GST YM+PMNLSTIM LDSRT
Sbjct  303   NLCPNRGQYAFWDAFHPSEKANRLIVQQIMTGSTMYMNPMNLSTIMALDSRT  354



>ref|XP_002868396.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44655.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=366

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/357 (74%), Positives = 306/357 (86%), Gaps = 2/357 (1%)
 Frame = -3

Query  1308  LLGLLALTI--VFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             LLG   L +  +   +A  RAF VFGDSLVDNGNN++LATTARAD  PYGID+PTHR TG
Sbjct  10    LLGFCILQVMSLLVPQANARAFLVFGDSLVDNGNNDFLATTARADNYPYGIDFPTHRPTG  69

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE LG E  +P LSP LK +KLL GANFASAG+GILNDTG+QF+NIIR
Sbjct  70    RFSNGLNIPDLISEHLGQESPMPYLSPMLKKDKLLRGANFASAGIGILNDTGIQFLNIIR  129

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYFE+Y+ RVS L+G  E  +LVN ALVLITLGGNDFVNNYYLVPFSARSRQF++
Sbjct  130   ITKQLEYFEQYKVRVSGLVGEEEMNRLVNGALVLITLGGNDFVNNYYLVPFSARSRQFSL  189

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV F+ISEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR GECA +LQRAA+L
Sbjct  190   PDYVVFIISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECATELQRAASL  249

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL QM+ +LN+E+ +  F+AANT  MHMDFI +PQA+GFVTSKVACCGQGPYNGIGL
Sbjct  250   FNPQLVQMITDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGL  309

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT  SNLCPNRD++AFWDPFHPSEKA+RII Q I +GS +YMHPMNLSTI+ +DS T
Sbjct  310   CTPLSNLCPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTILTVDSMT  366



>ref|XP_003555561.1| PREDICTED: GDSL esterase/lipase At5g33370 [Glycine max]
Length=371

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/358 (74%), Positives = 307/358 (86%), Gaps = 3/358 (1%)
 Frame = -3

Query  1311  ILLGLLALTIV---FFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRA  1141
             +L  ++AL I    F G    RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R 
Sbjct  12    VLSLVMALAISGFNFKGAEAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRP  71

Query  1140  TGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNI  961
             TGRFSNGLNIPD IS++LG E TLP LSP+L GE+LLVGANFASAG+GILNDTGVQF+NI
Sbjct  72    TGRFSNGLNIPDFISQELGSESTLPYLSPELNGERLLVGANFASAGIGILNDTGVQFVNI  131

Query  960   IRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQF  781
             IRI  QLEYF+EYQ+RVS L+G  + K+LVN ALVLIT GGNDFVNNYYLVP SARSRQF
Sbjct  132   IRITRQLEYFQEYQQRVSALVGDEKTKELVNGALVLITCGGNDFVNNYYLVPNSARSRQF  191

Query  780   TIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAA  601
              +PDYV ++ISEY+K+L+RLYDLGARRV+VTGTGP+GCVPAELA R R GEC+ +LQRA+
Sbjct  192   ALPDYVTYVISEYKKVLRRLYDLGARRVLVTGTGPLGCVPAELALRGRNGECSEELQRAS  251

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             AL+NPQL +M+ +LN E+ +DVFVAANT  MH DF+ NPQA+GF+TSKVACCGQGP+NG+
Sbjct  252   ALYNPQLVEMIKQLNKEVGSDVFVAANTQLMHDDFVTNPQAYGFITSKVACCGQGPFNGL  311

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             GLCT  SNLCPNR  +AFWDPFHPSEKANR+IVQ I SG++ YMHPMNLSTI+ LDS+
Sbjct  312   GLCTVVSNLCPNRHEFAFWDPFHPSEKANRLIVQQIMSGTSKYMHPMNLSTILALDSK  369



>ref|XP_006283972.1| hypothetical protein CARUB_v10005096mg [Capsella rubella]
 gb|EOA16870.1| hypothetical protein CARUB_v10005096mg [Capsella rubella]
Length=366

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/355 (74%), Positives = 307/355 (86%), Gaps = 2/355 (1%)
 Frame = -3

Query  1308  LLGLLALTIV--FFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             LLG   L ++     +A  RAF VFGDSLVDNGNN++LATTARAD  PYGID+PTHR TG
Sbjct  10    LLGFCILQVISLLVPQANARAFLVFGDSLVDNGNNDFLATTARADNYPYGIDFPTHRPTG  69

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE LG E  +P LSP LK ++LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  70    RFSNGLNIPDLISEHLGQESPMPYLSPMLKKDRLLVGANFASAGIGILNDTGIQFLNIIR  129

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYFE+Y+ RVS L+G  E  +LVN ALVLITLGGNDFVNNYYLVPFSARSRQ+++
Sbjct  130   ITKQLEYFEQYKLRVSGLVGEEEMNRLVNGALVLITLGGNDFVNNYYLVPFSARSRQYSL  189

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV F+ISEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR GECA +LQRAA+L
Sbjct  190   PDYVVFIISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRDGECATELQRAASL  249

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQLTQM+++LN+E+ +  F+AANT  MHMDFI +PQ +GFVTSKVACCGQGPYNGIGL
Sbjct  250   FNPQLTQMISDLNNEVGSSAFIAANTQQMHMDFISDPQRYGFVTSKVACCGQGPYNGIGL  309

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWDPFHPSEKA+RII + I +GS +YMHPMNLST++ +DS
Sbjct  310   CTPLSNLCPNRDLYAFWDPFHPSEKASRIIAEQILNGSPEYMHPMNLSTVLTVDS  364



>gb|KHN04961.1| GDSL esterase/lipase [Glycine soja]
Length=355

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/344 (76%), Positives = 300/344 (87%), Gaps = 0/344 (0%)
 Frame = -3

Query  1278  FFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDII  1099
             F G    RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGRFSNGLNIPD I
Sbjct  10    FKGAEAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSNGLNIPDFI  69

Query  1098  SEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQ  919
             S++LG E TLP LSP+L GE+LLVGANFASAG+GILNDTGVQF+NIIRI  QLEYF+EYQ
Sbjct  70    SQELGSESTLPYLSPELNGERLLVGANFASAGIGILNDTGVQFVNIIRITRQLEYFQEYQ  129

Query  918   RRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYR  739
             +RVS L+G  + K+LVN ALVLIT GGNDFVNNYYLVP SARSRQF +PDYV ++ISEY+
Sbjct  130   QRVSALVGDEKTKELVNGALVLITCGGNDFVNNYYLVPNSARSRQFALPDYVTYVISEYK  189

Query  738   KILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAEL  559
             K+L+RLYDLGARRV+VTGTGP+GCVPAELA R R GEC+ +LQRA+AL+NPQL +M+ +L
Sbjct  190   KVLRRLYDLGARRVVVTGTGPLGCVPAELALRGRNGECSEELQRASALYNPQLVEMIKQL  249

Query  558   NSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRD  379
             N E+ +DVFVAANT  MH DF+ NPQA+GF+TSKVACCGQGP+NG+GLCT  SNLCPNR 
Sbjct  250   NKEVGSDVFVAANTQLMHDDFVTNPQAYGFITSKVACCGQGPFNGLGLCTVVSNLCPNRH  309

Query  378   IYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
              +AFWDPFHPSEKANR+IVQ I SG++ YMHPMNLSTI+ LDS+
Sbjct  310   EFAFWDPFHPSEKANRLIVQQIMSGTSKYMHPMNLSTILALDSK  353



>ref|XP_002319125.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|EEE95048.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
Length=368

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/360 (71%), Positives = 312/360 (87%), Gaps = 0/360 (0%)
 Frame = -3

Query  1323  NNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHR  1144
             +++ ++ GL  +      +A+ RAF VFGDSLVD+GNNNYLATTARAD  PYGIDYPTH+
Sbjct  9     SSYWVISGLALVLGAIVHQADARAFLVFGDSLVDSGNNNYLATTARADSYPYGIDYPTHQ  68

Query  1143  ATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMN  964
             ATGRFSNGLNIPD+ISE++G E  LP LSP+L+G+KLLVGANFASAG+GILNDTG+QF+N
Sbjct  69    ATGRFSNGLNIPDLISEQIGSESPLPYLSPELRGQKLLVGANFASAGIGILNDTGIQFLN  128

Query  963   IIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQ  784
             IIR+  QLEYF++YQ+RV  LIGA +AK+LVN++L+L+T+GGNDFVNNYYLVP+SARSRQ
Sbjct  129   IIRMHRQLEYFQQYQQRVGALIGAEKAKRLVNQSLILLTVGGNDFVNNYYLVPYSARSRQ  188

Query  783   FTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRA  604
             + +PDYV  LISEY+KIL RLY+LGARRV+VTGTGP+GCVPAELA RS  G C+ +LQRA
Sbjct  189   YDLPDYVKHLISEYKKILMRLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSAELQRA  248

Query  603   AALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNG  424
             AAL+NPQL  M+ ++N ++ +DVF+AANT+ MH DF+ NPQA+GF TSK+ACCGQGPYNG
Sbjct  249   AALYNPQLESMIIDVNRKIGSDVFIAANTHQMHADFVSNPQAYGFTTSKIACCGQGPYNG  308

Query  423   IGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             +GLCT  SNLCPNR++YAFWDPFHPSEKAN+IIVQ I +GST YM PMNLSTIM LDSRT
Sbjct  309   LGLCTLLSNLCPNRELYAFWDPFHPSEKANKIIVQQIMTGSTRYMKPMNLSTIMALDSRT  368



>ref|XP_006375868.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 ref|XP_006375869.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|ERP53665.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|ERP53666.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
Length=372

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 313/362 (86%), Gaps = 0/362 (0%)
 Frame = -3

Query  1329  LPNNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPT  1150
             + +++ ++ GL  +      +A+ RAF VFGDSLVD+GNNNYLATTARAD  PYGIDYPT
Sbjct  11    IQSSYWVISGLALVLGAIVHQADARAFLVFGDSLVDSGNNNYLATTARADSYPYGIDYPT  70

Query  1149  HRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQF  970
             H+ATGRFSNGLNIPD+ISE++G E  LP LSP+L+G+KLLVGANFASAG+GILNDTG+QF
Sbjct  71    HQATGRFSNGLNIPDLISEQIGSESPLPYLSPELRGQKLLVGANFASAGIGILNDTGIQF  130

Query  969   MNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARS  790
             +NIIR+  QLEYF++YQ+RV  LIGA +AK+LVN++L+L+T+GGNDFVNNYYLVP+SARS
Sbjct  131   LNIIRMHRQLEYFQQYQQRVGALIGAEKAKRLVNQSLILLTVGGNDFVNNYYLVPYSARS  190

Query  789   RQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQ  610
             RQ+ +PDYV  LISEY+KIL RLY+LGARRV+VTGTGP+GCVPAELA RS  G C+ +LQ
Sbjct  191   RQYDLPDYVKHLISEYKKILMRLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSAELQ  250

Query  609   RAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPY  430
             RAAAL+NPQL  M+ ++N ++ +DVF+AANT+ MH DF+ NPQA+GF TSK+ACCGQGPY
Sbjct  251   RAAALYNPQLESMIIDVNRKIGSDVFIAANTHQMHADFVSNPQAYGFTTSKIACCGQGPY  310

Query  429   NGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             NG+GLCT  SNLCPNR++YAFWDPFHPSEKAN+IIVQ I +GST YM PMNLSTIM LDS
Sbjct  311   NGLGLCTLLSNLCPNRELYAFWDPFHPSEKANKIIVQQIMTGSTRYMKPMNLSTIMALDS  370

Query  249   RT  244
             RT
Sbjct  371   RT  372



>ref|XP_010918935.1| PREDICTED: GDSL esterase/lipase LTL1 [Elaeis guineensis]
Length=364

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/355 (72%), Positives = 310/355 (87%), Gaps = 0/355 (0%)
 Frame = -3

Query  1308  LLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRF  1129
              L +LA        +E RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPTH+ TGRF
Sbjct  10    FLAVLATLGTLSTMSEARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTHQPTGRF  69

Query  1128  SNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIG  949
             SNGLNIPDIISE++G EPTLP LSP+L+GEKLLVGANFASAG+GILNDTG+QF+NII+I 
Sbjct  70    SNGLNIPDIISEQIGAEPTLPYLSPELRGEKLLVGANFASAGIGILNDTGIQFINIIKIS  129

Query  948   NQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPD  769
              QL+YFE+YQ+R+S LIG  +AK+LVNKALVLITLGGNDFVNNYYLVPFSARSR+F +PD
Sbjct  130   RQLQYFEQYQQRLSALIGVAQAKKLVNKALVLITLGGNDFVNNYYLVPFSARSREFALPD  189

Query  768   YVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFN  589
             YV ++I EY+KIL+ L++LGARR++VTGTGP+GCVPAELA+RSR G C  +LQRAAALFN
Sbjct  190   YVRYIIFEYKKILRTLHELGARRIMVTGTGPLGCVPAELAERSRDGSCDPELQRAAALFN  249

Query  588   PQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCT  409
             PQL Q+L ELN++L +D++++AN + MHMD++ +P A+GFVTSK+ACCGQGPYNG+GLCT
Sbjct  250   PQLIQILNELNTDLGSDIYISANAFKMHMDYVSDPAAYGFVTSKIACCGQGPYNGLGLCT  309

Query  408   QASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
              ASNLC NR++Y+FWD +HP+EKANRIIV     GS++YM+PMNLSTI+ LD+ T
Sbjct  310   VASNLCSNRNLYSFWDAYHPTEKANRIIVNQFMIGSSEYMNPMNLSTILALDAST  364



>gb|ABK95911.1| unknown [Populus trichocarpa]
Length=368

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/360 (71%), Positives = 312/360 (87%), Gaps = 0/360 (0%)
 Frame = -3

Query  1323  NNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHR  1144
             +++ ++ GL  +      +A+ RAF VFGDSLVD+GNNNYLATTARAD  PYGIDYPTH+
Sbjct  9     SSYWVISGLALVLGAIVHQADARAFLVFGDSLVDSGNNNYLATTARADSYPYGIDYPTHQ  68

Query  1143  ATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMN  964
             ATGRFSNGLNIPD+ISE++G E  LP LSP+L+G+KLLVGANFASAG+GILNDTG+QF+N
Sbjct  69    ATGRFSNGLNIPDLISEQIGSESPLPYLSPELRGQKLLVGANFASAGIGILNDTGIQFLN  128

Query  963   IIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQ  784
             IIR+  QLEYF++YQ+RV  LIGA +AK+LVN++L+L+T+GGNDFVNNYYLVP+SARSRQ
Sbjct  129   IIRMHRQLEYFQQYQQRVGALIGAEKAKRLVNQSLILLTVGGNDFVNNYYLVPYSARSRQ  188

Query  783   FTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRA  604
             + +PDYV  LISEY+K+L RLY+LGARRV+VTGTGP+GCVPAELA RS  G C+ +LQRA
Sbjct  189   YDLPDYVKHLISEYKKLLMRLYNLGARRVLVTGTGPLGCVPAELATRSTNGGCSAELQRA  248

Query  603   AALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNG  424
             AAL+NPQL  M+ ++N ++ +DVF+AANT+ MH DF+ NPQA+GF TSK+ACCGQGPYNG
Sbjct  249   AALYNPQLESMIIDVNRKIGSDVFIAANTHQMHADFVSNPQAYGFTTSKIACCGQGPYNG  308

Query  423   IGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             +GLCT  SNLCPNR++YAFWDPFHPSEKAN+IIVQ I +GST YM PMNLSTIM LDSRT
Sbjct  309   LGLCTLLSNLCPNRELYAFWDPFHPSEKANKIIVQQIMTGSTRYMKPMNLSTIMALDSRT  368



>emb|CDO99962.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/354 (76%), Positives = 300/354 (85%), Gaps = 1/354 (0%)
 Frame = -3

Query  1308  LLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRF  1129
             + GLL    V   R E RAFFVFGDSLVD+GNNNYL T+ARAD PPYG+DYPTHR TGRF
Sbjct  15    IFGLLWALQVGVSRVEGRAFFVFGDSLVDSGNNNYLVTSARADSPPYGLDYPTHRPTGRF  74

Query  1128  SNGLNIPDIISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             SNG NIPDIIS+ +G  E  LP L P+L G +LLVGANFASAGVGILNDTG+QF+NIIRI
Sbjct  75    SNGFNIPDIISQNIGASESPLPYLDPELNGRRLLVGANFASAGVGILNDTGIQFVNIIRI  134

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF EYQ+RVS L+GA +AKQLVN+ALVL+TLGGNDFVNNYYLVP SARSRQ+ +P
Sbjct  135   SLQLEYFREYQQRVSALVGAQQAKQLVNQALVLMTLGGNDFVNNYYLVPNSARSRQYALP  194

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV FLISEY+K+L RLYDLGARRVIVTGTGP+GCVPAELA RSR GEC+ +LQRAA LF
Sbjct  195   DYVRFLISEYQKVLSRLYDLGARRVIVTGTGPLGCVPAELAMRSRNGECSAELQRAAGLF  254

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QML  LNS++  DVF+ ANT  MH DFI NP AFGFV+SKVACCGQGPYNG+GLC
Sbjct  255   NPQLIQMLRGLNSKIGKDVFIGANTQQMHNDFITNPGAFGFVSSKVACCGQGPYNGLGLC  314

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             T  SNLCPNRD YAFWDPFHPSEKAN+IIVQ I +GSTDYM PMNLSTI+ +DS
Sbjct  315   TGLSNLCPNRDQYAFWDPFHPSEKANKIIVQQILTGSTDYMTPMNLSTILAVDS  368



>gb|KDP23751.1| hypothetical protein JCGZ_23584 [Jatropha curcas]
Length=367

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/342 (78%), Positives = 296/342 (87%), Gaps = 1/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +AE RAFFVFGDSLVDNGNNNYLATTARAD PPYGID+PT R TGRFSNG NIPD IS+ 
Sbjct  25    QAEARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDFPTRRPTGRFSNGYNIPDYISQA  84

Query  1089  LGMEPTL-PCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRR  913
             +G    L P LSP L GE+LL GANFASAG+GILNDTG+QF NIIR+  Q +YFE+YQRR
Sbjct  85    IGSRNLLLPYLSPQLNGERLLDGANFASAGIGILNDTGIQFANIIRMFQQFDYFEQYQRR  144

Query  912   VSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKI  733
             V+ LIGA   KQLVN ALVLIT+GGNDFVNNYYLVP+S RSRQ+++PDYV FLISEY+K+
Sbjct  145   VTGLIGAQRTKQLVNGALVLITVGGNDFVNNYYLVPYSIRSRQYSLPDYVKFLISEYKKL  204

Query  732   LQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNS  553
             LQRLYDLGARRV+VTGTGP+GCVPAELAQR R G+C+ +LQRAA+LFNPQLTQML +LNS
Sbjct  205   LQRLYDLGARRVLVTGTGPLGCVPAELAQRGRNGQCSAELQRAASLFNPQLTQMLRQLNS  264

Query  552   ELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIY  373
             +  +DVF+AANT  M  DFI NP A+GFVTSKVACCGQGPYNGIGLCT ASNLCPNRD+Y
Sbjct  265   QYGSDVFIAANTGRMTGDFITNPGAYGFVTSKVACCGQGPYNGIGLCTPASNLCPNRDVY  324

Query  372   AFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             AFWDPFHPSEKANR I Q I SGSTDYM PMNLSTIM LDSR
Sbjct  325   AFWDPFHPSEKANRYIAQQILSGSTDYMSPMNLSTIMALDSR  366



>gb|ACU23725.1| unknown [Glycine max]
Length=372

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/349 (74%), Positives = 304/349 (87%), Gaps = 1/349 (0%)
 Frame = -3

Query  1287  TIVFFGRAEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNI  1111
             +I+   +AE  RAFFVFGDSLVDNGNNN+LATTARAD  PYGID  +HRA+GRFSNGLN+
Sbjct  24    SIIVAPQAEAARAFFVFGDSLVDNGNNNFLATTARADSYPYGIDSASHRASGRFSNGLNM  83

Query  1110  PDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYF  931
             PD+ISEK+G EPTLP LSP L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  QL YF
Sbjct  84    PDLISEKIGSEPTLPYLSPQLNGERLLVGANFASAGIGILNDTGIQFINIIRITEQLAYF  143

Query  930   EEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLI  751
             ++YQ+RVS LIG  + + LVNKALVLITLGGNDFVNNYYLVPFSARSR++ +PDYV FLI
Sbjct  144   KQYQQRVSALIGEEQTRNLVNKALVLITLGGNDFVNNYYLVPFSARSREYALPDYVVFLI  203

Query  750   SEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQM  571
             SEYRKIL  LY+LGARRV+VTGTGP+GCVPAELA  S+ GECA +LQRA +LFNPQL Q+
Sbjct  204   SEYRKILANLYELGARRVLVTGTGPLGCVPAELAMHSQNGECATELQRAVSLFNPQLVQL  263

Query  570   LAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLC  391
             L ELN+++ +DVF++AN + MH+DF+ NPQA+GFVTSKVAC GQG YNGIGLCT ASNLC
Sbjct  264   LHELNTQIGSDVFISANAFTMHLDFVSNPQAYGFVTSKVACGGQGAYNGIGLCTPASNLC  323

Query  390   PNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             PNRD+YAFWDPFHPSE+ANR+IV    +GST+YMHPMNLSTI+ LDS T
Sbjct  324   PNRDLYAFWDPFHPSERANRLIVDKFMTGSTEYMHPMNLSTIIALDSTT  372



>ref|XP_002319124.2| hypothetical protein POPTR_0013s04780g [Populus trichocarpa]
 gb|EEE95047.2| hypothetical protein POPTR_0013s04780g [Populus trichocarpa]
Length=419

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/356 (76%), Positives = 313/356 (88%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ++LGL+        + E RAFFVFGDSLVDNGNNNYLATTARAD PPYG+DYPT RATGR
Sbjct  64    LILGLVVTLAGVIPQVEARAFFVFGDSLVDNGNNNYLATTARADAPPYGVDYPTRRATGR  123

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPD+ISE +G EPTLP L+P+L GEKLLVGANFASAG+GILNDTGVQF+NIIRI
Sbjct  124   FSNGLNIPDLISEAIGSEPTLPYLAPELNGEKLLVGANFASAGIGILNDTGVQFLNIIRI  183

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
             G QL++F++YQ+RVS LIG  +A++LVN+ALVL+TLGGNDFVNNYYLVPFSARSRQF +P
Sbjct  184   GQQLQFFQQYQQRVSALIGPEQAQRLVNEALVLMTLGGNDFVNNYYLVPFSARSRQFALP  243

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRKIL R+Y+LGARR++VTGTGP+GCVPAE A RSR GECAV+LQRAA LF
Sbjct  244   DYVVYLISEYRKILVRVYELGARRILVTGTGPLGCVPAERATRSRNGECAVELQRAATLF  303

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+ ELN E+ +DVF+AAN Y M+MDF+ NPQA+GFVTS+VACCGQG +NGIGLC
Sbjct  304   NPQLVQMITELNMEIGSDVFIAANAYEMNMDFVTNPQAYGFVTSQVACCGQGRFNGIGLC  363

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T ASNLCPNRDI+AFWDPFHP+E+ANRIIV  I +G T YM+PMNLSTIM LDSR 
Sbjct  364   TIASNLCPNRDIFAFWDPFHPTERANRIIVSTIVTGDTKYMNPMNLSTIMALDSRV  419



>ref|XP_006403052.1| hypothetical protein EUTSA_v10003456mg [Eutrema salsugineum]
 gb|ESQ44505.1| hypothetical protein EUTSA_v10003456mg [Eutrema salsugineum]
Length=366

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/355 (74%), Positives = 306/355 (86%), Gaps = 2/355 (1%)
 Frame = -3

Query  1308  LLGLLALTI--VFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             LLGL  L +  +   +A  RAF VFGDSLVDNGNN++L TTARAD  PYGIDYPTHR TG
Sbjct  10    LLGLCILQVMSLLALQANARAFLVFGDSLVDNGNNDFLVTTARADNYPYGIDYPTHRPTG  69

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE LG   +LP LSP LK +KLL+GANFASAG+GILNDTG+QF+NIIR
Sbjct  70    RFSNGLNIPDLISEHLGQASSLPYLSPMLKKDKLLIGANFASAGIGILNDTGIQFLNIIR  129

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYF++Y+ R+S LIG  E ++LVN ALVLITLGGNDFVNNYYLVPFSARSRQF++
Sbjct  130   ITKQLEYFQQYKVRLSGLIGEEEMERLVNGALVLITLGGNDFVNNYYLVPFSARSRQFSL  189

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV ++ISEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR GEC+ +LQRAA+L
Sbjct  190   PDYVVYIISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRNGECSTELQRAASL  249

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL QM+ +LN+E+ +  F+AANT  MHMDFI NPQA+GFV+SKVACCGQGPYNGIGL
Sbjct  250   FNPQLVQMINDLNNEVGSSAFIAANTQQMHMDFISNPQAYGFVSSKVACCGQGPYNGIGL  309

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD++AFWDPFHPSEKA+RII Q I +GS  YMHPMNLSTI+ LDS
Sbjct  310   CTPISNLCPNRDLFAFWDPFHPSEKASRIIAQQILNGSPQYMHPMNLSTILSLDS  364



>ref|XP_008441804.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis melo]
Length=368

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/356 (74%), Positives = 303/356 (85%), Gaps = 4/356 (1%)
 Frame = -3

Query  1299  LLALTIVFFG----RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             +L L + F G    +A+ RAFFVFGDSLVDNGNNN+L TTARAD  PYGIDYPT R TGR
Sbjct  13    ILGLVLFFLGSFVCQAQARAFFVFGDSLVDNGNNNFLLTTARADNYPYGIDYPTRRPTGR  72

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPD+ISE +G   TLP LSP L+GE LLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  73    FSNGLNIPDLISEAMGSPSTLPYLSPQLRGENLLVGANFASAGIGILNDTGIQFLNIIRI  132

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF +YQ RVS LIG  E  +LVN+ALVLITLGGNDFVNNYYLVP SARSRQF++P
Sbjct  133   RQQLEYFRQYQARVSALIGEAETVRLVNEALVLITLGGNDFVNNYYLVPVSARSRQFSLP  192

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV ++ISEYRKIL  LY+ GARRV+VTGTGP+GCVPAELA R R GEC+V+LQRAAALF
Sbjct  193   DYVVYIISEYRKILASLYEFGARRVLVTGTGPLGCVPAELAMRGRNGECSVELQRAAALF  252

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL Q++  LN E+ + VF+A NT  MHMDF+ NPQA+GF+TSKVACCGQGP+NGIGLC
Sbjct  253   NPQLVQIINSLNDEIGSHVFIAVNTQMMHMDFVSNPQAYGFITSKVACCGQGPFNGIGLC  312

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T ASNLCPNR++YAFWDPFHPSE+ANRIIVQ I +G+ +YMHPMNLSTI+ +DSRT
Sbjct  313   TPASNLCPNRNVYAFWDPFHPSERANRIIVQQILTGTQEYMHPMNLSTILAMDSRT  368



>gb|KHN43144.1| GDSL esterase/lipase [Glycine soja]
Length=363

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/342 (75%), Positives = 302/342 (88%), Gaps = 0/342 (0%)
 Frame = -3

Query  1272  GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISE  1093
             G    RAFFVFGDSLVDNGNNN+LATTARAD PPYGIDYPT R TGRFSNG NIPD IS+
Sbjct  21    GAEAQRAFFVFGDSLVDNGNNNFLATTARADAPPYGIDYPTGRPTGRFSNGYNIPDFISQ  80

Query  1092  KLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRR  913
              LG E TLP L P+L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  QLEY+EEYQ+R
Sbjct  81    SLGAESTLPYLDPELDGERLLVGANFASAGIGILNDTGIQFVNIIRIYRQLEYWEEYQQR  140

Query  912   VSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKI  733
             VS LIG  + ++L+N ALVLITLGGNDFVNNYYLVP+SARSRQ+ +PDYV ++ISEY+K+
Sbjct  141   VSGLIGPEQTERLINGALVLITLGGNDFVNNYYLVPYSARSRQYNLPDYVKYIISEYKKV  200

Query  732   LQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNS  553
             L+RLY++GARRV+VTGTGP+GCVPAELAQRS  G+C+ +LQRAAALFNPQL Q++ +LNS
Sbjct  201   LRRLYEIGARRVLVTGTGPLGCVPAELAQRSTNGDCSAELQRAAALFNPQLVQIIQQLNS  260

Query  552   ELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIY  373
             E+ ++VFV  NT  MH+DFI NPQ +GFVTSKVACCGQGPYNG+GLCT ASNLCPNRDIY
Sbjct  261   EIGSNVFVGVNTQQMHIDFISNPQRYGFVTSKVACCGQGPYNGLGLCTPASNLCPNRDIY  320

Query  372   AFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             AFWDPFHPSE+ANR+IVQ I SG+++YM+PMNLSTIM LDS+
Sbjct  321   AFWDPFHPSERANRLIVQQILSGTSEYMYPMNLSTIMALDSK  362



>ref|XP_010530492.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Tarenaya 
hassleriana]
Length=361

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/356 (74%), Positives = 305/356 (86%), Gaps = 2/356 (1%)
 Frame = -3

Query  1305  LGLLALTIVFFG-RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRF  1129
             LG  +L +     +AE RAFFVFGDSLVDNGNN++LATTARAD  PYGID+PTH ATGRF
Sbjct  6     LGFCSLVLSLLASQAEARAFFVFGDSLVDNGNNDFLATTARADNYPYGIDFPTHMATGRF  65

Query  1128  SNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIG  949
             SNGLNI DIISE +G    LP LSP LK  KLL+GANFASAG+GILNDTG+QF+NIIRI 
Sbjct  66    SNGLNIADIISEYIGQPAPLPYLSPFLKKHKLLIGANFASAGIGILNDTGIQFINIIRIT  125

Query  948   NQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPD  769
              QLEYFE+YQRRVS +IG  + +QLVN ALVLITLGGNDFVNNYYLVPFS RSRQF +PD
Sbjct  126   KQLEYFEQYQRRVSAMIGEAQTRQLVNGALVLITLGGNDFVNNYYLVPFSLRSRQFALPD  185

Query  768   YVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVD-LQRAAALF  592
             YV +L+SEYRK+L++LYDLGARRV+VTGTGP+GCVPAELAQRSR GECAV+  +RAA+LF
Sbjct  186   YVVYLVSEYRKVLRKLYDLGARRVLVTGTGPMGCVPAELAQRSRDGECAVEQRRRAASLF  245

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NP+L QM+ +LN E+ + VF+AANT  MHMDFI +PQA+GFVTSK+ACCGQGPYNGIGLC
Sbjct  246   NPRLAQMINDLNGEVGSSVFIAANTQRMHMDFISDPQAYGFVTSKIACCGQGPYNGIGLC  305

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T ASNLCPNRD+YAFWDPFHPSEKANRII + I +GS  YMHPMNLS+I+ LDS T
Sbjct  306   TPASNLCPNRDLYAFWDPFHPSEKANRIIARQILTGSPQYMHPMNLSSILTLDSMT  361



>ref|XP_006577328.1| PREDICTED: GDSL esterase/lipase LTL1-like isoform X2 [Glycine 
max]
Length=382

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/355 (75%), Positives = 307/355 (86%), Gaps = 8/355 (2%)
 Frame = -3

Query  1284  IVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPD  1105
             +V   +AE RAFFVFGDSLVDNGNNNYL TTARAD  PYGIDYPTHRATGRFSNGLNIPD
Sbjct  28    VVVVPQAEARAFFVFGDSLVDNGNNNYLFTTARADSYPYGIDYPTHRATGRFSNGLNIPD  87

Query  1104  IISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQF------MNIIRIGNQ  943
             IISEK+G EPTLP LS +L GE+LLVGANFASAG+GILNDTG+QF      +NIIRI  Q
Sbjct  88    IISEKIGSEPTLPYLSRELDGERLLVGANFASAGIGILNDTGIQFYNLHLQINIIRISRQ  147

Query  942   LEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYV  763
             L+YFE+YQ+RVS LIG  + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF +P+YV
Sbjct  148   LQYFEQYQQRVSALIGPEQTQRLVNQALVLITLGGNDFVNNYYLVPFSARSRQFALPNYV  207

Query  762   PFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQ  583
              +LISEYRKIL RLY+LGARRV+VTGTGP+GCVPAELAQRSR GECA +LQ A+ALFNPQ
Sbjct  208   VYLISEYRKILVRLYELGARRVLVTGTGPLGCVPAELAQRSRNGECAAELQEASALFNPQ  267

Query  582   LTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQA  403
             L Q++ +LNSE+ + VF++AN +  +MDFI NPQA+GF+TSKVACCGQGPYNGIGLCT A
Sbjct  268   LVQLVNQLNSEIGSVVFISANAFESNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPA  327

Query  402   SNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD--SRT  244
             SNLCPNRD++AFWDPFHPSE+ANR+IV     G + YMHPMNLST++ LD  SRT
Sbjct  328   SNLCPNRDVFAFWDPFHPSERANRLIVDTFMIGDSKYMHPMNLSTVLLLDATSRT  382



>ref|XP_006350943.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=364

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/346 (76%), Positives = 302/346 (87%), Gaps = 1/346 (0%)
 Frame = -3

Query  1281  VFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDI  1102
             V   ++E RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT RATGRFSNG NIPDI
Sbjct  18    VGISQSEARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRATGRFSNGYNIPDI  77

Query  1101  ISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEE  925
             IS+++G  E  LP LSP L G++LLVGANFASAG+GILNDTGVQF+NIIR+  QL+YF +
Sbjct  78    ISQQIGSSESPLPYLSPALTGQRLLVGANFASAGIGILNDTGVQFINIIRMPQQLDYFRQ  137

Query  924   YQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISE  745
             YQRRVS LIG    ++LVN+ALVL+TLGGNDFVNNY+LVP SARSRQF+IPDYVPFLI E
Sbjct  138   YQRRVSGLIGEASTQRLVNQALVLMTLGGNDFVNNYFLVPNSARSRQFSIPDYVPFLIRE  197

Query  744   YRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLA  565
             YRKIL  +Y+LG RRVIVTGTGP+GCVPAELAQRSR GEC+ +LQ+AAALFNPQL QML 
Sbjct  198   YRKILMTVYNLGGRRVIVTGTGPLGCVPAELAQRSRNGECSPELQQAAALFNPQLMQMLQ  257

Query  564   ELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPN  385
              LN EL ++VF+AANT  MH +FI NPQA+GF+TSKVACCGQGPYNG+GLCT  SNLCPN
Sbjct  258   GLNRELGSNVFIAANTQQMHTNFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNLCPN  317

Query  384   RDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             RD+YAFWDPFHPSEKAN+IIVQ I SG+T+YM+PMNLSTI+ +DS 
Sbjct  318   RDVYAFWDPFHPSEKANKIIVQQIMSGTTEYMNPMNLSTILAMDSE  363



>ref|XP_011084724.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=367

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/352 (74%), Positives = 298/352 (85%), Gaps = 4/352 (1%)
 Frame = -3

Query  1290  LTIVFFG----RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSN  1123
             L I+ FG    R E RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTHR TGRFSN
Sbjct  15    LFILAFGDLAVRVEARAFFVFGDSLVDNGNNNYLVTTARADAPPYGIDYPTHRPTGRFSN  74

Query  1122  GLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQ  943
             GLNIPDIISE++G EPTLP LSP+L+G KLLVGANFASAGVG+LNDTG+QF+NIIRI  Q
Sbjct  75    GLNIPDIISEEMGWEPTLPYLSPELRGSKLLVGANFASAGVGVLNDTGIQFVNIIRIYQQ  134

Query  942   LEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYV  763
             L YFEEYQ+R+   IG  EA+++VN++LVLITLGGNDFVNNYYLVP+SARSRQ+++PDYV
Sbjct  135   LNYFEEYQQRLRAEIGVDEARKVVNESLVLITLGGNDFVNNYYLVPYSARSRQYSLPDYV  194

Query  762   PFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQ  583
             PF+ISEY+K+L+RLY LG  RVIVTGTGP+GCVPAELA  SR GECA +L  AA L+NPQ
Sbjct  195   PFVISEYKKVLRRLYTLGVLRVIVTGTGPLGCVPAELALHSRNGECAEELMEAAQLYNPQ  254

Query  582   LTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQA  403
             L  ML +LN E+   VF+AANT  MHMDFI  PQ FGF+TSK+ACCGQGPYNGIGLCT  
Sbjct  255   LQDMLKDLNDEIGRKVFIAANTNQMHMDFISEPQRFGFITSKIACCGQGPYNGIGLCTPF  314

Query  402   SNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             SNLCPNRD+Y FWDPFHPSEKANRIIVQ I +G   YMHPMNL T++ +DS+
Sbjct  315   SNLCPNRDLYVFWDPFHPSEKANRIIVQQILNGDNKYMHPMNLRTMLAMDSK  366



>ref|XP_003626492.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82710.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=369

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/342 (76%), Positives = 299/342 (87%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             + E RAFFVFGDSLVDNGNNNYLATTARAD  PYGIDYPTHRATGRFSNGLN+PD+ISE+
Sbjct  28    QVEARAFFVFGDSLVDNGNNNYLATTARADSYPYGIDYPTHRATGRFSNGLNMPDLISER  87

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G +PTLP LSP+L GE LLVGANFASAG+GILNDTG+QF NIIRI  QL+YFE+YQ+RV
Sbjct  88    IGSQPTLPYLSPELNGEALLVGANFASAGIGILNDTGIQFFNIIRITRQLQYFEQYQQRV  147

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG  E  +LVN+AL L+TLGGNDFVNNY+LVPFSARSRQF +PDYV +LISEYRKIL
Sbjct  148   SALIGEEETVRLVNEALYLMTLGGNDFVNNYFLVPFSARSRQFRLPDYVVYLISEYRKIL  207

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY+LGARRV+VTGTGP+GCVPAELAQ SR GEC  +LQ AA LFNPQL  +L +LNSE
Sbjct  208   ARLYELGARRVLVTGTGPLGCVPAELAQHSRNGECYAELQEAANLFNPQLVDLLGQLNSE  267

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             + +DVF++AN + M+MDFI NP+A+GF TSKVACCGQGPYNGIGLCT ASN+CPNRD Y 
Sbjct  268   IGSDVFISANAFAMNMDFIGNPEAYGFATSKVACCGQGPYNGIGLCTPASNICPNRDAYV  327

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWD FHPS++ANR+IV+    GS++YMHPMNLSTIM LDSRT
Sbjct  328   FWDAFHPSDRANRLIVERFMIGSSEYMHPMNLSTIMLLDSRT  369



>ref|XP_008810810.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=365

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/355 (73%), Positives = 308/355 (87%), Gaps = 1/355 (0%)
 Frame = -3

Query  1308  LLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRF  1129
             L GL AL  +    +E RAFFVFGDSLVDNGNNN+L TTARAD PPYGIDYPTHR TGRF
Sbjct  12    LAGLAALGTLSM-MSEARAFFVFGDSLVDNGNNNFLLTTARADLPPYGIDYPTHRPTGRF  70

Query  1128  SNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIG  949
             SNGLN+PDIISE LG EPTLP LSP+L+GEKLLVGANFASAG+GILNDTG+QF+NIIRI 
Sbjct  71    SNGLNMPDIISEHLGAEPTLPYLSPELRGEKLLVGANFASAGIGILNDTGIQFLNIIRID  130

Query  948   NQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPD  769
              QL YFE+Y++R+S ++G  + K+LVN+ALVLITLGGNDFVNNYYLVPFSARSR+F +PD
Sbjct  131   RQLVYFEQYKQRLSSVVGEAQMKKLVNQALVLITLGGNDFVNNYYLVPFSARSREFALPD  190

Query  768   YVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFN  589
             YV +LISEY+KIL RLY+LGARRV+VTGTGP+GCVP+ELAQR R GECA +LQRAA+LFN
Sbjct  191   YVRYLISEYKKILGRLYELGARRVMVTGTGPLGCVPSELAQRGRNGECAAELQRAASLFN  250

Query  588   PQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCT  409
             PQL + L ELN +  +DVF++AN + MHMD+I +P ++GFVTSK+ACCGQGPYNG+GLCT
Sbjct  251   PQLDRTLIELNRKFGSDVFISANAFKMHMDYISDPGSYGFVTSKIACCGQGPYNGLGLCT  310

Query  408   QASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
              ASNLCPNR++Y+FWD FHP+EKANRIIV     GS++YM+PMNLSTI+ +D+ T
Sbjct  311   AASNLCPNRNLYSFWDAFHPTEKANRIIVSQFMIGSSEYMNPMNLSTILAMDAST  365



>gb|ACU23610.1| unknown [Glycine max]
Length=363

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/342 (75%), Positives = 301/342 (88%), Gaps = 0/342 (0%)
 Frame = -3

Query  1272  GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISE  1093
             G    RAFFVFGDSLVDNGNNN+LATTARAD PPYGIDYPT R TGRFSNG NIPD IS+
Sbjct  21    GAEAQRAFFVFGDSLVDNGNNNFLATTARADAPPYGIDYPTGRPTGRFSNGYNIPDFISQ  80

