BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79196_g1_i1 len=1465 path=[1:0-1464]

Length=1465
                                                                      Score     E

sp|O22046.1|CHSE_IPONI  RecName: Full=Chalcone synthase E; AltNam...    782   0.0     Ipomoea nil [qian niu]
sp|O22047.1|CHSE_IPOPU  RecName: Full=Chalcone synthase E; AltNam...    777   0.0     Ipomoea purpurea
gb|ADW11243.1|  chalcone synthase 2                                     730   0.0     
sp|P48387.1|CHS2_CAMSI  RecName: Full=Chalcone synthase 2; AltNam...    729   0.0     Camellia sinensis [black tea]
gb|AIY22756.1|  chalcone synthase                                       726   0.0     
gb|ABS52573.1|  chalcone synthase                                       726   0.0     Gossypium hirsutum [American cotton]
gb|AIY22757.1|  chalcone synthase                                       724   0.0     
gb|ACS12837.1|  chalcone synthase                                       724   0.0     Nicotiana alata [flowering tobacco]
ref|NP_001234036.1|  chalcone synthase 2                                724   0.0     
ref|XP_009764938.1|  PREDICTED: chalcone synthase A                     724   0.0     
gb|ACH56521.1|  chalcone synthase                                       723   0.0     Gossypium hirsutum [American cotton]
gb|ACV72638.1|  chalcone synthase 1                                     723   0.0     Gossypium hirsutum [American cotton]
gb|ABN80439.1|  chalcone synthase                                       723   0.0     Nicotiana benthamiana
ref|XP_007034442.1|  Chalcone and stilbene synthase family protein      723   0.0     
gb|KHG25969.1|  Chalcone synthase 1                                     723   0.0     
gb|AFL47798.1|  chalcone synthase                                       723   0.0     
ref|NP_001275296.1|  chalcone synthase 2                                723   0.0     
gb|AGW22222.1|  chalcone synthase                                       723   0.0     
sp|P22928.2|CHSJ_PETHY  RecName: Full=Chalcone synthase J; AltNam...    722   0.0     Petunia x hybrida [garden petunia]
ref|XP_009616637.1|  PREDICTED: chalcone synthase 2                     722   0.0     
gb|AIV99854.1|  chalcone synthase                                       722   0.0     
gb|ACE60221.1|  chalcone synthase                                       722   0.0     Abelmoschus manihot [aibika]
gb|AAK49457.1|  chalcone synthase                                       721   0.0     Nicotiana tabacum [American tobacco]
ref|XP_011091402.1|  PREDICTED: chalcone synthase                       721   0.0     
gb|AEO96985.1|  chalcone synthase                                       721   0.0     
ref|XP_009619773.1|  PREDICTED: chalcone synthase 1B                    720   0.0     
gb|KDP20327.1|  hypothetical protein JCGZ_06413                         719   0.0     
gb|AFC37242.1|  chalcone synthase 1                                     719   0.0     
ref|XP_002264019.1|  PREDICTED: chalcone synthase 2                     718   0.0     Vitis vinifera
dbj|BAI66465.1|  chalcone synthase                                      718   0.0     Camellia japonica [common camellia]
gb|AIB06736.1|  chalcone synthases-1                                    718   0.0     
sp|P48386.1|CHS1_CAMSI  RecName: Full=Chalcone synthase 1; AltNam...    718   0.0     Camellia sinensis [black tea]
gb|AEO96989.1|  chalcone synthase                                       718   0.0     
ref|XP_009774927.1|  PREDICTED: chalcone synthase 2                     718   0.0     
gb|AGI02994.1|  chalcone synthase                                       717   0.0     
gb|AHK22740.1|  chalcone synthase                                       717   0.0     
ref|XP_010023738.1|  PREDICTED: chalcone synthase 1                     717   0.0     
ref|XP_011020681.1|  PREDICTED: chalcone synthase 1                     717   0.0     
gb|AFE56210.1|  chalcone synthase                                       716   0.0     
sp|Q9ZRS4.1|CHSY_CATRO  RecName: Full=Chalcone synthase; AltName:...    716   0.0     Catharanthus roseus [chatas]
emb|CAA64452.1|  naringenin-chalcone synthase                           716   0.0     Juglans nigra x Juglans regia
dbj|BAE45039.1|  chalcone synthase                                      716   0.0     Gentiana triflora
gb|ABI79305.1|  chalcone synthase                                       715   0.0     Pyrus communis
dbj|BAM17286.1|  chalcone synthase                                      714   0.0     
gb|AGH13332.1|  chalcone synthase                                       714   0.0     
ref|XP_011020677.1|  PREDICTED: chalcone synthase 1-like isoform X1     714   0.0     
sp|Q43163.1|CHSB_SOLTU  RecName: Full=Chalcone synthase 1B; AltNa...    714   0.0     Solanum tuberosum [potatoes]
gb|AEK80412.1|  type III polyketide synthase                            714   0.0     
emb|CAC88858.1|  chalcone synthase                                      714   0.0     Rhododendron simsii
gb|ABP57071.1|  chalcone synthase                                       713   0.0     Solenostemon scutellarioides
gb|ABM63466.1|  aromatic polyketide synthase                            713   0.0     Hypericum hookerianum
gb|ADD74168.1|  chalcone synthase                                       713   0.0     
ref|XP_002303821.2|  naregenin-chalcone synthase family protein         713   0.0     Populus trichocarpa [western balsam poplar]
gb|ACN60400.1|  chalcone synthase                                       713   0.0     Capsicum annuum
ref|XP_010099135.1|  Chalcone synthase                                  713   0.0     
gb|AFH68066.1|  chalcone synthase                                       713   0.0     
sp|Q9FUB7.1|CHSY_HYPAN  RecName: Full=Chalcone synthase; AltName:...    713   0.0     Hypericum androsaemum
sp|P08894.1|CHSA_PETHY  RecName: Full=Chalcone synthase A; AltNam...    712   0.0     Petunia x hybrida [garden petunia]
gb|AAO13091.1|  chalcone synthase                                       712   0.0     Camellia sinensis [black tea]
ref|XP_002303820.1|  naregenin-chalcone synthase family protein         712   0.0     Populus trichocarpa [western balsam poplar]
gb|AFQ92052.1|  chalcone synthase                                       712   0.0     
dbj|BAM17287.1|  chalcone synthase                                      712   0.0     
ref|XP_009376347.1|  PREDICTED: polyketide synthase 5                   712   0.0     
ref|XP_006420608.1|  hypothetical protein CICLE_v10005133mg             712   0.0     
gb|AGV53049.1|  chalcone synthase                                       712   0.0     
gb|AFM74036.1|  chalcone synthase                                       712   0.0     
dbj|BAC87863.1|  chalcone synthase                                      712   0.0     Torenia hybrid cultivar
dbj|BAM17288.1|  chalcone synthase                                      711   0.0     
emb|CAJ44127.1|  chalcone synthase                                      711   0.0     Misopates orontium
gb|ACN30003.1|  chalcone synthase                                       712   0.0     Vitis rotundifolia [fox grape]
dbj|BAC10998.1|  chalcone synthase                                      711   0.0     Nierembergia sp. NB17
dbj|BAO58433.1|  chalcone synthase                                      711   0.0     
ref|XP_008380609.1|  PREDICTED: polyketide synthase 5                   711   0.0     
gb|AEP17003.1|  chalcone synthase                                       711   0.0     
ref|XP_011020680.1|  PREDICTED: chalcone synthase 1-like isoform X2     711   0.0     
gb|AFU52909.1|  chalcone synthase                                       711   0.0     
ref|XP_011034455.1|  PREDICTED: chalcone synthase 1-like                711   0.0     
gb|AAX16494.1|  chalcone synthase                                       711   0.0     Pyrus communis
ref|XP_006489796.1|  PREDICTED: chalcone synthase 1-like                711   0.0     
emb|CAA32731.1|  chalcone synthase                                      711   0.0     Petunia x hybrida [garden petunia]
sp|Q8RVK9.1|CHS_CANSA  RecName: Full=Naringenin-chalcone synthase       711   0.0     Cannabis sativa [marijuana]
dbj|BAB92996.1|  chalcone synthase                                      711   0.0     Malus domestica [apple tree]
gb|AAN05791.1|  chalcone synthase                                       711   0.0     Mazus pumilus [tokiwahaze]
ref|XP_011034457.1|  PREDICTED: chalcone synthase 1-like                710   0.0     
emb|CAA64366.1|  naringenin-chalcone synthase                           710   0.0     Juglans nigra x Juglans regia
gb|AGZ15299.1|  chalcone synthase                                       710   0.0     
gb|AAF60297.1|AF233638_1  chalcone synthase                             710   0.0     Petunia x hybrida [garden petunia]
ref|NP_001275352.1|  chalcone synthase 1A                               710   0.0     
ref|XP_002299282.1|  naregenin-chalcone synthase family protein         709   0.0     Populus trichocarpa [western balsam poplar]
gb|AGU70032.1|  chalcone synthase                                       709   0.0     
gb|AGE84303.1|  chalcone synthase                                       709   0.0     
ref|XP_008380608.1|  PREDICTED: polyketide synthase 5-like              709   0.0     
dbj|BAE17124.1|  chalcone synthase                                      709   0.0     Fragaria x ananassa
gb|AAX63402.1|  chalcone synthase                                       709   0.0     Solanum pinnatisectum
ref|XP_002299281.2|  naregenin-chalcone synthase family protein         709   0.0     Populus trichocarpa [western balsam poplar]
gb|AAL67805.1|AF461105_1  chalcone synthase                             709   0.0     Hypericum perforatum
ref|XP_009376346.1|  PREDICTED: chalcone synthase-like                  709   0.0     
gb|ADV29810.1|  chalcone synthase                                       709   0.0     
gb|AEN83501.1|  chalcone synthase                                       709   0.0     
ref|XP_009353801.1|  PREDICTED: chalcone synthase                       708   0.0     
gb|ABB89213.1|  chalcone synthase                                       708   0.0     Sorbus aucuparia [European mountain ash]
sp|O04111.1|CHSY_PERFR  RecName: Full=Chalcone synthase; AltName:...    708   0.0     Perilla frutescens [beefsteak-mint]
gb|AAB36038.1|  chalcone synthase                                       708   0.0     Petunia x hybrida [garden petunia]
ref|XP_008358057.1|  PREDICTED: polyketide synthase 5                   708   0.0     
ref|XP_010264056.1|  PREDICTED: chalcone synthase 1                     707   0.0     
gb|AHY35308.1|  chalcone synthase 1                                     707   0.0     
ref|XP_004306542.1|  PREDICTED: chalcone synthase 2-like                707   0.0     
ref|XP_007223025.1|  hypothetical protein PRUPE_ppa006888mg             707   0.0     
gb|AEJ88217.1|  chalcone synthase                                       707   0.0     
gb|AFJ44312.1|  chalcone synthase                                       707   0.0     
ref|XP_009370115.1|  PREDICTED: chalcone synthase-like                  707   0.0     
gb|AFX71920.1|  CHS2 chalcone synthase                                  707   0.0     
gb|AGL50915.1|  chalcone synthase                                       706   0.0     
ref|XP_010249317.1|  PREDICTED: chalcone synthase                       707   0.0     
dbj|BAB20074.1|  chalcone synthase                                      706   0.0     Torenia hybrid cultivar
gb|AFC37244.1|  chalcone synthase 3                                     706   0.0     
gb|AIC75908.1|  chalcone synthase                                       706   0.0     