Query  1092  KLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRR  913
              LG E TLP L P+L GE+LLVGANFASAG+GILNDTG+QF+NIIRI  QLEY+EEYQ+R
Sbjct  81    SLGAESTLPYLDPELDGERLLVGANFASAGIGILNDTGIQFVNIIRIYRQLEYWEEYQQR  140

Query  912   VSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKI  733
             VS LIG  + ++L+N ALVLITLGGNDFVNNYYLVP+SARSRQ+ +PDYV ++ISEY+K+
Sbjct  141   VSGLIGPEQTERLINGALVLITLGGNDFVNNYYLVPYSARSRQYNLPDYVKYIISEYKKV  200

Query  732   LQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNS  553
             L+RLY++GARRV+VTGTGP+GCVPAELAQRS  G+C+ +LQRAAALFNPQL Q++ +LNS
Sbjct  201   LRRLYEIGARRVLVTGTGPLGCVPAELAQRSTNGDCSAELQRAAALFNPQLVQIIQQLNS  260

Query  552   ELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIY  373
             E+ ++VFV  NT  MH+DFI NPQ +GFVTSKVACCGQGPYNG+GLCT ASNLCPNRDIY
Sbjct  261   EIGSNVFVGVNTQQMHIDFISNPQRYGFVTSKVACCGQGPYNGLGLCTPASNLCPNRDIY  320

Query  372   AFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             AFWDPFHPSE+ANR+IVQ I SG+++YM+PMN STIM LDS+
Sbjct  321   AFWDPFHPSERANRLIVQQILSGTSEYMYPMNFSTIMALDSK  362



>ref|XP_011038450.1| PREDICTED: GDSL esterase/lipase LTL1-like [Populus euphratica]
Length=368

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/355 (75%), Positives = 313/355 (88%), Gaps = 0/355 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ++LGL+A       + E RAFFVFGDSLVDNGNNNYLATTARAD PPYG+DYPT RATGR
Sbjct  13    LILGLVATLAGVTPQVEARAFFVFGDSLVDNGNNNYLATTARADAPPYGVDYPTRRATGR  72

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPD+ISE +G EPTLP L+P+LKGEKLLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  73    FSNGLNIPDLISEAIGSEPTLPYLAPELKGEKLLVGANFASAGIGILNDTGIQFLNIIRI  132

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
             G QL++F++YQ+RVS LIG  +A++LVN+ALVL+TLGGNDFVNNYYLVPFS RSRQF +P
Sbjct  133   GQQLQFFQQYQQRVSALIGPEQAQRLVNEALVLMTLGGNDFVNNYYLVPFSVRSRQFALP  192

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRKIL R+Y+LGARR++VTGTGP+GC PAE A RSR GECAV+LQRAAA+F
Sbjct  193   DYVVYLISEYRKILVRVYELGARRILVTGTGPLGCAPAERATRSRNGECAVELQRAAAMF  252

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+ ELN E+ +DVF+A N Y+M+ DF+ NPQA+GFVTS+VACCGQG +NGIGLC
Sbjct  253   NPQLVQMITELNKEIGSDVFIATNAYDMNTDFVTNPQAYGFVTSQVACCGQGRFNGIGLC  312

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             T ASNLCPNR+I+AFWDPFHP+E+ANRIIV  I +G T YM+PMNLSTIM LDSR
Sbjct  313   TIASNLCPNREIFAFWDPFHPTERANRIIVSTIVTGDTKYMNPMNLSTIMALDSR  367



>ref|XP_011084387.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=354

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/332 (80%), Positives = 295/332 (89%), Gaps = 1/332 (0%)
 Frame = -3

Query  1236  DSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLG-MEPTLPCL  1060
             DSLVD+GNNNYLATTARAD PPYGIDYPT RATGRFSNGLNIPD+ISE +G  E  LP L
Sbjct  23    DSLVDSGNNNYLATTARADAPPYGIDYPTRRATGRFSNGLNIPDLISESIGGSESPLPYL  82

Query  1059  SPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGAGEAK  880
             SP L G +LLVGANFASAGVGILNDTGVQF+NIIRIG QL+YFE+YQ+RVS LIGA EA+
Sbjct  83    SPALNGPRLLVGANFASAGVGILNDTGVQFVNIIRIGQQLQYFEQYQQRVSGLIGAEEAQ  142

Query  879   QLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDLGARR  700
             +LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF +PDYVPFLISEYR IL RLY LGARR
Sbjct  143   RLVNQALVLITLGGNDFVNNYYLVPFSARSRQFALPDYVPFLISEYRNILLRLYQLGARR  202

Query  699   VIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVFVAAN  520
             V+VTGTGP+GCVPAELA R R G+C+ +LQ+AAALFNPQLTQML  LN +L  +VF+AAN
Sbjct  203   VLVTGTGPLGCVPAELAMRGRNGQCSTELQQAAALFNPQLTQMLLALNEQLGDNVFIAAN  262

Query  519   TYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFHPSEK  340
             T   H DFI NPQAFGFVTSKVACCGQGP+NG+GLCTQ SNLCPNRD+YAFWDPFHPSE+
Sbjct  263   TQLTHYDFISNPQAFGFVTSKVACCGQGPFNGLGLCTQLSNLCPNRDVYAFWDPFHPSER  322

Query  339   ANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             ANR+IVQ I +GS +YM+PMNLSTI+ LDSRT
Sbjct  323   ANRLIVQQIMTGSIEYMNPMNLSTILALDSRT  354



>ref|XP_007143993.1| hypothetical protein PHAVU_007G120000g [Phaseolus vulgaris]
 gb|ESW15987.1| hypothetical protein PHAVU_007G120000g [Phaseolus vulgaris]
Length=366

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/356 (73%), Positives = 304/356 (85%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I++  L + I F      RAFFVFGDSLVD+GNN++LATTARAD PPYGID+PTHR TGR
Sbjct  11    IMVTSLFMCISFASAQPARAFFVFGDSLVDSGNNDFLATTARADAPPYGIDFPTHRPTGR  70

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISE+LG+EPTLP L+P L GEKLLVGANFASAG+GILNDTG QF++II I
Sbjct  71    FSNGLNIPDIISEQLGLEPTLPYLNPLLIGEKLLVGANFASAGIGILNDTGFQFLHIIHI  130

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL+ F+ YQ+R+S  IGA  A++ VN+ALVLITLGGNDFVNNYYLVP+SARSRQF++P
Sbjct  131   YKQLKLFQHYQQRLSAHIGAEGARKHVNQALVLITLGGNDFVNNYYLVPYSARSRQFSLP  190

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV ++ISEYR IL+RLYDLG RRV+VTGTGP+GCVPAELA RS  GEC ++LQRAA+LF
Sbjct  191   DYVNYIISEYRLILKRLYDLGGRRVLVTGTGPMGCVPAELALRSGNGECDLELQRAASLF  250

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL +M+  LN E+ A VF+A N Y MHMDF+ NP+AFGFVTSK+ACCGQGPYNG+GLC
Sbjct  251   NPQLVEMVRGLNQEIGAHVFIAVNAYEMHMDFVNNPRAFGFVTSKIACCGQGPYNGVGLC  310

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNRD+YAFWDPFHPSEKANRIIVQ + +GS  YMHPMNLSTIM +DSR 
Sbjct  311   TAISNLCPNRDLYAFWDPFHPSEKANRIIVQQMMTGSVQYMHPMNLSTIMAIDSRV  366



>ref|XP_004249922.1| PREDICTED: GDSL esterase/lipase At5g33370 [Solanum lycopersicum]
 gb|AEJ88779.1| cutin-deficient 1 protein [Solanum lycopersicum]
Length=362

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/356 (74%), Positives = 304/356 (85%), Gaps = 1/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+L  L +  V   ++E RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT RATGR
Sbjct  6     IILSFLLIFGVAICQSEARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRATGR  65

Query  1131  FSNGLNIPDIISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             FSNG NIPDIIS+++G  E  LP L P L G++LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  66    FSNGYNIPDIISQQIGSSESPLPYLDPALTGQRLLVGANFASAGIGILNDTGIQFINIIR  125

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  QL YF +YQ RVS LIG    ++LVN+ALVL+TLGGNDFVNNYYLVP SARSRQF+I
Sbjct  126   MPQQLAYFRQYQSRVSGLIGEANTQRLVNQALVLMTLGGNDFVNNYYLVPNSARSRQFSI  185

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
              DYVP+LI EYRKIL  +Y+LGARRVIVTGTGP+GCVPAELAQRSR GEC+ +LQRAA L
Sbjct  186   QDYVPYLIREYRKILMNVYNLGARRVIVTGTGPLGCVPAELAQRSRNGECSPELQRAAGL  245

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQLTQML  LNSEL +DVF+AANT  MH +FI NPQA+GF+TSKVACCGQGPYNG+GL
Sbjct  246   FNPQLTQMLQGLNSELGSDVFIAANTQQMHTNFITNPQAYGFITSKVACCGQGPYNGLGL  305

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             CT  SNLCPNRD+YAFWDPFHPSE+AN+IIVQ I SG+T+ M+PMNLSTI+ +DS 
Sbjct  306   CTPLSNLCPNRDVYAFWDPFHPSERANKIIVQQIMSGTTELMNPMNLSTILAMDSH  361



>ref|XP_004152806.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
 gb|KGN61316.1| Zinc finger protein [Cucumis sativus]
Length=368

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/357 (74%), Positives = 301/357 (84%), Gaps = 3/357 (1%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G +L  LA    F  +A+ RAFFVFGDSLVDNGNNNYL TTARAD  PYGIDYPT R TG
Sbjct  15    GFILFFLA---SFVCQAQARAFFVFGDSLVDNGNNNYLLTTARADNYPYGIDYPTRRPTG  71

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE +G   TLP LSP L+GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  72    RFSNGLNIPDLISEAMGSPSTLPYLSPQLRGENLLVGANFASAGIGILNDTGIQFLNIIR  131

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYF +YQ RVS LIG  E  +LVN+ALVLITLGGNDFVNNYYLVP SARSRQFT+
Sbjct  132   IRQQLEYFRQYQARVSALIGEEETVRLVNEALVLITLGGNDFVNNYYLVPVSARSRQFTL  191

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV ++ISEYRK+L  LY+ GARRV+VTGTGP+GCVPAELA R R GEC+ +LQRAAAL
Sbjct  192   PDYVVYIISEYRKVLASLYEFGARRVLVTGTGPLGCVPAELAMRGRNGECSAELQRAAAL  251

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL Q++  LN E+ + VF+A NT  MHMDF+ NPQA+GF+TSKVACCGQGP+NGIGL
Sbjct  252   FNPQLAQIINSLNEEIGSHVFIAVNTQMMHMDFVSNPQAYGFITSKVACCGQGPFNGIGL  311

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLC NR++YAFWDPFHPSE+ANRIIVQ I +G+ +YMHPMNLSTI+ +DSRT
Sbjct  312   CTPASNLCRNRNVYAFWDPFHPSERANRIIVQQILTGTQEYMHPMNLSTILAMDSRT  368



>ref|XP_004302115.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/342 (75%), Positives = 298/342 (87%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             + E RAFFVFGDSLVDNGNNNYLAT ARAD PPYGIDYPT RATGRFSNG NIPD IS+ 
Sbjct  24    QVEARAFFVFGDSLVDNGNNNYLATQARADAPPYGIDYPTGRATGRFSNGYNIPDFISQA  83

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG E TLP LSP+L GEKLLVGANFASAG+GILNDTGVQF+NIIR+  Q EYFE+YQ+R+
Sbjct  84    LGAEATLPYLSPELNGEKLLVGANFASAGIGILNDTGVQFINIIRMFRQYEYFEQYQQRL  143

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG  +A+QLVN AL+L+T+GGNDFVNNYYLVPFSARSRQ+ +P+YV +LISE+RK+L
Sbjct  144   SALIGPEQAQQLVNDALILLTVGGNDFVNNYYLVPFSARSRQYPLPEYVEYLISEFRKLL  203

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLYDLG RRV+VTGTGP+GCVPAELA RS  G+CA +LQRAA+LFNPQLTQM+ E+NSE
Sbjct  204   LRLYDLGGRRVLVTGTGPLGCVPAELAMRSTNGQCAPELQRAASLFNPQLTQMIREVNSE  263

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             L AD+F+AANT   H DF+ NPQA+GF TSK+ACCGQGPYNG+GLCT  SN+CP+RD+YA
Sbjct  264   LGADIFIAANTQLSHYDFVSNPQAYGFTTSKIACCGQGPYNGLGLCTALSNVCPDRDLYA  323

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWD FHPSE+ANR +VQ I +G T+YM PMNLSTI+ LDSRT
Sbjct  324   FWDAFHPSERANRYVVQAILNGGTEYMSPMNLSTILALDSRT  365



>ref|XP_007133949.1| hypothetical protein PHAVU_010G005800g [Phaseolus vulgaris]
 gb|ESW05943.1| hypothetical protein PHAVU_010G005800g [Phaseolus vulgaris]
Length=369

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/342 (75%), Positives = 297/342 (87%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
              AE RAFFVFGDSLVDNGNNNYLATTARADG PYGID  +HRA+GRFSNGLN+PD+ISEK
Sbjct  28    EAEARAFFVFGDSLVDNGNNNYLATTARADGYPYGIDSASHRASGRFSNGLNMPDLISEK  87

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G EPTLP LSP+L GEKLLVGANFASAGVGILNDTG QF+NIIRI  QL YF +YQ+RV
Sbjct  88    IGSEPTLPYLSPELNGEKLLVGANFASAGVGILNDTGFQFINIIRIREQLAYFRQYQQRV  147

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG  +++ LV+KALVLITLGGNDFVNNY+LVPFSARSR++ +PDYV  LISEYRKIL
Sbjct  148   SALIGEEQSRDLVDKALVLITLGGNDFVNNYFLVPFSARSREYALPDYVVLLISEYRKIL  207

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
               LY+LGARRV+VTGTGP+GCVPAELA  SR GECA +LQRA  +FNPQL Q+L ELN++
Sbjct  208   VDLYELGARRVLVTGTGPLGCVPAELAMHSRNGECATELQRAVNMFNPQLVQLLQELNAQ  267

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             + + VF++AN + MH+DF+ +PQA+GFVTSKVACCGQG YNGIGLCT ASNLCPNR++YA
Sbjct  268   IGSHVFISANAFAMHLDFVTDPQAYGFVTSKVACCGQGAYNGIGLCTPASNLCPNRNLYA  327

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWD FHPSE ANR+IV    +GSTDYMHPMNLSTI+ LDS T
Sbjct  328   FWDAFHPSETANRLIVDKFMTGSTDYMHPMNLSTILALDSTT  369



>ref|XP_009108075.1| PREDICTED: GDSL esterase/lipase At5g33370 [Brassica rapa]
Length=366

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/356 (72%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             +++ +L +  +   +A  RAF VFGDSLVDNGNN++L TTARAD  PYGID+PTH  TGR
Sbjct  11    LVVCILQMMSLLVLQANARAFLVFGDSLVDNGNNDFLVTTARADNYPYGIDFPTHLPTGR  70

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPD+ISE LG    LP LSP LK +KLL+GANFASAG+GILNDTG+QF+NIIRI
Sbjct  71    FSNGLNIPDLISEHLGQASPLPYLSPMLKKDKLLIGANFASAGIGILNDTGIQFLNIIRI  130

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEY E+Y+ RVS L+G  E ++LVN ALVLITLGGNDFVNNYYLVPFSARSRQF++P
Sbjct  131   TKQLEYLEQYKVRVSGLVGEEEMERLVNGALVLITLGGNDFVNNYYLVPFSARSRQFSLP  190

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +++SEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR GEC+ +LQRAA+LF
Sbjct  191   DYVVYVVSEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRTGECSTELQRAASLF  250

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+ +LN+E+ +  F+AANT  MHMDFI +PQA+GFVTSKVACCGQGPYNGIGLC
Sbjct  251   NPQLVQMINDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLC  310

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNRD++AFWDPFHPSEKA+RII Q I +GS +YMHPMNLSTI+ LDS T
Sbjct  311   TPLSNLCPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTILTLDSTT  366



>ref|XP_004494758.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=369

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/365 (72%), Positives = 306/365 (84%), Gaps = 5/365 (1%)
 Frame = -3

Query  1323  NNHGILLGLLALTIVFF-----GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGID  1159
             NN  I+  +  + I F       + E RAFFVFGDSLVDNGNNN+L TTARAD  PYGID
Sbjct  5     NNPRIVFAISCILICFLISNVVPQVEARAFFVFGDSLVDNGNNNFLVTTARADSYPYGID  64

Query  1158  YPTHRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTG  979
             YPTHRATGRFSNGLNIPD+ISE++G EPTLP L+P+L GE+LL GANFASAG+GILNDTG
Sbjct  65    YPTHRATGRFSNGLNIPDLISEQIGSEPTLPYLNPELDGERLLNGANFASAGIGILNDTG  124

Query  978   VQFMNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFS  799
             +QF+NIIRI  QL+YFE+YQ+RVS LIG  E  +LVN AL LI LGGNDFVNNY+LVPFS
Sbjct  125   IQFINIIRISRQLQYFEQYQQRVSALIGEEETVKLVNGALFLIALGGNDFVNNYFLVPFS  184

Query  798   ARSRQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAV  619
             ARSRQF +PDYV +LISEYRKIL RLY+LGARRV+VTGTGP+GC PAELAQ SR GEC  
Sbjct  185   ARSRQFALPDYVVYLISEYRKILARLYELGARRVMVTGTGPLGCAPAELAQHSRNGECFA  244

Query  618   DLQRAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQ  439
             +LQ+A+ LF+PQL Q+L +LNSE+ +DVF++AN ++ +MDFI NPQAFGF TSKVACCGQ
Sbjct  245   ELQQASDLFDPQLVQLLTQLNSEIGSDVFISANAFSRNMDFIGNPQAFGFATSKVACCGQ  304

Query  438   GPYNGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIME  259
             GPYNGIGLCT  SN+CPNRDIY FWDP+HPSE+ANR+IV+    GST YM+PMNLSTIM 
Sbjct  305   GPYNGIGLCTPLSNVCPNRDIYVFWDPYHPSERANRLIVEKFMIGSTKYMYPMNLSTIML  364

Query  258   LDSRT  244
             LDSRT
Sbjct  365   LDSRT  369



>ref|XP_008370770.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/352 (75%), Positives = 301/352 (86%), Gaps = 1/352 (0%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             ++AL ++  G AE RAFFVFGDSLVDNGNNNYLAT+ARAD PPYGIDYPT R TGRFSNG
Sbjct  11    VMALGMLSCG-AEARAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPTRRPTGRFSNG  69

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             L IPD IS+KLG EPTLP LSP L G+KLLVGANFASAG+GILNDTGVQF NIIR+  QL
Sbjct  70    LTIPDYISQKLGAEPTLPYLSPQLTGQKLLVGANFASAGIGILNDTGVQFANIIRMPLQL  129

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
               F++YQ+R+S  IG    KQLVN+ALVL+T+GGNDFVNNYYLVPFSARSRQF++PDYV 
Sbjct  130   LNFQQYQQRLSAQIGPQRTKQLVNQALVLLTVGGNDFVNNYYLVPFSARSRQFSLPDYVK  189

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQL  580
             +LISE RKIL ++YDLGARRV+VTGTGP+GCVPAELA RSR GECA +LQRA+AL+NPQL
Sbjct  190   YLISELRKILLKMYDLGARRVLVTGTGPMGCVPAELAMRSRNGECAAELQRASALYNPQL  249

Query  579   TQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQAS  400
              QML  +NS+L +DVFVAAN      DFI NPQAFGF TSKVACCGQGPYNG+GLCT+AS
Sbjct  250   IQMLRSVNSQLGSDVFVAANVQETRNDFIRNPQAFGFTTSKVACCGQGPYNGLGLCTRAS  309

Query  399   NLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             NLCPNRD+YAFWD FHPSEK NR+IV+ I +G   YM+PMNLSTI+ LDSRT
Sbjct  310   NLCPNRDLYAFWDAFHPSEKGNRLIVENILTGDEKYMYPMNLSTILALDSRT  361



>ref|XP_008796408.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=371

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/356 (72%), Positives = 304/356 (85%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ++ GL+ +  +       RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGR
Sbjct  16    LIAGLVVVGTLPVSSEAARAFFVFGDSLVDNGNNNYLATTARADRPPYGIDYPTGRPTGR  75

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLN+PDIISE LG EPTLP LSP+L+GEKLLVGANFASAG+GILNDTG+QF NIIRI
Sbjct  76    FSNGLNVPDIISENLGAEPTLPYLSPELRGEKLLVGANFASAGIGILNDTGIQFANIIRI  135

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL YFE+YQ+R+S LIG+   ++LVN+ALVLITLGGNDFVNNYYLVP+S RSR+F++P
Sbjct  136   RRQLSYFEQYQQRLSSLIGSARTQRLVNQALVLITLGGNDFVNNYYLVPYSPRSREFSLP  195

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEY+KIL  LY+LGARRV+VTGTGP+GCVPAELA RSR G+C  +L RA+ LF
Sbjct  196   DYVTYLISEYKKILASLYELGARRVLVTGTGPLGCVPAELALRSRNGQCDSELNRASDLF  255

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL Q+L +LN +  +DVFVA N+  MHMDFI NPQA+GFVTSKVACCGQGPYNGIGLC
Sbjct  256   NPQLIQLLNQLNRQFGSDVFVAVNSRKMHMDFISNPQAYGFVTSKVACCGQGPYNGIGLC  315

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  S+LCPNR++Y+FWD +HP+EKANRIIV    +GST+YM+PMNLSTI+ +D+R+
Sbjct  316   TSLSSLCPNRNVYSFWDQYHPTEKANRIIVSQFMTGSTEYMNPMNLSTILAMDARS  371



>ref|XP_010674245.1| PREDICTED: GDSL esterase/lipase At5g33370 [Beta vulgaris subsp. 
vulgaris]
Length=365

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/337 (76%), Positives = 299/337 (89%), Gaps = 0/337 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RA FVFGDSLVD+GNNN+LATTARAD PPYGIDYPTH ATGRFSNGLNIPDIISE +G E
Sbjct  28    RALFVFGDSLVDSGNNNFLATTARADSPPYGIDYPTHIATGRFSNGLNIPDIISETIGSE  87

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             PTLP LSP+L G+KLLVGANFASAG+GILNDTG QF+NIIRI  QLEYF++YQ+RVS LI
Sbjct  88    PTLPYLSPELTGQKLLVGANFASAGIGILNDTGAQFLNIIRIYGQLEYFQQYQQRVSALI  147

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G    +QLVNKALVLITLGGNDFVNNYYLVPFS RS QFT+PDYV +LIS+Y  ILQRLY
Sbjct  148   GEERTRQLVNKALVLITLGGNDFVNNYYLVPFSIRSTQFTLPDYVDYLISQYTMILQRLY  207

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             +LG RRV+VTGTGP+GCVP+E+AQR R G CA +LQ+AA+LFNP+L QM+ +LN+++ + 
Sbjct  208   ELGPRRVLVTGTGPLGCVPSEIAQRGRNGNCADELQKAASLFNPRLVQMINQLNNKIGSH  267

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VFVAAN + MHMDFI NP+++GFVTSKVACCGQGPYNG+GLCT  SNLCPNR++YAFWD 
Sbjct  268   VFVAANAFQMHMDFINNPRSYGFVTSKVACCGQGPYNGVGLCTVLSNLCPNRNLYAFWDA  327

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FHP+E+ANR+IVQ I  G+T+YMHPMNLSTI+ELDSR
Sbjct  328   FHPTERANRLIVQQILRGNTNYMHPMNLSTIIELDSR  364



>ref|XP_003535381.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/354 (74%), Positives = 303/354 (86%), Gaps = 3/354 (1%)
 Frame = -3

Query  1299  LLALTIV---FFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRF  1129
             ++AL I    F G    RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGRF
Sbjct  16    VMALAISGFNFKGAEAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRF  75

Query  1128  SNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIG  949
             SNGLNIPD IS++LG E TLP LSP+L GE+L VGANFASAG+G+LNDTGVQF+NIIRI 
Sbjct  76    SNGLNIPDFISQELGSESTLPYLSPELNGERLFVGANFASAGIGVLNDTGVQFVNIIRIS  135

Query  948   NQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPD  769
              QLEYF+EYQ+RVS LIG  + K+LVN ALVLIT GGNDFVNNYYLVP SARSRQF +PD
Sbjct  136   RQLEYFQEYQQRVSALIGDDKTKELVNGALVLITCGGNDFVNNYYLVPNSARSRQFALPD  195

Query  768   YVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFN  589
             YV F+ISEY+K+L+RLYDLGARRV+VTGTGP+GCVPAELA R R GEC+ +LQ+AA+L+N
Sbjct  196   YVTFVISEYKKVLRRLYDLGARRVVVTGTGPLGCVPAELALRGRNGECSEELQQAASLYN  255

Query  588   PQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCT  409
             PQL +M+ +LN E+ +DVFVAANT  MH DF+ NPQ +GF+TSKVACCGQGP+NGIGLCT
Sbjct  256   PQLVEMIKQLNKEVGSDVFVAANTQLMHNDFVTNPQTYGFITSKVACCGQGPFNGIGLCT  315

Query  408   QASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
              ASNLCP RD +AFWD FHPSEKA+++IVQ I SG++ YMHPMNLSTI+ LDS+
Sbjct  316   VASNLCPYRDEFAFWDAFHPSEKASKLIVQQIMSGTSKYMHPMNLSTILALDSK  369



>ref|XP_003521784.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
 gb|KHN35334.1| GDSL esterase/lipase [Glycine soja]
Length=365

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/354 (73%), Positives = 307/354 (87%), Gaps = 4/354 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+LG+L L     G    RAFFVFGDSLVDNGNNN+LATTARAD PPYGID+PT R TGR
Sbjct  13    IVLGILVLK----GAEAQRAFFVFGDSLVDNGNNNFLATTARADAPPYGIDFPTGRPTGR  68

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD IS+ LG E TLP L P+L GE+LLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  69    FSNGYNIPDFISQSLGAESTLPYLDPELDGERLLVGANFASAGIGILNDTGIQFVNIIRI  128

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEY++EYQ+RVS LIG  + ++L+N ALVLITLGGNDFVNNYYLVP+SARSRQ+ +P
Sbjct  129   YRQLEYWQEYQQRVSALIGPEQTERLINGALVLITLGGNDFVNNYYLVPYSARSRQYNLP  188

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV ++ISEY+K+L+RLY++GARRV+VTGTGP+GCVPAELAQRS  G+C+ +LQ+AAALF
Sbjct  189   DYVKYIISEYKKVLRRLYEIGARRVLVTGTGPLGCVPAELAQRSTNGDCSAELQQAAALF  248

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL Q++ +LNSE+ ++VFV  NT  MH+DFI NPQ +GFVTSKVACCGQGPYNG+GLC
Sbjct  249   NPQLVQIIRQLNSEIGSNVFVGVNTQQMHIDFISNPQRYGFVTSKVACCGQGPYNGLGLC  308

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             T ASNLCPNRD YAFWDPFHP+E+ANRIIVQ I SG+++YM+PMNLSTIM LDS
Sbjct  309   TPASNLCPNRDSYAFWDPFHPTERANRIIVQQILSGTSEYMYPMNLSTIMALDS  362



>emb|CDY12384.1| BnaC08g08210D [Brassica napus]
Length=365

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/357 (72%), Positives = 308/357 (86%), Gaps = 3/357 (1%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G+ L +++L ++   +A  RAF VFGDSLVDNGNN++L TTARAD  PYGID+PTH  TG
Sbjct  12    GVCLQMMSLLVL---QANARAFLVFGDSLVDNGNNDFLVTTARADNYPYGIDFPTHLPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE LG    LP LSP LK +KLL+GANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDLISEHLGQASPLPYLSPMLKKDKLLIGANFASAGIGILNDTGIQFLNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QLEYFE+Y+ RVS L+G  E ++LVN AL LITLGGNDFVNNYYLVPFSARSRQF++
Sbjct  129   ITKQLEYFEQYKVRVSGLVGEEEMERLVNGALGLITLGGNDFVNNYYLVPFSARSRQFSL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +++SEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR+GEC+ +LQRAA+L
Sbjct  189   PDYVVYVVSEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRSGECSTELQRAASL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL QM+ +LN+E+ +  F+AANT  MHMDFI +P+A+GFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPQLVQMINDLNNEVGSSAFIAANTQQMHMDFISDPEAYGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT  SNLCPNRD++AFWDPFHPSEKA+RII Q I +GS +YMHPMNLSTI+ LDS T
Sbjct  309   CTPLSNLCPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSTILTLDSTT  365



>ref|XP_006437267.1| hypothetical protein CICLE_v10033835mg [Citrus clementina]
 gb|ESR50507.1| hypothetical protein CICLE_v10033835mg [Citrus clementina]
Length=368

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/354 (74%), Positives = 301/354 (85%), Gaps = 2/354 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+LGL+   ++   +AE RAFFVFGDSLVD GNNNYLAT ARAD PPYGIDYPTHR TGR
Sbjct  12    IVLGLV-FALIVAPQAEARAFFVFGDSLVDVGNNNYLATIARADAPPYGIDYPTHRPTGR  70

Query  1131  FSNGLNIPDIISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             FSNGLNIPDIISE++G  E  LP LSP+L GE+LL GANFASAG+GILNDTG+QF+NIIR
Sbjct  71    FSNGLNIPDIISEQIGQPESPLPYLSPELTGERLLNGANFASAGIGILNDTGIQFLNIIR  130

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  QL  FEEYQ RVS LIG    KQLVNKALVLIT+GGNDFVNNYYLVPFSARSRQ+ +
Sbjct  131   LFRQLHCFEEYQHRVSALIGVQNTKQLVNKALVLITVGGNDFVNNYYLVPFSARSRQYPL  190

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             P+YV +LISEY+K L+RLY+LGARRV+VTGTGP+GCVPAELA R   G C+ +LQRAAAL
Sbjct  191   PEYVKYLISEYKKQLKRLYELGARRVLVTGTGPLGCVPAELAMRGTDGGCSAELQRAAAL  250

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQL QML ELN E+   +F+ ANT  MHMDF+ +PQA+GFVTSK+ACCGQGPYNG+GL
Sbjct  251   YNPQLVQMLQELNREIGETIFIGANTQQMHMDFVSDPQAYGFVTSKIACCGQGPYNGLGL  310

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             CT  SNLCPNRD+YAFWDPFHPSEKANRIIVQ I SGST YM+PMNLST++ LD
Sbjct  311   CTALSNLCPNRDLYAFWDPFHPSEKANRIIVQQIMSGSTKYMNPMNLSTVLALD  364



>emb|CDY47551.1| BnaA08g07360D [Brassica napus]
Length=366

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/356 (72%), Positives = 304/356 (85%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             +++ +L +  +   +A  RAF VFGDSLVDNGNN++L TTARAD  PYGID+PTH  TGR
Sbjct  11    LVVCILQMMSLLVLQANARAFLVFGDSLVDNGNNDFLVTTARADNYPYGIDFPTHLPTGR  70

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPD+ISE LG    LP LSP LK +KLL+GANFASAG+GILNDTG+QF+NIIRI
Sbjct  71    FSNGLNIPDLISEHLGQASPLPYLSPMLKKDKLLIGANFASAGIGILNDTGIQFLNIIRI  130

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEY E+Y+ RVS L+G  E ++LVN ALVLITLGGNDFVNNYYLVPFSARSRQF++P
Sbjct  131   TKQLEYLEQYKVRVSGLVGEEEMERLVNGALVLITLGGNDFVNNYYLVPFSARSRQFSLP  190

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +++SEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR GEC+ +LQRAA+LF
Sbjct  191   DYVVYVVSEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRTGECSTELQRAASLF  250

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+ +LN+E+ +  F+AANT  MHMDFI +PQA+GFVTSKVACCGQGPYNGIGLC
Sbjct  251   NPQLVQMINDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLC  310

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNRD++AFWDPFHPSEKA+RII Q I  GS +YMHPMNLSTI+ LDS T
Sbjct  311   TPLSNLCPNRDLFAFWDPFHPSEKASRIIAQQILDGSPEYMHPMNLSTILTLDSTT  366



>ref|XP_010043320.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Eucalyptus grandis]
 gb|KCW85325.1| hypothetical protein EUGRSUZ_B02164 [Eucalyptus grandis]
Length=369

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/342 (74%), Positives = 303/342 (89%), Gaps = 1/342 (0%)
 Frame = -3

Query  1269  RAEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISE  1093
             RAE  RAFF+FGDSLVDNGNNNYLATTARAD PPYGIDYPTHR TGRFSNG NIPD IS+
Sbjct  27    RAEAARAFFIFGDSLVDNGNNNYLATTARADSPPYGIDYPTHRPTGRFSNGFNIPDFISQ  86

Query  1092  KLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRR  913
             ++G +PTLP LSP+L+G++LLVGANFASAG+GILNDTGVQF+N+IR+  QLEYF +YQ+R
Sbjct  87    EIGSQPTLPYLSPELRGQRLLVGANFASAGIGILNDTGVQFINVIRMYQQLEYFRQYQQR  146

Query  912   VSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKI  733
             VS LIG G  ++LVN+ALVLIT+GGNDFVNNY+LVP+SARSRQ+++P+YV F+ISE++K 
Sbjct  147   VSALIGPGRTRKLVNQALVLITVGGNDFVNNYFLVPYSARSRQYSLPNYVRFVISEFKKQ  206

Query  732   LQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNS  553
             L RL+DLGARRV+VTGTGP+GCVPAELA R R G+C  +LQ+AA+L+NPQL QML +LN+
Sbjct  207   LMRLHDLGARRVLVTGTGPLGCVPAELAMRGRNGQCVAELQQAASLYNPQLLQMLKDLNN  266

Query  552   ELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIY  373
             + K+ VF+AANT  MH +FI NP+A+GF+T+KVACCGQGPYNGIGLCT AS LCPNRD Y
Sbjct  267   KYKSQVFIAANTQLMHNNFIANPRAYGFITAKVACCGQGPYNGIGLCTVASTLCPNRDQY  326

Query  372   AFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             AFWDPFHPS+KANR+IVQ I SGST YM PMN+STIM LDSR
Sbjct  327   AFWDPFHPSQKANRLIVQQIMSGSTKYMDPMNVSTIMALDSR  368



>ref|XP_004495557.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=368

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/354 (72%), Positives = 303/354 (86%), Gaps = 0/354 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I++  L +   F      RAFFVFGDS+ DNGNN++LATTARAD PPYGID+PTH+ +GR
Sbjct  13    IMITCLLVAFDFACAQPTRAFFVFGDSIADNGNNHFLATTARADTPPYGIDFPTHKPSGR  72

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPD+ISE+LG+EPTLP LSP L GEKLLVGANFASAG+GILNDTG+QF++I+ I
Sbjct  73    FSNGLNIPDLISEQLGLEPTLPYLSPCLVGEKLLVGANFASAGIGILNDTGIQFLDILHI  132

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL+ F  YQ+R+S  IGA EA++LVNKALVLI LGGNDFVNNYYLVPFSARSRQF++P
Sbjct  133   DKQLKLFHHYQQRLSAHIGANEAQKLVNKALVLIVLGGNDFVNNYYLVPFSARSRQFSLP  192

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRKIL++LYDLG R+V+VTGTGP+GCVPAELA RSR G+C V+L+RA +L+
Sbjct  193   DYVSYLISEYRKILKKLYDLGGRKVLVTGTGPMGCVPAELAMRSRNGDCDVELERAGSLY  252

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+  LN E+ AD+F+AAN + MHMDFI NPQAFGFVTSK ACCGQGPYNGIGLC
Sbjct  253   NPQLVQMIKGLNQEIGADIFIAANAHQMHMDFISNPQAFGFVTSKEACCGQGPYNGIGLC  312

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             T  SNLC NRD+YAFWD FHPSEKA+RIIVQ I +GS +YMHPMNLST++ +DS
Sbjct  313   TPLSNLCQNRDLYAFWDSFHPSEKASRIIVQQILTGSYEYMHPMNLSTLLAMDS  366



>ref|NP_001237641.2| uncharacterized LOC100500155 precursor [Glycine max]
Length=364

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/356 (73%), Positives = 301/356 (85%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I++  L +++ F    + RAFFVFGDSLVD+GNN++LATTARAD PPYGID+PTHR TGR
Sbjct  9     IIVTSLFMSLSFASAQQGRAFFVFGDSLVDSGNNDFLATTARADAPPYGIDFPTHRPTGR  68

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISE LG+EPTLP LSP L GE+LLVGANFASAG+GILNDTG QF+NII I
Sbjct  69    FSNGLNIPDIISENLGLEPTLPYLSPLLVGERLLVGANFASAGIGILNDTGFQFLNIIHI  128

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL+ F  YQ+R+S  IG   A + VN+AL+LITLGGNDFVNNYYLVP+S RSRQF++P
Sbjct  129   YKQLKLFAHYQQRLSAHIGKEGAWRHVNQALILITLGGNDFVNNYYLVPYSVRSRQFSLP  188

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV ++ISEYR IL+RLYDLG RRV+VTGTGP+GCVPAELA RSR GEC V+LQRAA+LF
Sbjct  189   DYVTYIISEYRLILRRLYDLGGRRVLVTGTGPMGCVPAELALRSRNGECDVELQRAASLF  248

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL +M+  LN E+ A VF+A N Y MHMDF+ NPQ FGFVTSK+ACCGQGP+NG+GLC
Sbjct  249   NPQLVEMVKGLNQEIGAHVFIAVNAYEMHMDFVTNPQDFGFVTSKIACCGQGPFNGVGLC  308

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNRD+YAFWDPFHPSEKANRIIVQ + +GS  YMHPMNLSTIM LDSR 
Sbjct  309   TPLSNLCPNRDLYAFWDPFHPSEKANRIIVQQMMTGSDQYMHPMNLSTIMALDSRV  364



>ref|XP_006484791.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
Length=368

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/354 (74%), Positives = 301/354 (85%), Gaps = 2/354 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+LGL+   ++   +AE RAFFVFGDSLVD GNNNYLAT ARAD PPYGIDYPTHR TGR
Sbjct  12    IVLGLV-FALIVAPQAEARAFFVFGDSLVDVGNNNYLATIARADAPPYGIDYPTHRPTGR  70

Query  1131  FSNGLNIPDIISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             FSNGLNIPDIISE++G  E  LP LSP+L GE+LL GANFASAG+GILNDTG+QF+NIIR
Sbjct  71    FSNGLNIPDIISEQIGQPESPLPYLSPELTGERLLNGANFASAGIGILNDTGIQFLNIIR  130

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  QL  FEEYQ RVS LIG    KQLVNKALVLIT+GGNDFVNNYYLVPFSARSRQ+ +
Sbjct  131   LFRQLHCFEEYQHRVSALIGLQNTKQLVNKALVLITVGGNDFVNNYYLVPFSARSRQYPL  190

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             P+YV +LISEY+K L+RLY+LGARRV+VTGTGP+GCVPAELA R   G C+ +LQRAAAL
Sbjct  191   PEYVKYLISEYKKQLKRLYELGARRVLVTGTGPLGCVPAELAMRGTDGGCSAELQRAAAL  250

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQL QML ELN E+   +F+ ANT  MHMDF+ +PQA+GFVTSK+ACCGQGPYNG+GL
Sbjct  251   YNPQLVQMLQELNREIGETIFIGANTQQMHMDFVSDPQAYGFVTSKIACCGQGPYNGLGL  310

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             CT  SNLCPNRD+YAFWDPFHPSEKANRIIVQ I SGST YM+PMNLST++ LD
Sbjct  311   CTALSNLCPNRDLYAFWDPFHPSEKANRIIVQQIMSGSTKYMNPMNLSTVLALD  364



>gb|KDO46628.1| hypothetical protein CISIN_1g041652mg [Citrus sinensis]
Length=368

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/354 (74%), Positives = 301/354 (85%), Gaps = 2/354 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+LGL+   ++   +AE RAFFVFGDSLVD GNNNYLAT ARAD PPYGIDYPTHR TGR
Sbjct  12    IVLGLV-FALIVAPQAEARAFFVFGDSLVDVGNNNYLATIARADAPPYGIDYPTHRPTGR  70

Query  1131  FSNGLNIPDIISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             FSNGLNIPDIISE++G  E  LP LSP+L GE+LL GANFASAG+GILNDTG+QF+NIIR
Sbjct  71    FSNGLNIPDIISEQIGQPESPLPYLSPELTGERLLNGANFASAGIGILNDTGIQFLNIIR  130

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  QL  FEEYQ RVS LIG    KQLVNKALVLIT+GGNDFVNNYYLVPFSARSRQ+ +
Sbjct  131   LFRQLHCFEEYQHRVSALIGLQNTKQLVNKALVLITVGGNDFVNNYYLVPFSARSRQYPL  190

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             P+YV +LISEY+K L+RLY+LGAR+V+VTGTGP+GCVPAELA R   GEC+ +LQRAAAL
Sbjct  191   PEYVKYLISEYKKQLKRLYELGARQVLVTGTGPLGCVPAELAMRGTDGECSAELQRAAAL  250