gb|AEW12813.1|  chalcone synthase                                       706   0.0     
dbj|BAE17123.1|  chalcone synthase                                      706   0.0     Fragaria x ananassa
ref|XP_004306543.1|  PREDICTED: chalcone synthase 2-like                706   0.0     
sp|Q9XJ58.1|CHS1_CITSI  RecName: Full=Chalcone synthase 1; AltNam...    706   0.0     Citrus sinensis [apfelsine]
ref|NP_001267879.1|  chalcone synthase                                  706   0.0     
gb|ACJ54531.1|  chalcone synthase                                       706   0.0     Malus domestica [apple tree]
gb|AEC13058.1|  chalcone synthase protein                               705   0.0     
gb|AAM90652.1|AF400567_1  chalcone synthase 6                           706   0.0     Rubus idaeus [European raspberry]
ref|XP_007223028.1|  hypothetical protein PRUPE_ppa006899mg             706   0.0     
ref|XP_008224579.1|  PREDICTED: polyketide synthase 5-like              705   0.0     
sp|Q9AU11.1|PKS1_RUBID  RecName: Full=Polyketide synthase 1; Shor...    705   0.0     Rubus idaeus [European raspberry]
gb|ADD74167.1|  chalcone synthase                                       705   0.0     
gb|ADZ54780.1|  naringenin-chalcone synthase                            705   0.0     
gb|AAX99413.1|  chalcone synthase                                       705   0.0     Fragaria x ananassa
ref|XP_008224578.1|  PREDICTED: polyketide synthase 5                   705   0.0     
ref|XP_009353802.1|  PREDICTED: chalcone synthase-like                  705   0.0     
dbj|BAE17122.1|  chalcone synthase                                      704   0.0     Fragaria x ananassa
dbj|BAA31259.1|  chalcone synthase                                      704   0.0     Vitis vinifera
sp|P48388.1|CHS3_CAMSI  RecName: Full=Chalcone synthase 3; AltNam...    704   0.0     Camellia sinensis [black tea]
ref|XP_010099134.1|  Chalcone synthase                                  704   0.0     
gb|AAM00232.1|AF358432_1  root-specific chalcone synthase               704   0.0     Senna alata [bajagua]
sp|Q9ZRR8.1|CHS1_CASGL  RecName: Full=Chalcone synthase; AltName:...    704   0.0     Casuarina glauca
gb|AHK07000.1|  chalcone synthase                                       704   0.0     
gb|AGW24283.1|  chalcone synthase                                       704   0.0     
dbj|BAO58434.1|  chalcone synthase                                      703   0.0     
ref|NP_001234033.1|  chalcone synthase 1                                703   0.0     
sp|B0LDU6.1|PKS5_RUBID  RecName: Full=Polyketide synthase 5; Shor...    703   0.0     Rubus idaeus [European raspberry]
dbj|BAB84112.1|  chalcone synthase                                      703   0.0     Vitis vinifera
gb|AFL72079.1|  chalcone synthase                                       703   0.0     
sp|P06515.1|CHSY_ANTMA  RecName: Full=Chalcone synthase; AltName:...    702   0.0     Antirrhinum majus [garden snapdragon]
gb|AAM90651.1|AF400566_1  chalcone synthase 11                          702   0.0     Rubus idaeus [European raspberry]
dbj|BAC66467.1|  chalcone synthase                                      702   0.0     Rosa hybrid cultivar
gb|AHZ97870.1|  chalcone synthase                                       702   0.0     
ref|XP_008224580.1|  PREDICTED: polyketide synthase 5-like              702   0.0     
sp|P51090.1|CHSY_VITVI  RecName: Full=Chalcone synthase; AltName:...    702   0.0     Vitis vinifera
gb|AIA22214.1|  chalcone synthase                                       702   0.0     
ref|XP_007032052.1|  Chalcone and stilbene synthase family protein      702   0.0     
gb|ACS36661.1|  CHS4                                                    702   0.0     Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|AGI02993.1|  chalcone synthase                                       702   0.0     
gb|AFU90825.1|  chalcone synthase                                       701   0.0     
gb|AHA61354.1|  chalcone synthase                                       701   0.0     
gb|AAM90650.1|AF400565_1  chalcone synthase 5                           701   0.0     Rubus idaeus [European raspberry]
gb|AAT75302.1|  chalcone synthase                                       701   0.0     Camellia sinensis [black tea]
gb|AAM00231.1|AF358431_1  root-specific chalcone synthase               701   0.0     Senna alata [bajagua]
emb|CAA05512.1|  chalcone synthase                                      700   0.0     Digitalis lanata [Grecian foxglove]
emb|CAK19318.1|  naringenin-chalcone synthase                           700   0.0     Humulus lupulus [common hop]
gb|AGI02996.1|  chalcone synthase                                       699   0.0     
emb|CAK19319.1|  naringenin-chalcone synthase                           699   0.0     Humulus lupulus [common hop]
ref|XP_003601647.1|  Chalcone synthase                                  698   0.0     
ref|XP_003553986.1|  PREDICTED: chalcone synthase-like                  698   0.0     
ref|XP_007161599.1|  hypothetical protein PHAVU_001G083000g             698   0.0     
gb|AAM00230.1|AF358430_1  root-specific chalcone synthase               698   0.0     Senna alata [bajagua]
gb|AFM36768.1|  chalcone synthase                                       698   0.0     
emb|CAK19317.1|  naringenin-chalcone synthase                           698   0.0     Humulus lupulus [common hop]
gb|EYU43821.1|  hypothetical protein MIMGU_mgv1a007904mg                697   0.0     
gb|AHY35309.1|  chalcone synthase 2                                     697   0.0     
gb|AFM36767.1|  chalcone synthase                                       697   0.0     
dbj|BAD34456.1|  chalcone synthase                                      697   0.0     Eustoma exaltatum subsp. russellianum [bluebells]
gb|EPS72180.1|  chalcone synthase                                       697   0.0     
ref|XP_009376348.1|  PREDICTED: polyketide synthase 5-like              697   0.0     
sp|Q9AU09.1|PKS3_RUBID  RecName: Full=Polyketide synthase 3; Shor...    697   0.0     Rubus idaeus [European raspberry]
ref|XP_003531225.1|  PREDICTED: chalcone synthase 1 isoform X1          696   0.0     
ref|XP_003524935.1|  PREDICTED: chalcone synthase                       696   0.0     
gb|ACM17224.1|  naringenin-chalcone synthase                            696   0.0     Humulus lupulus [common hop]
sp|O82144.1|CHSY_HYDMC  RecName: Full=Chalcone synthase; AltName:...    696   0.0     Hydrangea macrophylla
gb|AEN04070.1|  chalcone synthase                                       696   0.0     
gb|AGM46641.1|  chalcone synthase protein                               696   0.0     
sp|P51082.1|CHSB_PEA  RecName: Full=Chalcone synthase 1B; AltName...    696   0.0     Pisum sativum [garden pea]
gb|AAQ62588.1|  chalcone synthase CHS4                                  695   0.0     Glycine max [soybeans]
ref|XP_006585154.1|  PREDICTED: chalcone synthase 3-like isoform X2     694   0.0     
dbj|BAO58435.1|  chalcone synthase                                      695   0.0     
gb|ABC71308.1|  chalcone synthase                                       694   0.0     Saussurea medusa
ref|WP_039310897.1|  hypothetical protein                               693   0.0     
ref|NP_001276296.1|  chalcone synthase                                  694   0.0     
ref|XP_006468926.1|  PREDICTED: chalcone synthase 2-like                694   0.0     
gb|AHJ80976.1|  chalcone synthase                                       694   0.0     
ref|XP_003531219.1|  PREDICTED: chalcone synthase 5-like                694   0.0     
ref|XP_004504355.1|  PREDICTED: chalcone synthase 1-like                693   0.0     
gb|KHN12336.1|  Chalcone synthase 1                                     693   0.0     
gb|KDO45963.1|  hypothetical protein CISIN_1g016330mg                   693   0.0     
gb|AEO36981.1|  chalcone synthase                                       693   0.0     
dbj|BAD34457.1|  chalcone synthase                                      693   0.0     Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAJ14518.1|  chalcone synthase type 4                               693   0.0     
ref|XP_002518132.1|  Chalcone synthase, putative                        693   0.0     Ricinus communis
ref|XP_011006130.1|  PREDICTED: chalcone synthase                       693   0.0     
sp|P51075.2|CHSY_BETPN  RecName: Full=Chalcone synthase; AltName:...    693   0.0     Betula pendula [white birch]
emb|CAH61575.1|  chalcone synthase                                      693   0.0     Dictamnus albus
sp|Q9FSB7.1|CHS3_RUTGR  RecName: Full=Chalcone synthase 3; AltNam...    692   0.0     Ruta graveolens
gb|AGE10597.1|  chalcone synthase                                       692   0.0     
dbj|BAF49290.1|  chalcone synthase                                      692   0.0     Clitoria ternatea
gb|ACQ41890.1|  chalcone synthase                                       692   0.0     Citrus unshiu [satsuma mandarin]
gb|KDP41871.1|  hypothetical protein JCGZ_26889                         692   0.0     
gb|ACB78187.1|  chalcone synthase                                       692   0.0     Senna tora
ref|XP_006446902.1|  hypothetical protein CICLE_v10015535mg             692   0.0     
gb|ABD24222.1|  chalcone synthase                                       692   0.0     Populus alba [abele]
gb|AFM36766.1|  chalcone synthase                                       692   0.0     
ref|XP_002303819.2|  naregenin-chalcone synthase family protein         692   0.0     Populus trichocarpa [western balsam poplar]
gb|ACX31605.1|  chalcone synthase                                       692   0.0     Lilium hybrid cultivar
gb|ACX37403.1|  chalcone synthase                                       691   0.0     Citrus maxima [buntan]
sp|Q9AU10.1|PKS2_RUBID  RecName: Full=Inactive polyketide synthas...    691   0.0     Rubus idaeus [European raspberry]
gb|ABF59866.1|  chalcone synthase                                       691   0.0     Lupinus luteus
gb|ADZ45296.1|  chalcone synthase 2                                     691   0.0     
ref|XP_003624524.1|  Chalcone synthase                                  691   0.0     
sp|P19168.1|CHS3_SOYBN  RecName: Full=Chalcone synthase 3; AltNam...    691   0.0     Glycine max [soybeans]
ref|XP_003516867.1|  PREDICTED: chalcone synthase 6-like                691   0.0     
ref|XP_004493096.1|  PREDICTED: chalcone synthase-like                  691   0.0     
gb|AHL69646.1|  chalcone synthase 1                                     691   0.0     
gb|ACM62742.1|  chalcone synthase                                       691   0.0     Garcinia mangostana [mangosteen]
emb|CAC19808.1|  chalcone synthase                                      691   0.0     Humulus lupulus [common hop]
gb|AFU90824.1|  chalcone synthase                                       691   0.0     
ref|XP_003531223.1|  PREDICTED: chalcone synthase 1                     691   0.0     
gb|ADZ45294.1|  chalcone synthase 3                                     691   0.0     
gb|ADB44077.1|  chalcone synthase                                       690   0.0     Litchi chinensis [litchi]
sp|P17957.1|CHS2_SOYBN  RecName: Full=Chalcone synthase 2; AltNam...    690   0.0     Glycine max [soybeans]
ref|XP_008797107.1|  PREDICTED: chalcone synthase 1                     690   0.0     
gb|AFM36770.1|  chalcone synthase                                       690   0.0     
gb|AFM36769.1|  chalcone synthase                                       690   0.0     
dbj|BAA19548.1|  chalcone synthase                                      689   0.0     Perilla frutescens [beefsteak-mint]
ref|XP_002450870.1|  hypothetical protein SORBIDRAFT_05g020160          690   0.0     Sorghum bicolor [broomcorn]