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQL QML ELN E+   +F+ ANT  MHMDF+ +PQA+GFVTSK+ACCGQGPYNG+GL
Sbjct  251   YNPQLVQMLQELNREIGETIFIGANTQQMHMDFVSDPQAYGFVTSKIACCGQGPYNGLGL  310

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             CT  SNLCPNRD+YAFWDPFHPSEKANRIIVQ I  GST YM+PMNLST++ LD
Sbjct  311   CTALSNLCPNRDLYAFWDPFHPSEKANRIIVQQIMRGSTKYMNPMNLSTVLALD  364



>ref|XP_008789479.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=364

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/356 (72%), Positives = 303/356 (85%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I   L+AL  +       RAFFVFGDSLVDNGNNNYLATTARAD PPYGID PT R TGR
Sbjct  9     IFFSLVALVTLPVSSEAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDSPTRRPTGR  68

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG+N+PDIISE LG EPTLP LSP+L+GEKLLVGANFASAGVGILNDTG+QF+NIIRI
Sbjct  69    FSNGMNVPDIISENLGAEPTLPYLSPELRGEKLLVGANFASAGVGILNDTGIQFVNIIRI  128

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL YFE+YQ+R+S LIG  +A++LVN+ALVLITLGGNDFVNNYYLVPFS RSRQFT+P
Sbjct  129   WTQLHYFEQYQQRLSSLIGPEQAQRLVNQALVLITLGGNDFVNNYYLVPFSVRSRQFTLP  188

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             +YV +L+SEYRKIL  LY+LGARRV+VTGTGP+GCVPAELA RSR G C  +L  A+ LF
Sbjct  189   NYVTYLMSEYRKILAGLYELGARRVLVTGTGPLGCVPAELALRSRTGHCDPELNGASNLF  248

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL Q++ ELNS++ +DVF + N Y+MHMDFI +PQA+GFVTSK+ACCGQGPYNGIGLC
Sbjct  249   NPQLIQVVNELNSQIGSDVFFSVNVYSMHMDFISDPQAYGFVTSKIACCGQGPYNGIGLC  308

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SN+CPNRDI+AFWD FHP+E+ANRI+V+   +G+T YM P+NLSTI+ +D+RT
Sbjct  309   TVLSNVCPNRDIFAFWDAFHPTERANRILVRQFMAGTTKYMSPLNLSTILAMDART  364



>ref|XP_002522022.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40426.1| zinc finger protein, putative [Ricinus communis]
Length=369

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/353 (75%), Positives = 302/353 (86%), Gaps = 2/353 (1%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             +LAL I    +AE RAFFVFGDSLVD+GNNNYLATTARAD  PYGIDYPTHRATGRFSNG
Sbjct  18    VLALEICSM-QAEARAFFVFGDSLVDSGNNNYLATTARADSYPYGIDYPTHRATGRFSNG  76

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             LNIPDIISE++G EP LP LSP+L G++LL GANFASAG+GILNDTGVQF+NIIR+  Q 
Sbjct  77    LNIPDIISERIGSEPVLPYLSPELTGKRLLNGANFASAGIGILNDTGVQFLNIIRMYRQF  136

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
             +YF EYQRRV  LIG+   K+LVN ALVLIT+GGNDFVNNYYLVP+SARSRQF +PDYV 
Sbjct  137   QYFGEYQRRVRALIGSSRTKRLVNGALVLITVGGNDFVNNYYLVPYSARSRQFALPDYVK  196

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQR-SRAGECAVDLQRAAALFNPQ  583
             +LISEY+K+L  LY LGARRV+VTGTGP+GCVPAELA R +  G C+ +LQRAA+L+NPQ
Sbjct  197   YLISEYKKLLMALYKLGARRVLVTGTGPLGCVPAELAMRGANNGGCSAELQRAASLYNPQ  256

Query  582   LTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQA  403
             L QML  LN ++   VF+ ANT  MHMDFI +PQA+GF TSKVACCGQGPYNG+GLCT A
Sbjct  257   LVQMLNGLNRKIGKTVFIGANTQQMHMDFISSPQAYGFTTSKVACCGQGPYNGLGLCTLA  316

Query  402   SNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             SNLCPNR +YAFWDPFHPSEKANR+IV+ IFSG+T+YM PMNLSTIM LD+RT
Sbjct  317   SNLCPNRGLYAFWDPFHPSEKANRLIVEQIFSGTTNYMVPMNLSTIMALDART  369



>ref|XP_004155142.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
Length=440

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/345 (75%), Positives = 296/345 (86%), Gaps = 0/345 (0%)
 Frame = -3

Query  1278  FFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDII  1099
             F  +A+ RAFFVFGDSLVDNGNNNYL TTARAD  PYGIDYPT R TGRFSNGLNIPD+I
Sbjct  96    FVCQAQARAFFVFGDSLVDNGNNNYLLTTARADNYPYGIDYPTRRPTGRFSNGLNIPDLI  155

Query  1098  SEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQ  919
             SE +G   TLP LSP L+GE LLVGANFASAG+GILNDTG+QF+NIIRI  QLEYF +YQ
Sbjct  156   SEAMGSPSTLPYLSPQLRGENLLVGANFASAGIGILNDTGIQFLNIIRIRQQLEYFRQYQ  215

Query  918   RRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYR  739
              RVS LIG  E  +LVN+ALVLITLGGNDFVNNYYLVP SARSRQFT+PDYV ++ISEYR
Sbjct  216   ARVSALIGEEETVRLVNEALVLITLGGNDFVNNYYLVPVSARSRQFTLPDYVVYIISEYR  275

Query  738   KILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAEL  559
             K+L  LY+ GARRV+VTGTGP+GCVPAELA R R GEC+ +LQRAAALFNPQL Q++  L
Sbjct  276   KVLASLYEFGARRVLVTGTGPLGCVPAELAMRGRNGECSAELQRAAALFNPQLAQIINSL  335

Query  558   NSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRD  379
             N E+ + VF+A NT  MHMDF+ NPQA+GF+TSKVACCGQGP+NGIGLCT ASNLC NR+
Sbjct  336   NEEIGSHVFIAVNTQMMHMDFVSNPQAYGFITSKVACCGQGPFNGIGLCTPASNLCRNRN  395

Query  378   IYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             +YAFWDPFHPSE+ANRIIVQ I +G+ +YMHPMNLSTI+ +DSRT
Sbjct  396   VYAFWDPFHPSERANRIIVQQILTGTQEYMHPMNLSTILAMDSRT  440



>gb|KFK24279.1| hypothetical protein AALP_AAs47157U000200 [Arabis alpina]
Length=366

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/356 (72%), Positives = 305/356 (86%), Gaps = 1/356 (0%)
 Frame = -3

Query  1308  LLGLLALTI-VFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             LLG   L I +   +A  RAF VFGDSLVDNGNN+YL TTARAD  PYGIDYPTHR TGR
Sbjct  10    LLGFCILLICLLVPQANARAFLVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTHRPTGR  69

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPD+ISE LG    LP LSP L  +KLL+GANFASAG+GILNDTG+QF+NIIRI
Sbjct  70    FSNGLNIPDLISEHLGQASPLPYLSPMLTKDKLLLGANFASAGIGILNDTGIQFLNIIRI  129

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF++Y+ R++ LIG  E ++ VN+ALVLITLGGNDFVNNYYLVPFSARSRQF++P
Sbjct  130   TKQLEYFQQYKVRLAGLIGEEEMERRVNEALVLITLGGNDFVNNYYLVPFSARSRQFSLP  189

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +++SEYRK+L+++YDLGARRV+VTGTGP+GCVPAELAQRSR GEC+ +LQRAAAL+
Sbjct  190   DYVVYIVSEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRSRTGECSTELQRAAALY  249

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+ +LN+E+ +  F+AANT  MHMDFI +PQA+GF+TSKVACCGQGPYNGIGLC
Sbjct  250   NPQLVQMINDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFITSKVACCGQGPYNGIGLC  309

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNRD++AFWDPFHPSEKA+RII Q I +GS +YMHPMNLS+I+ +DS T
Sbjct  310   TALSNLCPNRDLFAFWDPFHPSEKASRIIAQQILNGSPEYMHPMNLSSILTVDSMT  365



>ref|XP_008370782.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/352 (75%), Positives = 300/352 (85%), Gaps = 1/352 (0%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             ++AL ++  G AE RAFFVFGDSLVDNGNNNYLAT+ARAD PPYGIDYPT R TGRFSNG
Sbjct  11    VMALGMLSCG-AEARAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPTRRPTGRFSNG  69

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             L IPD IS+KLG EPTLP LSP L G+KLLVGANFASAG+GILNDTGVQF NIIR+  QL
Sbjct  70    LTIPDYISQKLGAEPTLPYLSPQLTGQKLLVGANFASAGIGILNDTGVQFANIIRMPLQL  129

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
               F++YQ+R+S  IG    KQLVN+ALVL+T+GGNDFVNNYYLVPFSARSRQF++PDYV 
Sbjct  130   LNFQQYQQRLSAQIGPQRTKQLVNQALVLLTVGGNDFVNNYYLVPFSARSRQFSLPDYVK  189

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQL  580
             +LISE RKIL ++YDLGARRV+VTGTGP+GC PAELA RSR GECA +LQRA+AL+NPQL
Sbjct  190   YLISELRKILLKMYDLGARRVLVTGTGPMGCXPAELAMRSRNGECAAELQRASALYNPQL  249

Query  579   TQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQAS  400
              QML  +NS+L +DVFVAAN      DFI NPQAFGF TSKVACCGQGPYNG+GLCT+AS
Sbjct  250   IQMLRSVNSQLGSDVFVAANVQETRNDFIRNPQAFGFTTSKVACCGQGPYNGLGLCTRAS  309

Query  399   NLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             NLCPNRD+YAFWD FHPSEK NR+IV+ I +G   YM+PMNLSTI+ LDSRT
Sbjct  310   NLCPNRDLYAFWDAFHPSEKGNRLIVENIXTGDEKYMYPMNLSTILALDSRT  361



>ref|XP_009348738.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=361

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/351 (75%), Positives = 299/351 (85%), Gaps = 1/351 (0%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             ++AL ++ +G AE RAFFVFGDSLVD GNNNYLAT+ARAD PPYGIDYPT R TGRFSNG
Sbjct  11    VMALGMLSYG-AEARAFFVFGDSLVDTGNNNYLATSARADSPPYGIDYPTRRPTGRFSNG  69

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             L+IPD IS+KLG EPTLP LSP L G+KLLVGANFASAG+GILNDTGVQF NIIR+  QL
Sbjct  70    LSIPDYISQKLGAEPTLPYLSPLLTGQKLLVGANFASAGIGILNDTGVQFANIIRMPAQL  129

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
               F++YQRR+S  IG    KQLVN+ALVL+T+GGNDFVNNYYLVPFSARSRQF +PDYV 
Sbjct  130   LNFQQYQRRLSAQIGPQRTKQLVNQALVLLTVGGNDFVNNYYLVPFSARSRQFALPDYVR  189

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQL  580
             +LISE RKIL ++YDLGARRV+VTGTGP+GC PAELA RSR GECA +LQRAAAL+NPQL
Sbjct  190   YLISELRKILLKMYDLGARRVLVTGTGPLGCAPAELAMRSRNGECAAELQRAAALYNPQL  249

Query  579   TQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQAS  400
              QML  +NS+L +DVFVAAN      DFI NPQAFGF TSK+ACCGQGPYNG+GLCT+AS
Sbjct  250   IQMLRSVNSQLGSDVFVAANVQETRNDFIKNPQAFGFTTSKIACCGQGPYNGLGLCTRAS  309

Query  399   NLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             NLCPNRD+YAFWD FHPSEK NR+IV+ I +G   YM+PMNLSTI+ LDSR
Sbjct  310   NLCPNRDLYAFWDAFHPSEKGNRLIVENIMTGDEKYMYPMNLSTILALDSR  360



>ref|XP_008345728.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/352 (75%), Positives = 300/352 (85%), Gaps = 1/352 (0%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             ++AL ++  G AE RAFFVFGDSLVDNGNNNYLAT+ARAD PPYGIDYPT R TGRFSNG
Sbjct  11    VMALGMLSCG-AEARAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPTRRPTGRFSNG  69

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             L IPD IS+KLG EPTLP LSP L G+KLLVGANFASAG+GILNDTGVQF NIIR+  QL
Sbjct  70    LTIPDYISQKLGAEPTLPYLSPQLTGQKLLVGANFASAGIGILNDTGVQFANIIRMPLQL  129

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
               F++YQ+R+S  IG    KQLVN+ALVL+T+GGNDFVNNYYLVPFSARSRQF++PDYV 
Sbjct  130   LNFQQYQQRLSAQIGPQRTKQLVNQALVLLTVGGNDFVNNYYLVPFSARSRQFSLPDYVK  189

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQL  580
             +LISE RKIL ++YDLGARRV+VTGTGP+GCVPAELA RSR GECA +LQRA+AL+NPQL
Sbjct  190   YLISELRKILLKMYDLGARRVLVTGTGPMGCVPAELAMRSRNGECAAELQRASALYNPQL  249

Query  579   TQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQAS  400
              QML  +NS+L +DVFVAAN      DFI NPQAFGF TSKVACCGQGPY G+GLCT+AS
Sbjct  250   IQMLRSVNSQLGSDVFVAANVQETRNDFIXNPQAFGFTTSKVACCGQGPYXGLGLCTRAS  309

Query  399   NLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             NLCPNRD+YAFWD FHPSEK NR+IV+ I +G   YM+PMNLSTI+ LDSRT
Sbjct  310   NLCPNRDLYAFWDAFHPSEKGNRLIVENIXTGDEKYMYPMNLSTILALDSRT  361



>gb|EYU39533.1| hypothetical protein MIMGU_mgv1a008571mg [Erythranthe guttata]
Length=369

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/356 (73%), Positives = 302/356 (85%), Gaps = 1/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFF-GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             I + +LAL   +     E +AFFVFGDSLVDNGNNNYLATTARAD PPYGID+PTHR TG
Sbjct  13    IFVFVLALEFNYLCNHVEGKAFFVFGDSLVDNGNNNYLATTARADAPPYGIDFPTHRPTG  72

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISEK+G EPT+P LS +L G+KLLVGANFASAGVG+LNDTG+QF+NIIR
Sbjct  73    RFSNGLNIPDIISEKMGWEPTIPYLSRELSGQKLLVGANFASAGVGVLNDTGIQFVNIIR  132

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QL +F +YQ+R+   IGA EAK+LVN++LVL+TLGGNDFVNNY+LVP+S RS+Q++I
Sbjct  133   IYEQLNFFRQYQQRLMREIGATEAKKLVNESLVLMTLGGNDFVNNYFLVPYSIRSQQYSI  192

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
              DYVPF+ISEY+K+LQRLY+LG RRVIVTGTGP+GCVPAELA  S  GECA  LQ AA+L
Sbjct  193   QDYVPFVISEYKKVLQRLYELGPRRVIVTGTGPLGCVPAELALHSNNGECAEQLQLAASL  252

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL QM+ ELN ++  DVFVAANT  MHMDFI NP+ FGF TSK+ACCGQGPYNG+GL
Sbjct  253   FNPQLVQMIDELNQDIGTDVFVAANTNQMHMDFISNPEQFGFQTSKIACCGQGPYNGLGL  312

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             CT  SNLCPNRD+Y FWD FHPSE+ANR+IV  IF GST YMHPMNLSTI+ LDSR
Sbjct  313   CTPFSNLCPNRDLYVFWDAFHPSERANRMIVDQIFGGSTTYMHPMNLSTIVTLDSR  368



>ref|XP_004489545.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=366

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/355 (72%), Positives = 302/355 (85%), Gaps = 3/355 (1%)
 Frame = -3

Query  1299  LLALTIVFFG---RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRF  1129
             L+  +IVF      A+ RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPTH  TGRF
Sbjct  12    LIIFSIVFIVGGVEAKSRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPTHAPTGRF  71

Query  1128  SNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIG  949
             SNG NIPD+IS++LG E TLP LSP+L+GE+LLVGANFASAG+GILNDTGVQF+N+IR+ 
Sbjct  72    SNGYNIPDLISQQLGAESTLPYLSPELRGERLLVGANFASAGIGILNDTGVQFINVIRMY  131

Query  948   NQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPD  769
              QLEYFEEYQ R+S +IGA +AK  VN+ALVLIT+GGNDFVNNYYLVP+SARSRQ+ +P 
Sbjct  132   RQLEYFEEYQNRLSAIIGAAQAKSRVNEALVLITVGGNDFVNNYYLVPYSARSRQYQLPQ  191

Query  768   YVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFN  589
             YV +LISEY+K+LQ+LYDLGARRV+VTGTGP+GCVP+ELAQR R G+C+ +LQ+AA+LFN
Sbjct  192   YVKYLISEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCSTELQKAASLFN  251

Query  588   PQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCT  409
             PQL  ML  LN ++  DVF+AANT  MH +F+ NP  FGF TSKVACCGQGPYNG+GLCT
Sbjct  252   PQLESMLLALNKKIGRDVFIAANTAKMHNNFVSNPSQFGFKTSKVACCGQGPYNGLGLCT  311

Query  408   QASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
               SNLC NR++YAFWD FHPSEKANR+IVQ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  312   AVSNLCSNRELYAFWDAFHPSEKANRLIVQEIMSGSKAYMNPMNLSTILALDATT  366



>ref|XP_002325359.2| hypothetical protein POPTR_0019s04110g [Populus trichocarpa]
 gb|EEE99740.2| hypothetical protein POPTR_0019s04110g [Populus trichocarpa]
Length=405

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/354 (75%), Positives = 310/354 (88%), Gaps = 0/354 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ++LGL+          E RAFFVFGDSLVDNGNNNYLATTARAD PPYG+DYPTHRATGR
Sbjct  50    LILGLVITLASVIPEVEARAFFVFGDSLVDNGNNNYLATTARADAPPYGVDYPTHRATGR  109

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD+ISE +G EPTLP LSP+L+GE LLVGANFASAG+GILNDTG+QF+NIIR+
Sbjct  110   FSNGFNIPDLISEAIGSEPTLPYLSPELRGENLLVGANFASAGIGILNDTGIQFLNIIRM  169

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
             G QL+YF++YQ+RVS LIG  +A++LVN+ALVL+TLGGNDFVNNYYLVPFSARSRQF +P
Sbjct  170   GRQLQYFQQYQQRVSALIGPEQAQRLVNQALVLMTLGGNDFVNNYYLVPFSARSRQFALP  229

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRKIL  +Y+LGARRV+VTGTGP+GCVPAE A RSR GECA +LQRAAA+F
Sbjct  230   DYVVYLISEYRKILVSVYELGARRVLVTGTGPLGCVPAERAMRSRNGECAAELQRAAAMF  289

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QML ELN E+ +DVF++AN Y  +MDF+ NPQA+GFVTS+VACCGQG +NGIGLC
Sbjct  290   NPQLVQMLMELNKEIGSDVFISANAYEANMDFVTNPQAYGFVTSQVACCGQGRFNGIGLC  349

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             T ASNLCPNR+I+AFWDPFHP+E+ANRIIV  I +GST YM+PMNLSTI+ LDS
Sbjct  350   TIASNLCPNREIFAFWDPFHPTERANRIIVSTIVTGSTKYMNPMNLSTIIALDS  403



>ref|XP_003589465.1| GDSL esterase/lipase [Medicago truncatula]
 ref|XP_003590913.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES59716.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=368

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/342 (74%), Positives = 301/342 (88%), Gaps = 1/342 (0%)
 Frame = -3

Query  1275  FGRAE-CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDII  1099
             F  A+  RAFFVFGDS+ DNGNN++L TTARAD PPYGID+PTH+ TGRFSNGLNIPDII
Sbjct  24    FAHAQPTRAFFVFGDSIADNGNNHFLLTTARADTPPYGIDFPTHKPTGRFSNGLNIPDII  83

Query  1098  SEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQ  919
             SE+LG+EPTLP LSP L GEKLLVGANFASAG+GILNDTG QF++II I  QL+ F+ YQ
Sbjct  84    SERLGLEPTLPYLSPLLIGEKLLVGANFASAGIGILNDTGFQFLDIIHIDKQLKLFDHYQ  143

Query  918   RRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYR  739
             +R+S  IGA EAK+LV+KA+VLI LGGNDFVNNYYLVPFSARSRQF++PDYV +LISEY+
Sbjct  144   QRLSAHIGAEEAKKLVHKAIVLIVLGGNDFVNNYYLVPFSARSRQFSLPDYVTYLISEYK  203

Query  738   KILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAEL  559
             K+L++LYDLG R+V+VTGTGP+GCVPAELA RSR G+C V+L RAA+L+NPQL +M+ EL
Sbjct  204   KVLKKLYDLGGRKVLVTGTGPMGCVPAELALRSRNGDCDVELVRAASLYNPQLVEMIKEL  263

Query  558   NSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRD  379
             N+E+ +DVF+AAN   MHMDFI NPQAFGFVTSK+ACCGQGPYNGIGLCT  SNLC NRD
Sbjct  264   NTEIGSDVFIAANARQMHMDFITNPQAFGFVTSKIACCGQGPYNGIGLCTPLSNLCQNRD  323

Query  378   IYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             +YAFWDPFHPSEKA+RIIVQ I +GS +YM+PMNLST++ +D
Sbjct  324   LYAFWDPFHPSEKASRIIVQQILTGSNEYMYPMNLSTVLAMD  365



>ref|XP_002325361.2| hypothetical protein POPTR_0019s04140g [Populus trichocarpa]
 gb|EEE99742.2| hypothetical protein POPTR_0019s04140g [Populus trichocarpa]
Length=364

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/357 (72%), Positives = 303/357 (85%), Gaps = 2/357 (1%)
 Frame = -3

Query  1314  GILLGL-LALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRAT  1138
             G++  L LAL  V   +AE RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYP+HR T
Sbjct  8     GVIFSLVLALKYVAL-QAEARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPSHRPT  66

Query  1137  GRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNII  958
             GRFSNGLNIPD+IS+++G E  LP LSP+L+G++LL GANFASAG+GILNDTGVQF+NII
Sbjct  67    GRFSNGLNIPDLISKRIGSESVLPYLSPELRGQRLLNGANFASAGIGILNDTGVQFINII  126

Query  957   RIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFT  778
             R+  QLEYF+EYQRR   L+G  + ++LV  ALVLIT+GGNDFVNNYYL+P+SARSRQF+
Sbjct  127   RMYRQLEYFQEYQRRARALVGVDQTERLVKGALVLITVGGNDFVNNYYLIPYSARSRQFS  186

Query  777   IPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAA  598
             +P+YV +LISEY KIL +LY LGARRV+VTGTGP+GCVPAELA RS  G C+ +LQRAA+
Sbjct  187   VPNYVKYLISEYEKILMKLYKLGARRVLVTGTGPMGCVPAELAMRSTNGGCSAELQRAAS  246

Query  597   LFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIG  418
             LFNPQL QML  LN ++   VF+AANT   H+DFI NPQA+GF T+K ACCGQGPYNG+G
Sbjct  247   LFNPQLVQMLKGLNKKIGNTVFIAANTQQSHLDFISNPQAYGFTTAKTACCGQGPYNGLG  306

Query  417   LCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             LCT ASNLCPNRD+YAFWD FHPSEKANR+IV+ I+SG+T YM PMNLSTIM LD+R
Sbjct  307   LCTAASNLCPNRDLYAFWDAFHPSEKANRLIVEQIYSGTTKYMDPMNLSTIMTLDAR  363



>gb|KHN14896.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/356 (74%), Positives = 304/356 (85%), Gaps = 2/356 (1%)
 Frame = -3

Query  1305  LGLLALTIVFFG-RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGR  1132
             L LL + I+  G  A  RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYP THR TGR
Sbjct  15    LVLLVVGIIVSGVEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPPTHRPTGR  74

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD+IS++LG E TLP LSP+L+G+KLLVGANFASAG+GILNDTGVQF+N+IR+
Sbjct  75    FSNGYNIPDLISQRLGAESTLPYLSPELRGDKLLVGANFASAGIGILNDTGVQFVNVIRM  134

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF+EYQ RVS +IGA EAK LV +ALVLIT+GGNDFVNNY+LVP SARS+Q+ +P
Sbjct  135   YRQLEYFKEYQNRVSAIIGASEAKNLVKQALVLITVGGNDFVNNYFLVPNSARSQQYPLP  194

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
              YV +LISEY+K+LQRLYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AAALF
Sbjct  195   AYVKYLISEYQKLLQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALF  254

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QML +LN ++  DVF+AANT   H DF+ NPQ FGFVTS+VACCGQGPYNGIGLC
Sbjct  255   NPQLEQMLLQLNRKIATDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGIGLC  314

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLC NRD YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LDS T
Sbjct  315   TALSNLCSNRDQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDSNT  370



>ref|XP_010940685.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Elaeis guineensis]
Length=364

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/339 (75%), Positives = 294/339 (87%), Gaps = 0/339 (0%)
 Frame = -3

Query  1260  CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGM  1081
              RAFFVFGDSLVDNGNNNYLATTARAD PPYGID PT R TGRFSNGLN+PDIISE LG 
Sbjct  26    ARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDSPTRRPTGRFSNGLNVPDIISENLGS  85

Query  1080  EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDL  901
             EP +P LSP+L+GEKLLVGANFASAGVGILNDTG+QF+NIIRI NQL YF++YQ+R+S L
Sbjct  86    EPLMPYLSPELRGEKLLVGANFASAGVGILNDTGIQFVNIIRIWNQLHYFQQYQQRLSSL  145

Query  900   IGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRL  721
             IG  + + LVN+ LVLITLGGNDFVNNYYLVP+S RSRQFT+PDYV +L+SEY+KIL  L
Sbjct  146   IGPEQTQSLVNQGLVLITLGGNDFVNNYYLVPYSLRSRQFTLPDYVTYLMSEYKKILAGL  205

Query  720   YDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKA  541
             Y+LGARRV+VTGTGP+GCVPAELA RSR G+C  +L RA+ LFNPQL Q+L ELN ++ +
Sbjct  206   YELGARRVLVTGTGPLGCVPAELALRSRTGQCDPELNRASNLFNPQLIQVLNELNGQIGS  265

Query  540   DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWD  361
             DVFV+ N Y MHMDFI +PQA+GFVTSKVACCGQGPYNGIGLCT  SN+CPNR+IYAFWD
Sbjct  266   DVFVSVNVYTMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTVLSNVCPNRNIYAFWD  325

Query  360   PFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
              FHP+E+ANR++V    +G+T YM PMNLSTI+ +DSRT
Sbjct  326   AFHPTERANRMLVSQFMAGTTKYMSPMNLSTILAMDSRT  364



>ref|XP_006443291.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 ref|XP_006478981.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Citrus sinensis]
 gb|ESR56531.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 gb|KDO52502.1| hypothetical protein CISIN_1g017181mg [Citrus sinensis]
Length=376

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/342 (74%), Positives = 298/342 (87%), Gaps = 1/342 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             AE RAFFVFGDSLVD+GNNNYLATTARAD PPYGID+PTHR TGRFSNG NIPDIIS+++
Sbjct  34    AEGRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDFPTHRPTGRFSNGFNIPDIISQRI  93

Query  1086  GM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             G  E  LP LSP+L G++LL+GANFASAG+GILNDTG+QF+NIIR+  QL+YF EYQRRV
Sbjct  94    GQSEAPLPYLSPELNGQRLLIGANFASAGIGILNDTGIQFVNIIRMFRQLDYFAEYQRRV  153

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S +IGA +A+QLVN+ALVLIT+GGNDFVNNYYLVP+SARSRQFT+P+YV ++ISEYRK+L
Sbjct  154   SAVIGAQQARQLVNRALVLITVGGNDFVNNYYLVPYSARSRQFTLPNYVKYIISEYRKLL  213

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY+LGARRV+VTGTGP+GCVPAELA R   G C+ +LQRA +L+NPQL QML  +N +
Sbjct  214   MRLYELGARRVLVTGTGPLGCVPAELALRGSNGGCSAELQRATSLYNPQLEQMLQGINRK  273

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             +   VF+AANT   HMDF+ NPQA+GF T+KVACCGQGP NG+GLCT  SNLCPNR +YA
Sbjct  274   IGQTVFIAANTQQTHMDFVSNPQAYGFTTAKVACCGQGPNNGLGLCTALSNLCPNRQLYA  333

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWDPFHPSEKANR+IV+ IFSGST+YM PMNLST+M LDS T
Sbjct  334   FWDPFHPSEKANRLIVEQIFSGSTNYMTPMNLSTVMALDSLT  375



>ref|XP_010485798.1| PREDICTED: GDSL esterase/lipase LTL1-like [Camelina sativa]
Length=392

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/355 (74%), Positives = 294/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  35    GFLISLFFIVTFLAPQVKSRAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  94

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  95    RFSNGLNIPDIISEAIGMPSTLPYLSPQLTGENLLVGANFASAGIGILNDTGIQFINIIR  154

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q EYFE+YQ+RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQF +
Sbjct  155   IFKQFEYFEQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFAL  214

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL+RLY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  215   PDYVVYLISEYAKILRRLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  274

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNP+L  ++A +N+E+  DVFVAAN+Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  275   FNPRLVDLIASVNAEIGQDVFVAANSYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGL  334

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRDIYAFWD FHP+EKANRIIV  I +GS  YMHPMNLST M LDS
Sbjct  335   CTPVSNLCPNRDIYAFWDAFHPTEKANRIIVNQILTGSAKYMHPMNLSTAMLLDS  389



>ref|XP_010463906.1| PREDICTED: GDSL esterase/lipase LTL1 [Camelina sativa]
Length=366

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/355 (74%), Positives = 294/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GFLISLFFIVTFLAPQVKSRAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEAIGMPSTLPYLSPQLTGENLLVGANFASAGIGILNDTGIQFINIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q EYFE+YQ+RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQF +
Sbjct  129   IFKQFEYFEQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFAL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL+RLY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYAKILRRLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNP+L  ++A +N+E+  DVFVAAN+Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPRLVDLIASVNAEIGQDVFVAANSYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRDIYAFWD FHP+EKANRIIV  I +GS  YMHPMNLST M LDS
Sbjct  309   CTPVSNLCPNRDIYAFWDAFHPTEKANRIIVNQILTGSAKYMHPMNLSTAMLLDS  363



>gb|KCW61461.1| hypothetical protein EUGRSUZ_H04197 [Eucalyptus grandis]
Length=373

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/368 (71%), Positives = 306/368 (83%), Gaps = 6/368 (2%)
 Frame = -3

Query  1332  WLPNNHGILLGLLALTIVFFGRAEC------RAFFVFGDSLVDNGNNNYLATTARADGPP  1171
             +L ++   +L ++ L  V  G   C      RAFFVFGDSLVDNGNNNYL TTARAD PP
Sbjct  4     FLHSSPTTVLAVIILAKVMMGTFLCPSAEAARAFFVFGDSLVDNGNNNYLVTTARADSPP  63

Query  1170  YGIDYPTHRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGIL  991
             YGIDYPT + TGRFSNG N+PD IS++LG E TLP LSP+L G+KLLVGANFASAG+GIL
Sbjct  64    YGIDYPTGQPTGRFSNGFNVPDFISQELGSESTLPYLSPELTGQKLLVGANFASAGIGIL  123

Query  990   NDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYL  811
             NDTG QF+NII +  QL+YFEEYQ+RVS L+GA   +QLVN+ALVLIT+GGNDFVNNY+L
Sbjct  124   NDTGTQFINIIGMYTQLQYFEEYQKRVSALVGAERTQQLVNQALVLITVGGNDFVNNYFL  183

Query  810   VPFSARSRQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAG  631
             VP+SARSRQFTIP+Y  +LISEYRK+L+RLY+LGARRV+VTGTGP+GCVPAELA R R G
Sbjct  184   VPYSARSRQFTIPEYAKYLISEYRKLLERLYELGARRVLVTGTGPLGCVPAELALRGRNG  243

Query  630   ECAVDLQRAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVA  451
             +CA +LQ+AA+LFNPQLTQML  LN E  + VF+AANT  MH DFI +PQA+GFVTSKVA
Sbjct  244   QCAPELQQAASLFNPQLTQMLQGLNQEYGSPVFIAANTDLMHGDFISDPQAYGFVTSKVA  303

Query  450   CCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLS  271
             CCGQGPYNGIGLCT AS+LC NRD YAFWDPFHPS+KAN++IVQ I  GS +YM+PMNLS
Sbjct  304   CCGQGPYNGIGLCTTASDLCTNRDQYAFWDPFHPSQKANKLIVQSIMKGSAEYMYPMNLS  363

Query  270   TIMELDSR  247
             TI+ LDS 
Sbjct  364   TILALDSH  371



>ref|XP_002265999.1| PREDICTED: GDSL esterase/lipase At4g28780 [Vitis vinifera]
 emb|CBI37236.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/339 (74%), Positives = 296/339 (87%), Gaps = 1/339 (0%)
 Frame = -3

Query  1260  CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGM  1081
              RAFF+FGDSLV+ GNNNYLATTARAD PPYGIDYPTH+ATGRFSNGLNIPDIISE+LG 
Sbjct  30    ARAFFIFGDSLVEQGNNNYLATTARADSPPYGIDYPTHQATGRFSNGLNIPDIISEQLGA  89

Query  1080  EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDL  901
             E TLP LSP L G+KLLVGANFASAG+GILNDTG+QF+NIIRI  QLE+F++YQ+RVS L
Sbjct  90    ESTLPYLSPQLTGQKLLVGANFASAGIGILNDTGIQFLNIIRISRQLEFFQQYQQRVSAL  149

Query  900   IGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRL  721
             IG  + ++LVN+ALVLITLGGNDFVNNY+L P S RSRQ ++PDY  ++ISEYRKIL +L
Sbjct  150   IGEEQTQRLVNQALVLITLGGNDFVNNYFL-PLSLRSRQMSLPDYSRYVISEYRKILMKL  208

Query  720   YDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKA  541
             Y+LGARRV+VTGTGP+GCVPAELA     G+CA + QRAAA+FNPQL +M   LNSEL +
Sbjct  209   YELGARRVLVTGTGPLGCVPAELAMSRSNGQCAEEPQRAAAIFNPQLIEMAQGLNSELGS  268

Query  540   DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWD  361
             ++F+ AN + MHMDFI +PQ +GFVTSKVACCGQGPYNG+G CT ASNLCPNR+IYAFWD
Sbjct  269   NIFITANAFEMHMDFITDPQLYGFVTSKVACCGQGPYNGLGFCTLASNLCPNRNIYAFWD  328

Query  360   PFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             P+HP+E+ANR+IVQ I SGS+ YM+PMNLSTIME+DSRT
Sbjct  329   PYHPTERANRLIVQQIMSGSSKYMNPMNLSTIMEMDSRT  367



>gb|AAS75127.1| GDSL-motif lipase [Agave americana]
Length=367

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/352 (72%), Positives = 300/352 (85%), Gaps = 0/352 (0%)
 Frame = -3

Query  1299  LLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             L+A+  +       RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPTHR TGRFSNG
Sbjct  16    LVAVGTLSASSLAARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTHRPTGRFSNG  75

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
             LNIPDIISE LG E TLP LSPDL+G++LLVGANFASAG+GILNDTG+QF+NIIRI  Q+
Sbjct  76    LNIPDIISEHLGAEATLPYLSPDLRGQRLLVGANFASAGIGILNDTGIQFINIIRISRQM  135

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
             +YFE+YQ+RVS LIG  + ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++PD+V 
Sbjct  136   QYFEQYQQRVSALIGQAQMRRLVNRALVLITLGGNDFVNNYYLVPFSARSRQFSLPDFVR  195

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQL  580
             ++ISEY+KIL RLY+LGAR+V+VTGTGP+GCVP+ELAQRSR G C  +LQRA  LFNPQL
Sbjct  196   YVISEYKKILARLYELGARQVLVTGTGPLGCVPSELAQRSRDGNCDPELQRAGDLFNPQL  255

Query  579   TQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQAS  400
              Q+L +LNS+  + VF+ ANT   HMDFI  PQ +GF+TSKVACCGQGPYNGIGLCT AS
Sbjct  256   VQILNQLNSQFGSTVFLGANTRRAHMDFISYPQRYGFITSKVACCGQGPYNGIGLCTVAS  315

Query  399   NLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             NLCPNRD+YAFWD FHP++KANRIIV    +GS +YM PMN+++++ ++  T
Sbjct  316   NLCPNRDLYAFWDAFHPTQKANRIIVSQFMTGSNEYMTPMNVTSLLAMNDST  367



>gb|EYU33157.1| hypothetical protein MIMGU_mgv1a008646mg [Erythranthe guttata]
Length=367

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/343 (78%), Positives = 305/343 (89%), Gaps = 1/343 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             R E RAFFVFGDSLVD+GNNNYLATTARAD PPYGID P+HRA+GRFSNGLNIPD+IS+ 
Sbjct  25    RVEGRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDSPSHRASGRFSNGLNIPDLISQS  84

Query  1089  LGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRR  913
             +G  EP LP LSP L G +LLVGANFASAGVGILNDTGVQF+NIIRIG QL+YF++YQ+R
Sbjct  85    IGASEPPLPYLSPALYGSRLLVGANFASAGVGILNDTGVQFVNIIRIGQQLQYFQQYQQR  144

Query  912   VSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKI  733
             +S LIG GE ++LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF +PDYVP+LISEY+KI
Sbjct  145   ISGLIGPGETQRLVNQALVLITLGGNDFVNNYYLVPFSARSRQFALPDYVPYLISEYQKI  204

Query  732   LQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNS  553
             L RLY+LGARRV+VTGTGP+GCVPAELAQR R G+CA DLQ+A+ALFNPQLTQM+  LN+
Sbjct  205   LLRLYELGARRVLVTGTGPLGCVPAELAQRGRNGQCAPDLQQASALFNPQLTQMILGLNA  264

Query  552   ELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIY  373
             +L  +VF+AANT   H +FI NPQ FGFVTSKVACCGQGPYNG+GLCT  SNLCPNRDIY
Sbjct  265   QLGDNVFIAANTQLTHYNFISNPQDFGFVTSKVACCGQGPYNGLGLCTALSNLCPNRDIY  324

Query  372   AFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             AFWD FHPSE+ANR+IV  IF+GS +YM+PMNLSTIM LDSRT
Sbjct  325   AFWDAFHPSERANRLIVSQIFTGSVEYMNPMNLSTIMALDSRT  367



>ref|XP_003521785.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/359 (72%), Positives = 301/359 (84%), Gaps = 7/359 (2%)
 Frame = -3

Query  1302  GLLALTIVFFG-------RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHR  1144
             GL+++ IV FG        A+ RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT R
Sbjct  6     GLVSMLIVLFGMVLVVGVEAKARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRR  65

Query  1143  ATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMN  964
              TGRFSNGLNIPD+ISE++G E  LP LSP LKGE LL GANFASAG+GILNDTG QF+N
Sbjct  66    PTGRFSNGLNIPDLISERIGGESVLPYLSPQLKGENLLNGANFASAGIGILNDTGSQFLN  125

Query  963   IIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQ  784
             IIR+  QL+YFEEYQ+RVS LIG   AK+LVN+ALVLIT+GGNDFVNNYYLVP+SARSRQ
Sbjct  126   IIRMYRQLDYFEEYQQRVSILIGVARAKKLVNQALVLITVGGNDFVNNYYLVPYSARSRQ  185

Query  783   FTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRA  604
             +++ DYV FLI EYRK+L RLYDLGARRVIVTGTGP+GCVPAELA R   G C+ +LQRA
Sbjct  186   YSLQDYVKFLIVEYRKLLMRLYDLGARRVIVTGTGPMGCVPAELAMRGTNGGCSAELQRA  245

Query  603   AALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNG  424
             A+L+NPQLT M+  LN ++  DVF+AANT  MH DF+ NP A+GF TS++ACCGQGPYNG
Sbjct  246   ASLYNPQLTHMIQGLNKKIGKDVFIAANTALMHNDFVSNPAAYGFTTSQIACCGQGPYNG  305

Query  423   IGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             IGLCT  S+LCPNR+++AFWDPFHPSEK+NR+IV+ I SGS  YM PMNLST++ LD+R
Sbjct  306   IGLCTPLSDLCPNRNLHAFWDPFHPSEKSNRLIVEQIMSGSKRYMKPMNLSTVISLDAR  364



>ref|XP_011002017.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Populus euphratica]
Length=364

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/361 (71%), Positives = 303/361 (84%), Gaps = 2/361 (1%)
 Frame = -3

Query  1326  PNNHGILLGL-LALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPT  1150
             P+  G++L L LAL  V   +AE RAFFVFGDSLVD+GNNNYL TTARAD PPYGIDYPT
Sbjct  4     PSIVGVILSLVLALKYVAL-QAEARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPT  62

Query  1149  HRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQF  970
             HR TGRFSNGLNIPD+IS+++G E  LP LSP L+G++LL GANFASAG+GILNDTGVQF
Sbjct  63    HRPTGRFSNGLNIPDLISKRIGSESVLPYLSPALRGQRLLNGANFASAGIGILNDTGVQF  122

Query  969   MNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARS  790
             +NIIR+  QLEYF+EYQRR   L+G  + K+LV  ALVLIT+GGNDFVNNYYL+P+SARS
Sbjct  123   INIIRMYRQLEYFQEYQRRARALVGVDQTKRLVKGALVLITVGGNDFVNNYYLIPYSARS  182

Query  789   RQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQ  610
             RQF++P+YV +LISEY K+L +LY LGARRV+VTGTGP+GCVPAELA R   G C+ +LQ
Sbjct  183   RQFSVPNYVKYLISEYEKLLMKLYKLGARRVLVTGTGPMGCVPAELAMRGTNGGCSAELQ  242

Query  609   RAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPY  430
             RAA+L+NPQL QML  LN ++   VFVAANT   H+DFI NP+A+GF T+K ACCGQGPY
Sbjct  243   RAASLYNPQLVQMLKGLNKKIGKTVFVAANTQQSHLDFISNPRAYGFTTTKRACCGQGPY  302

Query  429   NGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             NG+GLCT ASNLCPNRD+YAFWD FHPSEKANR+IV+ I+SG+T YM PMNLSTIM LD+
Sbjct  303   NGLGLCTAASNLCPNRDLYAFWDAFHPSEKANRLIVEQIYSGTTKYMDPMNLSTIMTLDA  362

Query  249   R  247
             R
Sbjct  363   R  363



>ref|XP_010413520.1| PREDICTED: GDSL esterase/lipase LTL1 [Camelina sativa]
Length=366

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/355 (73%), Positives = 294/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G ++ L  +      + + RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GFIISLFFIVTFLAPQVKSRAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEAIGMPSTLPYLSPQLTGENLLVGANFASAGIGILNDTGIQFINIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q EYFE+YQ+RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQF +
Sbjct  129   IFKQFEYFEQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFAL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL+RLY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYAKILRRLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNP+L  ++A +N+E+  DVFVAAN+Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPRLVDLIASVNAEIGQDVFVAANSYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I +GS  YMHPMNLST M LDS
Sbjct  309   CTPVSNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSAKYMHPMNLSTAMLLDS  363



>ref|XP_003553269.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/356 (74%), Positives = 304/356 (85%), Gaps = 2/356 (1%)
 Frame = -3

Query  1305  LGLLALTIVFFG-RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGR  1132
             L LL + I+  G  A  RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYP +HR TGR
Sbjct  15    LVLLVVGIIVSGVEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGR  74

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD+IS++LG E TLP LSP+L+G+KLLVGANFASAG+GILNDTGVQF+N+IR+
Sbjct  75    FSNGYNIPDLISQRLGAESTLPYLSPELRGDKLLVGANFASAGIGILNDTGVQFVNVIRM  134

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF+EYQ RVS +IGA EAK LV +ALVLIT+GGNDFVNNY+LVP SARS+Q+ +P
Sbjct  135   YRQLEYFKEYQNRVSAIIGASEAKNLVKQALVLITVGGNDFVNNYFLVPNSARSQQYPLP  194

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
              YV +LISEY+K+LQRLYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AAALF
Sbjct  195   AYVKYLISEYQKLLQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALF  254

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QML +LN ++  DVF+AANT   H DF+ NPQ FGFVTS+VACCGQGPYNGIGLC
Sbjct  255   NPQLEQMLLQLNRKIATDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGIGLC  314

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLC NR+ YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  315   TALSNLCSNREQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDAIT  370



>ref|XP_010024922.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Eucalyptus grandis]
Length=352

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/337 (76%), Positives = 294/337 (87%), Gaps = 0/337 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPT + TGRFSNG N+PD IS++LG E
Sbjct  14    RAFFVFGDSLVDNGNNNYLVTTARADSPPYGIDYPTGQPTGRFSNGFNVPDFISQELGSE  73

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
              TLP LSP+L G+KLLVGANFASAG+GILNDTG QF+NII +  QL+YFEEYQ+RVS L+
Sbjct  74    STLPYLSPELTGQKLLVGANFASAGIGILNDTGTQFINIIGMYTQLQYFEEYQKRVSALV  133

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             GA   +QLVN+ALVLIT+GGNDFVNNY+LVP+SARSRQFTIP+Y  +LISEYRK+L+RLY
Sbjct  134   GAERTQQLVNQALVLITVGGNDFVNNYFLVPYSARSRQFTIPEYAKYLISEYRKLLERLY  193

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             +LGARRV+VTGTGP+GCVPAELA R R G+CA +LQ+AA+LFNPQLTQML  LN E  + 
Sbjct  194   ELGARRVLVTGTGPLGCVPAELALRGRNGQCAPELQQAASLFNPQLTQMLQGLNQEYGSP  253

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AANT  MH DFI +PQA+GFVTSKVACCGQGPYNGIGLCT AS+LC NRD YAFWDP
Sbjct  254   VFIAANTDLMHGDFISDPQAYGFVTSKVACCGQGPYNGIGLCTTASDLCTNRDQYAFWDP  313

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FHPS+KAN++IVQ I  GS +YM+PMNLSTI+ LDS 
Sbjct  314   FHPSQKANKLIVQSIMKGSAEYMYPMNLSTILALDSH  350



>ref|NP_187079.1| Li-tolerant lipase 1 [Arabidopsis thaliana]
 sp|Q9M8Y5.1|LTL1_ARATH RecName: Full=GDSL esterase/lipase LTL1; AltName: Full=Extracellular 
lipase LTL1; AltName: Full=Lithium-tolerant lipase 1; 
Short=AtLTL1; Short=Li-tolerant lipase 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF26785.1|AC016829_9 putative GDSL-motif lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AAM61681.1| putative GDSL-motif lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AEE74063.1| Li-tolerant lipase 1 [Arabidopsis thaliana]
Length=366

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/355 (73%), Positives = 294/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GFLISLFFIVTFLAPQVKSRAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEAIGMPSTLPYLSPHLTGENLLVGANFASAGIGILNDTGIQFVNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q+EYFE+YQ RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQ+ +
Sbjct  129   ISKQMEYFEQYQLRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQYAL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL++LY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL  ++A +N+E+  DVFVAAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPQLVDLIASVNAEIGQDVFVAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I +GS+ YMHPMNLST M LDS
Sbjct  309   CTPVSNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTAMLLDS  363



>ref|XP_009348740.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=361

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/357 (73%), Positives = 299/357 (84%), Gaps = 1/357 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
              I   ++AL ++  G AE RAFFVFGDSLVDNGNNNYLAT+ARAD PPYGIDYP  + TG
Sbjct  6     AIFCVVMALGMLSCG-AEARAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPNRQPTG  64

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGL IPD IS+ LG EPTLP LSP L G+KLLVGANFASAG+GILNDTGVQF NIIR
Sbjct  65    RFSNGLTIPDYISQNLGAEPTLPYLSPQLTGQKLLVGANFASAGIGILNDTGVQFANIIR  124

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  QL  F++YQ+R+S  IG    KQLVN+ALVL+T+GGNDFVNNYYLVPFSARSRQF++
Sbjct  125   MPLQLLNFQQYQQRLSAQIGPQRTKQLVNQALVLLTVGGNDFVNNYYLVPFSARSRQFSL  184

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISE RKIL ++YDLG RRV+VTGTGP+GCVPAELA RSR GECA +LQRA+AL
Sbjct  185   PDYVKYLISELRKILLKMYDLGVRRVLVTGTGPMGCVPAELAMRSRNGECAAELQRASAL  244

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQL QML  +NS+L +DVFVAAN      DFI NPQAFGF TSK+ACCGQGPYNG+GL
Sbjct  245   YNPQLIQMLRSVNSQLGSDVFVAANIQETRNDFIRNPQAFGFTTSKIACCGQGPYNGLGL  304

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT+ASNLCPNRD+YAFWD FHPSEK NR+IV+ I +G   YM+PMNLSTI+ LDSRT
Sbjct  305   CTRASNLCPNRDLYAFWDAFHPSEKGNRLIVENILTGDEKYMYPMNLSTILALDSRT  361



>gb|KDO52498.1| hypothetical protein CISIN_1g017684mg [Citrus sinensis]
Length=368

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/336 (75%), Positives = 290/336 (86%), Gaps = 0/336 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGRFSNGLNIPD IS+ +G EPT
Sbjct  33    FFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDFISQHIGSEPT  92

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSP+L G +LLVGANFASAG+GILNDTG+QF+NIIR+  Q EYF+EYQ RV+ LIG 
Sbjct  93    LPYLSPELTGSRLLVGANFASAGIGILNDTGIQFVNIIRMFRQFEYFQEYQNRVTALIGP  152

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
                KQLVN AL+LIT+GGNDFVNNYYLVP+SARSRQF++PDYV ++ISEYRK+L RLYDL
Sbjct  153   QRTKQLVNGALILITVGGNDFVNNYYLVPYSARSRQFSLPDYVKYVISEYRKLLTRLYDL  212

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             GARRV+VTGTGP+GCVPAE A R R G+CA DLQRAA L+NPQL Q++ +LNS+  +++F
Sbjct  213   GARRVLVTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQLVKDLNSQYGSEIF  272

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             VA NT  M  +FI NP+AFGF TSKVACCGQGPYNG+GLCT ASNLCPNR +YAFWDPFH
Sbjct  273   VAVNTGKMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNLCPNRAVYAFWDPFH  332

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             PSE+AN  IVQ   +GST+YM+PMNLSTIM LDSRT
Sbjct  333   PSERANGFIVQEFMTGSTEYMYPMNLSTIMALDSRT  368



>ref|XP_007030301.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY10803.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=370

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/356 (72%), Positives = 306/356 (86%), Gaps = 2/356 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             +L+ LLAL  +    AE RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYP+ R TGR
Sbjct  15    VLVFLLALESIA-PLAEARAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPSRRPTGR  73

Query  1131  FSNGLNIPDIISEKLGM-EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             FSNGLNIPD+I E++G+ E  LP LSP+  G+K+LVGANFASAGVGILNDTGVQF+NIIR
Sbjct  74    FSNGLNIPDLIGEQIGLSESPLPYLSPEFNGQKMLVGANFASAGVGILNDTGVQFVNIIR  133

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  QLEYF+EY+RR++ L+G+ +A QLV++ALVLIT+GGNDFVNNYYLVP+SARSRQ+ +
Sbjct  134   MSGQLEYFKEYKRRLTALVGSKQAHQLVSQALVLITVGGNDFVNNYYLVPYSARSRQYKL  193

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV FLISEYR++L RLY LGARRV+VTGTGP+GCVPAELA R   G C+ +LQRAA+L
Sbjct  194   PDYVKFLISEYRRLLMRLYKLGARRVLVTGTGPMGCVPAELAMRGTNGGCSEELQRAASL  253

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQL QML  LN  +  DVFV+ANT  MH DF+ +P+AFGF TS++ACCGQGPYNG+GL
Sbjct  254   YNPQLAQMLNGLNKNIGRDVFVSANTQKMHNDFVSDPRAFGFTTSQIACCGQGPYNGLGL  313

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             CT+ SNLCPNR +YAFWDPFHPSEKANR+IVQ I +GST+YM+PMNL+TIM LDSR
Sbjct  314   CTRLSNLCPNRALYAFWDPFHPSEKANRLIVQQIMTGSTEYMNPMNLTTIMALDSR  369



>ref|XP_009379724.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Pyrus x bretschneideri]
Length=363

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/357 (74%), Positives = 309/357 (87%), Gaps = 2/357 (1%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G+L+ ++AL ++ +  AE RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TG
Sbjct  9     GVLM-IMALGMLSY-EAEARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTGRPTG  66

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD IS++LG EPTLP LSP+L G+KLLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  67    RFSNGLNIPDFISQQLGAEPTLPYLSPELTGQKLLVGANFASAGIGILNDTGIQFINIIR  126

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  Q EYF++YQ+R+S LIG    KQLVN+ALVL+T+GGNDFVNNYYLVPFSARSRQF +
Sbjct  127   MTRQFEYFQQYQQRLSSLIGPQRTKQLVNQALVLLTVGGNDFVNNYYLVPFSARSRQFAL  186

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISE RK+L ++YDLGARRV+VTGTGP+GCVPAELA RSR GEC+ +LQRAA+L
Sbjct  187   PDYVRYLISELRKLLLKMYDLGARRVLVTGTGPLGCVPAELAMRSRNGECSAELQRAASL  246

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQL QML  +NS+L +DVF+AANT   H DF+ NPQAFGF TSK+ACCGQGPYNG+GL
Sbjct  247   YNPQLIQMLKSVNSQLGSDVFIAANTQQTHNDFVSNPQAFGFSTSKIACCGQGPYNGLGL  306

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLCPNR+ YAFWD FHPSEKAN++IVQ I  G   YM+PMNLSTI+ LDSRT
Sbjct  307   CTVASNLCPNRNQYAFWDAFHPSEKANKLIVQNILKGDEKYMYPMNLSTILALDSRT  363



>ref|XP_009389128.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/332 (76%), Positives = 295/332 (89%), Gaps = 0/332 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVDNGNNNYLATTARAD PPYGID P+HR +GRFSNG NIPDI+SE+LG E
Sbjct  31    RAFFVFGDSLVDNGNNNYLATTARADAPPYGIDTPSHRPSGRFSNGRNIPDIMSEQLGAE  90

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
              TLP LSP+L+GEKLLVGANFASAG+GILNDTG+QF+NIIRI  QL+YFEEYQ+++SDLI
Sbjct  91    TTLPYLSPELRGEKLLVGANFASAGIGILNDTGIQFVNIIRINRQLQYFEEYQKKLSDLI  150

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             GA +A+  VN+ALVLITLGGNDFVNNYYL+P+S RSRQF +PDYV +LISEY KILQRLY
Sbjct  151   GASQAEMRVNQALVLITLGGNDFVNNYYLIPYSFRSRQFALPDYVRYLISEYYKILQRLY  210

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             DLGARRVIVTGTGP+GCVPAELA R R G+C  +LQRAA LFNPQL Q+L  LNS++ +D
Sbjct  211   DLGARRVIVTGTGPLGCVPAELALRGRNGQCDSELQRAAGLFNPQLVQILNRLNSKIGSD  270

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VFV+AN + MHM+++ NPQAFGF TSK+ACCGQGPYNGIGLC  ASNLCP+RD YAFWDP
Sbjct  271   VFVSANAFGMHMNYVANPQAFGFTTSKIACCGQGPYNGIGLCNAASNLCPDRDKYAFWDP  330

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIM  262
             +HP+E+A RI+V  + +GST++M+PMNLSTI+
Sbjct  331   YHPTERACRIVVSHMMTGSTEFMNPMNLSTIL  362



>ref|XP_003553249.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/356 (74%), Positives = 302/356 (85%), Gaps = 2/356 (1%)
 Frame = -3

Query  1305  LGLLALTIVFFG-RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGR  1132
             L LL + I+  G  A  RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYP +HR TGR
Sbjct  15    LVLLVVGIIVSGVEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGR  74

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD+IS++LG E TLP LSP+L+G+KLLVGANFASAG+GILNDTGVQF+N+IR+
Sbjct  75    FSNGYNIPDLISQRLGAESTLPYLSPELRGDKLLVGANFASAGIGILNDTGVQFVNVIRM  134

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF+EYQ RVS +IGA EAK LV +ALVLIT+GGNDFVNNY+LVP SARS+Q+ +P
Sbjct  135   YRQLEYFKEYQNRVSAIIGASEAKNLVKQALVLITVGGNDFVNNYFLVPNSARSQQYPLP  194

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
              YV +LISEY+K+LQRLYDLGARRV+VTGTGP+ CVP+ELAQR R G+CA +LQ+AAALF
Sbjct  195   AYVKYLISEYQKLLQRLYDLGARRVLVTGTGPLACVPSELAQRGRNGQCAPELQQAAALF  254

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QML +LN ++  DVF+AANT   H DF+ N Q FGFVTS+VACCGQGPYNGIGLC
Sbjct  255   NPQLEQMLLQLNRKIATDVFIAANTGKAHNDFVTNAQQFGFVTSQVACCGQGPYNGIGLC  314

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLC NRD YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LDS T
Sbjct  315   TALSNLCSNRDQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDSNT  370



>ref|XP_003554997.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/356 (73%), Positives = 304/356 (85%), Gaps = 2/356 (1%)
 Frame = -3

Query  1305  LGLLALTIVFFG-RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGR  1132
             L LL + I+  G  A  RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYP THR TGR
Sbjct  15    LVLLVVGIIVSGVEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPPTHRPTGR  74

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD+IS++LG E TLP LSP+L+G+KLLVGANFASAG+GILNDTGVQF+N+IR+
Sbjct  75    FSNGYNIPDLISQRLGAESTLPYLSPELRGDKLLVGANFASAGIGILNDTGVQFVNVIRM  134

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF+EYQ RVS +IGA EAK LV +ALVLIT+GGNDFVNNY+LVP SARS+Q+ +P
Sbjct  135   YRQLEYFKEYQNRVSAIIGASEAKNLVKQALVLITVGGNDFVNNYFLVPNSARSQQYPLP  194

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
              YV +LISEY+K+LQRLYDLGARRV+VTGTGP+GCVP+ELAQR R G+C  +LQ+AAALF
Sbjct  195   AYVKYLISEYQKLLQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCVPELQQAAALF  254

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QML +LN ++ +DVF+AANT   H DF+ NPQ FGFVTS+VACCGQGPYNG+GLC
Sbjct  255   NPQLEQMLLQLNRKIGSDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGLGLC  314

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLC NR+ YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  315   TALSNLCSNREQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDANT  370



>ref|XP_006478980.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
Length=368

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/336 (75%), Positives = 291/336 (87%), Gaps = 0/336 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGRFSNGLNIPD IS+ +G EPT
Sbjct  33    FFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDFISQHIGSEPT  92

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSP+L G +LLVGANFASAG+GILNDTG+QF+NIIR+  Q EYF+EYQ RV+ LIG 
Sbjct  93    LPYLSPELTGSRLLVGANFASAGIGILNDTGIQFVNIIRMFRQFEYFQEYQNRVTALIGP  152

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
                KQLVN AL+LIT+GGNDFVNNYYLVP+SARSRQF++PDYV ++ISEYRK+L RL+DL
Sbjct  153   QRTKQLVNGALILITVGGNDFVNNYYLVPYSARSRQFSLPDYVKYVISEYRKLLTRLHDL  212

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             GARRV+VTGTGP+GCVPAE A R R G+CA DLQRAA L+NPQL Q++ +LNS+  +++F
Sbjct  213   GARRVLVTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQLVKDLNSQYGSEIF  272

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             VA NT  M  +FI NP+AFGF TSKVACCGQGPYNG+GLCT ASNLCPNR++YAFWDPFH
Sbjct  273   VAVNTGKMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNLCPNRNVYAFWDPFH  332

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             PSE+AN  IVQ   +GST+YM+PMNLSTIM LDSRT
Sbjct  333   PSERANGFIVQEFMTGSTEYMYPMNLSTIMALDSRT  368



>ref|XP_009134760.1| PREDICTED: GDSL esterase/lipase LTL1 [Brassica rapa]
Length=366

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/355 (73%), Positives = 295/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GFLISLFFIVTFLAPQVKSRAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE LGM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEALGMPSTLPYLSPQLTGENLLVGANFASAGIGILNDTGIQFVNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q EYFE+Y++RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQF +
Sbjct  129   ISKQFEYFEQYRQRVSALIGPEATQQLVNRALVLITLGGNDFVNNYYLIPFSARSRQFAL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL++LY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNP+L  ++A +N+E+  +VFVAAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPRLVDLIASVNAEIGQEVFVAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I +GS+ YMHPMNLST+M LDS
Sbjct  309   CTPISNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>ref|XP_006443290.1| hypothetical protein CICLE_v10020515mg [Citrus clementina]
 gb|ESR56530.1| hypothetical protein CICLE_v10020515mg [Citrus clementina]
Length=392

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/336 (75%), Positives = 291/336 (87%), Gaps = 0/336 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TGRFSNGLNIPD IS+ +G EPT
Sbjct  57    FFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDFISQHIGSEPT  116

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSP+L G +LLVGANFASAG+GILNDTG+QF+NIIR+  Q EYF+EYQ RV+ LIG 
Sbjct  117   LPYLSPELTGSRLLVGANFASAGIGILNDTGIQFVNIIRMFRQFEYFQEYQNRVTALIGP  176

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
                KQLVN AL+LIT+GGNDFVNNYYLVP+SARSRQF++PDYV ++ISEYRK+L RL+DL
Sbjct  177   QRTKQLVNGALILITVGGNDFVNNYYLVPYSARSRQFSLPDYVKYVISEYRKLLTRLHDL  236

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             GARRV+VTGTGP+GCVPAE A R R G+CA DLQRAA L+NPQL Q++ +LNS+  +++F
Sbjct  237   GARRVLVTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQLVKDLNSQYGSEIF  296

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             VA NT  M  +FI NP+AFGF TSKVACCGQGPYNG+GLCT ASNLCPNR++YAFWDPFH
Sbjct  297   VAVNTGKMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNLCPNRNVYAFWDPFH  356

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             PSE+AN  IVQ   +GST+YM+PMNLSTIM LDSRT
Sbjct  357   PSERANGFIVQEFMTGSTEYMYPMNLSTIMALDSRT  392



>ref|XP_007151673.1| hypothetical protein PHAVU_004G066300g [Phaseolus vulgaris]
 gb|ESW23667.1| hypothetical protein PHAVU_004G066300g [Phaseolus vulgaris]
Length=370

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/349 (74%), Positives = 298/349 (85%), Gaps = 1/349 (0%)
 Frame = -3

Query  1287  TIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDY-PTHRATGRFSNGLNI  1111
             +IV    A  RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDY PTHR TGRFSNG NI
Sbjct  21    SIVCGAEARARAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYSPTHRPTGRFSNGYNI  80

Query  1110  PDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYF  931
             PD+IS+K+G E TLP LSP+L+G KLLVGANFASAG+GILNDTG+QF+N+IR+  QLEYF
Sbjct  81    PDLISQKIGAESTLPYLSPELRGNKLLVGANFASAGIGILNDTGLQFVNVIRMYRQLEYF  140

Query  930   EEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLI  751
             +EYQ RVS +IG+ + K LVN+ALVLIT+GGNDFVNNY+LVP SARSRQ+ +P YV +LI
Sbjct  141   KEYQNRVSAIIGSSQTKSLVNQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVNYLI  200

Query  750   SEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQM  571
             SEY+K+LQ+LYDLGARRV+VTGTGP+GCVP+ELAQR   G+CA +LQRAAALFNPQL QM
Sbjct  201   SEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGTNGQCAAELQRAAALFNPQLEQM  260

Query  570   LAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLC  391
             L +LN +L  DVF+AANT   H DF+ NPQ FGFVT+KVACCGQGPYNG+GLCT  SNLC
Sbjct  261   LLQLNRKLGKDVFIAANTGKTHNDFVSNPQQFGFVTAKVACCGQGPYNGLGLCTPLSNLC  320

Query  390   PNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             PNR  YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  321   PNRGQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDAIT  369



>ref|XP_010043319.1| PREDICTED: GDSL esterase/lipase LTL1-like [Eucalyptus grandis]
 gb|KCW85324.1| hypothetical protein EUGRSUZ_B02163 [Eucalyptus grandis]
Length=365

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/357 (75%), Positives = 308/357 (86%), Gaps = 1/357 (0%)
 Frame = -3

Query  1311  ILLGLLALT-IVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             ++LGL  +  +V  G    RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPTHR TG
Sbjct  9     VILGLAVMVGVVTPGVDAARAFFVFGDSLVDNGNNNYLATTARADLPPYGIDYPTHRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE +G EPTLP L P+L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDLISEAIGSEPTLPYLDPELNGENLLVGANFASAGIGILNDTGIQFINIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QL+ F++YQ+RV+ LIG  +A+QLV+ ALVLITLGGNDFVNNYYLVPFSARSRQF++
Sbjct  129   IFQQLQLFQQYQQRVAALIGEEQAQQLVSNALVLITLGGNDFVNNYYLVPFSARSRQFSL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEYR IL RLY+LGARRV+VTGTGP+GCVP+ELAQRSR GEC  +LQRAAAL
Sbjct  189   PDYVVYLISEYRNILARLYELGARRVLVTGTGPLGCVPSELAQRSRNGECVAELQRAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL QM++ LN+E+ ++VF+AAN   M  +FI NP+AFGFVTSKVACCGQG YNG+GL
Sbjct  249   FNPQLVQMVSSLNNEIGSNVFIAANAQQMSSNFISNPRAFGFVTSKVACCGQGRYNGLGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLCPNRD+YAFWD FHPSE+ANR IV+ I +G T YM+PMNLSTIM LD+RT
Sbjct  309   CTVASNLCPNRDVYAFWDAFHPSERANRFIVREILTGDTRYMYPMNLSTIMALDTRT  365



>ref|XP_004494761.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=373

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/357 (72%), Positives = 302/357 (85%), Gaps = 1/357 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             GI L ++ + +   G ++ RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT R TG
Sbjct  18    GIFL-VVGVIVPVEGDSKPRAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTGRPTG  76

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+IS+KLG E  LP LSP L+GEKLL GANFASAG+GILNDTGVQF+NIIR
Sbjct  77    RFSNGLNIPDLISQKLGTESVLPYLSPQLRGEKLLNGANFASAGIGILNDTGVQFLNIIR  136

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  QL+YFEEYQ RV+ LIGA   K+LVN+ALVLIT+GGNDFVNNYYLVP+SARSRQ+++
Sbjct  137   MYRQLDYFEEYQHRVTSLIGAARTKKLVNQALVLITVGGNDFVNNYYLVPYSARSRQYSL  196

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
              DYV FLI EYRK+LQRLYDLGARRVIVTGTGP+GCVPAELA R  +G C+ +LQRAA L
Sbjct  197   QDYVKFLIVEYRKLLQRLYDLGARRVIVTGTGPLGCVPAELAMRGSSGGCSAELQRAAEL  256

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQL  M+  LN+++  DVF+AANT  MH DF+ NP+AFGF TS++ACCGQGPYNGIGL
Sbjct  257   YNPQLQHMIQGLNNKIGKDVFIAANTALMHSDFVTNPKAFGFATSRIACCGQGPYNGIGL  316

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT  SNLC +R++YAFWDPFHPSEKA ++IV+ I SGS  YMHPMNLST++ LD+ T
Sbjct  317   CTPLSNLCQDRNLYAFWDPFHPSEKAGKLIVEQIMSGSKRYMHPMNLSTVLALDATT  373



>ref|XP_002884438.1| Li-tolerant lipase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60697.1| Li-tolerant lipase 1 [Arabidopsis lyrata subsp. lyrata]
Length=366

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/355 (73%), Positives = 295/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GFLISLFFIVTFLAPQVKSRAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEAIGMPSTLPYLSPHLTGENLLVGANFASAGIGILNDTGIQFVNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q+EYFE+YQ+RVS LIG    +QLVN+ALVLITLGGNDFVNNYY++PFSARSRQF +
Sbjct  129   ISKQMEYFEQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYVIPFSARSRQFAL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL++LY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNP+L  ++A +N+E+  DVFVAAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPRLVDLIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I +GS+ YMHPMNLST M LDS
Sbjct  309   CTPISNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTAMLLDS  363



>gb|EPS65950.1| hypothetical protein M569_08823, partial [Genlisea aurea]
Length=340

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/340 (73%), Positives = 293/340 (86%), Gaps = 0/340 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             AE +AFFVFGDSLVDNGNNNYLATTARAD PPYGID+P+HR TGRFSNGLNIPDIIS+  
Sbjct  1     AEGKAFFVFGDSLVDNGNNNYLATTARADSPPYGIDHPSHRPTGRFSNGLNIPDIISQHF  60

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G EPTLP LSP+L G KLLVGANFASAGVG+LNDTG+QF+NIIR+  QL +FE+YQ+R++
Sbjct  61    GWEPTLPYLSPELSGSKLLVGANFASAGVGVLNDTGIQFVNIIRVFQQLNFFEQYQQRLA  120

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
              LIG   AK+LV  +LV ITLGGNDFVNNYYLVPFS RS+Q++I DYVP +ISEY+K+L+
Sbjct  121   VLIGKDAAKKLVRNSLVFITLGGNDFVNNYYLVPFSIRSQQYSIDDYVPLVISEYKKVLK  180

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLY+LG RR+IVTGTGP+GCVPAELAQ S+ GEC  +LQ+AAALFNPQL QML ELN E+
Sbjct  181   RLYELGPRRIIVTGTGPLGCVPAELAQHSQNGECVPELQKAAALFNPQLVQMLDELNREV  240

Query  546   KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAF  367
              +  F+AANT  MHMDF+ NPQAFGFV+S+VACCGQGPYNG+GLCT  SNLC NRD Y F
Sbjct  241   GSHAFLAANTNQMHMDFMSNPQAFGFVSSQVACCGQGPYNGLGLCTGFSNLCSNRDQYVF  300

Query  366   WDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             WDPFHPSEKAN++IVQ I +G+  YMHP+NL+T+M LD +
Sbjct  301   WDPFHPSEKANKLIVQQILTGTNTYMHPLNLTTLMALDKQ  340



>ref|XP_003541357.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/344 (74%), Positives = 297/344 (86%), Gaps = 1/344 (0%)
 Frame = -3

Query  1272  GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGRFSNGLNIPDIIS  1096
               A  RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYP +HR TGRFSNG NIPD+IS
Sbjct  27    AEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLIS  86

Query  1095  EKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQR  916
             ++LG E TLP LSP+L+G KLLVGANFASAG+GILNDTG+QF+N+IR+  QLEYF+EYQ 
Sbjct  87    QRLGAESTLPYLSPELRGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLEYFKEYQN  146

Query  915   RVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRK  736
             RVS LIGA EAK LV +ALVLIT+GGNDFVNNY+LVP SARSRQ+ +P YV +LISEY+K
Sbjct  147   RVSALIGASEAKNLVKQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVKYLISEYQK  206

Query  735   ILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELN  556
             +LQ+LYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AAALFNPQL QML +LN
Sbjct  207   LLQKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLQLN  266

Query  555   SELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDI  376
              ++ +DVF+AANT   H DF+ NPQ FGFVTS+VACCGQGPYNG+GLCT  SNLC NR+ 
Sbjct  267   RKIGSDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGLGLCTALSNLCSNREQ  326

Query  375   YAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  327   YAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDANT  370



>gb|ACG37655.1| anther-specific proline-rich protein APG [Zea mays]
Length=367

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/337 (76%), Positives = 290/337 (86%), Gaps = 0/337 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH ATGRFSNGLNIPDIISE LG +
Sbjct  30    RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMATGRFSNGLNIPDIISEHLGSQ  89

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             P LP LSPDL+G +LLVGANFASAGVGILNDTG+QF+NIIRIG QL  F+EYQ+R++  +
Sbjct  90    PALPYLSPDLRGAQLLVGANFASAGVGILNDTGIQFVNIIRIGQQLRNFQEYQQRLAAFV  149

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G   A+Q V+ ALVLITLGGNDFVNNYYLVPFS RSRQF I DYVP+LISEYRKIL RLY
Sbjct  150   GEDAARQAVSDALVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRLY  209

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             +LGARRV+VTGTG IGCVPAELA  S  GECA DL  AA LFNPQL QML+ELN+++ AD
Sbjct  210   ELGARRVVVTGTGMIGCVPAELAMHSVDGECARDLTEAADLFNPQLVQMLSELNADIGAD  269

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AANT  +  DF+FNPQ +GFVTSKVACCGQGPYNGIGLCT ASN+CPNRD+YA+WD 
Sbjct  270   VFIAANTNRVSFDFMFNPQDYGFVTSKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDA  329

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FHP+E+ANRIIV     GSTD++ PMN+STI+ +D+R
Sbjct  330   FHPTERANRIIVGQFMHGSTDHISPMNISTILAMDNR  366



>ref|XP_007151676.1| hypothetical protein PHAVU_004G066600g [Phaseolus vulgaris]
 gb|ESW23670.1| hypothetical protein PHAVU_004G066600g [Phaseolus vulgaris]
Length=370

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/349 (73%), Positives = 298/349 (85%), Gaps = 1/349 (0%)
 Frame = -3

Query  1287  TIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDY-PTHRATGRFSNGLNI  1111
             +IV    A  RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDY PTHR TGRFSNG NI
Sbjct  21    SIVCGAEARARAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYSPTHRPTGRFSNGYNI  80

Query  1110  PDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYF  931
             PD+IS+K+G E TLP LSP+L+G KLLVGANFASAG+GILNDTG+QF+N+IR+  QLEYF
Sbjct  81    PDLISQKIGAESTLPYLSPELRGNKLLVGANFASAGIGILNDTGLQFVNVIRMYRQLEYF  140

Query  930   EEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLI  751
             +EYQ RVS +IG+ + K LVN+ALVLIT+GGNDFVNNY+LVP SARSRQ+ +P YV +LI
Sbjct  141   KEYQNRVSAIIGSSQTKSLVNQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVNYLI  200

Query  750   SEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQM  571
             SEY+K+LQ+LYDLGARRV+VTGTGP+GCVP+ELAQR   G+CA +LQRAAALFNPQL QM
Sbjct  201   SEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGTNGQCAAELQRAAALFNPQLEQM  260

Query  570   LAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLC  391
             L +LN +L  DVF+AANT   H DF+ NPQ FGF+T+KVACCGQGPYNG+GLCT  SNLC
Sbjct  261   LLQLNRKLGKDVFIAANTGKTHNDFVSNPQQFGFITAKVACCGQGPYNGLGLCTPLSNLC  320

Query  390   PNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             PNR  YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  321   PNRGQYAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDAIT  369



>gb|KFK37853.1| hypothetical protein AALP_AA3G037800 [Arabis alpina]
Length=366

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/355 (72%), Positives = 295/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G+L+ L  +      + + RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPT   TG
Sbjct  9     GLLISLFIIVTFLAPQVKSRAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRIPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE +GM  TLP LSP L GE+LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDMISEAIGMPSTLPYLSPHLTGEELLVGANFASAGIGILNDTGIQFVNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q EYFE+YQ+R++ LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQF +
Sbjct  129   ISKQFEYFEQYQQRMNALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFAL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL++LY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQAAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL  ++  +NSE+  DVFVAAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPQLVYLIKSINSEIGQDVFVAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I +GST YMHPMNLST+M +DS
Sbjct  309   CTPISNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSTKYMHPMNLSTVMLVDS  363



>emb|CDX92063.1| BnaC03g33650D [Brassica napus]
Length=366

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/355 (72%), Positives = 296/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAF+VFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GFLISLFFIVTFLAPQVKSRAFYVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEAIGMPSTLPYLSPQLTGENLLVGANFASAGIGILNDTGIQFVNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q E+FE+YQ+RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQF++
Sbjct  129   IFKQFEFFEQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFSL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL++LY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNP+L  ++A +N+E+  DVFVAAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPRLVDLIASVNAEIGQDVFVAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I +GS+ YMHPMNLST+M LDS
Sbjct  309   CTPISNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>ref|XP_003524731.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
 gb|KHN42753.1| GDSL esterase/lipase [Glycine soja]
Length=372

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/344 (74%), Positives = 298/344 (87%), Gaps = 1/344 (0%)
 Frame = -3

Query  1272  GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGRFSNGLNIPDIIS  1096
              +A  RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYP +HR TGRFSNG NIPD+IS
Sbjct  27    AKARPRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLIS  86

Query  1095  EKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQR  916
             ++LG E TLP LSP+L+G+KLLVGANFASAG+GILNDTG+QF+N+IR+  QLEYF+EYQ 
Sbjct  87    QRLGAESTLPYLSPELRGDKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLEYFKEYQN  146

Query  915   RVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRK  736
             RVS LIGA EA  LV +ALVLIT+GGNDFVNNY+LVP SARSRQ+ +P YV +LISEY+K
Sbjct  147   RVSALIGASEATNLVKQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVKYLISEYQK  206

Query  735   ILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELN  556
             ILQRLYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AAALFNPQL QML +LN
Sbjct  207   ILQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLQLN  266

Query  555   SELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDI  376
              ++ +DVF+AANT   H DF+ NP+ FGFVTS+VACCGQGPYNG+GLCT  SNLC NR+ 
Sbjct  267   RKIGSDVFIAANTGKAHNDFVTNPRQFGFVTSQVACCGQGPYNGLGLCTALSNLCSNRET  326

Query  375   YAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  327   YAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDANT  370



>gb|KHN14884.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/356 (73%), Positives = 299/356 (84%), Gaps = 2/356 (1%)
 Frame = -3

Query  1305  LGLLALTIVFFG-RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGR  1132
             L LL + I+  G  A  RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYP +HR TGR
Sbjct  15    LVLLVVGIIVSGVEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGR  74

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD+IS++LG E TLP LSP+L G KLLVGANFASAG+GILNDTG+QF+N+IR+
Sbjct  75    FSNGYNIPDLISQRLGAESTLPYLSPELSGNKLLVGANFASAGIGILNDTGIQFVNVIRM  134

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLEYF+EYQ RVS LIGA EAK LV +ALVLIT+GGNDFVNNY+LVP SARSRQ+ +P
Sbjct  135   YRQLEYFKEYQNRVSALIGASEAKNLVKQALVLITVGGNDFVNNYFLVPNSARSRQYPLP  194

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
              Y  +LISEY+K+LQRLYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AAALF
Sbjct  195   QYAKYLISEYQKLLQRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALF  254

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QML +LN ++  DVF+AANT   H DF+ NPQ FGFVTS+VACCGQGPYNGIGLC
Sbjct  255   NPQLEQMLLQLNRKIATDVFIAANTGKAHNDFVTNPQQFGFVTSQVACCGQGPYNGIGLC  314

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLC NRD YAFWD FHPSEKANR+I+  I SG   YM+PMNLSTI+ LD+ T
Sbjct  315   TALSNLCSNRDQYAFWDAFHPSEKANRLILDEIMSGYKGYMNPMNLSTILALDANT  370



>ref|XP_003553275.1| PREDICTED: GDSL esterase/lipase At5g33370 [Glycine max]
 gb|KHN14883.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/355 (72%), Positives = 300/355 (85%), Gaps = 1/355 (0%)
 Frame = -3

Query  1305  LGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGRF  1129
             L L+   IVF   A  R FFVFGDSLVDNGNNNYLATTARAD PPYGIDYP +HR TGRF
Sbjct  15    LVLVISAIVFEAEARPRTFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRF  74

Query  1128  SNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIG  949
             SNG NIPD+IS++LG E TLP LSP+L+G KLLVGANFASAG+GILNDTG+QF+N+IR+ 
Sbjct  75    SNGYNIPDLISQRLGAEATLPYLSPELRGNKLLVGANFASAGIGILNDTGIQFINVIRMY  134

Query  948   NQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPD  769
              QL+YF+EYQ RV  +IGA + K LVN+ALVLIT+GGNDFVNNY+LVP SARSRQ+ +P 
Sbjct  135   RQLQYFKEYQNRVRAIIGASQTKSLVNQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQ  194

Query  768   YVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFN  589
             YV +LISEY+K+LQ+LYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AA LFN
Sbjct  195   YVKYLISEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAAELQQAAELFN  254

Query  588   PQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCT  409
             PQL QML +LN ++  D F+AANT  MH +F+ NPQ FGF+TS++ACCGQGPYNG+GLCT
Sbjct  255   PQLEQMLLQLNRKIGKDTFIAANTGKMHNNFVTNPQQFGFITSQIACCGQGPYNGLGLCT  314

Query  408   QASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
               SNLCPNRD YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  315   PLSNLCPNRDQYAFWDAFHPSEKANRLIVEEIMSGSKIYMNPMNLSTILALDAIT  369



>gb|KHG28665.1| hypothetical protein F383_15485 [Gossypium arboreum]
Length=369

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/361 (71%), Positives = 302/361 (84%), Gaps = 5/361 (1%)
 Frame = -3

Query  1332  WLPNNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP  1153
             WL     +L+  LA+ +        RAFFVFGDSLVDNGNNNYLATTARAD PPYGID P
Sbjct  10    WL-----VLVLTLAMAVSKTQVEAARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDSP  64

Query  1152  THRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQ  973
             + R TGRFSNG NIPD ISE LG EP LP LSP+L G++LLVGANFASAG+GILNDTG+Q
Sbjct  65    SRRPTGRFSNGKNIPDFISEALGSEPLLPYLSPELNGDRLLVGANFASAGIGILNDTGIQ  124

Query  972   FMNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSAR  793
             F+NIIR+  Q EYF+EYQ R+++L+G  EA+++V++ALVLIT+GGNDFVNNY+LVPFSAR
Sbjct  125   FINIIRMFRQFEYFQEYQGRLANLVGTTEAQRIVSEALVLITVGGNDFVNNYFLVPFSAR  184

Query  792   SRQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDL  613
             SRQF++PDYV +LISEYRK+L RLY+LGAR+V+VTGTGP+GCVPAELA RS  G+CA +L
Sbjct  185   SRQFSLPDYVRYLISEYRKLLMRLYELGARKVLVTGTGPLGCVPAELAMRSPNGQCAAEL  244

Query  612   QRAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGP  433
             QRAA LFNPQL QM+  LNS+L A+VF+AANT     DFI NP AFGF TSK+ACCGQGP
Sbjct  245   QRAAGLFNPQLVQMINGLNSDLGANVFIAANTQQQTNDFISNPGAFGFTTSKIACCGQGP  304