gb|AFW98276.1|  chalone synthase                                        690   0.0     
gb|AFA55180.1|  chalcone synthase                                       690   0.0     
ref|XP_010028921.1|  PREDICTED: chalcone synthase 3                     690   0.0     
gb|ADZ45298.1|  chalcone synthase 1                                     689   0.0     
dbj|BAJ14517.1|  chalcone synthase type 3                               689   0.0     
gb|AHC07953.1|  chalcone synthase                                       689   0.0     
gb|AAO32821.1|  chalcone synthase                                       689   0.0     Arachis hypogaea [goober]
ref|XP_002321081.1|  chalcone synthase family protein                   689   0.0     Populus trichocarpa [western balsam poplar]
gb|AAK39111.1|AF358655_1  chalcone synthase                             689   0.0     Ipomoea purpurea
sp|O22045.1|CHSD_IPONI  RecName: Full=Chalcone synthase D; AltNam...    689   0.0     Ipomoea nil [qian niu]
ref|XP_003533807.1|  PREDICTED: chalcone synthase 6                     688   0.0     
gb|AEK70334.1|  chalcone synthase                                       689   0.0     
dbj|BAJ14516.1|  chalcone synthase type 2                               688   0.0     
gb|ADK78881.1|  chalcone synthase                                       688   0.0     
ref|XP_010929491.1|  PREDICTED: chalcone synthase 2                     688   0.0     
gb|ABF59867.1|  chalcone synthase                                       687   0.0     Lupinus luteus
gb|ADM86717.1|  chalcone synthase                                       688   0.0     
pdb|4WUM|A  Chain A, X-ray Crystal Structure Of Chalcone Synthase...    688   0.0     
sp|Q9SBL7.1|CHS2_SORBI  RecName: Full=Chalcone synthase 2; AltNam...    688   0.0     Sorghum bicolor [broomcorn]
gb|ABB30178.1|  chalcone synthase 1                                     687   0.0     Glycine max [soybeans]
dbj|BAJ14515.1|  chalcone synthase type 1                               688   0.0     
gb|AIU98510.1|  chalcone synthase                                       688   0.0     
sp|Q9FSB8.1|CHS2_RUTGR  RecName: Full=Chalcone synthase 2; AltNam...    687   0.0     Ruta graveolens
ref|XP_004502226.1|  PREDICTED: chalcone synthase 1B-like               687   0.0     
gb|ABW69675.1|  chalcone synthase D                                     687   0.0     Ipomoea purpurea
gb|AAU43217.1|  chalcone synthase                                       687   0.0     Arachis hypogaea [goober]
gb|AEF14414.1|  chalcone synthase                                       687   0.0     
ref|XP_011034458.1|  PREDICTED: chalcone synthase 1-like                687   0.0     
emb|CAP20328.1|  chalcone synthase                                      687   0.0     Gerbera hybrid cultivar
gb|AIZ70321.1|  chalcone synthase                                       687   0.0     
ref|NP_001268064.1|  chalcone synthase                                  689   0.0     
ref|XP_010908134.1|  PREDICTED: chalcone synthase 3-like                687   0.0     
gb|AAK39110.1|AF358654_1  chalcone synthase                             686   0.0     Ipomoea purpurea
gb|ADB28916.1|  chalcone synthase                                       687   0.0     
ref|XP_002450871.1|  hypothetical protein SORBIDRAFT_05g020170          687   0.0     Sorghum bicolor [broomcorn]
ref|XP_002449616.1|  hypothetical protein SORBIDRAFT_05g020150          687   0.0     Sorghum bicolor [broomcorn]
gb|ABC86919.1|  chalcone synthase                                       686   0.0     Populus alba [abele]
ref|XP_002450877.1|  hypothetical protein SORBIDRAFT_05g020230          687   0.0     Sorghum bicolor [broomcorn]
gb|AFK33946.1|  unknown                                                 686   0.0     
dbj|BAB40787.2|  chalcone synthase                                      686   0.0     Lilium hybrid division I
ref|XP_010908135.1|  PREDICTED: chalcone synthase 3-like                686   0.0     
sp|P51081.1|CHSA_PEA  RecName: Full=Chalcone synthase 1A; AltName...    686   0.0     Pisum sativum [garden pea]
ref|XP_007157043.1|  hypothetical protein PHAVU_002G038700g             686   0.0     
gb|ABY68457.1|  chalcone synthase                                       686   0.0     
dbj|BAJ17656.1|  chalcone synthase                                      686   0.0     
gb|AAD49355.1|AF169800_1  chalcone synthase                             686   0.0     
gb|AAD49353.1|AF169798_1  chalcone synthase                             686   0.0     
ref|XP_004979391.1|  PREDICTED: chalcone synthase C2-like               686   0.0     
gb|ADF57184.1|  chalcone synthase                                       686   0.0     
ref|XP_008808809.1|  PREDICTED: chalcone synthase 3                     685   0.0     
dbj|BAJ88598.1|  predicted protein                                      685   0.0     
gb|ACT31917.1|  chalcone synthase                                       685   0.0     
ref|XP_010909688.1|  PREDICTED: chalcone synthase 3-like                685   0.0     
dbj|BAE79201.1|  chalcon synthase                                       685   0.0     
dbj|BAJ14768.1|  chalcone synthase type 1                               685   0.0     
sp|P16107.1|CHSY_PETCR  RecName: Full=Chalcone synthase; AltName:...    685   0.0     
gb|AGU91424.1|  chalcone synthase                                       685   0.0     
ref|XP_002450875.1|  hypothetical protein SORBIDRAFT_05g020210          685   0.0     
gb|ABM66532.1|  chalcone synthase                                       684   0.0     
sp|P48390.1|CHS1_GERHY  RecName: Full=Chalcone synthase 1; AltNam...    685   0.0     
gb|AAQ19318.1|  chalcone synthase                                       684   0.0     
sp|Q9MB38.1|CHS6_IPOBA  RecName: Full=Chalcone synthase DII; AltN...    684   0.0     
sp|Q9SBL4.1|CHS5_SORBI  RecName: Full=Chalcone synthase 5; AltNam...    685   0.0     
gb|AAK39114.1|AF358658_1  chalcone synthase                             684   0.0     
sp|Q9FSB9.1|CHS1_RUTGR  RecName: Full=Chalcone synthase 1; AltNam...    684   0.0     
sp|Q9MB41.1|CHS2_IPOBA  RecName: Full=Chalcone synthase LF2; AltN...    684   0.0     
ref|XP_007157050.1|  hypothetical protein PHAVU_002G039100g             684   0.0     
gb|AGJ50587.1|  CHS1                                                    684   0.0     
gb|AAQ19321.1|  chalcone synthase                                       684   0.0     
ref|XP_002450874.1|  hypothetical protein SORBIDRAFT_05g020200          684   0.0     
ref|XP_010907554.1|  PREDICTED: chalcone synthase 3-like                684   0.0     
sp|P53415.1|CHS2_SECCE  RecName: Full=Chalcone synthase 2; AltNam...    684   0.0     
gb|KEH27375.1|  chalcone and stilbene synthase family protein           684   0.0     
ref|XP_003601648.1|  Chalcone synthase                                  683   0.0     
gb|AFM29141.1|  chalcone synthase                                       683   0.0     
gb|EMT10555.1|  Chalcone synthase 1                                     684   0.0     
gb|AIB06737.1|  chalcone synthases-1                                    684   0.0     
sp|A2ZEX7.1|CHS1_ORYSI  RecName: Full=Chalcone synthase 1; Short=...    684   0.0     
gb|AID51449.1|  chalcone synthase 2                                     683   0.0     
sp|Q9ZS40.1|CHS2_DAUCA  RecName: Full=Chalcone synthase 2; AltNam...    683   0.0     
dbj|BAH16615.1|  chalcone synthase                                      683   0.0     
ref|NP_001068009.1|  Os11g0530600                                       683   0.0     
dbj|BAM28981.1|  chalcone synthase C                                    683   0.0     
sp|Q9MB36.1|CHS8_IPOBA  RecName: Full=Chalcone synthase DIV; AltN...    683   0.0     
ref|NP_001142246.1|  chalcone synthase C2                               683   0.0     
gb|AAK39113.1|AF358657_1  chalcone synthase                             683   0.0     
ref|XP_002450876.1|  hypothetical protein SORBIDRAFT_05g020220          683   0.0     
gb|ABM73434.1|  chalcone synthase                                       683   0.0     
gb|ACH67480.1|  chalcone synthase                                       682   0.0     
dbj|BAB40786.2|  chalcone synthase                                      682   0.0     
ref|XP_003577513.1|  PREDICTED: chalcone synthase 2                     683   0.0     
sp|Q9MB40.1|CHS3_IPOBA  RecName: Full=Chalcone synthase LF3; AltN...    682   0.0     
gb|AFK65634.1|  chalcone synthase 2                                     683   0.0     
gb|ABF69124.1|  chalcone synthase                                       682   0.0     
ref|XP_003518828.1|  PREDICTED: chalcone synthase 6-like                682   0.0     
gb|AAQ19319.1|  chalcone synthase                                       682   0.0     
gb|ACH42078.1|  chalcone synthase                                       682   0.0     
sp|P49440.1|CHSY_PHAVU  RecName: Full=Chalcone synthase 17; AltNa...    682   0.0     
gb|EMT14846.1|  Chalcone synthase 2                                     682   0.0     
gb|ADZ45299.1|  chalcone synthase 1                                     682   0.0     
gb|AAN76184.1|  chalcone synthase                                       682   0.0     
gb|ABF59865.1|  chalcone synthase                                       682   0.0     
gb|KCW55748.1|  hypothetical protein EUGRSUZ_I01579                     686   0.0     
gb|ADZ45297.1|  chalcone synthase 2                                     682   0.0     
sp|Q9MB37.1|CHS7_IPOBA  RecName: Full=Chalcone synthase DIII; Alt...    682   0.0     
gb|ABE01413.1|  chalcone synthase                                       682   0.0     
gb|AFJ49141.1|  CHS                                                     681   0.0     
dbj|BAE53636.1|  chalcone synthase                                      681   0.0     
ref|XP_008808192.1|  PREDICTED: chalcone synthase C2                    682   0.0     
gb|EMS66719.1|  Chalcone synthase 2                                     682   0.0     
ref|XP_007157053.1|  hypothetical protein PHAVU_002G039300g             681   0.0     
gb|AFD36435.1|  chalcone synthase 1                                     681   0.0     
sp|P48385.2|CHSY_CALCH  RecName: Full=Chalcone synthase; AltName:...    682   0.0     
sp|Q9MB33.1|CHS1_IPOBA  RecName: Full=Chalcone synthase LF1; AltN...    682   0.0     
sp|Q9MB39.1|CHS4_IPOBA  RecName: Full=Chalcone synthase LF4; AltN...    682   0.0     
gb|KEH27376.1|  chalcone and stilbene synthase family protein           681   0.0     
ref|XP_007157042.1|  hypothetical protein PHAVU_002G038600g             681   0.0     
emb|CAA10131.1|  chalcone synthase                                      681   0.0     
ref|XP_006662967.1|  PREDICTED: chalcone synthase 1-like                681   0.0     
dbj|BAJ14519.1|  chalcone synthase 2                                    681   0.0     
gb|AHZ30595.1|  chalcone synthase                                       680   0.0     
gb|AAQ19323.1|  chalcone synthase                                       681   0.0     
ref|XP_009404732.1|  PREDICTED: chalcone synthase 2                     681   0.0     
gb|AAQ19320.1|  chalcone synthase                                       681   0.0     
ref|XP_007158815.1|  hypothetical protein PHAVU_002G184300g             680   0.0     
gb|AIZ50175.1|  chalcone synthase                                       680   0.0     
sp|P23569.1|CHSY_PUEML  RecName: Full=Chalcone synthase; AltName:...    680   0.0     
gb|ADB44076.1|  chalcone synthase                                       680   0.0     
dbj|BAJ85286.1|  predicted protein                                      680   0.0     