Query  432   YNGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             YNG+GLCT ASNLCPNRD+YAFWDPFHPSEKANRIIV  I  GST+YM PMNLS+++ LD
Sbjct  305   YNGLGLCTIASNLCPNRDLYAFWDPFHPSEKANRIIVNMILRGSTNYMSPMNLSSLLALD  364

Query  252   S  250
             +
Sbjct  365   T  365



>ref|XP_004976167.1| PREDICTED: GDSL esterase/lipase LTL1-like [Setaria italica]
Length=363

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/340 (75%), Positives = 290/340 (85%), Gaps = 0/340 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             A  RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNGLNIPDIISE L
Sbjct  23    AAPRAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEHL  82

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G EP LP LSPDL+G++LLVGANFASAGVGILNDTG+QF+NIIRIG QLE F+EYQ++++
Sbjct  83    GSEPALPYLSPDLRGDRLLVGANFASAGVGILNDTGIQFVNIIRIGQQLENFQEYQQKLA  142

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
               +G   A Q+VN ALVLITLGGNDFVNNYYLVPFS RSRQF I DYVP+LISEYRKIL 
Sbjct  143   AFVGVDAAAQVVNNALVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILV  202

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLY+LGARRV+VTGTG IGCVPAELA  S  GECA +L  AA LFNPQL QML ELN+E+
Sbjct  203   RLYELGARRVVVTGTGMIGCVPAELAMHSIDGECARELTEAADLFNPQLAQMLGELNAEI  262

Query  546   KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAF  367
               DVF++ANT  +  DF+FNPQ +GFVTSKVACCGQGPYNGIGLCT ASN+CPNRD+YA+
Sbjct  263   GRDVFISANTNRVSFDFMFNPQDYGFVTSKVACCGQGPYNGIGLCTPASNVCPNRDVYAY  322

Query  366   WDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             WD FHP+E+ANRIIV     GSTD++ PMN+STI+ +D+R
Sbjct  323   WDAFHPTERANRIIVGQFMHGSTDHISPMNISTILAMDNR  362



>gb|KEH28987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=370

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/344 (73%), Positives = 296/344 (86%), Gaps = 2/344 (1%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             + E RAFFVFGDSLVDNGNNN+LATTARAD  PYGID  THRA+GRFSNGLN+PD+ISEK
Sbjct  27    QIEARAFFVFGDSLVDNGNNNFLATTARADSYPYGIDSQTHRASGRFSNGLNMPDLISEK  86

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             +G EPTLP LSP+L GE+LL+GANFASAG+GILNDTGVQF+NIIRI  QL YF++YQ+RV
Sbjct  87    IGSEPTLPYLSPELDGERLLIGANFASAGIGILNDTGVQFINIIRITAQLAYFKQYQQRV  146

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG  EA++LVN+AL LITLGGNDFVNNYYLVP+SARSR++ +PDYV FLISEYRKIL
Sbjct  147   SALIGESEAQKLVNQALTLITLGGNDFVNNYYLVPYSARSREYALPDYVVFLISEYRKIL  206

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
               LY+LGARRV+VTGTGP+GCVPAELA + R GEC V LQ A  LFNPQL +++ +LNSE
Sbjct  207   MNLYELGARRVLVTGTGPLGCVPAELAMQGRNGECGVPLQTATNLFNPQLVELINQLNSE  266

Query  549   LKA--DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDI  376
             +     VF+ AN + MH+DF+ NPQA+GF TSK ACCGQGP+NG+GLCT ASNLCPNRD+
Sbjct  267   IGGPNHVFIYANAFAMHLDFVSNPQAYGFETSKQACCGQGPFNGVGLCTPASNLCPNRDL  326

Query  375   YAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             YAFWDPFHPSE+ANR+IV    +G+TDYMHP NLST++ +DSRT
Sbjct  327   YAFWDPFHPSERANRLIVDKFMTGTTDYMHPYNLSTLIAMDSRT  370



>ref|XP_004494759.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=362

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/338 (74%), Positives = 297/338 (88%), Gaps = 0/338 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVD+GNN++LATTARAD  PYGIDYPTHR TGRFSNG NIPD+IS +LG+E
Sbjct  25    RAFFVFGDSLVDSGNNDFLATTARADNYPYGIDYPTHRPTGRFSNGRNIPDLISLELGLE  84

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             PTLP +SP L GEKLL+GANFASAG+GILNDTG QF++II I  QL+ FE YQ+R+S  I
Sbjct  85    PTLPIMSPLLVGEKLLIGANFASAGIGILNDTGFQFLHIIHIYKQLQLFELYQKRLSAHI  144

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G+  A+ LVN+ALVLITLGGNDFVNNYYLVP+SARSRQ+++PDYV ++ISEYRK+L+RLY
Sbjct  145   GSQGARNLVNRALVLITLGGNDFVNNYYLVPYSARSRQYSLPDYVRYIISEYRKVLRRLY  204

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             DLGARRV+VTGTGPIGC PAE+A +S  GECA++LQRAAA++NPQL QM+  LN E+ +D
Sbjct  205   DLGARRVLVTGTGPIGCAPAEIALKSPNGECALELQRAAAIYNPQLVQMIKGLNQEIGSD  264

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             +F+AA+ Y MHMDFI NPQA+GFVT+KVACCGQGPYNGIGLCT  SNLCPNRD+Y FWD 
Sbjct  265   IFIAADAYRMHMDFISNPQAYGFVTAKVACCGQGPYNGIGLCTPVSNLCPNRDLYVFWDA  324

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FHP+E+A++IIVQ I SGS +YM+PMNL+TIM LDS T
Sbjct  325   FHPTERASKIIVQQILSGSPEYMYPMNLTTIMALDSMT  362



>ref|NP_001141295.1| uncharacterized protein LOC100273386 precursor [Zea mays]
 gb|ACF86005.1| unknown [Zea mays]
 tpg|DAA37014.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=369

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/338 (75%), Positives = 291/338 (86%), Gaps = 1/338 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH ATGRFSNGLNIPDIISE LG +
Sbjct  31    RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMATGRFSNGLNIPDIISEHLGSQ  90

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             P LP LSPDL+G +LLVGANFASAGVGILNDTG+QF+NIIRIG QL  F+EYQ+R++  +
Sbjct  91    PALPYLSPDLRGAQLLVGANFASAGVGILNDTGIQFVNIIRIGQQLRNFQEYQQRLAAFV  150

Query  897   GAGEA-KQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRL  721
             G  +A +Q V+ ALVLITLGGNDFVNNYYLVPFS RSRQF I DYVP+LISEYRKIL RL
Sbjct  151   GDEDAARQAVSDALVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRL  210

Query  720   YDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKA  541
             Y+LGARRV+VTGTG IGCVPAELA  S  GECA DL  AA LFNPQL QML+ELN+++ A
Sbjct  211   YELGARRVVVTGTGMIGCVPAELAMHSVDGECARDLTEAADLFNPQLVQMLSELNADIGA  270

Query  540   DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWD  361
             DVF+AANT  +  DF+FNPQ +GFVTSKVACCGQGPYNGIGLCT ASN+CPNRD+YA+WD
Sbjct  271   DVFIAANTNRVSFDFMFNPQDYGFVTSKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWD  330

Query  360   PFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
              FHP+E+ANRIIV     GSTD++ PMN+STI+ +D+R
Sbjct  331   AFHPTERANRIIVGQFMHGSTDHISPMNISTILAMDNR  368



>ref|XP_007030303.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY10805.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=367

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/356 (72%), Positives = 302/356 (85%), Gaps = 1/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I+LGL+  T      A  RAFFVFGDSLVDNGNNNYLATTARAD PPYGID P+ R TGR
Sbjct  11    IVLGLVMATSTTKVEA-ARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDTPSRRPTGR  69

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD IS+ LG EP LP LSP+L+G+KLLVGANFASAG+GILNDTG+QF+NIIR+
Sbjct  70    FSNGKNIPDFISDALGSEPVLPYLSPELRGDKLLVGANFASAGIGILNDTGIQFINIIRM  129

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL YF+EYQ R++DL+G  EA+++V+ +LVLIT+GGNDFVNNYYLVPFSARSRQF++P
Sbjct  130   FRQLLYFQEYQSRLADLVGYNEAQRIVSDSLVLITVGGNDFVNNYYLVPFSARSRQFSLP  189

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRK+L++LYDLGARRV+VTGTGP+GCVPAELA RS +G+CA DLQRAAAL+
Sbjct  190   DYVRYLISEYRKLLRKLYDLGARRVLVTGTGPLGCVPAELAMRSLSGQCAPDLQRAAALY  249

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL QM+  LNSE+ A VF+AANT     DFI NP+A+GF TSKVACCGQGP+NG+GLC
Sbjct  250   NPQLVQMINGLNSEIGAKVFIAANTQQQTNDFISNPRAYGFATSKVACCGQGPFNGLGLC  309

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  SNLCPNR+ Y FWDPFHPSE+ANRIIV  I  GSTD++ PMNLST++ LD +T
Sbjct  310   TLLSNLCPNRNQYVFWDPFHPSERANRIIVDTILRGSTDHVSPMNLSTLLALDYKT  365



>ref|XP_007151675.1| hypothetical protein PHAVU_004G066500g [Phaseolus vulgaris]
 gb|ESW23669.1| hypothetical protein PHAVU_004G066500g [Phaseolus vulgaris]
Length=370

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/349 (73%), Positives = 296/349 (85%), Gaps = 1/349 (0%)
 Frame = -3

Query  1287  TIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDY-PTHRATGRFSNGLNI  1111
             +IV    A  RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDY PTHR TGRFSNG NI
Sbjct  21    SIVCGAEARARAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYAPTHRPTGRFSNGYNI  80

Query  1110  PDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYF  931
             PD+IS+K+G E TLP LSP+L G KLLVGANFASAG+GILNDTG+QF+N+IR+  QLEYF
Sbjct  81    PDLISQKIGAESTLPYLSPELTGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLEYF  140

Query  930   EEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLI  751
             +EYQ RVS LIGA +AK LVN++LVLIT GGNDFVNNY+LVP SARSRQ+ +P YV +LI
Sbjct  141   QEYQNRVSALIGASQAKSLVNESLVLITAGGNDFVNNYFLVPNSARSRQYPLPQYVKYLI  200

Query  750   SEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQM  571
             SEY+K+LQRLYDLG RR++VTGTGP+GCVP+ELAQR R G+CA +LQRAA LFNPQL QM
Sbjct  201   SEYQKLLQRLYDLGPRRILVTGTGPLGCVPSELAQRGRNGQCAPELQRAAELFNPQLEQM  260

Query  570   LAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLC  391
             L +LN +L  DVF+AANT  MH +F+ NPQ FGFVT+KVACCGQGPYNG+GLCT  SNLC
Sbjct  261   LLQLNRKLGKDVFIAANTGKMHNNFVSNPQQFGFVTAKVACCGQGPYNGLGLCTPLSNLC  320

Query  390   PNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
              NR  YAFWD FHPSEKANR+I + I SGS  YM+PMNLSTI++LD+ T
Sbjct  321   SNRGEYAFWDAFHPSEKANRLIAEEIMSGSKAYMNPMNLSTILDLDAIT  369



>gb|ACU23289.1| unknown [Glycine max]
Length=370

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/355 (71%), Positives = 299/355 (84%), Gaps = 1/355 (0%)
 Frame = -3

Query  1305  LGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGRF  1129
             L L+   IVF   A  R FFVFGDSLVDNGNNNYLATTARAD PPYGIDYP +HR TGRF
Sbjct  15    LVLVISAIVFEAEARPRTFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRF  74

Query  1128  SNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIG  949
             SNG NIPD+IS++LG E TLP LSP+L+G KLLVGANFASAG+GILNDTG+QF+N+IR+ 
Sbjct  75    SNGYNIPDLISQRLGAEATLPYLSPELRGNKLLVGANFASAGIGILNDTGIQFINVIRMY  134

Query  948   NQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPD  769
              QL+YF+EYQ RV  +IGA + K LVN+ALVLIT+GGNDFVNNY+LVP SARSRQ+ +P 
Sbjct  135   RQLQYFKEYQNRVRAIIGASQTKSLVNQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQ  194

Query  768   YVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFN  589
             YV +LISEY+K+LQ+LYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AA LFN
Sbjct  195   YVKYLISEYQKLLQKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCATELQQAAELFN  254

Query  588   PQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCT  409
             PQL QML +LN ++  D F+AANT  MH +F+ NPQ FGF+TS++ACCGQGPYNG+GLCT
Sbjct  255   PQLEQMLLQLNRKIGKDTFIAANTGKMHNNFVTNPQQFGFITSQIACCGQGPYNGLGLCT  314

Query  408   QASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
               SNLCPNRD YAFWD FHPSEKANR+IV+ I SG   YM+PMNLSTI+ LD+ T
Sbjct  315   PLSNLCPNRDQYAFWDAFHPSEKANRLIVEEIMSGFKIYMNPMNLSTILALDAIT  369



>gb|KHN35335.1| GDSL esterase/lipase [Glycine soja]
Length=349

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/348 (72%), Positives = 294/348 (84%), Gaps = 0/348 (0%)
 Frame = -3

Query  1290  LTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNI  1111
             + +V    A+ RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT R TGRFSNGLNI
Sbjct  1     MVLVVGVEAKARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNI  60

Query  1110  PDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYF  931
             PD+ISE++G E  LP LSP LKGE LL GANFASAG+GILNDTG QF+NIIR+  QL+YF
Sbjct  61    PDLISERIGGESVLPYLSPQLKGENLLNGANFASAGIGILNDTGSQFLNIIRMYRQLDYF  120

Query  930   EEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLI  751
             EEYQ+RVS LIG   AK+LVN+ALVLIT+GGNDFVNNYYLVP+SARSRQ+++ DYV FLI
Sbjct  121   EEYQQRVSILIGVARAKKLVNQALVLITVGGNDFVNNYYLVPYSARSRQYSLQDYVKFLI  180

Query  750   SEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQM  571
              EYRK+L RLYDLGARR IVTGTGP+GCVPAELA R   G C+ +LQRAA+L+NPQLT M
Sbjct  181   VEYRKLLMRLYDLGARRAIVTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLTHM  240

Query  570   LAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLC  391
             +  LN ++  DVF+AANT  MH DF+ NP A+GF TS++ACCGQGPYNGIGLCT  S+LC
Sbjct  241   IQGLNKKIGKDVFIAANTALMHNDFVSNPAAYGFTTSQIACCGQGPYNGIGLCTPLSDLC  300

Query  390   PNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             PNR+++AFWDPFHPSEK+NR+IV+ I SGS  YM PMNLST++ LD+R
Sbjct  301   PNRNLHAFWDPFHPSEKSNRLIVEQIMSGSKRYMKPMNLSTVISLDAR  348



>gb|KCW85323.1| hypothetical protein EUGRSUZ_B02163 [Eucalyptus grandis]
Length=367

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 308/359 (86%), Gaps = 3/359 (1%)
 Frame = -3

Query  1311  ILLGLLALT-IVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             ++LGL  +  +V  G    RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPTHR TG
Sbjct  9     VILGLAVMVGVVTPGVDAARAFFVFGDSLVDNGNNNYLATTARADLPPYGIDYPTHRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQF--MNI  961
             RFSNGLNIPD+ISE +G EPTLP L P+L GE LLVGANFASAG+GILNDTG+QF  +NI
Sbjct  69    RFSNGLNIPDLISEAIGSEPTLPYLDPELNGENLLVGANFASAGIGILNDTGIQFVSINI  128

Query  960   IRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQF  781
             IRI  QL+ F++YQ+RV+ LIG  +A+QLV+ ALVLITLGGNDFVNNYYLVPFSARSRQF
Sbjct  129   IRIFQQLQLFQQYQQRVAALIGEEQAQQLVSNALVLITLGGNDFVNNYYLVPFSARSRQF  188

Query  780   TIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAA  601
             ++PDYV +LISEYR IL RLY+LGARRV+VTGTGP+GCVP+ELAQRSR GEC  +LQRAA
Sbjct  189   SLPDYVVYLISEYRNILARLYELGARRVLVTGTGPLGCVPSELAQRSRNGECVAELQRAA  248

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             ALFNPQL QM++ LN+E+ ++VF+AAN   M  +FI NP+AFGFVTSKVACCGQG YNG+
Sbjct  249   ALFNPQLVQMVSSLNNEIGSNVFIAANAQQMSSNFISNPRAFGFVTSKVACCGQGRYNGL  308

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             GLCT ASNLCPNRD+YAFWD FHPSE+ANR IV+ I +G T YM+PMNLSTIM LD+RT
Sbjct  309   GLCTVASNLCPNRDVYAFWDAFHPSERANRFIVREILTGDTRYMYPMNLSTIMALDTRT  367



>ref|XP_003554733.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/358 (72%), Positives = 298/358 (83%), Gaps = 3/358 (1%)
 Frame = -3

Query  1311  ILLGLL---ALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRA  1141
             IL G++    + IV    A+ RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT R 
Sbjct  12    ILFGMVLVVGVNIVPGVEAKARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRP  71

Query  1140  TGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNI  961
             TGRFSNGLNIPD+ISE++G E  LP LSP LK E LL GANFASAG+GILNDTG QF+NI
Sbjct  72    TGRFSNGLNIPDLISERMGGESVLPYLSPQLKSENLLNGANFASAGIGILNDTGSQFLNI  131

Query  960   IRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQF  781
             IR+  QL+YFEEYQ+RVS LIG   AK+LVN+ALVLIT+GGNDFVNNYYLVP+SARSRQ+
Sbjct  132   IRMYRQLDYFEEYQQRVSILIGVARAKKLVNQALVLITVGGNDFVNNYYLVPYSARSRQY  191

Query  780   TIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAA  601
             ++ DYV FLI EYRK+L RLYDLGARRVIVTGTGP+GCVPAELA R   G C+ +LQRAA
Sbjct  192   SLQDYVKFLIVEYRKLLMRLYDLGARRVIVTGTGPMGCVPAELAMRGTNGGCSAELQRAA  251

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             +L+NPQLT M+  LN ++  +VF+AANT  MH DF+ NP A+GF TS++ACCGQGPYNGI
Sbjct  252   SLYNPQLTHMIQGLNKKIGKEVFIAANTALMHNDFVSNPAAYGFTTSQIACCGQGPYNGI  311

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             GLCT  SNLCPNR+ +AFWDPFHPSEKANR+IV+ I SGS  YM PMNLST++ LD+R
Sbjct  312   GLCTPLSNLCPNRNSHAFWDPFHPSEKANRLIVEQIMSGSKRYMKPMNLSTVLALDAR  369



>ref|XP_003533553.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/346 (73%), Positives = 292/346 (84%), Gaps = 0/346 (0%)
 Frame = -3

Query  1284  IVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPD  1105
             IV    A  RAFFVFGDSLVDNGNNNYL T ARA+ PPYGIDYPTHRATGRFSNG NIPD
Sbjct  23    IVPRSEARPRAFFVFGDSLVDNGNNNYLQTIARANAPPYGIDYPTHRATGRFSNGFNIPD  82

Query  1104  IISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEE  925
              IS++LG E T+P LSPDL  E LLVGANFASAGVGILNDTG QFMNII++  QLEYF+E
Sbjct  83    FISQELGAESTMPYLSPDLTRENLLVGANFASAGVGILNDTGDQFMNIIKMHQQLEYFKE  142

Query  924   YQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISE  745
             YQ+R+S LIG    K+LVN+AL+LIT+GGNDFVNNY+LV  +ARSRQ+++PDYV FLI+ 
Sbjct  143   YQQRLSALIGVPRTKRLVNQALILITVGGNDFVNNYFLVDSTARSRQYSLPDYVKFLITR  202

Query  744   YRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLA  565
             Y K LQRLYDLGARRV+VTGTGP+GC PAELA R + GEC+ DLQRAAAL+NPQL QML 
Sbjct  203   YSKHLQRLYDLGARRVLVTGTGPLGCAPAELAMRGKNGECSADLQRAAALYNPQLEQMLL  262

Query  564   ELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPN  385
             ELN +L +DVF+AANT  MH D+I NP A+GF TSKVACCGQGPYNG+GLC   SNLCPN
Sbjct  263   ELNKKLGSDVFIAANTALMHNDYITNPNAYGFNTSKVACCGQGPYNGMGLCLPVSNLCPN  322

Query  384   RDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             R+++AFWDPFHP+EKAN+++V+ I SGST YM PMNLSTI+ LD+R
Sbjct  323   RELHAFWDPFHPTEKANKLVVEQIMSGSTKYMKPMNLSTILALDAR  368



>gb|EYU19868.1| hypothetical protein MIMGU_mgv1a008447mg [Erythranthe guttata]
Length=373

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/356 (73%), Positives = 295/356 (83%), Gaps = 1/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             IL      T+    R E RAFFVFGDSLVD+GNNNYL TTARAD PPYGID P HR +GR
Sbjct  16    ILYAFFLATLFIGSRVEARAFFVFGDSLVDSGNNNYLVTTARADAPPYGIDSPNHRPSGR  75

Query  1131  FSNGLNIPDIISEKLG-MEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             FSNGLNI DIISE +G  E  LP L+P L G +LLVGANFASAGVGILNDTGVQF+NII 
Sbjct  76    FSNGLNIADIISESIGGRESPLPYLNPALNGPRLLVGANFASAGVGILNDTGVQFVNIIG  135

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  QL  F++YQ+RVS LIG  E ++LV ++LVLITLGGNDFVNNYYLVPFSARSRQF I
Sbjct  136   ISQQLTNFQQYQQRVSALIGVSETQRLVKESLVLITLGGNDFVNNYYLVPFSARSRQFAI  195

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY+KIL RLY LGARRV+VTGTGP+GCVPAELA RSR GECA +LQRAA+L
Sbjct  196   PDYVRYLISEYQKILLRLYGLGARRVLVTGTGPLGCVPAELAMRSRNGECATELQRAASL  255

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             F+PQLT ML  LNS++ ++VF+AANT  M+ DFI NPQAFGF TSKVACCGQGPYNG+GL
Sbjct  256   FDPQLTDMLLRLNSQIGSNVFIAANTQLMNNDFIRNPQAFGFTTSKVACCGQGPYNGLGL  315

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             CTQ SNLCPNRD+YAFWD FHPSE+ANR+IV  I +GS  YM+PMNL+TIMELDS 
Sbjct  316   CTQLSNLCPNRDVYAFWDAFHPSERANRLIVDQIMTGSLQYMNPMNLTTIMELDSH  371



>ref|XP_006297961.1| hypothetical protein CARUB_v10014002mg [Capsella rubella]
 gb|EOA30859.1| hypothetical protein CARUB_v10014002mg [Capsella rubella]
Length=367

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/336 (76%), Positives = 285/336 (85%), Gaps = 0/336 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TGRFSNGLNIPDIISE +GM 
Sbjct  29    RAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMP  88

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
              TLP LSP L GE LLVGANFASAG+GILNDTGVQF+NIIRI  Q EYF++YQ RVS +I
Sbjct  89    STLPYLSPQLTGENLLVGANFASAGIGILNDTGVQFVNIIRISKQFEYFQQYQLRVSAMI  148

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQF +PDYV +LISEY K+L++LY
Sbjct  149   GPEATQQLVNRALVLITLGGNDFVNNYYLIPFSARSRQFALPDYVVYLISEYGKVLRKLY  208

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             +LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAALFNP+L  ++A +N+E+  D
Sbjct  209   ELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVDLIASVNAEIGQD  268

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VFVAAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGLCT  SNLCPNRD+YAFWD 
Sbjct  269   VFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDA  328

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             FHP+EKANRIIV  I +GS  YMHPMNLST M LDS
Sbjct  329   FHPTEKANRIIVNQILTGSAKYMHPMNLSTAMLLDS  364



>ref|XP_008388753.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
 ref|XP_008350647.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=363

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/357 (72%), Positives = 308/357 (86%), Gaps = 2/357 (1%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G+L+ ++AL ++ +  AE RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPT R TG
Sbjct  9     GVLM-IMALGMLSY-EAEARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTGRPTG  66

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNG+NIPD IS++LG EPTLP LSP+L G+KLLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  67    RFSNGMNIPDFISQQLGAEPTLPYLSPELTGQKLLVGANFASAGIGILNDTGIQFINIIR  126

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  Q +YF++YQ+R+S LIG    KQLVN+ALVL+T+GGNDFVNNYYLVPFSARSRQF +
Sbjct  127   MTRQFDYFQQYQQRLSSLIGPQRTKQLVNQALVLLTVGGNDFVNNYYLVPFSARSRQFAL  186

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISE RK+L ++YDLG RRV+VTGTGP+GCVPAELA RSR GEC+ +LQRAA+L
Sbjct  187   PDYVKYLISELRKLLLKMYDLGVRRVLVTGTGPLGCVPAELAMRSRNGECSAELQRAASL  246

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQL Q+L  LNS+L +DVF+AANT     DF+ NPQA+GF TSK+ACCGQGPYNG+GL
Sbjct  247   YNPQLVQLLRSLNSQLGSDVFIAANTQQTRNDFVSNPQAYGFSTSKIACCGQGPYNGLGL  306

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             CT ASNLCPNR+ YAFWD FHP+EKAN++IVQ I +G   YM+PMNLSTI+ LDSRT
Sbjct  307   CTVASNLCPNRNQYAFWDAFHPTEKANKLIVQNILTGDEKYMYPMNLSTILALDSRT  363



>ref|XP_002446760.1| hypothetical protein SORBIDRAFT_06g021990 [Sorghum bicolor]
 gb|EES11088.1| hypothetical protein SORBIDRAFT_06g021990 [Sorghum bicolor]
Length=395

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/336 (75%), Positives = 291/336 (87%), Gaps = 0/336 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNGLNIPDIISE LG +
Sbjct  32    RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEHLGSQ  91

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             P LP LSPDL+G++LLVGANFASAGVGILNDTG+QF+NIIRIG QL+ F++YQ+R+++ +
Sbjct  92    PALPYLSPDLRGDQLLVGANFASAGVGILNDTGIQFVNIIRIGQQLQNFQDYQQRLAEFV  151

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G   A+Q+VN ALVLITLGGNDFVNNYYLVPFS RSRQF I DYVP+LISEYRKIL RLY
Sbjct  152   GEDAARQVVNNALVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRLY  211

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             +LGARRV+VTGTG IGCVPAELA  S  GECA DL  AA LFNPQL QML++LN+++  D
Sbjct  212   ELGARRVVVTGTGMIGCVPAELAMHSIDGECARDLTEAADLFNPQLVQMLSQLNADIGGD  271

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AANT  +  DF+FNPQ +GFVTSKVACCGQGPYNGIGLCT ASN+CPNRD+YA+WD 
Sbjct  272   VFIAANTNRVSFDFMFNPQDYGFVTSKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDA  331

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             FHP+E+ANRIIV     GSTD++ PMN+STI+ +D+
Sbjct  332   FHPTERANRIIVGQFMHGSTDHITPMNISTILAMDN  367



>ref|XP_009405750.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/341 (72%), Positives = 290/341 (85%), Gaps = 0/341 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             +  RAFFVFGDSLVDNGNNNYLATTARAD PPYGID P+HRATGRFSNG N+PDI+SE L
Sbjct  23    SAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDTPSHRATGRFSNGKNVPDIVSEYL  82

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G E TLP LSP+L GE+LLVGANFASAG+GILNDTG+QF NIIRI  QL+YFE+YQ+R+S
Sbjct  83    GAESTLPYLSPELHGERLLVGANFASAGIGILNDTGIQFANIIRITKQLQYFEQYQQRLS  142

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
              LIG  + ++LVN+ LVLITLGGNDFVNNYYLVPFS RSRQF +PDYV +L+SEY+KIL 
Sbjct  143   SLIGPEKTERLVNEGLVLITLGGNDFVNNYYLVPFSLRSRQFALPDYVRYLVSEYKKILS  202

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLY+LG+RRV+VTG GP+GCVPAELA RSR G C  +LQR   L+NPQL Q+L++LN++ 
Sbjct  203   RLYELGSRRVLVTGIGPLGCVPAELALRSRTGACDPELQRVPDLYNPQLMQLLSDLNTQY  262

Query  546   KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAF  367
              + VFVA N Y MHMDFI NP A+GF+TS+VACCGQGPYNGIGLCT  SNLCPNR++YAF
Sbjct  263   GSSVFVAVNAYKMHMDFITNPGAYGFITSRVACCGQGPYNGIGLCTILSNLCPNRNVYAF  322

Query  366   WDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             WD FHP+EKANRIIV    +G  +YM PMNLS+I+ +D+RT
Sbjct  323   WDAFHPTEKANRIIVSQFMTGLEEYMSPMNLSSILAMDART  363



>ref|XP_008677149.1| PREDICTED: uncharacterized protein LOC100280267 isoform X1 [Zea 
mays]
 gb|ACF85174.1| unknown [Zea mays]
 gb|AFW63006.1| anther-specific proline-rich protein APG [Zea mays]
Length=366

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/335 (74%), Positives = 284/335 (85%), Gaps = 0/335 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH+ATGRFSNGLNIPDIISE LG EP 
Sbjct  30    FFVFGDSLVDNGNNNYLLTTARADAPPYGIDFPTHQATGRFSNGLNIPDIISEHLGAEPA  89

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSP+L+GEKLLVGANFASAGVGILNDTG+QF+NIIRIG+QL+YF EYQR++  L+G 
Sbjct  90    LPYLSPELRGEKLLVGANFASAGVGILNDTGIQFVNIIRIGDQLQYFREYQRKLRALVGE  149

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
              +A QLVN+ALVLITLGGNDFVNNYYLVP S RSRQ+ +PDYV F++SEYRKIL RLY+L
Sbjct  150   PQATQLVNQALVLITLGGNDFVNNYYLVPMSVRSRQYALPDYVRFIVSEYRKILSRLYEL  209

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             GARRVIVTGTGP+GCVPAELA  S+ GECA +L RA  LFNPQ+  M+  LN  + ADVF
Sbjct  210   GARRVIVTGTGPLGCVPAELALHSQNGECAAELTRAVNLFNPQMVDMVRGLNRAIGADVF  269

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             V ANTY M+ D++ NPQ FGF   +VACCGQGPYNGIGLCT ASN+C NRD++AFWD FH
Sbjct  270   VTANTYRMNFDYLANPQDFGFTNVQVACCGQGPYNGIGLCTAASNVCDNRDVFAFWDAFH  329

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             P+E+ANRIIV     G TDYMHPMNLSTI+ +D  
Sbjct  330   PTERANRIIVAQFMHGDTDYMHPMNLSTILAMDQE  364



>ref|XP_003552505.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/342 (72%), Positives = 291/342 (85%), Gaps = 0/342 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
              A  RAFFVFGDSLVDNGNNNYL T ARA+ PPYGIDYPTHRATGRFSNG NIPD IS++
Sbjct  28    EARPRAFFVFGDSLVDNGNNNYLQTIARANAPPYGIDYPTHRATGRFSNGFNIPDFISQQ  87

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG E T+P LSPDL  E LLVGANFASAGVGILNDTG QFMNII++  Q++YF+EYQ+R+
Sbjct  88    LGAESTMPYLSPDLTRENLLVGANFASAGVGILNDTGDQFMNIIKMHKQIDYFKEYQQRL  147

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG    K+LVN+AL+LIT+GGNDFVNNY+LV  +ARSRQ+++PDYV FLI+ Y K L
Sbjct  148   SALIGVSRTKRLVNQALILITVGGNDFVNNYFLVDSTARSRQYSLPDYVKFLINRYSKHL  207

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
             QRLY+LGARRV+VTG+GP+GC PAELA R + GEC+ DLQRAA+L+NPQL QML ELN +
Sbjct  208   QRLYNLGARRVLVTGSGPLGCAPAELAMRGKNGECSADLQRAASLYNPQLEQMLLELNKK  267

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             + +DVF+AANT  MH DFI NP A+GF TSKVACCGQGPYNG+GLC   SNLCPNRD++A
Sbjct  268   IGSDVFIAANTALMHNDFITNPNAYGFNTSKVACCGQGPYNGMGLCLPVSNLCPNRDLHA  327

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWDPFHP+EKAN+++V+ I SGST YM PMNLSTI+ LD+RT
Sbjct  328   FWDPFHPTEKANKLVVEQIMSGSTKYMKPMNLSTILTLDART  369



>ref|XP_010936081.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Elaeis guineensis]
Length=368

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/356 (71%), Positives = 308/356 (87%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ++ GL+ L  +       RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPTH+ATGR
Sbjct  13    LIAGLVVLGTLPVSSEAARAFFVFGDSLVDNGNNNYLATTARADRPPYGIDYPTHQATGR  72

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLN+PDIISE LG EPTLP LSP+L+GEKLLVGANFASAG+GILNDTG+QF+NIIRI
Sbjct  73    FSNGLNLPDIISENLGAEPTLPYLSPELRGEKLLVGANFASAGIGILNDTGIQFVNIIRI  132

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               Q++YF++YQ+R+S LIG+ +A++LVN+ALVLITLGGNDFVNNYYLVP+SARSR+F++P
Sbjct  133   RKQVQYFQQYQQRLSSLIGSAQARRLVNQALVLITLGGNDFVNNYYLVPYSARSREFSLP  192

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEY++IL  LY+LGARRV+VTGTGP+GCVPAELA RS  G C  +L RA+ LF
Sbjct  193   DYVTYLISEYKQILASLYELGARRVLVTGTGPLGCVPAELALRSTTGRCDPELNRASDLF  252

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL Q L E+NS++ +DVFVA N+  MH DFI NPQA+GF TSK+ACCGQGPYNGIGLC
Sbjct  253   NPQLIQALTEINSQIGSDVFVAVNSRKMHSDFISNPQAYGFATSKIACCGQGPYNGIGLC  312

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             T  S++CPNR++YAFWD +HP+EKANRIIV    +GST+YM+PMNLSTI+ +D+R+
Sbjct  313   TPLSSVCPNRNLYAFWDQYHPTEKANRIIVSQFMTGSTEYMNPMNLSTILAMDARS  368



>ref|XP_003626493.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82711.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=362

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/342 (74%), Positives = 295/342 (86%), Gaps = 1/342 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             A+ RAFFVFGDSLVD+GNN++LATTARAD  PYGIDYP+HR TGRFSNG NIPD+IS +L
Sbjct  21    AQPRAFFVFGDSLVDSGNNDFLATTARADNYPYGIDYPSHRPTGRFSNGYNIPDLISLEL  80

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G+EPTLP LSP L GEKLL+GANFASAG+GILNDTG QF++IIRI  QL  FE YQ+RVS
Sbjct  81    GLEPTLPYLSPLLVGEKLLIGANFASAGIGILNDTGFQFIHIIRIYKQLRLFELYQKRVS  140

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
               IG+  A+ LVN+ALVLITLGGNDFVNNYYLVPFSARSRQF++PDYV +LISEYRK+L+
Sbjct  141   AHIGSEGARNLVNRALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLISEYRKVLR  200

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRA-GECAVDLQRAAALFNPQLTQMLAELNSE  550
             RLYDLGARRV+VTGTGP+GC PAELA R    G+C+V+L+RAA+L+NPQL  M+  LN E
Sbjct  201   RLYDLGARRVLVTGTGPMGCAPAELAMRGGPNGQCSVELERAASLYNPQLVDMIRSLNQE  260

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             + +D+FVAA+ Y MHMD+I NPQA+GF TSKVACCGQGPYNG+GLCT ASNLCPNR++ A
Sbjct  261   IGSDIFVAADAYRMHMDYITNPQAYGFATSKVACCGQGPYNGLGLCTPASNLCPNRELNA  320

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             FWD FHPSEKAN+IIV  I  GS  YM+PMNLSTIM LDSRT
Sbjct  321   FWDAFHPSEKANKIIVNRILRGSAQYMYPMNLSTIMALDSRT  362



>ref|XP_003543915.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/344 (73%), Positives = 294/344 (85%), Gaps = 1/344 (0%)
 Frame = -3

Query  1272  GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGRFSNGLNIPDIIS  1096
               A  RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYP +HR TGRFSNG NIPD+IS
Sbjct  27    AEARPRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLIS  86

Query  1095  EKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQR  916
             ++L  E TLP LSP+L+G KLLVGANFASAG+GILNDTG+QF+N+IR+  QL+YF+EYQ 
Sbjct  87    QRLSAESTLPYLSPELRGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLQYFKEYQN  146

Query  915   RVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRK  736
             RV DLIGA + K LVNKALVLIT+GGNDFVNNY+LVP SARS+Q+ +P YV +LISEY+K
Sbjct  147   RVRDLIGASQTKSLVNKALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQK  206

Query  735   ILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELN  556
             +L+RLYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AAALFNPQL QML  LN
Sbjct  207   LLKRLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLRLN  266

Query  555   SELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDI  376
              ++  DVF+AANT   H DF+ NPQ FGFVTS+VACCGQGPYNG+GLCT  SNLC NR+ 
Sbjct  267   RKIGKDVFIAANTGKTHNDFVSNPQQFGFVTSQVACCGQGPYNGLGLCTALSNLCSNREQ  326

Query  375   YAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  327   YAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDANT  370



>gb|KHN13664.1| GDSL esterase/lipase [Glycine soja]
Length=362

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/341 (72%), Positives = 291/341 (85%), Gaps = 0/341 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             A  RAFFVFGDSLVDNGNNNYL T ARA+ PPYGIDYPTHRATGRFSNG NIPD IS++L
Sbjct  20    ARPRAFFVFGDSLVDNGNNNYLQTIARANAPPYGIDYPTHRATGRFSNGFNIPDFISQQL  79

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G E T+P LSPDL  E LLVGANFASAGVGILNDTG QFMNII++  Q++YF+EYQ+R+S
Sbjct  80    GAESTMPYLSPDLTRENLLVGANFASAGVGILNDTGDQFMNIIKMHKQIDYFKEYQQRLS  139

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
              LIG    K+LVN+AL+LIT+GGNDFVNNY+LV  +ARSRQ+++PDYV FLI+ Y K LQ
Sbjct  140   ALIGVSRTKRLVNQALILITVGGNDFVNNYFLVDSTARSRQYSLPDYVKFLINRYSKHLQ  199

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLY+LGARRV+VTG+GP+GC PAELA R + GEC+ DLQRAA+L+NPQL QML ELN ++
Sbjct  200   RLYNLGARRVLVTGSGPLGCAPAELAMRGKNGECSADLQRAASLYNPQLEQMLLELNKKI  259

Query  546   KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAF  367
              +DVF+AANT  MH DFI NP A+GF TSKVACCGQGPYNG+GLC   SNLCPNRD++AF
Sbjct  260   GSDVFIAANTALMHNDFITNPNAYGFNTSKVACCGQGPYNGMGLCLPVSNLCPNRDLHAF  319

Query  366   WDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             WDPFHP+EKAN+++V+ I SGST YM PMNLSTI+ LD+RT
Sbjct  320   WDPFHPTEKANKLVVEQIMSGSTKYMKPMNLSTILTLDART  360



>ref|XP_009385316.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=366

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/338 (73%), Positives = 286/338 (85%), Gaps = 0/338 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVDNGNNNYLATTARAD PPYGID P+HRATGRFSN  N+PDI+SE LG E
Sbjct  29    RAFFVFGDSLVDNGNNNYLATTARADEPPYGIDTPSHRATGRFSNAKNVPDIVSEYLGAE  88

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             PTLP LSP L GEKLLVGANFASAG+GILNDTG QF NIIRI  QL YFE+YQ R+S LI
Sbjct  89    PTLPYLSPQLDGEKLLVGANFASAGIGILNDTGFQFANIIRINKQLHYFEQYQGRLSSLI  148

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             GA   K+LVN+ LVLITLGGNDFVNNYYLVP+S RSR+F++PDY+ +LISEY+KIL +LY
Sbjct  149   GAERTKKLVNEGLVLITLGGNDFVNNYYLVPYSVRSREFSLPDYIRYLISEYKKILMKLY  208

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             DLG RR +VTG GP+GCVPA LA RSR+G C  ++QR   L+NPQL Q+++ELNS+   D
Sbjct  209   DLGCRRFLVTGIGPLGCVPAILATRSRSGACDPEMQRVPDLYNPQLVQLMSELNSQYGDD  268

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VFVA N Y MHMDFI +P A+GFVTSKVACCGQGPYNG+GLCT  SNLCPNR+IYAFWD 
Sbjct  269   VFVAVNAYKMHMDFISDPAAYGFVTSKVACCGQGPYNGLGLCTVLSNLCPNRNIYAFWDA  328

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             +HP+EKANRIIV    +GS +YM+PMNLSTI+ +D+RT
Sbjct  329   YHPTEKANRIIVGQFMTGSNEYMNPMNLSTILAMDART  366



>ref|XP_008350788.1| PREDICTED: GDSL esterase/lipase At5g33370-like, partial [Malus 
domestica]
Length=319

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/319 (77%), Positives = 285/319 (89%), Gaps = 0/319 (0%)
 Frame = -3

Query  1200  ATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGA  1021
             ATTARAD  PYGIDYPTHR TGRFSNGLNIPD+ISE++G EPTLP LSP L G+KLLVGA
Sbjct  1     ATTARADNYPYGIDYPTHRPTGRFSNGLNIPDLISEQIGSEPTLPYLSPHLTGQKLLVGA  60