gb|ADZ45295.1|  chalcone synthase 3                                     680   0.0     
sp|P30077.1|CHS9_MEDSA  RecName: Full=Chalcone synthase 9; AltNam...    680   0.0     
sp|P30075.2|CHS4_MEDSA  RecName: Full=Chalcone synthase 4; AltNam...    680   0.0     
gb|AAG43350.1|AF144532_1  chalcone synthase                             680   0.0     
gb|EMT16500.1|  Chalcone synthase 2                                     680   0.0     
gb|AAP20864.1|  putative chalcone synthase                              680   0.0     
ref|XP_010910437.1|  PREDICTED: chalcone synthase 3-like                680   0.0     
gb|AAD49354.1|AF169799_1  chalcone synthase                             680   0.0     
gb|AFK48401.1|  unknown                                                 679   0.0     
gb|AAG43348.1|AF144530_1  chalcone synthase                             679   0.0     
dbj|BAK08888.1|  chalcone synthase 2                                    679   0.0     
dbj|BAA75310.1|  Chalcone synthase                                      679   0.0     
gb|AHL83549.1|  chalcone synthase                                       679   0.0     
ref|XP_003537853.1|  PREDICTED: chalcone synthase                       678   0.0     
ref|NP_001149022.1|  chalcone synthase                                  679   0.0     
gb|EMT05352.1|  Chalcone synthase 2                                     678   0.0     
gb|AHN85848.1|  chalcone synthase                                       679   0.0     
ref|XP_003621538.1|  Chalcone synthase                                  678   0.0     
ref|XP_009421018.1|  PREDICTED: chalcone synthase 2-like                678   0.0     
gb|AHJ60259.1|  chalcone synthase                                       678   0.0     
dbj|BAM28982.1|  chalcone synthase C                                    678   0.0     
gb|AEU17693.1|  chalcone synthase-like protein                          678   0.0     
gb|AHB18370.1|  chalcone synthase 1                                     677   0.0     
ref|XP_003610852.1|  Chalcone synthase                                  677   0.0     
gb|KFK25629.1|  hypothetical protein AALP_AA8G139500                    677   0.0     
dbj|BAJ21532.1|  chalcone synthase type 2                               677   0.0     
gb|AAG43356.1|AF144538_1  chalcone synthase                             677   0.0     
sp|O23882.1|CHS4_PEA  RecName: Full=Chalcone synthase 4; AltName:...    677   0.0     
gb|AGC72947.1|  chalcone synthase                                       677   0.0     
sp|O23884.1|CHS5_PEA  RecName: Full=Chalcone synthase 5; AltName:...    677   0.0     
gb|AHZ31750.1|  chalcone synthase                                       677   0.0     
sp|Q01286.1|CHS1_PEA  RecName: Full=Chalcone synthase 1; AltName:...    677   0.0     
sp|Q9SEP2.1|CHSY_CARAN  RecName: Full=Chalcone synthase; AltName:...    677   0.0     
sp|Q01288.1|CHS6_PEA  RecName: Full=Chalcone synthase 6; AltName:...    677   0.0     
sp|P51077.1|CHS3_MEDSA  RecName: Full=Chalcone synthase 4-1; AltN...    677   0.0     
sp|Q01287.1|CHS2_PEA  RecName: Full=Chalcone synthase 2; AltName:...    677   0.0     
sp|P26018.1|CHS1_HORVU  RecName: Full=Chalcone synthase 1; AltNam...    677   0.0     
sp|P30074.1|CHS2_MEDSA  RecName: Full=Chalcone synthase 2; AltNam...    676   0.0     
sp|Q9SML4.1|CHS1_CICAR  RecName: Full=Chalcone synthase 1; AltNam...    676   0.0     
sp|P51084.1|CHS2_TRISU  RecName: Full=Chalcone synthase 2; AltNam...    676   0.0     
sp|O23883.1|CHS3_PEA  RecName: Full=Chalcone synthase 3; AltName:...    676   0.0     
gb|ABE03647.1|  chalcone synthase                                       676   0.0     
emb|CDX78547.1|  BnaA03g04590D                                          676   0.0     
gb|ACT32034.1|  chalcone synthase                                       676   0.0     
gb|ABE03651.1|  chalcone synthase                                       676   0.0     
gb|ADF43042.1|  chalcone synthase 1 protein                             676   0.0     
gb|AHB50476.1|  putative stilbene synthase                              676   0.0     
gb|ABE03650.1|  chalcone synthase                                       676   0.0     
gb|AAO67373.1|  chalcone synthase                                       676   0.0     
gb|ACU21426.1|  unknown                                                 675   0.0     
sp|P51085.1|CHS3_TRISU  RecName: Full=Chalcone synthase 3; AltNam...    675   0.0     
sp|P51083.1|CHS1_TRISU  RecName: Full=Chalcone synthase 1; AltNam...    675   0.0     
sp|O04220.1|CHSY_CHRAE  RecName: Full=Chalcone synthase; AltName:...    675   0.0     
gb|AAG43360.1|AF144542_1  chalcone synthase                             676   0.0     
emb|CAC20725.1|  putative chalcone synthase                             675   0.0     
gb|AGC72966.1|  chalcone synthase                                       675   0.0     
gb|ABE03652.1|  chalcone synthase                                       675   0.0     
ref|XP_008778753.1|  PREDICTED: chalcone synthase 3-like                675   0.0     
gb|AGC72946.1|  chalcone synthase                                       674   0.0     
sp|Q9SEP4.1|CHSY_ARAAL  RecName: Full=Chalcone synthase; AltName:...    674   0.0     
gb|AGC72954.1|  chalcone synthase                                       674   0.0     
gb|EMS64381.1|  Chalcone synthase 2                                     675   0.0     
gb|AAG43352.1|AF144534_1  chalcone synthase                             674   0.0     
gb|KHN25612.1|  Chalcone synthase 7                                     674   0.0     
ref|XP_003592044.1|  Chalcone synthase                                  674   0.0     
ref|XP_003621530.1|  Chalcone synthase                                  674   0.0     
ref|XP_009404102.1|  PREDICTED: chalcone synthase 2-like                674   0.0     
gb|ADE59487.1|  type III polyketide synthase 3                          674   0.0     
ref|XP_003621532.1|  Chalcone synthase                                  674   0.0     
gb|AAG43359.1|AF144541_1  chalcone synthase                             674   0.0     
pdb|1CHW|A  Chain A, Chalcone Synthase From Alfalfa Complexed Wit...    674   0.0     
sp|P48392.1|CHS3_GERHY  RecName: Full=Chalcone synthase 3; AltNam...    674   0.0     
sp|P17818.1|CHSY_MATIN  RecName: Full=Chalcone synthase; AltName:...    674   0.0     
gb|ABE03664.1|  chalcone synthase                                       673   0.0     
prf||1609233A  chalcone synthase 3                                      673   0.0  
pdb|1CML|A  Chain A, Chalcone Synthase From Alfalfa Complexed Wit...    673   0.0     
gb|AAZ23764.1|  chalcone synthase family protein                        673   0.0     
gb|ABO21005.1|  chalcone synthase                                       673   0.0     
gb|ABE03648.1|  chalcone synthase                                       673   0.0     
gb|ABE03669.1|  chalcone synthase                                       673   0.0     
ref|XP_006399896.1|  hypothetical protein EUTSA_v10013745mg             673   0.0     
gb|AGC72963.1|  chalcone synthase                                       672   0.0     
gb|AAF23583.1|AF112108_1  chalcone synthase                             673   0.0     
ref|XP_003621536.1|  Chalcone synthase                                  672   0.0     
sp|P51087.1|CHS5_TRISU  RecName: Full=Chalcone synthase 5; AltNam...    672   0.0     
gb|ABE03654.1|  chalcone synthase                                       672   0.0     
pdb|1BI5|A  Chain A, Chalcone Synthase From Alfalfa                     672   0.0     
sp|P13417.1|CHS3_SINAL  RecName: Full=Chalcone synthase 3; AltNam...    672   0.0     
gb|ABF68878.1|  chalcone synthase                                       672   0.0     
emb|CDX69618.1|  BnaA10g19670D                                          672   0.0     
gb|ABQ95960.1|  chalcone synthase                                       672   0.0     
gb|AEO96986.1|  chalcone synthase                                       672   0.0     
emb|CDY09836.1|  BnaC09g43250D                                          672   0.0     
gb|AAZ23761.1|  chalcone synthase family protein                        672   0.0     
gb|AAG43349.1|AF144531_1  chalcone synthase                             672   0.0     
sp|P53414.1|CHS1_SECCE  RecName: Full=Chalcone synthase 1; AltNam...    672   0.0     
gb|ABE03665.1|  chalcone synthase                                       672   0.0     
ref|XP_003621534.1|  Chalcone synthase                                  672   0.0     
gb|ABE03653.1|  chalcone synthase                                       672   0.0     
sp|P51088.1|CHS6_TRISU  RecName: Full=Chalcone synthase 6; AltNam...    672   0.0     
gb|ABE03649.1|  chalcone synthase                                       672   0.0     
gb|ABG76200.1|  chalcone synthase                                       672   0.0     
gb|ABE03660.1|  chalcone synthase                                       672   0.0     
gb|AAZ23765.1|  chalcone synthase family protein                        672   0.0     
ref|XP_009131369.1|  PREDICTED: chalcone synthase 3-like                672   0.0     
emb|CAI30816.1|  chalcone synthase                                      672   0.0     
gb|AAZ23769.1|  chalcone synthase family protein                        672   0.0     
sp|O22652.1|CHSY_RAPSA  RecName: Full=Chalcone synthase; AltName:...    671   0.0     
ref|XP_003517529.1|  PREDICTED: chalcone synthase 7                     671   0.0     
gb|AGC72960.1|  chalcone synthase                                       671   0.0     
emb|CAD20740.1|  chalcone synthase                                      671   0.0     
gb|AAG43353.1|AF144535_1  chalcone synthase                             671   0.0     
ref|XP_002871591.1|  chalcone synthase                                  671   0.0     
gb|AAF23570.1|AF112095_1  chalcone synthase                             671   0.0     
gb|ACN41945.1|  chalcone synthase                                       671   0.0     
gb|ABQ95964.1|  chalcone synthase                                       671   0.0     
gb|AAZ23766.1|  chalcone synthase family protein                        671   0.0     
gb|AAF23559.1|AF112084_1  chalcone synthase                             671   0.0     
pdb|1BQ6|A  Chain A, Chalcone Synthase From Alfalfa With Coenzyme A     671   0.0     
gb|KEH43642.1|  chalcone and stilbene synthase family protein           671   0.0     
gb|AAG43351.1|AF144533_1  chalcone synthase                             671   0.0     
emb|CDX91090.1|  BnaC02g05070D                                          671   0.0     
gb|AIM48929.1|  chalcone synthase                                       671   0.0     
gb|ADE18850.1|  chalcone synthase                                       671   0.0     
gb|AAF23568.1|AF112093_1  chalcone synthase                             671   0.0     
pdb|1I86|A  Chain A, Chalcone Synthase, G256a Mutant                    671   0.0     
gb|AAZ23760.1|  chalcone synthase family protein                        671   0.0     
ref|NP_196897.1|  chalcone synthase                                     671   0.0     
ref|XP_003610855.1|  Chalcone synthase                                  671   0.0     
gb|AAZ23759.1|  chalcone synthase family protein                        671   0.0     
gb|ABF68856.1|  chalcone synthase                                       670   0.0     
gb|ABQ95962.1|  chalcone synthase                                       671   0.0     
gb|ABE03670.1|  chalcone synthase                                       670   0.0     
gb|ABF68855.1|  chalcone synthase                                       670   0.0     
ref|XP_003592022.1|  Chalcone synthase                                  670   0.0     



>sp|O22046.1|CHSE_IPONI RecName: Full=Chalcone synthase E; AltName: Full=Naringenin-chalcone 
synthase E; Short=CHS-E [Ipomoea nil]
 dbj|BAA21788.1| chalcone synthase [Ipomoea nil]
 dbj|BAA87338.1| chalcone synthase [Ipomoea nil]
Length=389

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/389 (100%), Positives = 389/389 (100%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW
Sbjct  241   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT
Sbjct  301   IAHPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>sp|O22047.1|CHSE_IPOPU RecName: Full=Chalcone synthase E; AltName: Full=Naringenin-chalcone 
synthase E; Short=CHS-E [Ipomoea purpurea]
 dbj|BAA21789.1| chalcone synthase [Ipomoea purpurea]
 dbj|BAA87337.1| chalcone synthase [Ipomoea purpurea]
Length=389

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/389 (99%), Positives = 387/389 (99%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEIL ENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILTENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIRDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT
Sbjct  301   IAHPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>gb|ADW11243.1| chalcone synthase 2 [Camellia chekiangoleosa]
 gb|AFC37243.1| chalcone synthase 2 [Camellia chekiangoleosa]
Length=389

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/388 (91%), Positives = 376/388 (97%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSLNEAFQPL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLNEAFQPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK+S+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSAKEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS+S
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLS  388



>sp|P48387.1|CHS2_CAMSI RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Camellia sinensis]
 dbj|BAA05641.1| chalcone synthase [Camellia sinensis]
 gb|AGI02995.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/388 (91%), Positives = 376/388 (97%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAFQPL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK+S+K+GL T
Sbjct  301   IAHPGGPAILDQVELKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSAKKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>gb|AIY22756.1| chalcone synthase [Iochroma cyaneum]
Length=389

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/388 (92%), Positives = 375/388 (97%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTVIRLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDS+VGQALFGDGAAA+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATR VLS+YGNMSSACVLFILDEMRKAS+KEGL+T
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>gb|ABS52573.1| chalcone synthase [Gossypium hirsutum]
 gb|AEO96990.1| chalcone synthase [Gossypium hirsutum]
 gb|KHF97262.1| Chalcone synthase 1 [Gossypium arboreum]
 gb|KHG14487.1| Chalcone synthase 1 [Gossypium arboreum]
 gb|KHG14899.1| Chalcone synthase 1 [Gossypium arboreum]
Length=389

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/389 (91%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEIEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLQT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|AIY22757.1| chalcone synthase [Iochroma cyaneum]
Length=389

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/388 (92%), Positives = 374/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTVIRLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDS+VGQALFGDGAAA+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   STAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATR VLS+YGNMSSACVLFILDEMRKAS+KEGL+T
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>gb|ACS12837.1| chalcone synthase [Nicotiana alata]
Length=389

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/388 (91%), Positives = 373/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEFRRAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIGSDP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIIGSDPIPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATR+VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKQEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|NP_001234036.1| chalcone synthase 2 [Solanum lycopersicum]
 sp|P23419.2|CHS2_SOLLC RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum lycopersicum]
 emb|CAA38981.1| chalcone synthase [Solanum lycopersicum]
 gb|AEK99072.1| chalcone synthase [Solanum lycopersicum]
Length=389

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/388 (91%), Positives = 374/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI KRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH+VFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTVIRLAKDLAEN
Sbjct  121   KSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDS+VGQALFGD AAA+IIGSDP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDRAAAMIIGSDPLPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATR VLS+YGNMSSACVLFILDEMRKASSKEGL+T
Sbjct  301   IAHPGGPAILDQVELKLSLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASSKEGLST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>ref|XP_009764938.1| PREDICTED: chalcone synthase A [Nicotiana sylvestris]
Length=389

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/388 (91%), Positives = 373/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEFRRAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKI+HLVFCTTSGVDMPG DYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKISHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP PD+ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPIPDVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATR+VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKQEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|ACH56521.1| chalcone synthase [Gossypium hirsutum]
 gb|AEO96988.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/389 (91%), Positives = 372/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+F++V
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPMPEIEKPMFEIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SVAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLQT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|ACV72638.1| chalcone synthase 1 [Gossypium hirsutum]
Length=389

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/389 (91%), Positives = 372/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYF ITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFHITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPMPEIEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLQT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|ABN80439.1| chalcone synthase [Nicotiana benthamiana]
Length=389

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/388 (91%), Positives = 372/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEFRRAQRAEGPATVMAIGTATPFNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIGSDP P++ERPLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL L  EKL+ATR+VL+ YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLNQEKLKATRNVLTNYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_007034442.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOY05368.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=389

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/389 (91%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIK+RYMYLTEEILKENPNICAYMA SLDARQD+VVVEVPKLGKEAA +AIKEWGQP
Sbjct  61    EKSMIKRRYMYLTEEILKENPNICAYMATSLDARQDMVVVEVPKLGKEAATRAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEIEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS+SA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSISA  389



>gb|KHG25969.1| Chalcone synthase 1 [Gossypium arboreum]
Length=389

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/389 (90%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGADPLPEIEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS+SA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSISA  389



>gb|AFL47798.1| chalcone synthase [Capsicum annuum]
Length=402

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/388 (91%), Positives = 374/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+ QRA+GPATIMAIGT+TP NCVDQ+TYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1     MVTVEEVRREQRAKGPATIMAIGTATPSNCVDQATYPDYYFRITNSEHMTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAA+KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAKKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTVIRLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDS+VGQALFGDGAAALI+GSDP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAALIVGSDPLPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATR VLS+YGNMSSACVLFILDEMRKAS+KEGLNT
Sbjct  301   IAHPGGPAILDQVELKLGLKLEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>ref|NP_001275296.1| chalcone synthase 2 [Solanum tuberosum]
 sp|Q43188.1|CHS2_SOLTU RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum tuberosum]
 gb|AAB05239.1| chalcone synthase 2 [Solanum tuberosum]
Length=389

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/388 (91%), Positives = 374/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI KRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH+VFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTVIRLAKDLAEN
Sbjct  121   KSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTF GPSD HLDS+VGQALFGDGAAA+IIGSDP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFSGPSDTHLDSMVGQALFGDGAAAMIIGSDPLPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL+ATR VLS+YGNMSSACVLFILDEMRKASSKEGL+T
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLQATRQVLSDYGNMSSACVLFILDEMRKASSKEGLST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>gb|AGW22222.1| chalcone synthase [Abelmoschus esculentus]
Length=389

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/389 (91%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRIT+SEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITSSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPIPEIEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK+S + GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSKENGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVTA  389



>sp|P22928.2|CHSJ_PETHY RecName: Full=Chalcone synthase J; AltName: Full=Naringenin-chalcone 
synthase J [Petunia x hybrida]
 emb|CAA32737.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/388 (91%), Positives = 373/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+R+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEIRRAQRAEGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIIGSDPLPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA+QT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+I+KSL EAFQPLGI DWNS+FW
Sbjct  241   SASQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIQKSLVEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVS  388



>ref|XP_009616637.1| PREDICTED: chalcone synthase 2 [Nicotiana tomentosiformis]
Length=389

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/389 (90%), Positives = 372/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFR+TNSEH+ ELKEKFKRMC
Sbjct  1     MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDS+VGQALFGDGAAA+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPVPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLG+ DWNS+FW
Sbjct  241   SAAQTLLPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLSDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE  L LKPEKLRATR VLS+YGNMSSACVLFILDEMRK S+KEG  T
Sbjct  301   IAHPGGPAILDQVELTLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKTSAKEGFGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGL+WGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVSA  389



>gb|AIV99854.1| chalcone synthase [Iochroma calycinum]
 gb|AIY22758.1| chalcone synthase [Iochroma calycinum]
Length=389