Query  1020  NFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLG  841
             NFASAG+GILNDTG+QF+NIIRI  QL+YF++YQ RV+ L+G  +A++LVN+ALVLITLG
Sbjct  61    NFASAGIGILNDTGIQFLNIIRIYKQLKYFQQYQTRVNALVGPEQAQRLVNEALVLITLG  120

Query  840   GNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVP  661
             GNDFVNNYYLVPFSARSRQF++PDYV +LISEYRK+L RLY+LGAR+V+VTGTGP+GC P
Sbjct  121   GNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKVLARLYELGARKVLVTGTGPLGCAP  180

Query  660   AELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQ  481
             AELAQRSR GECAV+LQRAA+LFNPQL  M+  LN ++ +DVFVAAN + MHMDFI NPQ
Sbjct  181   AELAQRSRRGECAVELQRAASLFNPQLVDMINSLNGQIGSDVFVAANAFQMHMDFISNPQ  240

Query  480   AFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGS  301
             A+GFVTSK+ACCGQGPYNGIGLCT ASNLCPNRD+YAFWD FHPSEKA+RII Q I +GS
Sbjct  241   AYGFVTSKIACCGQGPYNGIGLCTIASNLCPNRDLYAFWDAFHPSEKASRIIAQQILTGS  300

Query  300   TDYMHPMNLSTIMELDSRT  244
               YM+PMNLSTI+ LDS+T
Sbjct  301   NKYMNPMNLSTILALDSKT  319



>ref|XP_007147237.1| hypothetical protein PHAVU_006G107400g [Phaseolus vulgaris]
 gb|ESW19231.1| hypothetical protein PHAVU_006G107400g [Phaseolus vulgaris]
Length=365

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/355 (71%), Positives = 297/355 (84%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G +L L  + +V    A+ RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT +ATG
Sbjct  9     GTMLILFGIALVAGVEAKSRAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTGKATG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD+ISE +G E  LP LSP LKG+ LL GANFASAG+GILNDTG QF+NIIR
Sbjct  69    RFSNGLNIPDLISEGMGGESVLPYLSPQLKGDNLLNGANFASAGIGILNDTGAQFLNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  QL+YFEEYQ+RVS L G   AK+LVN+ALVLIT+GGNDFVNNYYLVP+SARSRQF++
Sbjct  129   MYRQLDYFEEYQQRVSILTGVARAKKLVNQALVLITVGGNDFVNNYYLVPYSARSRQFSL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
              +YV +LI EYRK+L RLYDLGARRVIVTGTGP+GCVPAELA R  +G C+ +LQRAA+L
Sbjct  189   QNYVKYLIVEYRKLLMRLYDLGARRVIVTGTGPMGCVPAELALRGTSGGCSAELQRAASL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             +NPQL  M+  LN ++  DVF+AANT  MH DF+ NP A+GF TS++ACCGQGPYNGIGL
Sbjct  249   YNPQLQHMIQGLNKKIGKDVFIAANTALMHNDFVNNPAAYGFTTSRIACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCP+R+++AFWDPFHPSEKA+RIIV+ I SGS  YM PMNLST++ LD+
Sbjct  309   CTPLSNLCPDRNLHAFWDPFHPSEKASRIIVEQIMSGSKRYMKPMNLSTVLALDA  363



>ref|XP_004953113.1| PREDICTED: GDSL esterase/lipase LTL1-like [Setaria italica]
Length=366

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/333 (76%), Positives = 284/333 (85%), Gaps = 0/333 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVDNGNNNYL TTARAD PPYGID+PTHRATGRFSNGLNIPDIISE LG EP 
Sbjct  30    FFVFGDSLVDNGNNNYLLTTARADAPPYGIDFPTHRATGRFSNGLNIPDIISEHLGAEPA  89

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSP+L+GEKLLVGANFASAGVGILNDTG+QF+NIIRIG+QL+YF EYQR++  LIG 
Sbjct  90    LPYLSPELRGEKLLVGANFASAGVGILNDTGIQFVNIIRIGDQLQYFREYQRKLRALIGE  149

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
              +A QLVN+ALVLITLGGNDFVNNYYLVP S RSRQ+ +PDYV F++SEYRKIL RLY+L
Sbjct  150   EQAAQLVNQALVLITLGGNDFVNNYYLVPMSVRSRQYALPDYVRFIVSEYRKILLRLYEL  209

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             GAR+VIVTGTGP+GCVPAELA  S+ GECA +L RA  LFNPQL  M   LN EL ADVF
Sbjct  210   GARKVIVTGTGPLGCVPAELALHSQNGECATELTRAVNLFNPQLVDMARGLNRELGADVF  269

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             V ANT  M+ D+I NP+ FGF   +VACCGQGPYNGIGLCT ASN+C NRD++AFWD FH
Sbjct  270   VTANTLRMNFDYINNPERFGFTNVQVACCGQGPYNGIGLCTPASNVCNNRDVFAFWDAFH  329

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             P+E+ANRIIV    +G TDYMHPMNLSTI+ +D
Sbjct  330   PTERANRIIVGQFMNGDTDYMHPMNLSTILAMD  362



>ref|XP_008443761.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Cucumis 
melo]
Length=366

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/358 (72%), Positives = 302/358 (84%), Gaps = 2/358 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             IL  +LA+      +AE  RAFFVFGDSLVDNGNNNYLATTARAD  PYGID+PTHR TG
Sbjct  9     ILGVVLAILAALTAQAEAGRAFFVFGDSLVDNGNNNYLATTARADSYPYGIDFPTHRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPD IS++LG E  LP L+P+L G +LL GANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDYISQQLGSEFLLPYLNPELNGRRLLDGANFASAGIGILNDTGIQFINIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             +  Q EYFEEYQRRV  +IG   AK+LV  ALVLIT+GGNDFVNNYYLVPFSARSRQ+++
Sbjct  129   MFRQFEYFEEYQRRVGRVIGDERAKELVKGALVLITVGGNDFVNNYYLVPFSARSRQYSL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQR-SRAGECAVDLQRAAA  598
             PDYV  LI EYRKIL RLY+LGARRV+VTGTGP+GCVPAELA R S  G+C+ +LQRAAA
Sbjct  189   PDYVNLLIVEYRKILLRLYELGARRVLVTGTGPLGCVPAELAMRGSTGGQCSAELQRAAA  248

Query  597   LFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIG  418
             L+NP+L QM+  LNS+L ++VFVA NT  MH+DFI NP+A+GF TSKVACCGQGPYNG+G
Sbjct  249   LYNPKLFQMIKGLNSQLGSNVFVAVNTQQMHIDFISNPRAYGFETSKVACCGQGPYNGLG  308

Query  417   LCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             LCT ASNLC NRD YAFWD FHPS+KAN IIV+ +FSG+T YM+PMNL+TI++LDS+T
Sbjct  309   LCTVASNLCSNRDAYAFWDAFHPSQKANGIIVKQMFSGTTQYMYPMNLTTILQLDSKT  366



>ref|NP_001053264.1| Os04g0507700 [Oryza sativa Japonica Group]
 emb|CAE04723.1| OSJNBa0043L24.11 [Oryza sativa Japonica Group]
 emb|CAE05693.2| OSJNBb0002J11.20 [Oryza sativa Japonica Group]
 dbj|BAF15178.1| Os04g0507700 [Oryza sativa Japonica Group]
 emb|CAH67339.1| OSIGBa0157A06.8 [Oryza sativa Indica Group]
 emb|CAH67558.1| OSIGBa0101P20.1 [Oryza sativa Indica Group]
 gb|EAY94790.1| hypothetical protein OsI_16569 [Oryza sativa Indica Group]
 gb|EAZ31291.1| hypothetical protein OsJ_15397 [Oryza sativa Japonica Group]
Length=368

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/335 (76%), Positives = 284/335 (85%), Gaps = 0/335 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNGLNIPDIISE LG +P 
Sbjct  32    FFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYLGSQPA  91

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSPDL+GE LLVGANFASAGVGILNDTG+QF+NIIRIG QL+ FE YQR ++  +G 
Sbjct  92    LPYLSPDLRGENLLVGANFASAGVGILNDTGIQFVNIIRIGQQLDNFENYQRNLAAFVGE  151

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
               A+Q+V ++LVLITLGGNDFVNNYYLVPFS RSRQF I DYVP+LISEYRKIL RL+DL
Sbjct  152   DAARQVVQQSLVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRLHDL  211

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             G RRVIVTGTG IGCVPAELA  S  GECA DL RAA LFNPQL +MLAELNSEL   VF
Sbjct  212   GPRRVIVTGTGMIGCVPAELAMHSIDGECATDLTRAADLFNPQLERMLAELNSELGGHVF  271

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             +AANT  +  DF+FNPQ +GFVT+KVACCGQGPYNGIGLCT ASN+C NRD+YA+WD FH
Sbjct  272   IAANTNKISFDFMFNPQDYGFVTAKVACCGQGPYNGIGLCTPASNVCANRDVYAYWDAFH  331

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             P+E+ANR+IV  I  GSTD++ PMNLSTI+ +D R
Sbjct  332   PTERANRLIVAQIMHGSTDHISPMNLSTILAMDER  366



>gb|KHN41491.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/344 (73%), Positives = 293/344 (85%), Gaps = 1/344 (0%)
 Frame = -3

Query  1272  GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGRFSNGLNIPDIIS  1096
               A  RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYP +HR TGRFSNG NIPD+IS
Sbjct  27    AEARPRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLIS  86

Query  1095  EKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQR  916
             ++L  E TLP LSP+L+G KLLVGANFASAG+GILNDTG+QF+N+IR+  QL+YF+EYQ 
Sbjct  87    QRLSAESTLPYLSPELRGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLQYFKEYQN  146

Query  915   RVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRK  736
             RV DLIGA + K LVNKALVLIT+GGNDFVNNY+LVP SARS+Q+ +P YV +LISEY+K
Sbjct  147   RVRDLIGASQTKSLVNKALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQK  206

Query  735   ILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELN  556
             +L+RLYDLGARRV+VTGTGP+GCVP+ELAQR R  +CA +LQ+AAALFNPQL QML  LN
Sbjct  207   LLKRLYDLGARRVLVTGTGPLGCVPSELAQRGRNEQCAPELQQAAALFNPQLEQMLLRLN  266

Query  555   SELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDI  376
              ++  DVF+AANT   H DF+ NPQ FGFVTS+VACCGQGPYNG+GLCT  SNLC NR+ 
Sbjct  267   RKIGKDVFIAANTGKTHNDFVSNPQQFGFVTSQVACCGQGPYNGLGLCTALSNLCSNREQ  326

Query  375   YAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  327   YAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDANT  370



>gb|ACU23502.1| unknown [Glycine max]
Length=370

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/358 (71%), Positives = 296/358 (83%), Gaps = 3/358 (1%)
 Frame = -3

Query  1311  ILLGLL---ALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRA  1141
             IL G++    + IV    A+ RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPT R 
Sbjct  12    ILFGMVLVVGVNIVPGVEAKARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRP  71

Query  1140  TGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNI  961
             TGRFSNGLNIPD+ISE++G E  LP LSP LK E LL GANFASAG+GILNDTG QF+NI
Sbjct  72    TGRFSNGLNIPDLISERMGGESVLPYLSPQLKSENLLNGANFASAGIGILNDTGSQFLNI  131

Query  960   IRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQF  781
             IR+  QL+YFEEYQ+RVS LIG   AK+LVN+ALVLIT+GGNDFVNNYYLVP+SARSRQ+
Sbjct  132   IRMYRQLDYFEEYQQRVSILIGVARAKKLVNQALVLITVGGNDFVNNYYLVPYSARSRQY  191

Query  780   TIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAA  601
             ++ DYV FLI EYRK+L RLYDLGARRVIVTGTGP+GCVPAELA R   G C+ +LQRAA
Sbjct  192   SLQDYVKFLIVEYRKLLMRLYDLGARRVIVTGTGPMGCVPAELAMRGTNGGCSAELQRAA  251

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             +L+NPQLT M+  LN ++  +VF+AANT  MH DF+ NP A+GF TS++ACCGQGPYNGI
Sbjct  252   SLYNPQLTHMIQGLNKKIGKEVFIAANTALMHNDFVSNPAAYGFTTSQIACCGQGPYNGI  311

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             GLCT   NLCPNR+ +AFWDPFHPSEKANR+IV+ I SG   YM PMNLST++ LD+R
Sbjct  312   GLCTPLFNLCPNRNSHAFWDPFHPSEKANRLIVEQIMSGFKRYMKPMNLSTVLALDAR  369



>ref|XP_011083094.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Sesamum 
indicum]
Length=363

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/339 (74%), Positives = 283/339 (83%), Gaps = 0/339 (0%)
 Frame = -3

Query  1260  CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGM  1081
              RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPT R TGRFSNG NIPD+IS+ LG 
Sbjct  25    ARAFFVFGDSLVDNGNNNYLVTTARADSPPYGIDYPTRRPTGRFSNGYNIPDLISQALGA  84

Query  1080  EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDL  901
             E TL  L+P+L+GEKLLVGANFASAG+GILNDTG+QF NIIRI  QL +FE+YQRRVS L
Sbjct  85    ESTLAYLNPELRGEKLLVGANFASAGIGILNDTGIQFANIIRIYQQLGFFEQYQRRVSGL  144

Query  900   IGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRL  721
             IG  E  QLVN ALVLITLGGNDFVNNY+L P + R  QF + DY  +LISEY+KIL RL
Sbjct  145   IGEDETIQLVNGALVLITLGGNDFVNNYFLTPITIRRLQFNLQDYSKYLISEYKKILMRL  204

Query  720   YDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKA  541
             YDLGARRV+VTGTGP+GCVPA LA RSR GECAV+ QRAAA+FNP L QM+  LN E+ +
Sbjct  205   YDLGARRVLVTGTGPLGCVPAVLATRSRNGECAVEPQRAAAIFNPLLVQMIGALNQEIGS  264

Query  540   DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWD  361
             +VFVA N   M  DFI NPQAFGF+TSKVACCGQGPYNG+GLCT  SNLCPNRD+YAFWD
Sbjct  265   NVFVAVNAMEMQNDFITNPQAFGFITSKVACCGQGPYNGLGLCTVLSNLCPNRDVYAFWD  324

Query  360   PFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             PFHP+E+ANR IV+ I +GS  YM+PMNLSTIM LDS+T
Sbjct  325   PFHPTERANRFIVRTILTGSDKYMYPMNLSTIMALDSKT  363



>ref|XP_009589092.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana tomentosiformis]
Length=363

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/354 (71%), Positives = 292/354 (82%), Gaps = 0/354 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I L +L  T V   +   RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPTHR TGR
Sbjct  9     IFLVVLIGTFVTCTKGAPRAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPTHRPTGR  68

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD+IS++LG EPTLP L P+L G+KLLVGANFASAG+GILNDTGVQF NIIRI
Sbjct  69    FSNGFNIPDLISQELGAEPTLPYLDPELTGDKLLVGANFASAGIGILNDTGVQFANIIRI  128

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL+ FE+YQ RVS L+G  + + LVNKALVLITLGGND+VNNY+  P SAR  Q+ + 
Sbjct  129   SQQLQNFEQYQARVSALLGEEQTQMLVNKALVLITLGGNDYVNNYFFTPVSARRLQYNLQ  188

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             D+  ++ISEYRKIL RLYDLGARRV+VTG+GP+GCVP+ LA RS  GECA + QRA+A+F
Sbjct  189   DFSVYIISEYRKILMRLYDLGARRVLVTGSGPLGCVPSSLASRSTNGECAEEPQRASAIF  248

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NP L QM+  LN EL +D+FVAAN  +M  DFI +PQAFGF+TSKVACCGQGPYNG+G+C
Sbjct  249   NPLLVQMIQSLNQELGSDIFVAANAVDMQNDFIRDPQAFGFITSKVACCGQGPYNGVGIC  308

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             T ASNLCPNRD+YAFWDPFHP+E+AN+IIVQ IF+GS  YM PMNLSTIM +DS
Sbjct  309   TAASNLCPNRDLYAFWDPFHPTERANKIIVQTIFTGSDKYMTPMNLSTIMAIDS  362



>gb|AES82718.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=370

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/341 (72%), Positives = 292/341 (86%), Gaps = 0/341 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             ++ RAFFVFGDSLVD+GNNNYL TTARAD PPYGIDYPT R TGRFSNGLNIPD+IS+KL
Sbjct  30    SKQRAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSNGLNIPDLISQKL  89

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G+E  LP LSP L+GEKLL GANFASAG+GILNDTGVQF+NIIR+  QL+YFEEYQ RV+
Sbjct  90    GIESVLPYLSPRLRGEKLLAGANFASAGIGILNDTGVQFLNIIRMYRQLDYFEEYQHRVA  149

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
              +IGA  A++LVNKALVLIT+GGNDFVNNYYLVP+SARSR++++ DYV FLI EYRK+L+
Sbjct  150   SMIGAARAEKLVNKALVLITVGGNDFVNNYYLVPYSARSREYSLQDYVKFLIIEYRKLLE  209

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLYD+GARRV+VTGTGP+GCVPAE+A R   G C+ +LQRAA L+NPQL  M+  LN ++
Sbjct  210   RLYDIGARRVLVTGTGPLGCVPAEMAMRGTDGGCSAELQRAATLYNPQLQHMVQGLNKKI  269

Query  546   KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAF  367
               DVF+A NT  +H DF+ NP+A+GF+TS++ACCGQG YNGIGLCT  SNLCP+RD+YAF
Sbjct  270   GKDVFIATNTALIHSDFVTNPKAYGFITSRIACCGQGAYNGIGLCTPLSNLCPDRDLYAF  329

Query  366   WDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             WD FHPSEKAN+IIV+ I SGS  YM+PMNLSTI+ LD  T
Sbjct  330   WDAFHPSEKANKIIVERILSGSKRYMNPMNLSTILALDDTT  370



>ref|XP_003590909.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES61160.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=367

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/336 (74%), Positives = 289/336 (86%), Gaps = 0/336 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDS+ DNGNNN+L TTARAD PPYGID+PTH  TGRFSNGLNIPD+ SE+LG+E
Sbjct  30    RAFFVFGDSVADNGNNNFLTTTARADAPPYGIDFPTHEPTGRFSNGLNIPDLTSERLGLE  89

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             P+LP LSP L GEKLLVGANFASAGVGILNDTG QF+ II IG QL+ F +YQ+++S  I
Sbjct  90    PSLPYLSPLLVGEKLLVGANFASAGVGILNDTGFQFLQIIHIGKQLDLFNQYQQKLSAQI  149

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             GA  AKQLVNKA+VLI LGGNDFVNNYYLVPFSARSRQF++P+YV +LISEY+KILQRLY
Sbjct  150   GAEGAKQLVNKAIVLIMLGGNDFVNNYYLVPFSARSRQFSLPNYVTYLISEYKKILQRLY  209

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             DLGARRV+VTGTGP+GC PAELA +SR G+C  +L RAA+L+NPQL QM+ +LN E+  D
Sbjct  210   DLGARRVLVTGTGPMGCAPAELALKSRNGDCDAELMRAASLYNPQLVQMITQLNREIGDD  269

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+A N + MHMDFI NP+AFGFVT+K ACCGQG +NGIGLCT  S LCPNR++YAFWD 
Sbjct  270   VFIAVNAHKMHMDFITNPKAFGFVTAKDACCGQGRFNGIGLCTPISKLCPNRNLYAFWDA  329

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             FHPSEKA+RIIVQ +F GS  YM+PMNLST++ +DS
Sbjct  330   FHPSEKASRIIVQQMFIGSNLYMNPMNLSTVLAMDS  365



>ref|XP_003618755.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES74973.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=366

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/359 (70%), Positives = 300/359 (84%), Gaps = 3/359 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAEC--RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDY-PTHRA  1141
             + L +L +  +F    E   R F VFGDSLVDNGNNNYLATTARAD PPYGIDY P+HR 
Sbjct  8     VALVILVVGGIFVHEIEAIPRTFLVFGDSLVDNGNNNYLATTARADAPPYGIDYQPSHRP  67

Query  1140  TGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNI  961
             TGRFSNG NIPDIIS+KLG EPTLP LSP+L+GEKLLVGANFASAG+GILNDTG+QF+NI
Sbjct  68    TGRFSNGYNIPDIISQKLGAEPTLPYLSPELRGEKLLVGANFASAGIGILNDTGIQFINI  127

Query  960   IRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQF  781
             IR+  Q EYF+EYQ R+S LIGA +AK  VN+ALVLIT+GGNDFVNNYYLVP+SARSRQ+
Sbjct  128   IRMYRQYEYFQEYQSRLSALIGASQAKSRVNQALVLITVGGNDFVNNYYLVPYSARSRQY  187

Query  780   TIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAA  601
              +P+YV +LISEY+K+LQ+LYDLGARRV+VTGTGP+GCVP+E+AQR R G+C+ +LQRA+
Sbjct  188   PLPEYVKYLISEYQKLLQKLYDLGARRVLVTGTGPMGCVPSEIAQRGRNGQCSTELQRAS  247

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             +LFNPQL  ML  LN ++  DVF+AANT   H++FI NP  +GF TSK+ACCGQGP NGI
Sbjct  248   SLFNPQLENMLLGLNKKIGRDVFIAANTGKTHLNFINNPGQYGFKTSKIACCGQGPNNGI  307

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             GLCTQ SNLC NRD+ AFWD FHPSEKAN++IV  I +G+  YM+PMNLSTI+ LD+ T
Sbjct  308   GLCTQLSNLCSNRDLNAFWDAFHPSEKANKLIVNDIMTGTKAYMNPMNLSTILALDATT  366



>ref|XP_009766488.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana sylvestris]
Length=366

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/354 (70%), Positives = 291/354 (82%), Gaps = 0/354 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             I L ++    V +     RAFFVFGDSLVDNGNNNYLAT+ARAD PPYG+DYPTHR TGR
Sbjct  12    IFLAMVTANFVTYTEGAPRAFFVFGDSLVDNGNNNYLATSARADSPPYGVDYPTHRPTGR  71

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD+IS++LG EPTLP L P L G+KLLVGANFASAG+GILNDTG+QF NIIR+
Sbjct  72    FSNGFNIPDLISQQLGAEPTLPYLDPALTGDKLLVGANFASAGIGILNDTGIQFANIIRM  131

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QLE F++YQ+RVS LIGA E ++LVN AL+LITLGGND+VNNY+L P SAR  Q+ I 
Sbjct  132   PRQLELFQQYQQRVSALIGAEETQRLVNNALILITLGGNDYVNNYFLTPVSARRIQYNIQ  191

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DY  +L+++YRKIL+RL+DLG RRV+VTGTGP+GCVPAELA RS  GECA + Q+AAA F
Sbjct  192   DYSRYLVTKYRKILKRLHDLGGRRVLVTGTGPLGCVPAELATRSSNGECAKEPQQAAAAF  251

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NP L QM+  LN EL +D+FVA N   M  DFI NP+AFGFVTSK+ACCGQGPYNGIGLC
Sbjct  252   NPLLVQMIKRLNQELGSDIFVAVNAMEMQNDFINNPKAFGFVTSKIACCGQGPYNGIGLC  311

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             T ASNLCPNR+ YAFWDPFHPSEKAN+IIV+ I+SGS  Y+ PMNLSTIM +DS
Sbjct  312   TAASNLCPNREEYAFWDPFHPSEKANKIIVKTIYSGSDKYITPMNLSTIMAIDS  365



>ref|XP_009587010.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana tomentosiformis]
Length=367

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/356 (71%), Positives = 294/356 (83%), Gaps = 1/356 (0%)
 Frame = -3

Query  1314  GILLGLLAL-TIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRAT  1138
              I L +++  T V +     RAFFVFGDSLVDNGNNNYLAT+ARAD PPYG+DYPTHR T
Sbjct  11    AIFLAMVSTATFVTYTEGAARAFFVFGDSLVDNGNNNYLATSARADSPPYGVDYPTHRPT  70

Query  1137  GRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNII  958
             GRFSNGLNIPD+IS++LG EPTLP L P L G+KLLVGANFASAG+GILNDTG+QF NII
Sbjct  71    GRFSNGLNIPDLISQQLGAEPTLPYLDPALTGDKLLVGANFASAGIGILNDTGIQFANII  130

Query  957   RIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFT  778
             R+  QLE F+EYQ+RVS LIGA + ++LVN AL+LITLGGND+VNNY+L P SAR  Q+ 
Sbjct  131   RMPRQLELFQEYQQRVSALIGAEQTQRLVNNALILITLGGNDYVNNYFLTPVSARRIQYN  190

Query  777   IPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAA  598
             I DY  +L++EYRKIL+RL DLGARRV+VTGTGP+GCVPAELA RS  G+CA + Q+AAA
Sbjct  191   IQDYSRYLVTEYRKILKRLDDLGARRVLVTGTGPLGCVPAELAMRSSNGDCAKEPQQAAA  250

Query  597   LFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIG  418
              FNP L QM+  LN EL +D+FVA N   M  DFI NP+AFGFVTSK+ACCGQGP+NGIG
Sbjct  251   AFNPLLVQMIKRLNQELGSDIFVAVNAMEMQNDFINNPKAFGFVTSKIACCGQGPFNGIG  310

Query  417   LCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             LCT ASNLCPNR+ YAFWDPFHPSEKAN+IIV+ I+SGS  Y+ PMNLSTIM +DS
Sbjct  311   LCTAASNLCPNREEYAFWDPFHPSEKANKIIVKTIYSGSDKYITPMNLSTIMAIDS  366



>ref|NP_001241754.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG35356.1| anther-specific proline-rich protein APG [Zea mays]
Length=369

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/337 (74%), Positives = 288/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNGLNIPDIISE LG +
Sbjct  31    RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHLPTGRFSNGLNIPDIISEHLGSQ  90

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             P LP LSPDL+G++LLVGANFASAGVGILNDTG+QF+NII IG QL  F++YQ+R++  +
Sbjct  91    PALPYLSPDLRGDQLLVGANFASAGVGILNDTGIQFVNIIGIGQQLHNFQDYQQRLAAFV  150

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G   A+Q+V+ ALVLITLGGNDFVNNYYLVPFS RSRQF I DYVP+LISEYRKIL RLY
Sbjct  151   GDDAARQVVSNALVLITLGGNDFVNNYYLVPFSFRSRQFAIQDYVPYLISEYRKILTRLY  210

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             +LGARRV+VTGTG IGCVPAELA  S  GECA DL  AA LFNPQL QML++LN+ +  D
Sbjct  211   ELGARRVVVTGTGMIGCVPAELAMHSIDGECARDLTEAADLFNPQLVQMLSDLNAAIGGD  270

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AANT  +  DF+FNPQ +GFVT+KVACCGQGPYNGIGLCT ASN+CPNRD+YA+WD 
Sbjct  271   VFIAANTNRLSFDFMFNPQDYGFVTAKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDA  330

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FHP+E+ANRIIV     GSTD++ PMN+STI+ +D+R
Sbjct  331   FHPTERANRIIVAQFMHGSTDHISPMNISTILAMDNR  367



>gb|EMT19317.1| GDSL esterase/lipase [Aegilops tauschii]
Length=369

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/334 (74%), Positives = 283/334 (85%), Gaps = 0/334 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVD+GNNNYLATTARAD PPYG+DYPTHRATGRFSNGLN+PDIISE LG EP 
Sbjct  32    FFVFGDSLVDSGNNNYLATTARADSPPYGLDYPTHRATGRFSNGLNVPDIISEHLGAEPV  91

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSP L G KLL GANFASAGVGILNDTG+QF+NIIRI  QL YFE+YQ RV  LIG 
Sbjct  92    LPYLSPHLDGHKLLGGANFASAGVGILNDTGIQFVNIIRIQKQLRYFEQYQSRVRRLIGE  151

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
                ++LV  ALVLITLGGNDFVNNYYL+PFSARSRQF +PDY+ +LI+EY+ ILQ+L+ L
Sbjct  152   PATQRLVRSALVLITLGGNDFVNNYYLLPFSARSRQFALPDYIRYLIAEYKTILQQLHGL  211

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             GARRV+VTG+GPIGC PAELA RS  GEC ++LQRAAAL+NPQL QM  +LN++  ADVF
Sbjct  212   GARRVLVTGSGPIGCAPAELATRSANGECDLELQRAAALYNPQLVQMTKDLNAQFGADVF  271

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             VA N Y MHMDFI  P A+GFVTSKVACCGQGPYNG+GLCT  S++CP+R +YAFWD FH
Sbjct  272   VAVNAYRMHMDFISAPAAYGFVTSKVACCGQGPYNGVGLCTAMSSVCPDRSLYAFWDNFH  331

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             P+E+ANRIIV    +GS DYMHP+NLSTI+ +D+
Sbjct  332   PTERANRIIVSQFMAGSPDYMHPLNLSTILAMDA  365



>ref|XP_009801786.1| PREDICTED: GDSL esterase/lipase LTL1-like [Nicotiana sylvestris]
Length=361

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/344 (72%), Positives = 287/344 (83%), Gaps = 0/344 (0%)
 Frame = -3

Query  1281  VFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDI  1102
              F    E RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPTHR TGRFSNG NIPD+
Sbjct  17    TFVTCTEARAFFVFGDSLVDNGNNNYLLTSARADSPPYGIDYPTHRPTGRFSNGFNIPDL  76

Query  1101  ISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEY  922
             IS++LG EPTLP L P+L G+KLLVGANFASAG+GILNDTGVQF NIIRI  QL+ FE+Y
Sbjct  77    ISQELGAEPTLPYLDPELTGDKLLVGANFASAGIGILNDTGVQFANIIRISQQLQNFEQY  136

Query  921   QRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEY  742
             Q RVS L+G  + + LVNKALVLITLGGND+VNNY+  P SAR  Q+ + D+  ++ISEY
Sbjct  137   QARVSALLGEEQTQMLVNKALVLITLGGNDYVNNYFFTPLSARRLQYNLEDFSVYIISEY  196

Query  741   RKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAE  562
             RKIL RLYDLGARRV+VTG+GP+GCVP+ LA RS  GECA + QRA+A+FNP L +M+  
Sbjct  197   RKILMRLYDLGARRVLVTGSGPLGCVPSSLASRSTNGECAEEPQRASAIFNPLLVEMILS  256

Query  561   LNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNR  382
             LN EL +DVFVAAN  +M  DFI +PQAFGF+TSKVACCGQGPYNG+G+CT ASNLCPNR
Sbjct  257   LNQELGSDVFVAANAVDMQNDFIRDPQAFGFITSKVACCGQGPYNGVGICTAASNLCPNR  316

Query  381   DIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             D+YAFWDPFHP+E+AN+IIVQ IF+GS  YM PMNLSTIM +DS
Sbjct  317   DLYAFWDPFHPTERANKIIVQTIFTGSDKYMTPMNLSTIMAIDS  360



>gb|KHN14886.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/344 (73%), Positives = 292/344 (85%), Gaps = 1/344 (0%)
 Frame = -3

Query  1272  GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGRFSNGLNIPDIIS  1096
               A  RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYP THR TGRFSNG NIPD+IS
Sbjct  27    AEARPRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPTHRPTGRFSNGYNIPDLIS  86

Query  1095  EKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQR  916
             ++LG E TLP LSP+L G KLLVGANFASAG+GILNDTG+QF+N+IR+  QL YF+EYQ 
Sbjct  87    QRLGAESTLPYLSPELSGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLHYFKEYQN  146

Query  915   RVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRK  736
             RV  LIGA +AK LVNKALVLIT+GGNDFVNNY+LVP SARS+Q+ +P YV +LISEY+K
Sbjct  147   RVRALIGASQAKSLVNKALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQK  206

Query  735   ILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELN  556
             +L++LYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AAALFNPQL +ML  LN
Sbjct  207   LLKKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEKMLLRLN  266

Query  555   SELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDI  376
              ++  D+F+AANT   H DF+ NPQ FGF TS+VACCGQGPYNG+GLCT  SNLC NR+ 
Sbjct  267   RKIGKDIFIAANTGKTHNDFVSNPQQFGFFTSQVACCGQGPYNGLGLCTALSNLCTNREQ  326

Query  375   YAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  327   YAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDANT  370



>ref|NP_001132075.1| uncharacterized protein LOC100193489 precursor [Zea mays]
 ref|XP_008661412.1| PREDICTED: uncharacterized protein LOC100193489 isoform X1 [Zea 
mays]
 gb|ACF80762.1| unknown [Zea mays]
 gb|AFW58801.1| anther-specific proline-rich protein APG [Zea mays]
Length=367

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/337 (74%), Positives = 287/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNGLNIPDIISE LG +
Sbjct  29    RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHLPTGRFSNGLNIPDIISEHLGSQ  88

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             P LP LSPDL+G++LLVGANFASAGVGILNDTG+QF+NII IG QL  F++YQ+R++  +
Sbjct  89    PALPYLSPDLRGDQLLVGANFASAGVGILNDTGIQFVNIIGIGQQLHNFQDYQQRLAAFV  148

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G   A+Q+V+ ALVLITLGGNDFVNNYYLVPFS RSRQF I DYVP+LISEYRKIL RLY
Sbjct  149   GDDAARQVVSNALVLITLGGNDFVNNYYLVPFSFRSRQFAIQDYVPYLISEYRKILTRLY  208

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             +LGARRV+VTGTG IGC PAELA  S  GECA DL  AA LFNPQL QML++LN+ +  D
Sbjct  209   ELGARRVVVTGTGMIGCAPAELAMHSIDGECARDLTEAADLFNPQLVQMLSDLNAAIGGD  268

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VF+AANT  +  DF+FNPQ +GFVT+KVACCGQGPYNGIGLCT ASN+CPNRD+YA+WD 
Sbjct  269   VFIAANTNRLSFDFMFNPQDYGFVTAKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDA  328

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FHP+E+ANRIIV     GSTD++ PMN+STI+ +D+R
Sbjct  329   FHPTERANRIIVAQFMHGSTDHISPMNISTILAMDNR  365



>dbj|BAK06471.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/336 (74%), Positives = 283/336 (84%), Gaps = 0/336 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             R FFVFGDSLVD+GNNNYLATTARAD  PYG+DYPTHRATGRFSNGLN+PDIISE LG E
Sbjct  34    RPFFVFGDSLVDSGNNNYLATTARADSAPYGLDYPTHRATGRFSNGLNVPDIISEHLGAE  93

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             P LP LSP L G KLLVGANFASAGVGILNDTG+QF+NIIRI  QL YFE+YQ RV  LI
Sbjct  94    PVLPYLSPHLDGHKLLVGANFASAGVGILNDTGIQFVNIIRIQKQLRYFEQYQGRVRRLI  153

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G    ++LV  ALVLITLGGNDFVNNYYL+P SARSRQF +PDYV +LI+EY+ ILQ+L+
Sbjct  154   GEPATQRLVRSALVLITLGGNDFVNNYYLLPVSARSRQFALPDYVRYLIAEYKTILQQLH  213

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
              LGARRV+VTG+GPIGC PAELA RS  GEC ++LQRAAAL+NPQL Q+  ELN++  AD
Sbjct  214   GLGARRVLVTGSGPIGCAPAELATRSANGECDLELQRAAALYNPQLVQITKELNAQFGAD  273

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VFVA N Y MHMDFI  P A+GFVTSKVACCGQGPYNG+GLCT  S++CP+R +YAFWD 
Sbjct  274   VFVAVNAYRMHMDFISAPAAYGFVTSKVACCGQGPYNGVGLCTAMSSVCPDRSLYAFWDN  333

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             FHP+E+ANRIIV    +GS DYMHP+NLSTI+ +D+
Sbjct  334   FHPTERANRIIVSQFMAGSPDYMHPLNLSTILAMDA  369



>dbj|BAK07334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/355 (69%), Positives = 294/355 (83%), Gaps = 2/355 (1%)
 Frame = -3

Query  1305  LGLLALTIVFFGR-AEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             L ++AL +V     +EC RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTHRATGR
Sbjct  14    LAMMALGVVLLAAPSECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRATGR  73

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNGLNIPDIISE+LG EPTLP L P+L G KLLVGANFASAGVGILNDTG+QF+NI+R+
Sbjct  74    FSNGLNIPDIISEQLGAEPTLPYLCPELHGAKLLVGANFASAGVGILNDTGIQFVNIVRM  133

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               QL YF EYQ ++  L+GA +A Q+VN+ALVLITLGGNDFVNNYYL+PFS RSRQF++P
Sbjct  134   SRQLHYFGEYQGKLRALVGASQATQIVNRALVLITLGGNDFVNNYYLIPFSLRSRQFSLP  193

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LI+EY+KIL RLY++GARRV+VTGTGP+GC PAELA RSR GEC  DL RAA LF
Sbjct  194   DYVRYLIAEYKKILMRLYEMGARRVLVTGTGPLGCAPAELALRSRDGECDRDLMRAAELF  253

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL+Q+L +LN+      F+AAN++ +H DFI NP A+GF T+K ACCGQGP+NG+GLC
Sbjct  254   NPQLSQILEDLNARYGDGTFIAANSFRVHFDFISNPAAYGFRTAKEACCGQGPHNGVGLC  313

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             T  SNLC +RD Y FWD +HP+E+ANRIIV    +GS DY+ P+NLST + +D+R
Sbjct  314   TAVSNLCADRDQYVFWDSYHPTERANRIIVSQFMTGSLDYVSPLNLSTALHIDAR  368



>gb|ABX75139.1| lipase [Gossypium hirsutum]
Length=367

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/356 (69%), Positives = 299/356 (84%), Gaps = 0/356 (0%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGR  1132
             ++LG+L         A  RAFFVFGDSLVDNGNNNYLATTARAD PPYGID P+   TGR
Sbjct  10    LILGVLMAISSTQVEAAARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDTPSRHPTGR  69

Query  1131  FSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRI  952
             FSNG NIPD I++ LG EPTLP LSP+LKG+KLLVGANFASAG+GIL+DTG+QFMNIIR+
Sbjct  70    FSNGKNIPDFITDALGSEPTLPYLSPELKGDKLLVGANFASAGIGILDDTGIQFMNIIRM  129

Query  951   GNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIP  772
               Q +YFEEYQ++++DL+G  EA+++V++ALVLIT+GGNDFVNNY+LVPFSARSRQF +P
Sbjct  130   FRQFQYFEEYQKKLADLVGKDEAQRIVSEALVLITVGGNDFVNNYFLVPFSARSRQFNLP  189

Query  771   DYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALF  592
             DYV +LISEYRK+L RLYDLGAR+V+VTGTGP+GCVPAELA RS +G+CA +LQ+AAAL+
Sbjct  190   DYVRYLISEYRKLLVRLYDLGARKVLVTGTGPLGCVPAELAMRSPSGQCATELQQAAALY  249

Query  591   NPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLC  412
             NPQL +M+  LNS+L A++F+AANT     DFI NP A+GF TSK+ACCGQGPYNG+GLC
Sbjct  250   NPQLVEMVNGLNSQLGANIFIAANTQQQTSDFISNPGAYGFTTSKIACCGQGPYNGLGLC  309

Query  411   TQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             TQ SNLC NR+ Y FWD FHPSE+AN IIV  I +GST YM+PMNL+  + LD++T
Sbjct  310   TQLSNLCSNRNEYVFWDAFHPSERANGIIVDMILNGSTSYMNPMNLNAFLALDTKT  365



>emb|CDP03830.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/353 (71%), Positives = 290/353 (82%), Gaps = 1/353 (0%)
 Frame = -3

Query  1302  GLLALTIVFFGRAEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFS  1126
              ++   ++   +AE  RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTHR TGRFS
Sbjct  15    AIVVAVVLLLPQAEAARAFFVFGDSLVDNGNNNYLLTTARADSPPYGIDYPTHRPTGRFS  74

Query  1125  NGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGN  946
             NG NIPD+IS+ LG E TLP LSP+L GEKLLVGANFASAG+GILNDTG+QF NIIRI  
Sbjct  75    NGYNIPDLISQALGAESTLPYLSPELNGEKLLVGANFASAGIGILNDTGIQFANIIRIAQ  134

Query  945   QLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDY  766
             QLE F  YQ+R+  LIGA +A+Q VN+ALVLITLGGND+VNNY+L P SAR  Q+ I DY
Sbjct  135   QLELFARYQQRLGALIGADQAEQRVNQALVLITLGGNDYVNNYFLTPLSARRLQYNIQDY  194

Query  765   VPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNP  586
               FLISEYRKIL RLY+LGARRV+VTGTGPIGCVP ELA RSR GECA + Q+AAA+FNP
Sbjct  195   SVFLISEYRKILLRLYELGARRVLVTGTGPIGCVPGELATRSRNGECAEEPQQAAAIFNP  254

Query  585   QLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQ  406
              L QM+  LN +L ++VFVA N   M  DFI +P+AFGFVTSKVACCGQG +NG+GLCT 
Sbjct  255   LLIQMIQGLNQDLGSNVFVAVNAMQMQYDFITSPRAFGFVTSKVACCGQGAFNGVGLCTA  314

Query  405   ASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             ASNLCP+R++YAFWDPFHP+E+AN+IIVQ I +GS  YM PMNLSTIM LDS+
Sbjct  315   ASNLCPDRNVYAFWDPFHPTERANKIIVQTIITGSDKYMTPMNLSTIMALDSK  367