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/388 (91%), Positives = 375/388 (97%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M+TVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MMTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTVIRLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDS+VGQALFGDGAAA+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLIS++IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISQNIEKSLIEAFQPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATR VLS+YGNMSSACVLFILDE+RKAS+KEGL+T
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEIRKASAKEGLST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>gb|ACE60221.1| chalcone synthase [Abelmoschus manihot]
Length=389

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/389 (91%), Positives = 372/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRIT SEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITKSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPIPEIEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK+S + GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSKENGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVTA  389



>gb|AAK49457.1| chalcone synthase [Nicotiana tabacum]
Length=389

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/388 (91%), Positives = 372/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE R+AQ A+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIGSDP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATR VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_011091402.1| PREDICTED: chalcone synthase [Sesamum indicum]
Length=390

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/387 (91%), Positives = 376/387 (97%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+R+AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRIT+SEH  ELKEKFKRMC
Sbjct  1     MVTVEEIRRAQRAEGPATVLAIGTATPTNCVDQSTYPDYYFRITDSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD+HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQ+V
Sbjct  181   NAGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNS+FW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFEPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLR+TRHVLSEYGNMSSACVLFILDEMRK+S+KEG+N+
Sbjct  301   IAHPGGPAILDQVEEKLALKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSAKEGMNS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|AEO96985.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/389 (90%), Positives = 372/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP  ++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPLSEIEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS+SA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSISA  389



>ref|XP_009619773.1| PREDICTED: chalcone synthase 1B [Nicotiana tomentosiformis]
 gb|ACS12836.1| chalcone synthase [Nicotiana tomentosiformis]
Length=389

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/388 (91%), Positives = 372/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE R+AQ A+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILK+NPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKDNPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIGSDP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATR VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|KDP20327.1| hypothetical protein JCGZ_06413 [Jatropha curcas]
 gb|AIC83903.1| chalcone synthase [Jatropha curcas]
Length=389

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/388 (91%), Positives = 373/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRAQGPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAQGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTE+ILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEDILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P+LE+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPVPELEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL +TRH+LSEYGNMSSACVLFILDE+RK S+KEGL T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLASTRHILSEYGNMSSACVLFILDEVRKKSAKEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AFC37242.1| chalcone synthase 1 [Camellia chekiangoleosa]
Length=389

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/388 (90%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S+ +GL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS+S
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLS  388



>ref|XP_002264019.1| PREDICTED: chalcone synthase 2 [Vitis vinifera]
 dbj|BAB84111.1| chalcone synthase [Vitis vinifera]
 emb|CAN75038.1| hypothetical protein VITISV_030544 [Vitis vinifera]
Length=389

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/388 (90%), Positives = 372/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV EVR AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVNEVRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+C YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P +E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPGVEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAFQPLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGIKDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLR+TRHVLSEYGNMSSACVLFILDEMR+ S++EGL T
Sbjct  301   IAHPGGPAILDQVEEKLALKPEKLRSTRHVLSEYGNMSSACVLFILDEMRRKSAEEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVS  388



>dbj|BAI66465.1| chalcone synthase [Camellia japonica]
 gb|ADZ28512.1| chalcone synthase [Camellia nitidissima]
Length=389

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/388 (90%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S+ +GL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS+S
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLS  388



>gb|AIB06736.1| chalcone synthases-1 [Mangifera indica]
Length=390

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/389 (90%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRA+GPATIMAIGT+ P NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVDEVRKAQRAEGPATIMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENP IC YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPAICEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAALI+GSDP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEVEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  301   IAHPGGPAILDQVEVKLGLKEEKLRATRHVLSEYGNMSSACVLFILDDMRKKSKENGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGL+VETVVLHSV++
Sbjct  361   TGEGLEWGVLFGFGPGLSVETVVLHSVAS  389



>sp|P48386.1|CHS1_CAMSI RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Camellia sinensis]
 dbj|BAA05640.1| chalcone synthase [Camellia sinensis]
 gb|AGI02992.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE++R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S+ +GL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS+S
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLS  388



>gb|AEO96989.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/389 (90%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPN+CAYM PSLDARQD+VVVEVPKLGKEAA +AIKEWGQP
Sbjct  61    EKSMIKKRYMFLTEEILKENPNVCAYMEPSLDARQDMVVVEVPKLGKEAAARAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NEGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPIPEIEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMR  S ++G+ T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRNKSREDGVQT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS+ A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSIPA  389



>ref|XP_009774927.1| PREDICTED: chalcone synthase 2 [Nicotiana sylvestris]
Length=389

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/388 (90%), Positives = 374/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFR+TNSEH++ELKEKFKRMC
Sbjct  1     MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMIELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD H+DS+VGQALFGDGAAA+IIGSD  P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHVDSMVGQALFGDGAAAIIIGSDLVPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S+AQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLG+ DWNS+FW
Sbjct  241   SSAQTLLPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLSDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATR VLS+YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>gb|AGI02994.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE++R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S+ +GL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKESAADGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS+S
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLS  388



>gb|AHK22740.1| chalcone synthase [Nicotiana tabacum]
Length=389

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/388 (90%), Positives = 373/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFR+TNSEH+ ELKEKFKRMC
Sbjct  1     MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD H+DS+VGQALFGDGAAA+IIGSD  P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHVDSMVGQALFGDGAAAIIIGSDLVPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S+AQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLG+ DWNS+FW
Sbjct  241   SSAQTLLPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLSDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATR VLS+YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>ref|XP_010023738.1| PREDICTED: chalcone synthase 1 [Eucalyptus grandis]
 gb|KCW60095.1| hypothetical protein EUGRSUZ_H02828 [Eucalyptus grandis]
Length=391

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/389 (89%), Positives = 374/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRRAQRAEGPATIMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTE+ILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEDILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSK+THL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKVTHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DP P +E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   STAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL+LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL T
Sbjct  301   IAHPGGPAILDQVEEKLKLKAEKLRATRHVLSEYGNMSSACVLFILDEMRKKSTEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS++A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLAA  389



>ref|XP_011020681.1| PREDICTED: chalcone synthase 1 [Populus euphratica]
Length=391

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/388 (91%), Positives = 372/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+E+RK+QRA+GPATIMAIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVDEIRKSQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAALIIGSDP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVVGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL +
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AFE56210.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/388 (90%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+++R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVQDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S+ +GL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKRSAADGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS+S
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLS  388



>sp|Q9ZRS4.1|CHSY_CATRO RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Catharanthus roseus]
 emb|CAA10511.1| chalcone synthase [Catharanthus roseus]
Length=389

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/388 (90%), Positives = 375/388 (97%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV VEE+R AQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVNVEEIRNAQRAQGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEIL+ENPNICAYMAPSLDARQ+IVVVEVPKLGKEAAQKAIKEWGQ 
Sbjct  61    EKSMIKKRYMHLTEEILQENPNICAYMAPSLDARQNIVVVEVPKLGKEAAQKAIKEWGQS  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPIPEIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+I K+L+EAFQPLGI DWNS+FW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIGKALDEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRKAS+++GL+T
Sbjct  301   IAHPGGPAILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASARDGLST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVN  388



>emb|CAA64452.1| naringenin-chalcone synthase [Juglans nigra x Juglans regia]
Length=389

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/389 (91%), Positives = 372/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDVRRAQRAEGPATVMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPN+CAYMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPNVCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAALI+G+DP P +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGADPVPGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++ L T
Sbjct  301   IAHPGGPAILDQVESKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDRLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>dbj|BAE45039.1| chalcone synthase [Gentiana triflora]
Length=389

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/388 (88%), Positives = 372/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+RKAQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRIT+SEH  ELKEKFKRMC
Sbjct  1     MVTVEEIRKAQRAEGPATVLAIGTATPVNCVDQSTYPDYYFRITDSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI+KRYM+LTE+ILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIRKRYMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQ+TKLLGL+ SVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQITKLLGLRSSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP PDLERPLFQ+V
Sbjct  181   NRGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPIPDLERPLFQIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISKHIEKSL EAF P+GI DWNS+FW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLKEAFDPIGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEE L L+ +KLRATRHVL+EYGNMSSACVLFILDEMRK S+K+G  T
Sbjct  301   IAHPGGPAILDQVEETLGLEAQKLRATRHVLAEYGNMSSACVLFILDEMRKTSAKDGATT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEG +WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGQDWGVLFGFGPGLTVETVVLHSVS  388



>gb|ABI79305.1| chalcone synthase [Pyrus communis]
Length=389

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/389 (89%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHRVELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGTDPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKSIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKP+KL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPQKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>dbj|BAM17286.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/388 (90%), Positives = 371/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGA A+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL+ATR+VLS+YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AGH13332.1| chalcone synthase [Rhus chinensis]
Length=390

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/388 (89%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+V+EVRKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVSVDEVRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPAVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPGVEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   STAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S++ GL T
Sbjct  301   IAHPGGPAILDQVEIKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSTENGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS++
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSIA  388



>ref|XP_011020677.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
 ref|XP_011020678.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
 ref|XP_011020679.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
Length=391

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/388 (91%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV EVRK QRA+GPATIMAIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVNEVRKGQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTE+ILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ 
Sbjct  61    EKSMIKKRYMYLTEDILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQS  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKD AEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDHAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAALIIGSDP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVVGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL +
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>sp|Q43163.1|CHSB_SOLTU RecName: Full=Chalcone synthase 1B; AltName: Full=Naringenin-chalcone 
synthase 1B [Solanum tuberosum]
 gb|AAB67735.1| chalcone synthase 1b [Solanum tuberosum]
Length=389

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/388 (90%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQL KLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP   +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT++PDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATR VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AEK80412.1| type III polyketide synthase [Acer maximowiczianum]
Length=390

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/389 (90%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRAQGPATI+AIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAQGPATILAIGTATPPNCVDQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAY APSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNVCAYEAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP P +E+P+++LV
Sbjct  181   NIGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPLPGIEKPMYELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+RATRHVLSE+GNMSSACVLFILDEMRK S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKMRATRHVLSEFGNMSSACVLFILDEMRKKSAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>emb|CAC88858.1| chalcone synthase [Rhododendron simsii]
Length=389

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/387 (89%), Positives = 372/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQSTYPD+YFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEDVRRAQRAEGPATVMAIGTATPSNCVDQSTYPDFYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKALTEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMR+ S++EGL T
Sbjct  301   IAHPGGPAILDQVELKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSAEEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>gb|ABP57071.1| chalcone synthase [Solenostemon scutellarioides]
 gb|ABP57072.1| chalcone synthase [Solenostemon scutellarioides]
Length=390

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/387 (90%), Positives = 370/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE++R+AQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1     MVTVEDIRRAQRAEGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI+KRYM+LTEE LKENPN+ AYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD+HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQLV
Sbjct  181   NAGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF PLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGITDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL L PEKLR+TRHVLSEYGNMSSACVLFILDEMRK S+KEGLN+
Sbjct  301   IAHPGGPAILDQVEAKLRLTPEKLRSTRHVLSEYGNMSSACVLFILDEMRKTSAKEGLNS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|ABM63466.1| aromatic polyketide synthase [Hypericum hookerianum]
Length=390

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/388 (89%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGT+ P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IKKRYMYL EE+LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMR+ S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKQDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEG+EWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGIEWGVLFGFGPGLTVETVVLHSVA  388



>gb|ADD74168.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/389 (89%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE++ KAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDILKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSE+TAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P +E+PLF+LV
Sbjct  181   NRGARVLVVCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTILPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLRATRH+LSEYGNMSSACVLFILDEMRK S ++GL T
Sbjct  301   IAHPGGPAILDQVEEKLALKPEKLRATRHILSEYGNMSSACVLFILDEMRKKSIEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS++A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSIAA  389



>ref|XP_002303821.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE78800.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 371/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+E+RK+QRA+GPATIMAIGTSTP NCVDQSTYP+YYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVDEIRKSQRAEGPATIMAIGTSTPPNCVDQSTYPEYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAAL+IGSDP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALVIGSDPVIGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL +
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|ACN60400.1| chalcone synthase, partial [Capsicum annuum]
Length=386

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/386 (90%), Positives = 369/386 (96%), Gaps = 0/386 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+ QRA+GPATIMAIGT+TP NCVDQ+TYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1     MVTVEEVRREQRAKGPATIMAIGTATPSNCVDQATYPDYYFRITNSEHMTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAA+KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAKKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTVIRLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDS+VGQALFGDGAAALI+GSDP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAALIVGSDPLPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLG  DWNS+FW
Sbjct  241   SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGNSDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGP ILDQVE KL LK EKLRATR VLS+YGNMS ACVLFILDEMRKAS+KEGLNT
Sbjct  301   IAHPGGPTILDQVELKLGLKLEKLRATRQVLSDYGNMSRACVLFILDEMRKASAKEGLNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHS  1220
             TGEGL+WGVLFGFGPGLTVETVVLHS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHS  386



>ref|XP_010099135.1| Chalcone synthase [Morus notabilis]
 gb|EXB76929.1| Chalcone synthase [Morus notabilis]
Length=389

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/388 (89%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATIMAIGT+TP NC+DQS+YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATIMAIGTATPPNCIDQSSYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKS IKKRYMYL EEILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSQIKKRYMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+FQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPIPEVEKPIFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+I+KSL EAF+PLGI DWNS+FW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLTEAFKPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE K  LKPEKLRATRHVLSEYGNMSSACV+FILDEMR+  +++GL T
Sbjct  301   IAHPGGPAILDQVEAKCGLKPEKLRATRHVLSEYGNMSSACVVFILDEMRRKGAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AFH68066.1| chalcone synthase [Pyrus pyrifolia]
Length=389

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/389 (89%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVV+VPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVKVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVGA  389



>sp|Q9FUB7.1|CHSY_HYPAN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Hypericum androsaemum]
 gb|AAG30295.1|AF315345_1 chalcone synthase [Hypericum androsaemum]
Length=390

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/388 (89%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGT+ P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IKKRYMYL EE+LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMR+ S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEG+EWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGIEWGVLFGFGPGLTVETVVLHSVA  388



>sp|P08894.1|CHSA_PETHY RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A [Petunia x hybrida]
 emb|CAA27718.1| unnamed protein product [Petunia x hybrida]
Length=389

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/388 (90%), Positives = 371/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1     MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGA A+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL+ATR+VLS+YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AAO13091.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/387 (90%), Positives = 367/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE++R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPQVCGYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCS ITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E PLF+LV
Sbjct  181   NKGARVLVVCSGITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVENPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S+ +GL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>ref|XP_002303820.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE78799.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+E+RK QRA+GPATIMAIGTSTP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVDEIRKTQRAEGPATIMAIGTSTPPNCVDQSAYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAALIIGSDP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVIGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL +
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AFQ92052.1| chalcone synthase [Pyrus pyrifolia]
 gb|AGL81345.1| chalcone synthase [Pyrus communis]
Length=391

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/387 (89%), Positives = 372/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>dbj|BAM17287.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/388 (90%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1     MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGA A+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL+ATR+VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVEIKLGLKPEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_009376347.1| PREDICTED: polyketide synthase 5 [Pyrus x bretschneideri]
Length=391

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/387 (89%), Positives = 372/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRRVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>ref|XP_006420608.1| hypothetical protein CICLE_v10005133mg [Citrus clementina]
 gb|ESR33848.1| hypothetical protein CICLE_v10005133mg [Citrus clementina]
Length=390

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/389 (89%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRAQGPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1     MVTVDEVRKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLD RQD+VVVEVP+LGKEAA +AIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGKEAATEAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADY+LTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQTILPDS G+IDGHLRE GLTFHLLKDVPGLISK+I+KSL EAF+PLGI DWNS+FW
Sbjct  241   STAQTILPDSDGSIDGHLREAGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL T
Sbjct  301   IAHPGGPAILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLET  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
              GEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   AGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|AGV53049.1| chalcone synthase [Actinidia chinensis]
Length=389

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/387 (90%), Positives = 371/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+G ATIMAIGTSTP NCVDQS YPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRRAQRAEGLATIMAIGTSTPPNCVDQSEYPDYYFRITNSEHKTELKEKFRRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIK RYMYLTEEILKENPN+CAYMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKMRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPIPEVEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE+KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL T
Sbjct  301   IAHPGGPAILDQVEQKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>gb|AFM74036.1| chalcone synthase [Acer palmatum]
Length=390

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/389 (89%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRAQGPATI+AIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVDEVRKAQRAQGPATILAIGTATPPNCVDQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPN+CAY APSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNVCAYEAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFC+TSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCSTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP P +E+P+++LV
Sbjct  181   NTGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPQPGIEKPMYELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IA+PGGPAILDQVE KL LKPEK+RATRHVLSE+GNMSSACVLFILDEMRK S+++GL T
Sbjct  301   IAYPGGPAILDQVEAKLGLKPEKMRATRHVLSEFGNMSSACVLFILDEMRKKSAEDGLRT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETV+LHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVILHSVSA  389



>dbj|BAC87863.1| chalcone synthase [Torenia hybrid cultivar]
Length=391

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/387 (90%), Positives = 370/387 (96%), Gaps = 1/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV VE +R+AQRA+G ATI+AIGTSTPQNCVDQSTYPDYYFRITNSEH+ ELK+KF RMC
Sbjct  1     MVIVEAIRRAQRAEGAATILAIGTSTPQNCVDQSTYPDYYFRITNSEHMTELKDKFTRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTE+ LK+NPNICAYM PSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEDYLKQNPNICAYMEPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAA+I+GSDP  D+ERPLFQLV
Sbjct  181   NAGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAVIVGSDPT-DVERPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF PLGI DWNS+FW
Sbjct  240   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGIDDWNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKP+KLRATRHVLSEYGNMSSACVLFILDEMRKAS+KEG +T
Sbjct  300   IAHPGGPAILDQVEAKLALKPDKLRATRHVLSEYGNMSSACVLFILDEMRKASAKEGTST  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLHSV  386



>dbj|BAM17288.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPD+YFRITNSEH  +LKEKFKRMC
Sbjct  1     MVTVEEYRKAQRAEGPATVMAIGTATPSNCVDQSTYPDFYFRITNSEHKTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGA A+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL+ATR+VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVEIKLGLKPEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLET  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>emb|CAJ44127.1| chalcone synthase [Misopates orontium]
Length=390

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/387 (89%), Positives = 372/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1     MVTVEEVRRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP +C YMAPSLDARQDIVVVEVP+LGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQLV
Sbjct  181   NAGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             +AAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISKHIEKSL EAF PLGI DWNS+FW
Sbjct  241   TAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLKEAFDPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLR+TRHVLSEYGNMSSACVLFILDEMRK+S+KEG++T
Sbjct  301   IAHPGGPAILDQVEEKLGLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSTKEGMST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEG +WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGFDWGVLFGFGPGLTVETVVLHSV  387



>gb|ACN30003.1| chalcone synthase [Vitis rotundifolia]
Length=393

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/388 (90%), Positives = 366/388 (94%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV EVR AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVNEVRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +ERPLF+LV
Sbjct  181   NAGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPDTKIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFNPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S +EG  T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS++
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLA  388



>dbj|BAC10998.1| chalcone synthase [Nierembergia sp. NB17]
Length=389

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/388 (90%), Positives = 371/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR++QRA GPATIMAIGT+TP NCVDQ+TYPD+YFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRRSQRAIGPATIMAIGTATPSNCVDQTTYPDFYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLKSSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAA+IIGSDP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIIGSDPLPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA+QT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SASQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATR VLSEYGNMSSACVLFILDEMRK SSK GL +
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLRATRQVLSEYGNMSSACVLFILDEMRKTSSKMGLGS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVS  388



>dbj|BAO58433.1| chalcone synthase [Vaccinium ashei]
Length=389

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/387 (89%), Positives = 368/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA GPAT+MAIGT+TP NCVDQSTYPD+YFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAAGPATVMAIGTATPPNCVDQSTYPDFYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPGVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI DWNS+FW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALTEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE K  LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S++EGL T
Sbjct  301   IAHPGGPAILDQVELKCNLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>ref|XP_008380609.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAX16492.1| chalcone synthase [Malus domestica]
 gb|ACJ54530.1| chalcone synthase [Malus domestica]
Length=391

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/387 (89%), Positives = 372/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGT+TP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|AEP17003.1| chalcone synthase [Vitis vinifera]
Length=389

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV EVR AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVNEVRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+C YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P +E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPGVEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAFQPLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGIKDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLR+TRHVLSE GNMSSACVLFILDEMR+ S++EGL T
Sbjct  301   IAHPGGPAILDQVEEKLALKPEKLRSTRHVLSECGNMSSACVLFILDEMRRKSAEEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEG EWGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGPEWGVLFGFGPGLTVETVVLHSVS  388



>ref|XP_011020680.1| PREDICTED: chalcone synthase 1-like isoform X2 [Populus euphratica]
Length=391

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/388 (90%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV EVRK QRA+GPATIMAIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVNEVRKGQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTE+ILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ 
Sbjct  61    EKSMIKKRYMYLTEDILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQS  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKD AEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDHAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAALIIGSDP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVVGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL +
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGL+VETVV+HSV+
Sbjct  361   TGEGLEWGVLFGFGPGLSVETVVVHSVA  388



>gb|AFU52909.1| chalcone synthase [Hypericum sampsonii]
Length=390

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/388 (89%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGT+ P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IKKRYMYL EE+LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMR+ S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEG+EWGVLFGFGPGLTVETVVLHS++
Sbjct  361   TGEGIEWGVLFGFGPGLTVETVVLHSLA  388



>ref|XP_011034455.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=391

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/389 (89%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+E+RKAQRA+GPATI+AIGTSTP NCVDQ TYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVDEIRKAQRAEGPATILAIGTSTPPNCVDQCTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPVPAIEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KLELKPEKLRATR VL++YGNMSSACVLFILDEMRK S+++GL +
Sbjct  301   IAHPGGPAILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAEDGLKS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS+ A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLPA  389