>ref|NP_001047441.1| Os02g0617400 [Oryza sativa Japonica Group]
 dbj|BAD21448.1| putative anther-specific proline-rich protein [Oryza sativa Japonica 
Group]
 dbj|BAF09355.1| Os02g0617400 [Oryza sativa Japonica Group]
 gb|EAZ23825.1| hypothetical protein OsJ_07539 [Oryza sativa Japonica Group]
Length=367

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/333 (74%), Positives = 283/333 (85%), Gaps = 0/333 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTH+ATGRFSNGLNIPDIISE LG EP 
Sbjct  29    FFVFGDSLVDNGNNNYLITTARADAPPYGIDYPTHQATGRFSNGLNIPDIISEHLGAEPA  88

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSP+L+G+KLLVGANFASAGVGILNDTGVQF+NIIRIG+QL+YF EYQR++  L+G 
Sbjct  89    LPYLSPELRGDKLLVGANFASAGVGILNDTGVQFVNIIRIGDQLQYFREYQRKLRALVGE  148

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
              +AK++VN ALVLITLGGNDFVNNYYLVP S RSRQ+ I DYVPF+ISEYRKIL RLY+L
Sbjct  149   EQAKRIVNGALVLITLGGNDFVNNYYLVPMSVRSRQYAIQDYVPFIISEYRKILSRLYEL  208

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             GARRVIVTGTGP+GCVPAELA  SR GECA +L RA  L+NPQL  M+  LN  + A+VF
Sbjct  209   GARRVIVTGTGPLGCVPAELALHSRRGECAAELTRAVDLYNPQLVNMVRGLNRAIGAEVF  268

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             V ANT  M+ D+I NPQ +GF   +VACCGQGPYNGIGLCT ASN+C +R+ +AFWD FH
Sbjct  269   VTANTNRMNFDYISNPQNYGFTNVQVACCGQGPYNGIGLCTAASNVCDDREAFAFWDAFH  328

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             P+EKANRI+V     GST+YMHPMNLSTI+ +D
Sbjct  329   PTEKANRIVVGQFMHGSTEYMHPMNLSTILAVD  361



>gb|EAY86703.1| hypothetical protein OsI_08086 [Oryza sativa Indica Group]
Length=367

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/333 (74%), Positives = 283/333 (85%), Gaps = 0/333 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTH+ATGRFSNGLNIPDIISE LG EP 
Sbjct  29    FFVFGDSLVDNGNNNYLITTARADAPPYGIDYPTHQATGRFSNGLNIPDIISEHLGAEPA  88

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSP+L+G+KLLVGANFASAGVGILNDTGVQF+NIIRIG+QL+YF EYQR++  L+G 
Sbjct  89    LPYLSPELRGDKLLVGANFASAGVGILNDTGVQFVNIIRIGDQLQYFREYQRKLRALVGE  148

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
              +AK++VN ALVLITLGGNDFVNNYYLVP S RSRQ+ I DYVPF+ISEYRKIL RLY+L
Sbjct  149   EQAKRIVNGALVLITLGGNDFVNNYYLVPMSVRSRQYAIQDYVPFIISEYRKILSRLYEL  208

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             GARRVIVTGTGP+GCVPAELA  SR GECA +L RA  L+NPQL  M+  LN  + A+VF
Sbjct  209   GARRVIVTGTGPLGCVPAELALHSRRGECAAELTRAVDLYNPQLVNMVRGLNRAIGAEVF  268

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             V ANT  M+ D+I NPQ +GF   +VACCGQGPYNGIGLCT ASN+C +R+ +AFWD FH
Sbjct  269   VTANTNRMNFDYISNPQNYGFTNVQVACCGQGPYNGIGLCTAASNVCDDREAFAFWDAFH  328

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             P+EKANRI+V     GST+YMHPMNLSTI+ +D
Sbjct  329   PTEKANRIVVGQFMHGSTEYMHPMNLSTILAVD  361



>ref|NP_001146251.1| hypothetical protein precursor [Zea mays]
 gb|ACL53571.1| unknown [Zea mays]
 tpg|DAA48526.1| TPA: hypothetical protein ZEAMMB73_975942 [Zea mays]
Length=384

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/339 (72%), Positives = 285/339 (84%), Gaps = 1/339 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVD+GNNNYLATTARAD PPYG+DYPTHRATGRFSNG N+PDIISE LG E
Sbjct  41    RAFFVFGDSLVDSGNNNYLATTARADSPPYGLDYPTHRATGRFSNGKNVPDIISEYLGAE  100

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             P LP LSP L G KLLVGANFASAGVG+LNDTGVQF NIIR+  QL YF +YQ R+S L+
Sbjct  101   PALPYLSPHLDGRKLLVGANFASAGVGVLNDTGVQFANIIRVQKQLRYFRQYQDRLSRLV  160

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G   A +LV  ALVL+TLGGNDF+NNYYLVPFSARSR+F +PDYV +++SEY K+L++LY
Sbjct  161   GEDAAARLVRGALVLVTLGGNDFINNYYLVPFSARSREFALPDYVRYVVSEYAKVLRQLY  220

Query  717   DLGARRVIVTGTGPIGCVPAELAQR-SRAGECAVDLQRAAALFNPQLTQMLAELNSELKA  541
              LGARRV+VTG+GP+GC PAELA R SR GEC  +LQRAAAL+NPQL  M+  +N+EL A
Sbjct  221   SLGARRVLVTGSGPLGCAPAELALRGSRDGECDAELQRAAALYNPQLVDMIKGVNAELGA  280

Query  540   DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWD  361
             DVFVA N Y MHMDFI +P A+GFVTSKVACCGQGPYNG+GLCT AS++CP+R +YAFWD
Sbjct  281   DVFVAVNAYRMHMDFISDPAAYGFVTSKVACCGQGPYNGVGLCTAASSVCPDRSVYAFWD  340

Query  360   PFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
              FHP+EKANRIIV     G  +YMHP+NLSTI+ +D+R 
Sbjct  341   NFHPTEKANRIIVSQFMDGPQEYMHPLNLSTILAVDARA  379



>ref|XP_004292262.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Fragaria vesca 
subsp. vesca]
Length=357

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/353 (71%), Positives = 297/353 (84%), Gaps = 4/353 (1%)
 Frame = -3

Query  1296  LALTIVFFG--RAEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFS  1126
             L L ++  G  +AE  RAFFVFGDSLVDNGNNNYLATTARAD PPYGID+PTHR TG FS
Sbjct  5     LVLMVILPGPPQAEAARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDFPTHRPTGHFS  64

Query  1125  NGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGN  946
             NGLN+PD++SE++G E  LP LS +L G+KLL GANFASAG+GILNDTGVQF+NIIRI  
Sbjct  65    NGLNLPDLVSEQMGSELLLPYLSSELTGQKLLTGANFASAGIGILNDTGVQFVNIIRIFK  124

Query  945   QLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDY  766
             Q E F++YQ+RVS LIG  +AK+LVN ALVL+TLGGNDFVNNY+LVPFSARSRQ++I  Y
Sbjct  125   QFELFQQYQQRVSALIGGAQAKRLVNDALVLVTLGGNDFVNNYFLVPFSARSRQYSISQY  184

Query  765   VPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNP  586
               +LISEYRKIL RLY+LG RRV+VTGTGP+GCVPA +AQRSR GECA +LQRAAA+FNP
Sbjct  185   SQYLISEYRKILLRLYELGGRRVLVTGTGPLGCVPAAMAQRSRNGECAPELQRAAAIFNP  244

Query  585   QLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQ  406
              L QM+  LN++L  + FVAAN +   MDF+ NP+ +GFVTS+V CCGQGPYNG+GLCT 
Sbjct  245   LLVQMVQGLNAQLGTEAFVAANAH-ASMDFLSNPRKYGFVTSRVVCCGQGPYNGVGLCTP  303

Query  405   ASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
              SNLC NRD+YAFWDPFHPSE+ANR+IVQ + +GS+ YM+PMNLSTIM +DSR
Sbjct  304   LSNLCSNRDVYAFWDPFHPSERANRLIVQTMMTGSSKYMNPMNLSTIMAMDSR  356



>emb|CDY42916.1| BnaC05g47350D [Brassica napus]
Length=366

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/355 (73%), Positives = 296/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAF+VFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GFLISLFFIVTFLAPQVKSRAFYVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEAIGMPSTLPYLSPQLTGENLLVGANFASAGIGILNDTGIQFVNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q EYF++YQ+RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQFT+
Sbjct  129   ISKQFEYFQQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFTL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL++LY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYGKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL  ++A +N+E+  DVFVAAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPQLVNLIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I +GS+ YMHPMNLST+M LDS
Sbjct  309   CTPISNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>ref|XP_003580102.1| PREDICTED: GDSL esterase/lipase LTL1 [Brachypodium distachyon]
Length=375

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/341 (74%), Positives = 287/341 (84%), Gaps = 1/341 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             +  RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTH  TGRFSNGLNIPDIISE L
Sbjct  34    SAARAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDYPTHLPTGRFSNGLNIPDIISEYL  93

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G EP LP LSP+L+GE LLVGANFASAGVGILNDTGVQF+NIIRI  QL+ F+ YQ++++
Sbjct  94    GSEPALPYLSPNLRGENLLVGANFASAGVGILNDTGVQFVNIIRIAQQLQNFQAYQQKLA  153

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
               +G   A+Q V++ALVLITLGGNDFVNNYYLVPFSARS+QF I DYVP++ISEY+KIL 
Sbjct  154   AYVGEDAARQRVSQALVLITLGGNDFVNNYYLVPFSARSQQFEIHDYVPYIISEYKKILA  213

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLY+LGARRV+VTGTG IGCVPAELA  S  G CA DL RAA LFNPQL QML ELNSEL
Sbjct  214   RLYELGARRVVVTGTGMIGCVPAELAMHSLDGSCAPDLTRAADLFNPQLEQMLTELNSEL  273

Query  546   -KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
                DVF+AANT     DF+FNPQ +GFVT+K+ACCGQGPYNGIGLCT ASN+C NRD+YA
Sbjct  274   GHDDVFLAANTNRASFDFMFNPQQYGFVTAKIACCGQGPYNGIGLCTPASNVCANRDVYA  333

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             +WD FHP+E+ANRIIV     GSTD++ PMNLST++ +D+R
Sbjct  334   YWDAFHPTERANRIIVGNFMHGSTDHISPMNLSTVLAMDNR  374



>ref|XP_003554996.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/344 (72%), Positives = 291/344 (85%), Gaps = 1/344 (0%)
 Frame = -3

Query  1272  GRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP-THRATGRFSNGLNIPDIIS  1096
               A  RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYP +HR TGRFSNG NIPD+IS
Sbjct  27    AEARPRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLIS  86

Query  1095  EKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQR  916
             ++LG E TLP LSP+L G KLLVGANFASAG+GILNDTG+QF+N+IR+  QL YF+EYQ 
Sbjct  87    QRLGAESTLPYLSPELSGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLHYFKEYQN  146

Query  915   RVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRK  736
             RV  LIGA +AK LVNKALVLIT+GGNDFVNNY+LVP SARS+Q+ +P YV +LISEY+K
Sbjct  147   RVRALIGASQAKSLVNKALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQK  206

Query  735   ILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELN  556
             +L++LYDLGARRV+VTGTGP+GCVP+ELAQR R G+CA +LQ+AA LFNPQL +ML  LN
Sbjct  207   LLKKLYDLGARRVLVTGTGPLGCVPSELAQRGRNGQCAPELQQAATLFNPQLEKMLLRLN  266

Query  555   SELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDI  376
              ++  D+F+AANT   H DF+ NPQ FGF TS+VACCGQGPYNG+GLCT  SNLC NR+ 
Sbjct  267   RKIGKDIFIAANTGKTHNDFVSNPQQFGFFTSQVACCGQGPYNGLGLCTALSNLCTNREQ  326

Query  375   YAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             YAFWD FHPSEKANR+IV+ I SGS  YM+PMNLSTI+ LD+ T
Sbjct  327   YAFWDAFHPSEKANRLIVEEIMSGSKAYMNPMNLSTILALDANT  370



>ref|XP_004142546.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
Length=365

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/339 (73%), Positives = 292/339 (86%), Gaps = 1/339 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             R+FFVFGDSLVDNGNNNYLATTARAD  PYGID+PTHR TGRFSNGLNIPD IS++LG E
Sbjct  27    RSFFVFGDSLVDNGNNNYLATTARADSYPYGIDFPTHRPTGRFSNGLNIPDYISQQLGSE  86

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
               LP L+P+L G +LL GANFASAG+GILNDTG+QF+NIIR+  Q EYFEEYQRRV  +I
Sbjct  87    FLLPYLNPELNGRRLLDGANFASAGIGILNDTGIQFINIIRMFRQYEYFEEYQRRVGRII  146

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G    K+LV  ALVLIT+GGNDFVNNYYLVPFSARSRQ+++PDYV  LI EYRK+L RLY
Sbjct  147   GEERTKELVKGALVLITVGGNDFVNNYYLVPFSARSRQYSLPDYVNLLIVEYRKLLLRLY  206

Query  717   DLGARRVIVTGTGPIGCVPAELAQR-SRAGECAVDLQRAAALFNPQLTQMLAELNSELKA  541
             +LGARRV+VTGTGP+GCVPAELA R S  G+C+ +LQRAAAL+NP+L QM+  LN++L +
Sbjct  207   ELGARRVLVTGTGPLGCVPAELAMRGSSGGQCSEELQRAAALYNPKLLQMIKGLNTQLGS  266

Query  540   DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWD  361
             +VFVA NT  MH+DFI NP+A+GF TSKVACCGQGPYNG+GLCT ASNLC NRD YAFWD
Sbjct  267   NVFVAVNTQQMHIDFISNPRAYGFETSKVACCGQGPYNGLGLCTVASNLCSNRDAYAFWD  326

Query  360   PFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
              FHPSEKAN IIV+ +FSG+T YM+PMNL+TI++LDS+T
Sbjct  327   AFHPSEKANGIIVKQMFSGTTQYMYPMNLTTILQLDSKT  365



>ref|XP_009124003.1| PREDICTED: GDSL esterase/lipase LTL1-like [Brassica rapa]
Length=366

 Score =   523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/355 (73%), Positives = 296/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAF+VFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GFLISLFFIVTFLAPQVKSRAFYVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEAIGMPSTLPYLSPQLTGENLLVGANFASAGIGILNDTGIQFVNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q EYF++YQ+RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQFT+
Sbjct  129   ISKQFEYFQQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFTL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY K+L++LY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYGKVLRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL  ++A +N+E+  DVFVAAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPQLVNLIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I +GS+ YMHPMNLST+M LDS
Sbjct  309   CTPISNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>emb|CDY49349.1| BnaA05g33110D [Brassica napus]
Length=366

 Score =   522 bits (1345),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 258/355 (73%), Positives = 296/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAF+VFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GYLISLFFIVTFLAPQVKSRAFYVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEAIGMPSTLPYLSPQLTGENLLVGANFASAGIGILNDTGIQFVNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q EYF++YQ+RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQFT+
Sbjct  129   ISKQFEYFQQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFTL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY K+L++LY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYGKVLRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNPQL  ++A +N+E+  DVFVAAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPQLVNLIASVNAEIGQDVFVAANAYQMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I +GS+ YMHPMNLST+M LDS
Sbjct  309   CTPISNLCPNRDLYAFWDAFHPTEKANRIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>ref|XP_006408203.1| hypothetical protein EUTSA_v10020986mg [Eutrema salsugineum]
 gb|ESQ49656.1| hypothetical protein EUTSA_v10020986mg [Eutrema salsugineum]
Length=366

 Score =   521 bits (1343),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 258/355 (73%), Positives = 295/355 (83%), Gaps = 0/355 (0%)
 Frame = -3

Query  1314  GILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             G L+ L  +      + + RAFFVFGDSLVDNGNN+YL TTARAD  PYGIDYPT R TG
Sbjct  9     GFLISLFFIVTFLAPQVKSRAFFVFGDSLVDNGNNDYLVTTARADNYPYGIDYPTRRPTG  68

Query  1134  RFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIR  955
             RFSNGLNIPDIISE +GM  TLP LSP L GE LLVGANFASAG+GILNDTG+QF+NIIR
Sbjct  69    RFSNGLNIPDIISEAIGMPSTLPYLSPQLTGENLLVGANFASAGIGILNDTGIQFVNIIR  128

Query  954   IGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTI  775
             I  Q EYF++YQ+RVS LIG    +QLVN+ALVLITLGGNDFVNNYYL+PFSARSRQF +
Sbjct  129   ISKQFEYFQQYQQRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQFAL  188

Query  774   PDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAAL  595
             PDYV +LISEY KIL++LY+LGARRV+VTGTG +GC PAELAQ SR GEC   LQ AAAL
Sbjct  189   PDYVVYLISEYAKILRKLYELGARRVLVTGTGAMGCAPAELAQHSRNGECYGALQTAAAL  248

Query  594   FNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGL  415
             FNP+L  ++A +N+E+  DVF+AAN Y M+MD++ NP+ FGFVTSKVACCGQGPYNGIGL
Sbjct  249   FNPRLVDLIASVNAEIGQDVFIAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGL  308

Query  414   CTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             CT  SNLCPNRD+YAFWD FHP+EKANRIIV  I SGS+ YMHPMNLST+M LDS
Sbjct  309   CTPISNLCPNRDLYAFWDAFHPTEKANRIIVNQILSGSSKYMHPMNLSTVMLLDS  363



>ref|XP_008810066.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=366

 Score =   521 bits (1343),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 246/340 (72%), Positives = 286/340 (84%), Gaps = 0/340 (0%)
 Frame = -3

Query  1263  ECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLG  1084
             E RAFFVFGDSLVDNGNNNYLATTARAD PPYGIDYPTH+ TGRFSNGLNIPDIISE LG
Sbjct  27    EARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTHQPTGRFSNGLNIPDIISEHLG  86

Query  1083  MEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSD  904
              EPTLP LSP+L+G KLLVGANFASAGVGILNDTG+QF+NIIRI  QL YFE+YQ+ +S 
Sbjct  87    AEPTLPYLSPELRGGKLLVGANFASAGVGILNDTGIQFVNIIRISEQLLYFEQYQQSLSS  146

Query  903   LIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQR  724
             L+G  + K+LVN+ALVLI+LGGNDFVNNY+LVPFS RS +F +PDYV +LISEY+KIL R
Sbjct  147   LVGRAQTKRLVNQALVLISLGGNDFVNNYFLVPFSVRSIEFALPDYVYYLISEYKKILAR  206

Query  723   LYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELK  544
             LY+LGARRV+VTGTGP+GC PAELAQRS  G+C  +L  AA  FN  L Q L ELN+   
Sbjct  207   LYELGARRVLVTGTGPLGCAPAELAQRSLNGDCDPELLGAADQFNSLLLQTLKELNNHFG  266

Query  543   ADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFW  364
             +D+F++AN +  HMDFI +P+A+GFVTSKVACCGQGPYNG+GLCT ASNLC NR++YAFW
Sbjct  267   SDIFISANAFRTHMDFISDPEAYGFVTSKVACCGQGPYNGLGLCTVASNLCANRNLYAFW  326

Query  363   DPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             D FHP+E  NRIIV     GS +YMHPMNLSTI+ +D+ T
Sbjct  327   DAFHPTEIGNRIIVSQFMIGSAEYMHPMNLSTILAMDAGT  366



>ref|XP_009386573.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   521 bits (1343),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 238/339 (70%), Positives = 291/339 (86%), Gaps = 0/339 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             +E RAFFVFGDSLVDNGNNN+LATTARAD PPYGID P+ + TGRFSNGLNIPDI+SE L
Sbjct  25    SEARAFFVFGDSLVDNGNNNFLATTARADSPPYGIDTPSQQPTGRFSNGLNIPDILSEHL  84

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G EPTLP LSPDL+GE+LLVGANFASAG+GILNDTG+QF+NIIRI  QL++FEEYQ R+ 
Sbjct  85    GAEPTLPYLSPDLQGERLLVGANFASAGIGILNDTGIQFINIIRINRQLQHFEEYQERLR  144

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
              +IG  +A++LVN+AL LITLGGNDFVNNYYL+PFS RSRQF++PDYV +++ EY+KIL 
Sbjct  145   AMIGQSQAQKLVNQALFLITLGGNDFVNNYYLIPFSVRSRQFSLPDYVDYILFEYKKILT  204

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RL+++G RR +VTGTGP+GCVPAELA RS  GEC  +LQRAA+LFN QL Q+L ELN++ 
Sbjct  205   RLHEMGGRRALVTGTGPLGCVPAELALRSLDGECDPELQRAASLFNSQLFQVLQELNTQF  264

Query  546   KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAF  367
              ADVF++AN + MHM+++ NP+AFGF TS++ACCGQGPYNG+GLCT ASNLC +R  YAF
Sbjct  265   GADVFISANAFRMHMNYVTNPEAFGFTTSRIACCGQGPYNGLGLCTVASNLCEDRSKYAF  324

Query  366   WDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             WD FHPSEKA RI+V     GS++YM+PMNLSTI+ +D+
Sbjct  325   WDAFHPSEKACRIVVSHFMDGSSEYMNPMNLSTILAMDA  363



>ref|XP_008235540.1| PREDICTED: GDSL esterase/lipase At4g28780 [Prunus mume]
Length=374

 Score =   519 bits (1337),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 242/340 (71%), Positives = 290/340 (85%), Gaps = 1/340 (0%)
 Frame = -3

Query  1260  CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGM  1081
              RAFFVFGDSLVD+GNNNYLATTARAD PPYGID+PTHR TGRFSNGLN+PDIISE++G 
Sbjct  35    ARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDFPTHRPTGRFSNGLNLPDIISEEIGS  94

Query  1080  EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDL  901
             E  LP LSP+L G+KLL+GANFASAG+GILNDTGVQF+ +IRI  Q E F+EYQ+R++ L
Sbjct  95    ERVLPYLSPELTGQKLLIGANFASAGIGILNDTGVQFVTVIRIYRQFELFQEYQQRLTAL  154

Query  900   IGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRL  721
             +GA +A +LVN AL L+TLGGNDFVNNY+L P S RSRQ+++P++  +LI+E+RKIL  L
Sbjct  155   VGAPQATRLVNGALYLMTLGGNDFVNNYFLAPVSQRSRQYSVPEFSRYLITEFRKILMNL  214

Query  720   YDLGARRVIVTGTGPIGCVPAELAQ-RSRAGECAVDLQRAAALFNPQLTQMLAELNSELK  544
             Y+LGARRV+VTGTGP+GCVP+ELAQ RSR GEC  +LQ AAA+FNPQL QML  LN++L 
Sbjct  215   YELGARRVLVTGTGPLGCVPSELAQSRSRNGECNPELQGAAAIFNPQLVQMLQGLNTQLG  274

Query  543   ADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFW  364
             +DVFV AN ++M  DFI NPQ FGFVT+KVACCGQGPYNG+G C   SNLCPNR++YAFW
Sbjct  275   SDVFVTANAFDMKADFISNPQKFGFVTAKVACCGQGPYNGMGQCNPTSNLCPNRNLYAFW  334

Query  363   DPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             D FHP+EKA R+IV+ I +GST YM+PMNLSTIM LDSRT
Sbjct  335   DAFHPTEKATRLIVKQIMTGSTKYMNPMNLSTIMALDSRT  374



>ref|XP_004242381.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum lycopersicum]
Length=361

 Score =   518 bits (1335),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 246/360 (68%), Positives = 291/360 (81%), Gaps = 0/360 (0%)
 Frame = -3

Query  1329  LPNNHGILLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPT  1150
             +P     LL L    ++       RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPT
Sbjct  1     MPTATIFLLVLFIGKLISCSEGAPRAFFVFGDSLVDNGNNNYLLTSARADSPPYGIDYPT  60

Query  1149  HRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQF  970
             HR TGRFSNG NIPD+IS++LG E TLP L+P+L G+KLLVGANFASAG+GILNDTG+QF
Sbjct  61    HRPTGRFSNGFNIPDLISQELGAEATLPYLNPELNGDKLLVGANFASAGIGILNDTGIQF  120

Query  969   MNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARS  790
              NIIRI  QL+ FE+YQ RVS LIG  + ++LVN ALVLITLGGND+VNNY+  P SAR 
Sbjct  121   ANIIRISTQLQNFEQYQARVSALIGEEQTERLVNGALVLITLGGNDYVNNYFFTPISARR  180

Query  789   RQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQ  610
              Q+ + D+  ++ISEYRKIL RLYDLGARRV+VTG+GP+GCVP+ LA RS  GECA + Q
Sbjct  181   LQYNLQDFSVYIISEYRKILMRLYDLGARRVLVTGSGPLGCVPSSLASRSVNGECAEEPQ  240

Query  609   RAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPY  430
             +A+A+FNP L QM+  LN EL +D+FVAAN   M  DFI +PQAFGFVTSK+ACCGQGPY
Sbjct  241   KASAIFNPLLVQMIQGLNQELGSDIFVAANAMEMQNDFIKDPQAFGFVTSKIACCGQGPY  300

Query  429   NGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             NGIG+CT +SNLCPNRD+YAFWDPFHPSE+AN+IIVQ +F+GS  YM PMNLSTIM +DS
Sbjct  301   NGIGICTSSSNLCPNRDLYAFWDPFHPSERANKIIVQTLFTGSDKYMTPMNLSTIMAIDS  360



>ref|XP_006660400.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Oryza brachyantha]
Length=367

 Score =   519 bits (1336),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 242/336 (72%), Positives = 279/336 (83%), Gaps = 0/336 (0%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RA FVFGDSLVD+GNNNYL TTARAD PPYG+DYPTHRATGRFSNGLN+PDIISE LG +
Sbjct  28    RALFVFGDSLVDSGNNNYLLTTARADSPPYGLDYPTHRATGRFSNGLNVPDIISEYLGAD  87

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
               LP LSP L G KLL GANFASAGVGILNDTG+QF NIIRI  QL YF++YQ RV  LI
Sbjct  88    SVLPYLSPHLDGAKLLHGANFASAGVGILNDTGIQFANIIRIEKQLRYFQQYQDRVRWLI  147

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G   A++LV  ALVLITLGGNDFVNNYYLVPFSARSR+F +PDYV ++I+EY K+L++LY
Sbjct  148   GGAAARRLVEGALVLITLGGNDFVNNYYLVPFSARSREFALPDYVRYIIAEYSKVLRQLY  207

Query  717   DLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKAD  538
             D+GARRV+VTG+GP+GC PAELA RS  GEC  +LQRAAAL+NPQL +M  ELN +L AD
Sbjct  208   DMGARRVLVTGSGPLGCAPAELATRSATGECDAELQRAAALYNPQLVRMTRELNEQLGAD  267

Query  537   VFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDP  358
             VFVA N Y MHMDFI +P A+GF TSK ACCGQGPYNG+GLCT  S++CP+R +Y FWD 
Sbjct  268   VFVAVNAYRMHMDFISDPAAYGFATSKGACCGQGPYNGVGLCTAMSSICPDRSLYVFWDN  327

Query  357   FHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             FHP+E+ANRIIV    SGS DYMHP NLSTI+ +D+
Sbjct  328   FHPTERANRIIVSQFMSGSPDYMHPFNLSTILAMDA  363



>ref|XP_006652494.1| PREDICTED: GDSL esterase/lipase LTL1-like [Oryza brachyantha]
Length=374

 Score =   519 bits (1336),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 247/334 (74%), Positives = 283/334 (85%), Gaps = 0/334 (0%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGMEPT  1072
             FFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNGLNIPDIISE LG +P 
Sbjct  35    FFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYLGSQPA  94

Query  1071  LPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLIGA  892
             LP LSPDL+G+ LLVGANFASAGVGILNDTG+QF+NIIRIG QLE F+ YQ++++   G 
Sbjct  95    LPYLSPDLRGDNLLVGANFASAGVGILNDTGIQFVNIIRIGQQLENFQNYQQKLAAFAGE  154

Query  891   GEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLYDL  712
               A+Q+V  +LVLITLGGNDFVNNYYLVPFS RSRQF I DYVP+LISEYRKIL RL++L
Sbjct  155   DAARQVVAGSLVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRLHEL  214

Query  711   GARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKADVF  532
             G RRVIVTGTG IGCVPAELA  S  GECA DL +AA LFNPQL +MLAELNSEL   VF
Sbjct  215   GPRRVIVTGTGMIGCVPAELAMHSIDGECATDLTQAADLFNPQLERMLAELNSELGGHVF  274

Query  531   VAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWDPFH  352
             +AANT  +  DF+FNPQ +GFVT+KVACCGQGPYNGIGLCT ASN+C NRD+YA+WD FH
Sbjct  275   IAANTNKISFDFMFNPQDYGFVTAKVACCGQGPYNGIGLCTPASNVCANRDVYAYWDAFH  334

Query  351   PSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             P+E+ANR+IV  +  GSTD++ PMNLSTI+ +D+
Sbjct  335   PTERANRLIVAQLMHGSTDHIRPMNLSTILAMDA  368



>emb|CDY35219.1| BnaA01g08120D [Brassica napus]
Length=346

 Score =   516 bits (1330),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 246/339 (73%), Positives = 289/339 (85%), Gaps = 2/339 (1%)
 Frame = -3

Query  1260  CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGM  1081
              RAFFVFGDSLVD+GNNNYL TTARAD PPYGIDYPT R TGRFSNGLN+PDIISE++G 
Sbjct  8     ARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSNGLNLPDIISEQIGS  67

Query  1080  EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDL  901
             EPTLP LSP+L GEKLL+GANFASAG+GILNDTGVQF+NI+RIG Q E F+EYQ RVS++
Sbjct  68    EPTLPILSPELTGEKLLIGANFASAGIGILNDTGVQFLNILRIGRQFELFQEYQERVSEI  127

Query  900   IGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRL  721
             IG+ + +QLVN ALVL+TLGGNDFVNNY+L PFSARSRQ ++ ++   LISEY+KIL RL
Sbjct  128   IGSDKTQQLVNGALVLMTLGGNDFVNNYFL-PFSARSRQSSLSEFSQLLISEYKKILMRL  186

Query  720   YDLGARRVIVTGTGPIGCVPAELAQRSRA-GECAVDLQRAAALFNPQLTQMLAELNSELK  544
             Y+LGARRV+VTGTGP+GCVPAELA    A GECA + Q+AAA+FNP L QML  LN ++ 
Sbjct  187   YELGARRVMVTGTGPLGCVPAELASSGSANGECAPEAQQAAAIFNPLLDQMLQGLNRQVG  246

Query  543   ADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFW  364
             +DVF+ AN +NM+ DFI NPQ FGFVTSKVACCGQG YNG G+CT  S+LCP+R+ YAFW
Sbjct  247   SDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTPLSSLCPDRNAYAFW  306

Query  363   DPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             DPFHP+EKA R+IVQ I +GS +YM+PMNLSTIM LDSR
Sbjct  307   DPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  345



>ref|XP_009129278.1| PREDICTED: GDSL esterase/lipase At4g28780 [Brassica rapa]
Length=361

 Score =   517 bits (1332),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 250/358 (70%), Positives = 297/358 (83%), Gaps = 4/358 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAE--CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRAT  1138
             +LL  L +T+    +     RAFFVFGDSLVD+GNNNYL TTARAD PPYGIDYPT R T
Sbjct  4     LLLTSLCVTLFLMPQQTNAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPT  63

Query  1137  GRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNII  958
             GRFSNGLN+PDIISE++G EPTLP LSP+L GEKLL+GANFASAG+GILNDTGVQF+NI+
Sbjct  64    GRFSNGLNLPDIISEQIGSEPTLPILSPELTGEKLLIGANFASAGIGILNDTGVQFLNIL  123

Query  957   RIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFT  778
             RIG Q E F+EYQ RVS++IG+ + +QLVN ALVL+TLGGNDFVNNY+L PFSARSRQ +
Sbjct  124   RIGRQFELFQEYQERVSEIIGSDKTQQLVNGALVLMTLGGNDFVNNYFL-PFSARSRQSS  182

Query  777   IPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRA-GECAVDLQRAA  601
             + ++   LISEY+KIL RLY+LGARRV+VTGTGP+GCVPAELA    A GECA + Q+AA
Sbjct  183   LSEFSQLLISEYKKILMRLYELGARRVMVTGTGPLGCVPAELASSGSANGECAPEAQQAA  242

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             A+FNP L QML  LN ++ +DVF+ AN +NM+ DFI NPQ FGFVTSKVACCGQG YNG 
Sbjct  243   AIFNPLLDQMLQGLNRQVGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGQ  302

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             G+CT  S+LCP+R+ YAFWDPFHP+EKA R+IVQ I +GS +YM+PMNLSTIM LDSR
Sbjct  303   GVCTPLSSLCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  360



>ref|XP_006352714.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=364

 Score =   517 bits (1331),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 247/353 (70%), Positives = 287/353 (81%), Gaps = 0/353 (0%)
 Frame = -3

Query  1308  LLGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRF  1129
             LL L   T V       RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPTHR TGRF
Sbjct  11    LLVLFIGTFVSCTEGAPRAFFVFGDSLVDNGNNNYLLTSARADSPPYGIDYPTHRPTGRF  70

Query  1128  SNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIG  949
             SNG NIPD+IS++LG E TLP L P+L G+KLLVGANFASAG+GILNDTG+QF NIIRI 
Sbjct  71    SNGFNIPDLISQELGAEATLPYLDPELTGDKLLVGANFASAGIGILNDTGIQFANIIRIS  130

Query  948   NQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPD  769
              QL+ FE+YQ RVS LIG  + ++LVN ALVLITLGGND+VNNY+  P SAR  Q+ + D
Sbjct  131   TQLQNFEQYQARVSALIGEEQTERLVNGALVLITLGGNDYVNNYFFTPVSARRLQYNLQD  190

Query  768   YVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFN  589
             +  ++ISEYRKIL RLYDLGARRV+VTG+GP+GCVP+ LA RS  GECA + QRA+A+FN
Sbjct  191   FSVYIISEYRKILMRLYDLGARRVLVTGSGPLGCVPSSLASRSVNGECAEEPQRASAIFN  250

Query  588   PQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCT  409
             P L QM+  LN EL + +FVAAN   M  +FI NPQAFGFVTSK+ACCGQGPYNGIG+CT
Sbjct  251   PLLVQMIQGLNQELGSHIFVAANAMEMQTNFITNPQAFGFVTSKIACCGQGPYNGIGICT  310

Query  408   QASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
              +SNLCPNRD+YAFWDPFHPSE+AN+IIVQ +F+GS  YM PMNLSTIM +DS
Sbjct  311   ASSNLCPNRDLYAFWDPFHPSERANKIIVQTLFTGSDKYMTPMNLSTIMAIDS  363



>ref|XP_002303095.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE82368.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=370

 Score =   517 bits (1331),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 242/352 (69%), Positives = 291/352 (83%), Gaps = 2/352 (1%)
 Frame = -3

Query  1296  LALTIVFFGRAEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNG  1120
             +A+      +AE  RAFFVFGDSLVD+GNNNYLATTARAD PPYGIDYPTHR TGRFSNG
Sbjct  18    MAMVATIVPQAEAARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTHRPTGRFSNG  77

Query  1119  LNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQL  940
              N PDIIS+ +G+EPTLP LSP+L G++LL GANFASAG+GILNDTG+QF+NI+R+  Q 
Sbjct  78    FNFPDIISQSMGLEPTLPYLSPELNGQRLLNGANFASAGIGILNDTGIQFVNILRMFRQF  137

Query  939   EYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVP  760
             + FEEYQ+RVS +IG    +QLVN ALVLITLGGNDFVNNY+L PF+ R RQF++PDY  
Sbjct  138   QLFEEYQQRVSAIIGTDRTQQLVNNALVLITLGGNDFVNNYFLTPFAPRRRQFSLPDYCR  197

Query  759   FLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQR-SRAGECAVDLQRAAALFNPQ  583
             FL+SEYRK+L RLYDLG RR++VTGTGP+GCVPAELA   S  GECA + QRAA +FNPQ
Sbjct  198   FLVSEYRKLLMRLYDLGGRRILVTGTGPLGCVPAELAMSGSTNGECAPEPQRAAQIFNPQ  257

Query  582   LTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQA  403
             L QML  LN EL +DVF+ AN + M+ D I +PQ FGFVTSKVACCGQG YNG+GLCT  
Sbjct  258   LFQMLQNLNRELGSDVFITANAFAMNTDLINSPQRFGFVTSKVACCGQGLYNGLGLCTVV  317

Query  402   SNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             SNLCPNR++Y FWD FHP+E+ANR++VQ + +G+T+YM+PMNLSTIM LD++
Sbjct  318   SNLCPNRNVYVFWDAFHPTERANRVLVQQLMTGTTEYMNPMNLSTIMALDAK  369



>ref|XP_002467122.1| hypothetical protein SORBIDRAFT_01g020000 [Sorghum bicolor]
 gb|EER94120.1| hypothetical protein SORBIDRAFT_01g020000 [Sorghum bicolor]
Length=352

 Score =   516 bits (1328),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 239/340 (70%), Positives = 286/340 (84%), Gaps = 1/340 (0%)
 Frame = -3

Query  1266  AEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +EC RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTHR TGRFSNG NIPDIISE 
Sbjct  6     SECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSNGKNIPDIISEH  65

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG EPTLP LSP+L+G+KLLVGANFASAGVGILNDTG QF+NIIR+  QL++F EYQ ++
Sbjct  66    LGAEPTLPYLSPELRGQKLLVGANFASAGVGILNDTGFQFVNIIRMSRQLQHFGEYQGKL  125

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
               L+GA  A+Q+V ++LVLITLGGNDFVNNYYLVPFS RSRQF++PDYV ++ISEY+KIL
Sbjct  126   RALVGAARARQMVRRSLVLITLGGNDFVNNYYLVPFSLRSRQFSLPDYVRYIISEYKKIL  185

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY +G RRV+VTGTGP+GC PA LAQRSR GECA +L RAA+LFNPQL ++L +LN+ 
Sbjct  186   IRLYAMGCRRVLVTGTGPLGCAPAILAQRSRNGECAAELMRAASLFNPQLARVLDQLNAR  245

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
               A  F+AAN + +H DF+ +P AFGF T+K ACCGQGP+NG+GLCT ASNLCP+R  Y 
Sbjct  246   FGAGTFIAANAFRVHFDFVSDPAAFGFATAKEACCGQGPHNGLGLCTPASNLCPDRSKYV  305

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             FWD +HP+E+ANR IV    SGS DY+ PMNLST++++D+
Sbjct  306   FWDAYHPTERANRFIVSQFMSGSLDYVSPMNLSTVLQMDA  345



>ref|XP_006412910.1| hypothetical protein EUTSA_v10025523mg [Eutrema salsugineum]
 gb|ESQ54363.1| hypothetical protein EUTSA_v10025523mg [Eutrema salsugineum]
Length=367

 Score =   516 bits (1329),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 250/364 (69%), Positives = 297/364 (82%), Gaps = 10/364 (3%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRA--------ECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDY  1156
             ILL  + L+  F+G            RAF+VFGDSLVD+GNNNYL TTARAD PPYGIDY
Sbjct  4     ILLTSICLSAAFWGTLILMPQETNAARAFYVFGDSLVDSGNNNYLVTTARADSPPYGIDY  63

Query  1155  PTHRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGV  976
             PT R TGRFSNGLN+PDIISE++G EPTLP LSP+L GEKLL+GANFASAG+GILNDTGV
Sbjct  64    PTGRPTGRFSNGLNLPDIISEQIGSEPTLPILSPELTGEKLLIGANFASAGIGILNDTGV  123

Query  975   QFMNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSA  796
             QF+NI+RIG Q E F+EYQ RVS++IG+ + ++LVN ALVL+TLGGNDFVNNY+L PFSA
Sbjct  124   QFLNILRIGRQFELFQEYQERVSEIIGSDKTQELVNGALVLMTLGGNDFVNNYFL-PFSA  182

Query  795   RSRQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRA-GECAV  619
             R RQ ++ ++   LISEY+KIL RLY+LGARRV+VTGTGP+GCVPA+LA    A GECA 
Sbjct  183   RGRQSSLGEFSKLLISEYKKILARLYELGARRVMVTGTGPLGCVPAQLASSGSADGECAP  242

Query  618   DLQRAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQ  439
             + Q+AAA+FNP L QML ELN E  +DVF+ AN +NM+ DFI NPQ FGFVTSKVACCGQ
Sbjct  243   EAQQAAAIFNPLLDQMLQELNREFGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQ  302

Query  438   GPYNGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIME  259
             G YNG G+CT  S+LCP+R+ YAFWDPFHP+EKA R+IVQ I +GS +YM+PMNLSTIM 
Sbjct  303   GAYNGQGVCTPLSSLCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMA  362

Query  258   LDSR  247
             LDSR
Sbjct  363   LDSR  366



>ref|XP_010524958.1| PREDICTED: GDSL esterase/lipase At5g18430 [Tarenaya hassleriana]
Length=377

 Score =   516 bits (1329),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 248/357 (69%), Positives = 296/357 (83%), Gaps = 3/357 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGR-AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATG  1135
             + L  L L  + FGR  E RAFFVFGDSLVD+GNNNYL TTARAD PPYGID+PT R TG
Sbjct  19    MFLAFLVLVSMMFGRVTEARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDFPTRRPTG  78

Query  1134  RFSNGLNIPDIISEKLG-MEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNII  958
             RFSNGLN+PD+IS+++G  EP LP LSP+L+G +LL GANFASAG+GILNDTG QF+NII
Sbjct  79    RFSNGLNLPDLISQEMGNEEPPLPYLSPELRGRRLLNGANFASAGIGILNDTGFQFLNII  138

Query  957   RIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFT  778
             R+  QL+ FEEYQ RV  LIG  + ++LV+++LVLIT+GGNDFVNNY+LVP+SARSRQF 
Sbjct  139   RMYEQLDNFEEYQTRVGRLIGQTQTRRLVSQSLVLITVGGNDFVNNYFLVPYSARSRQFA  198

Query  777   IPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQR-SRAGECAVDLQRAA  601
             +PDYV  LISEY+KIL RLY LG  RV+VTGTGP+GC PAELA   SR GEC+  LQRAA
Sbjct  199   LPDYVKLLISEYKKILWRLYSLGVCRVLVTGTGPLGCAPAELANSGSRDGECSATLQRAA  258

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             +L+NPQL +ML  LN+++  +VF+AANT+ M MDF+ NPQA+GFVTSKVACCGQGPYNG+
Sbjct  259   SLYNPQLVRMLNGLNTKIGRNVFIAANTHQMQMDFLSNPQAYGFVTSKVACCGQGPYNGM  318

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             GLCT  SNLC NRD+  FWD FHPSEKANRIIV+ IF+GS +YM+PMNLST+M LDS
Sbjct  319   GLCTFVSNLCRNRDLNVFWDAFHPSEKANRIIVRQIFTGSINYMNPMNLSTVMALDS  375



>emb|CDY06871.1| BnaC01g09700D [Brassica napus]
Length=361

 Score =   515 bits (1327),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 249/358 (70%), Positives = 297/358 (83%), Gaps = 4/358 (1%)
 Frame = -3

Query  1311  ILLGLLALTIVFFGRAE--CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRAT  1138
             +LL  L +T+    +     RAFFVFGDSLVD+GNNNYL TTARAD PPYGIDYPT R T
Sbjct  4     LLLTSLCVTLFLMPQQTNAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPT  63

Query  1137  GRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNII  958
             GRFSNGLN+PDIISE++G EPTLP LSP+L G+KLL+GANFASAG+GILNDTGVQF+NI+
Sbjct  64    GRFSNGLNLPDIISEQIGSEPTLPILSPELTGKKLLIGANFASAGIGILNDTGVQFLNIL  123

Query  957   RIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFT  778
             RIG Q E F+EYQ RVS++IG+ + +QLVN ALVL+TLGGNDFVNNY+L PFSARSRQ +
Sbjct  124   RIGRQFELFQEYQERVSEIIGSDKTQQLVNGALVLMTLGGNDFVNNYFL-PFSARSRQSS  182

Query  777   IPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRA-GECAVDLQRAA  601
             + ++   LISEY+KIL RLY+LGARRV+VTGTGP+GCVPAELA    A GECA + Q+AA
Sbjct  183   LSEFSQLLISEYKKILMRLYELGARRVMVTGTGPLGCVPAELASSGSANGECAPEAQQAA  242

Query  600   ALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGI  421
             A+FNP L QML  LN ++ +DVF+ AN +NM+ DFI NPQ FGFVTSKVACCGQG YNG 
Sbjct  243   AIFNPLLDQMLQGLNRKVGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGQ  302

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             G+CT  S+LCP+R+ YAFWDPFHP+EKA R+IVQ I +GS +YM+PMNLSTIM LDSR
Sbjct  303   GVCTPLSSLCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  360



>ref|XP_003573228.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Brachypodium 
distachyon]
Length=375

 Score =   516 bits (1328),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 243/338 (72%), Positives = 281/338 (83%), Gaps = 2/338 (1%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             R FFVFGDSLVD+GNNNYL TTARAD PPYG+DYPTHRATGRFSNGLN+PDIISE LG  
Sbjct  33    RPFFVFGDSLVDSGNNNYLLTTARADSPPYGLDYPTHRATGRFSNGLNVPDIISEHLGSP  92

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             P LP LSP L G  LL GANFASAGVGILNDTG+QF NIIR+  QL YF++YQ R++  +
Sbjct  93    PVLPYLSPHLDGPTLLTGANFASAGVGILNDTGIQFANIIRMPKQLRYFQQYQTRLTRSL  152

Query  897   G--AGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQR  724
                A  A++LV  ALVLITLGGNDFVNNYYLVPFSARSRQF++PDYV +LI+EYRKIL++
Sbjct  153   AGDAAAARRLVRSALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLIAEYRKILRQ  212

Query  723   LYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELK  544
             LYDLGARRV+VTG+GPIGC PAELA RS  GEC ++LQRAAAL+NPQL  M  ELN+   
Sbjct  213   LYDLGARRVLVTGSGPIGCAPAELATRSANGECDIELQRAAALYNPQLVAMTRELNAGYG  272

Query  543   ADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFW  364
             ADVFVA N Y MHMDFI  P A+GF+TSKVACCGQGPYNG+GLCT  S++CP+R +YAFW
Sbjct  273   ADVFVAVNAYRMHMDFISAPAAYGFLTSKVACCGQGPYNGVGLCTALSSVCPDRSLYAFW  332

Query  363   DPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             D FHP+E+ANRIIV     GS +YMHP+NLSTI+ +D+
Sbjct  333   DNFHPTERANRIIVSQFMVGSPEYMHPLNLSTILAVDA  370



>ref|XP_010447915.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Camelina sativa]
Length=367

 Score =   515 bits (1327),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 248/353 (70%), Positives = 294/353 (83%), Gaps = 4/353 (1%)
 Frame = -3

Query  1296  LALTIVFFGRAE--CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSN  1123
             L LT++   +     RAFFVFGDSLVD+GNNNYL TTARAD PPYGIDYPT R TGRFSN
Sbjct  15    LCLTLILMPQQTNAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSN  74

Query  1122  GLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQ  943
             GLN+PDIISE++G EPTLP LSP+L GEKLL+GANFASAG+GILNDTGVQF+NI+RIG Q
Sbjct  75    GLNLPDIISEQIGSEPTLPILSPELTGEKLLIGANFASAGIGILNDTGVQFLNILRIGRQ  134

Query  942   LEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYV  763
              E F+EYQ RVS++IG+ + +QLVN ALVL+TLGGNDFVNNY+  PFS+R RQ ++ ++ 
Sbjct  135   FELFQEYQERVSEIIGSEKTQQLVNGALVLMTLGGNDFVNNYFF-PFSSRRRQSSLEEFS  193

Query  762   PFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQR-SRAGECAVDLQRAAALFNP  586
               LISEY+KIL RLY+LGARRV+VTGTGP+GCVPAELA   S  GECA + Q+AAA+FNP
Sbjct  194   QLLISEYKKILARLYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNP  253

Query  585   QLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQ  406
              L QML  LNSE+ +DVF+ AN +NM+ DFI NPQ FGFVTSKVACCGQG YNG G+CT 
Sbjct  254   LLVQMLQGLNSEIGSDVFIGANAFNMNADFINNPQRFGFVTSKVACCGQGAYNGRGICTP  313

Query  405   ASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
              S+LCP+R+ YAFWDPFHP+EKA R+IVQ I +GS +YM+PMNLSTIM LDSR
Sbjct  314   LSSLCPDRNAYAFWDPFHPTEKATRLIVQQIMTGSAEYMNPMNLSTIMALDSR  366



>emb|CDP04257.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   514 bits (1325),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 246/339 (73%), Positives = 286/339 (84%), Gaps = 0/339 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +AE RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNG N+PD+I + 
Sbjct  23    QAEARAFFVFGDSLVDNGNNNYLVTTARADTPPYGIDFPTHSPTGRFSNGYNLPDLIGQY  82

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
              G+E TLP LSP+L G+KLL GANFASAGVGILNDTGVQF+NII + +Q+ YF +YQ+R+
Sbjct  83    YGLEATLPYLSPELSGDKLLHGANFASAGVGILNDTGVQFINIIGMYDQIAYFLQYQKRL  142

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             SD IGA  A +LV ++LVLITLGGNDFVNNYYL+P+S RS+QF + DY  +LISEYRKIL
Sbjct  143   SDQIGAENATKLVKESLVLITLGGNDFVNNYYLIPYSPRSQQFNLQDYCKYLISEYRKIL  202

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
             QRL+++GA RVIVTGTGP+GCVPAELA RS  GECA +LQ AA+LFNPQL +ML  LN E
Sbjct  203   QRLHEVGAERVIVTGTGPLGCVPAELAMRSSNGECADELQTAASLFNPQLAEMLTGLNKE  262

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             + +DVFVAANT   HMDFI NPQAFGF T+K+ACCGQGPYNGIGLCT  SNLCPNR  Y 
Sbjct  263   IGSDVFVAANTNRAHMDFIANPQAFGFETAKIACCGQGPYNGIGLCTPFSNLCPNRGTYV  322

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             FWD FHP+E+ANR+IVQ +F+GST YM+PMNLSTI  LD
Sbjct  323   FWDAFHPTERANRLIVQQMFNGSTFYMNPMNLSTIRILD  361



>gb|EMT08293.1| GDSL esterase/lipase LTL1 [Aegilops tauschii]
Length=369

 Score =   513 bits (1322),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 246/340 (72%), Positives = 285/340 (84%), Gaps = 1/340 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             +  RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNGLNIPDIISE L
Sbjct  27    SAARAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYL  86

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G EP LP LSP ++GE LLVGANFASAGVGILNDTGVQF+NIIRI  QL+ F++YQRR++
Sbjct  87    GAEPALPYLSPYMRGENLLVGANFASAGVGILNDTGVQFVNIIRIAQQLQNFQDYQRRLA  146

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
               IG   A++ V+++LVLITLGGNDFVNNYYLVPFSARS+QF I DYVPF+ISEY+K+L 
Sbjct  147   AYIGEDAARERVSQSLVLITLGGNDFVNNYYLVPFSARSQQFEIHDYVPFIISEYKKVLA  206

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLY+LGARRVIVTGTG IGCVPAELA  S  G CA DL RAA LFNPQL +ML ELN E+
Sbjct  207   RLYELGARRVIVTGTGMIGCVPAELALHSLDGSCAPDLTRAADLFNPQLERMLTELNGEV  266

Query  546   -KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
                DVF+AANT  +  DF+FNPQ +GF T+K+ACCGQGPYNGIGLCT ASN+C NRD+YA
Sbjct  267   GHDDVFIAANTNRVSFDFMFNPQQYGFATAKIACCGQGPYNGIGLCTPASNVCANRDVYA  326

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             +WD FHP+E+ANRIIV     G+TD++ PMNLSTI+ +D+
Sbjct  327   YWDAFHPTERANRIIVANFMHGTTDHISPMNLSTILAMDN  366



>ref|XP_004982954.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Setaria italica]
Length=363

 Score =   513 bits (1322),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 239/341 (70%), Positives = 283/341 (83%), Gaps = 1/341 (0%)
 Frame = -3

Query  1266  AEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +EC RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTHRATGRFSNG NIPDIISE 
Sbjct  20    SECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDFPTHRATGRFSNGKNIPDIISEH  79

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG E TLP LSP+L+G+KLLVGANFASAGVGILNDTG+QF++I+R+  QL YF EYQ ++
Sbjct  80    LGAETTLPYLSPELRGQKLLVGANFASAGVGILNDTGIQFVDILRMSRQLRYFGEYQAKL  139

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
               L+GA  A+QLV ++L LITLGGNDFVNNYYLVPFS RSRQF +PDYV +L+SEY+KIL
Sbjct  140   RALVGAARARQLVRRSLTLITLGGNDFVNNYYLVPFSLRSRQFALPDYVRYLVSEYKKIL  199

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY +G RRV+VTGTGP+GC PA LAQRSR GECA +L RAA+LFNPQL + L  LN+ 
Sbjct  200   IRLYAMGCRRVLVTGTGPLGCAPAILAQRSRNGECAAELMRAASLFNPQLARALDGLNAR  259

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
               A  FVAAN + +H DF+ +P A+GF T+  ACCGQGP+NG+GLCT ASNLC +R  Y 
Sbjct  260   FGAGTFVAANAFRVHFDFVSDPAAYGFATATEACCGQGPHNGLGLCTAASNLCADRGRYV  319

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FWDP+HP+E+ANRIIV    SGS DY+ PMNLST++E+D+R
Sbjct  320   FWDPYHPTERANRIIVSQFMSGSLDYVSPMNLSTVLEMDAR  360



>gb|KFK29417.1| hypothetical protein AALP_AA7G132000 [Arabis alpina]
Length=367

 Score =   513 bits (1322),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 248/362 (69%), Positives = 294/362 (81%), Gaps = 15/362 (4%)
 Frame = -3

Query  1290  LTIVFFGRAEC-------------RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPT  1150
             LT +F   A C             RAF+VFGDSLVD+GNNNYL TTARAD PPYGIDYPT
Sbjct  6     LTSIFLSAALCITLFLMPQQIDAARAFYVFGDSLVDSGNNNYLVTTARADSPPYGIDYPT  65

Query  1149  HRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQF  970
              R TGRFSNGLN+PDIISE++G EPTLP LSP+L GEKLL+GANFASAG+GILNDTG+QF
Sbjct  66    GRPTGRFSNGLNLPDIISEQIGSEPTLPILSPELTGEKLLIGANFASAGIGILNDTGIQF  125

Query  969   MNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARS  790
             +NI+RIG Q E F+EYQ RVS++IG+ + +QLVN ALVL+TLGGNDFVNNY+ +PFSAR 
Sbjct  126   LNILRIGRQFELFQEYQERVSEIIGSDKTQQLVNGALVLMTLGGNDFVNNYF-IPFSARG  184

Query  789   RQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRA-GECAVDL  613
             RQ ++ ++   LISEY+KIL RLY+LGARRV+VTGTGP+GCVPAELA    A GECA + 
Sbjct  185   RQSSLGEFSQLLISEYKKILTRLYELGARRVMVTGTGPLGCVPAELASSGSANGECAPEA  244

Query  612   QRAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGP  433
             Q+AAA+FNP L QML  LN E+ +DVF+ AN ++M+ DFI NPQ FGFVTSKVACCGQG 
Sbjct  245   QKAAAIFNPLLNQMLQGLNREIGSDVFIGANAFDMNADFINNPQRFGFVTSKVACCGQGA  304

Query  432   YNGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             YNG G+CTQ S+LCP+R+ YAFWDPFHP+EKA R+IVQ I +GS  YM+PMNLSTIM LD
Sbjct  305   YNGQGVCTQLSSLCPDRNAYAFWDPFHPTEKAIRLIVQQIMTGSAKYMNPMNLSTIMALD  364

Query  252   SR  247
             SR
Sbjct  365   SR  366



>gb|EMS62626.1| GDSL esterase/lipase LTL1 [Triticum urartu]
Length=368

 Score =   513 bits (1322),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 246/340 (72%), Positives = 285/340 (84%), Gaps = 1/340 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             +  RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNGLNIPDIISE L
Sbjct  26    SAARAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYL  85

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G EP LP LSP ++GE LLVGANFASAGVGILNDTGVQF+NIIRI  QL+ F++YQRR++
Sbjct  86    GAEPALPYLSPYMRGENLLVGANFASAGVGILNDTGVQFVNIIRIAQQLQNFQDYQRRLA  145

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
               IG   A++ V+++LVLITLGGNDFVNNYYLVPFSARS+QF I DYVPF+ISEY+K+L 
Sbjct  146   AYIGEDAARERVSQSLVLITLGGNDFVNNYYLVPFSARSQQFEIHDYVPFIISEYKKVLA  205

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLY+LGARRVIVTGTG IGCVPAELA  S  G CA DL RAA LFNPQL +ML ELN E+
Sbjct  206   RLYELGARRVIVTGTGMIGCVPAELALHSLDGSCAPDLTRAADLFNPQLERMLTELNGEV  265

Query  546   -KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
                DVF+AANT  +  DF+FNPQ +GF T+K+ACCGQGPYNGIGLCT ASN+C NRD+YA
Sbjct  266   GHDDVFIAANTNRVSFDFMFNPQQYGFATAKIACCGQGPYNGIGLCTPASNVCANRDVYA  325

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             +WD FHP+E+ANRIIV     G+TD++ PMNLSTI+ +D+
Sbjct  326   YWDAFHPTERANRIIVANFMHGTTDHISPMNLSTILAMDN  365



>ref|XP_004489173.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=370

 Score =   512 bits (1319),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 240/341 (70%), Positives = 280/341 (82%), Gaps = 0/341 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             A  RAFFVFGDSLVDNGNNNYL T ARAD PPYGIDYPTHR TGRFSNG NI D+IS+++
Sbjct  30    ARPRAFFVFGDSLVDNGNNNYLHTNARADSPPYGIDYPTHRPTGRFSNGFNIADLISQRI  89

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G + TLP LSP LKG  LL+GANFASAG+GILNDTG QFMN+ R+  QL+YF+ YQRR++
Sbjct  90    GAKSTLPYLSPQLKGYNLLIGANFASAGIGILNDTGAQFMNVTRMHTQLDYFKAYQRRMT  149

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
              LIGA   K+LVN+AL L+T+GGNDFVNNYYLVP SARSRQ+++P YV  LI EYRK LQ
Sbjct  150   ALIGATRTKRLVNQALFLMTVGGNDFVNNYYLVPSSARSRQYSLPQYVKLLICEYRKHLQ  209

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLY+LGARRV+VTG+GP+GC PAELA   R G C+  LQ  AAL+NPQL +ML  LN +L
Sbjct  210   RLYNLGARRVLVTGSGPLGCAPAELAGHGRNGHCSPKLQLGAALYNPQLVKMLQGLNRKL  269

Query  546   KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAF  367
               D+F+AANT  MH DF+ +P+A+GFVTSKVACCGQGPYNG+G+C   SNLCPNR++YAF
Sbjct  270   GRDIFIAANTAQMHKDFVTHPRAYGFVTSKVACCGQGPYNGVGVCRTFSNLCPNRNLYAF  329

Query  366   WDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
             WD FHPSEKANRIIV  I SGST YM PMNLSTI+ LD+ T
Sbjct  330   WDQFHPSEKANRIIVHRIMSGSTRYMKPMNLSTILALDATT  370



>ref|XP_010528706.1| PREDICTED: GDSL esterase/lipase LTL1-like [Tarenaya hassleriana]
Length=369

 Score =   512 bits (1319),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 247/362 (68%), Positives = 299/362 (83%), Gaps = 3/362 (1%)
 Frame = -3

Query  1326  PNNHGILLGLLALTIVFFGRA--ECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYP  1153
             P+   ++LGL  +T+  F       RAFFVFGDS+VDNGNN+YLATTARAD PPYGIDYP
Sbjct  8     PSLRCLVLGLFLVTLRNFVEEVEAARAFFVFGDSIVDNGNNDYLATTARADRPPYGIDYP  67

Query  1152  THRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQ  973
                 TGRFSNGLNIPD IS++LG EPTLP LSP+L GE+LLVGANFASAG+GILNDTG+Q
Sbjct  68    PG-PTGRFSNGLNIPDFISQELGSEPTLPYLSPELTGERLLVGANFASAGIGILNDTGIQ  126

Query  972   FMNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSAR  793
             F++IIR+  Q EYFE+YQRRVS LIG  +  +LV  +LVLI +GGNDFVNNY+LVP+S R
Sbjct  127   FVSIIRMYQQFEYFEQYQRRVSALIGEEQTHRLVAGSLVLICVGGNDFVNNYFLVPYSLR  186

Query  792   SRQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDL  613
             S+QF+IPDYV +L+SEYRKIL RLY+LGARR++V GTGPIGCVPA+LAQRSR GEC  + 
Sbjct  187   SQQFSIPDYVVYLLSEYRKILIRLYELGARRILVLGTGPIGCVPAQLAQRSRNGECVAET  246

Query  612   QRAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGP  433
             QRAAAL+NPQL+QML +LNS+L  +VF++ N  +M  DFI NP AFGF  SK ACCGQG 
Sbjct  247   QRAAALYNPQLSQMLQDLNSQLGDNVFISGNINDMQDDFITNPSAFGFEDSKTACCGQGR  306

Query  432   YNGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELD  253
             YNG+GLCT  SNLCPNRD+YA+WDP+HP+E+AN IIV+ I +GST YM+PMNLST++ LD
Sbjct  307   YNGVGLCTAVSNLCPNRDVYAWWDPYHPTERANGIIVRRIMTGSTKYMNPMNLSTVIALD  366

Query  252   SR  247
             S+
Sbjct  367   SK  368



>dbj|BAJ85303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   512 bits (1318),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 245/340 (72%), Positives = 284/340 (84%), Gaps = 1/340 (0%)
 Frame = -3

Query  1266  AECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKL  1087
             +  RAFFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH  TGRFSNGLNIPDIISE L
Sbjct  26    SAARAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYL  85

Query  1086  GMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVS  907
             G EP LP LSP ++G+ LLVGANFASAGVGILNDTGVQF+NIIRI  QL+ F++YQRR++
Sbjct  86    GAEPALPYLSPYMRGDNLLVGANFASAGVGILNDTGVQFVNIIRIAQQLQNFQDYQRRLA  145

Query  906   DLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQ  727
               IG   A+Q V+++LVLITLGGNDFVNNYYLVPFSARS+QF I DYVPF++SEY+K+L 
Sbjct  146   AYIGEDAARQRVSQSLVLITLGGNDFVNNYYLVPFSARSQQFEIHDYVPFIVSEYKKVLA  205

Query  726   RLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSEL  547
             RLY+LGARRVIVTGTG IGCVPAELA  S  G CA DL RAA LFNPQL +ML ELN E+
Sbjct  206   RLYELGARRVIVTGTGMIGCVPAELALHSLDGSCAPDLTRAADLFNPQLERMLTELNGEV  265

Query  546   -KADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
                DVF+AANT  +  DF+FNPQ +GF T+K+ACCGQGPYNGIGLCT ASN+C NRD YA
Sbjct  266   GHDDVFIAANTNRVSFDFMFNPQQYGFATAKIACCGQGPYNGIGLCTPASNVCANRDAYA  325

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             +WD FHP+E+ANRIIV     G+TD++ PMNLSTI+ +D+
Sbjct  326   YWDAFHPTERANRIIVANFMHGTTDHISPMNLSTILAMDN  365



>ref|XP_003574015.1| PREDICTED: GDSL esterase/lipase LTL1 [Brachypodium distachyon]
Length=374

 Score =   512 bits (1319),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 243/362 (67%), Positives = 288/362 (80%), Gaps = 7/362 (2%)
 Frame = -3

Query  1332  WLPNNHGILLGLLALTIVFFGRAEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDY  1156
             W  +   + +GLLA  +      EC RAFFVFGDSLVDNGNNNYL T+ARAD PPYGID+
Sbjct  14    WAMSTMLMAVGLLASPV------ECARAFFVFGDSLVDNGNNNYLMTSARADSPPYGIDF  67

Query  1155  PTHRATGRFSNGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGV  976
             PTHRATGRFSNGLNIPDIISE LG EPTLP L P+L G KLLVGANFASAGVGILNDTG+
Sbjct  68    PTHRATGRFSNGLNIPDIISEHLGAEPTLPYLCPELHGAKLLVGANFASAGVGILNDTGI  127

Query  975   QFMNIIRIGNQLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSA  796
             QF+NI+R+  QL YF EYQ ++  L+GA +A Q+VN+ALVLITLGGNDFVNNYYL+PFS 
Sbjct  128   QFVNIVRMSRQLHYFREYQAKLRALVGAAQATQVVNRALVLITLGGNDFVNNYYLIPFSL  187

Query  795   RSRQFTIPDYVPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVD  616
             RSRQ+ +PDYV  LISEY+KIL  LY++GARRV+VTGTGP+GC PAELA RSR GEC  D
Sbjct  188   RSRQYALPDYVRLLISEYKKILVNLYEMGARRVLVTGTGPLGCAPAELALRSRDGECDKD  247

Query  615   LQRAAALFNPQLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQG  436
             L RAA LFNPQL+ +L ELN       F+AAN   +H DFI +P A+GF T+K ACCGQG
Sbjct  248   LMRAAGLFNPQLSDVLGELNGRYGDGTFIAANAMKVHFDFISDPAAYGFRTAKEACCGQG  307

Query  435   PYNGIGLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMEL  256
             P+NG+GLCT ASN+C NRD Y FWD +HP+E+ANRIIV    +GS DY+ P+NLST++ +
Sbjct  308   PHNGLGLCTVASNMCANRDEYVFWDSYHPTERANRIIVSQFMTGSLDYVSPLNLSTVLHM  367

Query  255   DS  250
             D+
Sbjct  368   DA  369



>gb|ACR37591.1| unknown [Zea mays]
Length=369

 Score =   511 bits (1317),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 284/340 (84%), Gaps = 1/340 (0%)
 Frame = -3

Query  1266  AEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +EC RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTHR TGRFSNG NIPDIISE 
Sbjct  27    SECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSNGKNIPDIISEH  86

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG EPTLP LSP+L+G+KLLVGANFASAGVGILNDTG QF++IIR+  QL YF EYQ ++
Sbjct  87    LGAEPTLPYLSPELRGQKLLVGANFASAGVGILNDTGFQFVDIIRMSRQLHYFGEYQGKL  146

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S L+GA  A+QLV ++LVLITLGGNDFVNNYYLVPFS RSRQF +P+YV +++SEY+KIL
Sbjct  147   SALVGAARARQLVRRSLVLITLGGNDFVNNYYLVPFSLRSRQFALPEYVGYIVSEYKKIL  206

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY +G RRV+VTGTGP+GC PA LAQRSR GECA +L RAAALFNPQL ++L +LN+ 
Sbjct  207   IRLYAMGCRRVLVTGTGPLGCAPAILAQRSRNGECAAELMRAAALFNPQLARVLDQLNAR  266

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
               A  F+AAN + +H DF+ +P AFGF T+K ACCGQGP+NG+GLCT  SNLC +R  Y 
Sbjct  267   FGAGTFIAANAFRVHFDFVSDPAAFGFATAKDACCGQGPHNGLGLCTPLSNLCADRSKYV  326

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             FWD +HP+E+ANR+IV    SGS DY+ PMNLST++++D+
Sbjct  327   FWDAYHPTERANRVIVSQFMSGSLDYVSPMNLSTVLQMDA  366



>ref|XP_002869473.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45732.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=357

 Score =   510 bits (1314),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 243/338 (72%), Positives = 286/338 (85%), Gaps = 2/338 (1%)
 Frame = -3

Query  1257  RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGME  1078
             RAFFVFGDSLVD+GNNNYL TTARAD PPYGIDYPT R TGRFSNGLN+PDIISE++G E
Sbjct  20    RAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSNGLNLPDIISEQIGSE  79

Query  1077  PTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDLI  898
             PTLP LSP+L GEKLL+GANFASAG+GILNDTGVQF+NI+RIG Q E F+EYQ RVS++I
Sbjct  80    PTLPILSPELTGEKLLIGANFASAGIGILNDTGVQFLNILRIGRQFELFQEYQERVSEII  139

Query  897   GAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRLY  718
             G+ + +QLVN ALVL+TLGGNDFVNNY+  P S+R RQ ++ ++   LISEY+KIL RLY
Sbjct  140   GSDKTQQLVNGALVLMTLGGNDFVNNYFF-PISSRRRQSSLGEFSQLLISEYKKILTRLY  198

Query  717   DLGARRVIVTGTGPIGCVPAELAQR-SRAGECAVDLQRAAALFNPQLTQMLAELNSELKA  541
             +LGARRV+VTGTGP+GCVPAELA   S  GECA + Q+AAA+FNP L QML  LN E+ +
Sbjct  199   ELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLVQMLQGLNREIGS  258

Query  540   DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWD  361
             DVF+ AN +N + DFI NPQ FGFVTSKVACCGQG YNG G+CTQ S+LCP+R+ YAFWD
Sbjct  259   DVFIGANAFNTNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTQLSSLCPDRNAYAFWD  318

Query  360   PFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             PFHP+EKA R+IVQ I +GS +YM+PMNLSTIM LDSR
Sbjct  319   PFHPTEKATRLIVQQIMTGSVEYMNPMNLSTIMALDSR  356



>gb|AFW63005.1| hypothetical protein ZEAMMB73_059549 [Zea mays]
Length=389

 Score =   511 bits (1317),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 248/357 (69%), Positives = 283/357 (79%), Gaps = 23/357 (6%)
 Frame = -3

Query  1251  FFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDII---------  1099
             FFVFGDSLVDNGNNNYL TTARAD PPYGID+PTH+ATGRFSNGLNIPDII         
Sbjct  30    FFVFGDSLVDNGNNNYLLTTARADAPPYGIDFPTHQATGRFSNGLNIPDIIIGDPCFAFP  89

Query  1098  -SEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEY  922
               E LG EP LP LSP+L+GEKLLVGANFASAGVGILNDTG+QF+NIIRIG+QL+YF EY
Sbjct  90    SGEHLGAEPALPYLSPELRGEKLLVGANFASAGVGILNDTGIQFVNIIRIGDQLQYFREY  149

Query  921   QRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEY  742
             QR++  L+G  +A QLVN+ALVLITLGGNDFVNNYYLVP S RSRQ+ +PDYV F++SEY
Sbjct  150   QRKLRALVGEPQATQLVNQALVLITLGGNDFVNNYYLVPMSVRSRQYALPDYVRFIVSEY  209

Query  741   RKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAE  562
             RKIL RLY+LGARRVIVTGTGP+GCVPAELA  S+ GECA +L RA  LFNPQ+  M+  
Sbjct  210   RKILSRLYELGARRVIVTGTGPLGCVPAELALHSQNGECAAELTRAVNLFNPQMVDMVRG  269

Query  561   LNSELKADVFVAANTYNMHMDFIFNPQAF-------------GFVTSKVACCGQGPYNGI  421
             LN  + ADVFV ANTY M+ D++ NPQ F             GF   +VACCGQGPYNGI
Sbjct  270   LNRAIGADVFVTANTYRMNFDYLANPQDFGERRRRGAEPKPKGFTNVQVACCGQGPYNGI  329

Query  420   GLCTQASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             GLCT ASN+C NRD++AFWD FHP+E+ANRIIV     G TDYMHPMNLSTI+ +D 
Sbjct  330   GLCTAASNVCDNRDVFAFWDAFHPTERANRIIVAQFMHGDTDYMHPMNLSTILAMDQ  386



>ref|XP_007139614.1| hypothetical protein PHAVU_008G044500g [Phaseolus vulgaris]
 gb|ESW11608.1| hypothetical protein PHAVU_008G044500g [Phaseolus vulgaris]
Length=370

 Score =   510 bits (1314),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 238/341 (70%), Positives = 283/341 (83%), Gaps = 0/341 (0%)
 Frame = -3

Query  1269  RAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
              A  RAFFVFGDSLVDNGNNNYL T ARA+ PPYGIDYPTHR TGRFSNG NIPD IS++
Sbjct  27    EARPRAFFVFGDSLVDNGNNNYLQTVARANAPPYGIDYPTHRPTGRFSNGFNIPDFISQE  86

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG E T+P  SPDL  E LLVGANFASAGVGILNDTG  FMNII++  QLE F+EYQ+R+
Sbjct  87    LGAESTMPYSSPDLTRENLLVGANFASAGVGILNDTGDHFMNIIKMHKQLENFKEYQQRM  146

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S LIG    K+LVN+AL+LIT+GGNDFVNNY+LV  +ARSRQ+ +PDYV FLIS YRK L
Sbjct  147   SSLIGISRTKRLVNEALILITVGGNDFVNNYFLVNSTARSRQYPLPDYVNFLISRYRKHL  206

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
             Q+LYDLG RRVIVTGTGP+GC PAELA R + GEC+ +LQRAAAL+NPQL QM+ ELNS+
Sbjct  207   QKLYDLGGRRVIVTGTGPMGCAPAELAMRGKNGECSSELQRAAALYNPQLEQMIVELNSK  266

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
             +   +F+AANT  MH DFI NP+A+GF TSKVACCGQGPYNG+GLC   SNLCPNR+++ 
Sbjct  267   IGTVIFIAANTALMHNDFITNPKAYGFDTSKVACCGQGPYNGMGLCLPISNLCPNRELHV  326

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSR  247
             FWD FHP+EK N+++VQ I SGS +YM+P+NLST++ +D+R
Sbjct  327   FWDAFHPTEKTNKLVVQQIMSGSANYMNPINLSTVLAMDAR  367



>gb|ACG46653.1| anther-specific proline-rich protein APG precursor [Zea mays]
Length=392

 Score =   511 bits (1316),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 284/340 (84%), Gaps = 1/340 (0%)
 Frame = -3

Query  1266  AEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +EC RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTHR TGRFSNG NIPDIISE 
Sbjct  50    SECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSNGKNIPDIISEH  109

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG EPTLP LSP+L+G+KLLVGANFASAGVGILNDTG QF++IIR+  QL YF EYQ ++
Sbjct  110   LGAEPTLPYLSPELRGQKLLVGANFASAGVGILNDTGFQFVDIIRMSRQLHYFGEYQGKL  169

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S L+GA  A+QLV ++LVLITLGGNDFVNNYYLVPFS RSRQF +P+YV +++SEY+KIL
Sbjct  170   SALVGAARARQLVRRSLVLITLGGNDFVNNYYLVPFSLRSRQFALPEYVGYIVSEYKKIL  229

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY +G RRV+VTGTGP+GC PA LAQRSR GECA +L RAAALFNPQL ++L +LN+ 
Sbjct  230   IRLYAMGCRRVLVTGTGPLGCAPAILAQRSRNGECAAELMRAAALFNPQLARVLDQLNAR  289

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
               A  F+AAN + +H DF+ +P AFGF T+K ACCGQGP+NG+GLCT  SNLC +R  Y 
Sbjct  290   FGAGTFIAANAFRVHFDFVSDPAAFGFATAKDACCGQGPHNGLGLCTPLSNLCADRSKYV  349

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             FWD +HP+E+ANR+IV    SGS DY+ PMNLST++++D+
Sbjct  350   FWDAYHPTERANRVIVSQFMSGSLDYVSPMNLSTVLQMDA  389



>gb|KEH21597.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=356

 Score =   509 bits (1312),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 243/354 (69%), Positives = 284/354 (80%), Gaps = 13/354 (4%)
 Frame = -3

Query  1305  LGLLALTIVFFGRAECRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFS  1126
             L L+   IV  G A  RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPT + TG   
Sbjct  16    LVLILGVIVPKGEARRRAFFVFGDSLVDNGNNNYLLTTARADSPPYGIDYPTRKPTG---  72

Query  1125  NGLNIPDIISEKLGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGN  946
                       ++LG   TLP LSP+LKG KLL+GANF SAG+GILNDTGVQF+N++++  
Sbjct  73    ----------QQLGTVSTLPYLSPELKGRKLLIGANFGSAGIGILNDTGVQFINVVKMHT  122

Query  945   QLEYFEEYQRRVSDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDY  766
             QL+YFEEYQ+R++ LIG    ++LVNKAL L+T+GGNDFVNNYYLVP S+RSRQ+ +P Y
Sbjct  123   QLDYFEEYQQRLTTLIGGSRTRRLVNKALFLMTVGGNDFVNNYYLVPSSSRSRQYPLPHY  182

Query  765   VPFLISEYRKILQRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNP  586
             V FLI EYRK LQRLYDLGARRV+VTGTGP+GC PAELA RS  GEC+++LQR AAL+NP
Sbjct  183   VKFLICEYRKHLQRLYDLGARRVLVTGTGPLGCAPAELATRSTNGECSMELQRGAALYNP  242

Query  585   QLTQMLAELNSELKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQ  406
             QL QML  LN +L +D+F+AANT  MH DF+ NP A+GFVTSKVACCGQGPYNGIG+CT 
Sbjct  243   QLEQMLQRLNRKLGSDIFIAANTAQMHKDFVTNPTAYGFVTSKVACCGQGPYNGIGVCTT  302

Query  405   ASNLCPNRDIYAFWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDSRT  244
              SNLCPNRD+Y FWDPFHPSEKANR+IV+ I SGST YM PMNLSTI+ LD+ T
Sbjct  303   LSNLCPNRDLYVFWDPFHPSEKANRLIVEQIMSGSTRYMKPMNLSTILLLDAST  356



>ref|NP_001136990.1| uncharacterized protein LOC100217152 [Zea mays]
 gb|ACF83028.1| unknown [Zea mays]
 tpg|DAA49763.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=406

 Score =   510 bits (1314),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 284/340 (84%), Gaps = 1/340 (0%)
 Frame = -3

Query  1266  AEC-RAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEK  1090
             +EC RAFFVFGDSLVDNGNNNYL TTARAD PPYGIDYPTHR TGRFSNG NIPDIISE 
Sbjct  64    SECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSNGKNIPDIISEH  123

Query  1089  LGMEPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRV  910
             LG EPTLP LSP+L+G+KLLVGANFASAGVGILNDTG QF++IIR+  QL YF EYQ ++
Sbjct  124   LGAEPTLPYLSPELRGQKLLVGANFASAGVGILNDTGFQFVDIIRMSRQLHYFGEYQGKL  183

Query  909   SDLIGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKIL  730
             S L+GA  A+QLV ++LVLITLGGNDFVNNYYLVPFS RSRQF +P+YV +++SEY+KIL
Sbjct  184   SALVGAARARQLVRRSLVLITLGGNDFVNNYYLVPFSLRSRQFALPEYVGYIVSEYKKIL  243

Query  729   QRLYDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSE  550
              RLY +G RRV+VTGTGP+GC PA LAQRSR GECA +L RAAALFNPQL ++L +LN+ 
Sbjct  244   IRLYAMGCRRVLVTGTGPLGCAPAILAQRSRNGECAAELMRAAALFNPQLARVLDQLNAR  303

Query  549   LKADVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYA  370
               A  F+AAN + +H DF+ +P AFGF T+K ACCGQGP+NG+GLCT  SNLC +R  Y 
Sbjct  304   FGAGTFIAANAFRVHFDFVSDPAAFGFATAKDACCGQGPHNGLGLCTPLSNLCADRSKYV  363

Query  369   FWDPFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             FWD +HP+E+ANR+IV    SGS DY+ PMNLST++++D+
Sbjct  364   FWDAYHPTERANRVIVSQFMSGSLDYVSPMNLSTVLQMDA  403



>gb|EPS69813.1| hypothetical protein M569_04951, partial [Genlisea aurea]
Length=337

 Score =   508 bits (1307),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 239/337 (71%), Positives = 277/337 (82%), Gaps = 0/337 (0%)
 Frame = -3

Query  1260  CRAFFVFGDSLVDNGNNNYLATTARADGPPYGIDYPTHRATGRFSNGLNIPDIISEKLGM  1081
              RAFFVFGDSLVDNGNNNYL T+ARAD PPYGIDYPTHR TGRFSNG NIPD+IS+ LG 
Sbjct  1     ARAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPTHRPTGRFSNGFNIPDLISQALGA  60

Query  1080  EPTLPCLSPDLKGEKLLVGANFASAGVGILNDTGVQFMNIIRIGNQLEYFEEYQRRVSDL  901
             EPTLP L P+L GE LLVGANFASAGVGILNDTG+QF NIIRI  QLE F +YQ RVS L
Sbjct  61    EPTLPYLDPNLDGENLLVGANFASAGVGILNDTGIQFANIIRIEQQLELFRQYQGRVSSL  120

Query  900   IGAGEAKQLVNKALVLITLGGNDFVNNYYLVPFSARSRQFTIPDYVPFLISEYRKILQRL  721
             IG   +  LVN ALVLITLGGND+VNNY+  P S R  Q+++ D+   LISEYRK+L  L
Sbjct  121   IGEEASGSLVNGALVLITLGGNDYVNNYFFTPLSLRRMQYSLEDFTTLLISEYRKVLSTL  180

Query  720   YDLGARRVIVTGTGPIGCVPAELAQRSRAGECAVDLQRAAALFNPQLTQMLAELNSELKA  541
             YDLGARRV+VTGTGP+GCVP++LA +S  G+CA + QRAAALFNP L QM++ELN EL +
Sbjct  181   YDLGARRVLVTGTGPLGCVPSQLATQSINGQCAQEPQRAAALFNPLLLQMVSELNGELGS  240

Query  540   DVFVAANTYNMHMDFIFNPQAFGFVTSKVACCGQGPYNGIGLCTQASNLCPNRDIYAFWD  361
             DVF+A+N    H DF+ +PQAFGFVTSKVACCGQGPYNG+GLC   SN+C NRD YAFWD
Sbjct  241   DVFIASNANQQHGDFVKDPQAFGFVTSKVACCGQGPYNGVGLCRSTSNICANRDEYAFWD  300

Query  360   PFHPSEKANRIIVQGIFSGSTDYMHPMNLSTIMELDS  250
             PFHP+E+ANRIIVQG+ +GS +YM PMNLSTI+ +D+
Sbjct  301   PFHPTERANRIIVQGLLTGSQEYMFPMNLSTIIAMDA  337



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3863858971050