>gb|AAX16494.1| chalcone synthase [Pyrus communis]
Length=391

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/387 (89%), Positives = 371/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   STAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>ref|XP_006489796.1| PREDICTED: chalcone synthase 1-like [Citrus sinensis]
Length=390

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 373/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M+TV+EVRKAQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1     MLTVDEVRKAQRAEGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLD RQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADY+LTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQTILPDS G+IDGHLREVGLTFHLLKDVPGLISK+I+KSL EAF+PLGI DWNS+FW
Sbjct  241   STAQTILPDSDGSIDGHLREVGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGP ILDQVEEKL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL T
Sbjct  301   IAHPGGPTILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLET  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
              GEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   AGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>emb|CAA32731.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1     MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL FCTTSGVDMPG DYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLFFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGA A+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL+ATR+VLS+YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>sp|Q8RVK9.1|CHS_CANSA RecName: Full=Naringenin-chalcone synthase [Cannabis sativa]
 gb|AAL92879.1| chalcone synthase [Cannabis sativa]
Length=389

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/388 (89%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPATIMAIGT+TP NCV QS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEFRKAQRAEGPATIMAIGTATPANCVLQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI+KRYM+LTEEILKENPN+CAY APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIRKRYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDG+AALI+GSDP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIVGSDPIPEVEKPIFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMR+   ++GLNT
Sbjct  301   IAHPGGPAILDQVESKLALKTEKLRATRHVLSEYGNMSSACVLFILDEMRRKCVEDGLNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>dbj|BAB92996.1| chalcone synthase [Malus domestica]
 gb|ACJ54532.1| chalcone synthase [Malus domestica]
Length=391

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/387 (89%), Positives = 372/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGT+TP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAAIKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|AAN05791.1| chalcone synthase [Mazus pumilus]
Length=392

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/385 (89%), Positives = 369/385 (96%), Gaps = 0/385 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             TVEE+R+AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMCEK
Sbjct  4     TVEEIRRAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCEK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             S IKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQPKS
Sbjct  64    SYIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAENN 
Sbjct  124   KITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNA  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             GARVLVVCSEITAVTFRGPSD+HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQ+VSA
Sbjct  184   GARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPIVGVERPLFQIVSA  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISKHIEKSL EAF PLGI DWNS+FWIA
Sbjct  244   AQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLKEAFDPLGISDWNSIFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE  L LKPEK+RATR VLS+YGNMSSACVLFILDEMRKAS+KEG+ +TG
Sbjct  304   HPGGPAILDQVESVLALKPEKMRATRQVLSDYGNMSSACVLFILDEMRKASAKEGMGSTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSV  1223
             EGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  364   EGLDWGVLFGFGPGLTVETVVLHSV  388



>ref|XP_011034457.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=390

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 372/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRA+GPA I+AIGTSTP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVDEVRKAQRAEGPAAILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP+IC Y APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSICEYRAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPVPAIEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KLELKPEKLRATR VL++YGNMSSACVLFILDEMRK S+++GL +
Sbjct  301   IAHPGGPAILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAEDGLKS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>emb|CAA64366.1| naringenin-chalcone synthase [Juglans nigra x Juglans regia]
Length=389

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/389 (90%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDVRRAQRAEGPATVMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
              KSMIKKRYM+LTEEILKENPN+CAYMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    GKSMIKKRYMHLTEEILKENPNVCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAALI+G+DP P +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGADPVPGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++ L T
Sbjct  301   IAHPGGPAILDQVESKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDRLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFG GLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGSGLTVETVVLHSVSA  389



>gb|AGZ15299.1| chalcone synthase [Pyrus x bretschneideri]
 gb|AGZ15300.1| chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/389 (89%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIK RYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKTRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|AAF60297.1|AF233638_1 chalcone synthase [Petunia x hybrida]
 gb|AGZ04577.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1     MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGA A+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PL I DWNSLFW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFRPLSISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL+ATR+VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVEIKLGLKPEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|NP_001275352.1| chalcone synthase 1A [Solanum tuberosum]
 sp|Q41436.1|CHSA_SOLTU RecName: Full=Chalcone synthase 1A; AltName: Full=Naringenin-chalcone 
synthase 1A [Solanum tuberosum]
 gb|AAB67734.1| chalcone synthase 1a [Solanum tuberosum]
Length=389

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/388 (90%), Positives = 367/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQL KLLGL+PSVKR MMYQQGCF GGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFVGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP   +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT++PDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATR VLS YGNMSSACVLFILDEMRKAS+ EGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTNEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_002299282.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|ABK95125.1| unknown [Populus trichocarpa]
 gb|EEE84087.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=390

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/389 (90%), Positives = 372/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRA+GPA I+AIGTSTP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVDEVRKAQRAEGPAVILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPVLGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KLELKPEKLRATR VL++YGNMSSACVLFILDEMRK S+K+GL +
Sbjct  301   IAHPGGPAILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAKDGLKS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV++
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAS  389



>gb|AGU70032.1| chalcone synthase [Solanum tuberosum]
Length=389

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/388 (90%), Positives = 368/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+ RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEQYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQL KLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP   +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT++PDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLQEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATR VLS YGNMSSACVLFILDE+RKAS+ EGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEVRKASTNEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AGE84303.1| chalcone synthase [Malus domestica]
Length=389

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRQVLSNYGNMSSACVLFILDEVRRKSTEKGLRT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>ref|XP_008380608.1| PREDICTED: polyketide synthase 5-like [Malus domestica]
Length=389

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRQVLSNYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>dbj|BAE17124.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/389 (89%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++ERPLF+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  G  T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>gb|AAX63402.1| chalcone synthase [Solanum pinnatisectum]
Length=389

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/389 (90%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRM 
Sbjct  1     MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMS  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGAAA+IIGSDP   +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNESHLDSLVGQALFGDGAAAIIIGSDPIISVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQ ++PDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQP+GI DWNSLFW
Sbjct  241   SAAQALVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATR VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV++
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAS  389



>ref|XP_002299281.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE84086.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/389 (90%), Positives = 372/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+E+RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVDEIRKAQRAEGPATILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPVLGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KLELKPEKLRATR VL++YGNMSSACVLFILDEMRK S+K+GL +
Sbjct  301   IAHPGGPAILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAKDGLKS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS+ A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLPA  389



>gb|AAL67805.1|AF461105_1 chalcone synthase [Hypericum perforatum]
Length=389

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/388 (89%), Positives = 371/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGT+ P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IKKRYMYL EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSQIKKRYMYLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAA++IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAASIIIGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA+QTILPDS GAIDGH+REVGLTFHLLKDVPGLISK++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SASQTILPDSEGAIDGHIREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLRATRHVLSEYGNMSSACVLFILDEMR+ S ++GL T
Sbjct  301   IAHPGGPAILDQVEEKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEG+EWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGIEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_009376346.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
 gb|ADP09376.1| chalcone synthase [Pyrus pyrifolia]
 gb|AGV40323.1| chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/389 (89%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIK RYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKTRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVGA  389



>gb|ADV29810.1| chalcone synthase [Malus toringoides]
Length=389

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 372/389 (96%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLET  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|AEN83501.1| chalcone synthase [Solanum tuberosum]
Length=389

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/388 (90%), Positives = 368/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+ RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEQYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQL KLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP   +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT++PDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATR VLS YGNMSSACVLFILDE+RKAS+ EGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEVRKASTNEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_009353801.1| PREDICTED: chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKSIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|ABB89213.1| chalcone synthase [Sorbus aucuparia]
Length=391

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/387 (89%), Positives = 371/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGT+TP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP  ++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVTEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPVGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>sp|O04111.1|CHSY_PERFR RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Perilla frutescens]
 dbj|BAA19656.1| chalcone synthase [Perilla frutescens]
Length=391

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/387 (89%), Positives = 372/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE++R+AQRA+GPAT+MAIGT+TP+NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1     MVTVEDIRRAQRAEGPATVMAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI+KRYM+LTEE LKENPN+ AYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQLV
Sbjct  181   NAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF PLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLR+TRHVL EYGNMSSACVLFILDEMRK+S+KEG+++
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLRSTRHVLGEYGNMSSACVLFILDEMRKSSAKEGMSS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|AAB36038.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/388 (90%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQR +GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1     MVTVEEYRKAQRCEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RL KDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLRKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGA A+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL+ATR+VLS+YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_008358057.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAY45748.1| chalcone synthase [Malus domestica]
 gb|ACJ54533.1| chalcone synthase [Malus domestica]
 gb|ACN25139.1| chalcone sythase [Malus hybrid cultivar]
Length=389

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIK RYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKTRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVGA  389



>ref|XP_010264056.1| PREDICTED: chalcone synthase 1 [Nelumbo nucifera]
 gb|ADD74169.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74170.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74171.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74172.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/389 (89%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE++RKAQRA+GPAT+MAIGT+ P NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDIRKAQRAEGPATVMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPNIC YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPNICEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSE+TAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P +E+PLF+LV
Sbjct  181   NRGARVLVVCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTILPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKL ATRH+LSEYGNMSSACVLFILDEMRK S ++GL T
Sbjct  301   IAHPGGPAILDQVEEKLALKPEKLSATRHILSEYGNMSSACVLFILDEMRKKSIEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS++A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSIAA  389



>gb|AHY35308.1| chalcone synthase 1 [Morus notabilis]
Length=389

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/388 (89%), Positives = 367/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GP TIMAIGT+TP NC+DQS+YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPVTIMAIGTATPPNCIDQSSYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKS IKKRYMYL EEILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSQIKKRYMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+ QLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPIPEVEKPILQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+I+KSL EAF+P GI DWNS+FW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLTEAFKPFGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE K  LKPEKLRATRHVLSEYGNMSSACV+FILDEMR+  +++GL T
Sbjct  301   IAHPGGPAILDQVEAKCGLKPEKLRATRHVLSEYGNMSSACVVFILDEMRRKGAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_004306542.1| PREDICTED: chalcone synthase 2-like [Fragaria vesca subsp. vesca]
Length=389

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/389 (88%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGK+AA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKDAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KS+ITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSRITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++ERPLF+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  G  T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>ref|XP_007223025.1| hypothetical protein PRUPE_ppa006888mg [Prunus persica]
 gb|EMJ24224.1| hypothetical protein PRUPE_ppa006888mg [Prunus persica]
 gb|AJA79072.1| chalcone synthase [Prunus persica]
 gb|AJA79077.1| chalcone synthase [Prunus persica]
Length=391

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/387 (88%), Positives = 371/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P++E+PLF++V
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPIPEIEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+RK ++++GL T
Sbjct  301   IAHPGGPAILDQVESKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRKRAAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TG+GL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGDGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|AEJ88217.1| chalcone synthase [Prunus persica]
Length=391

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/387 (88%), Positives = 371/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF++V
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+RK ++K+GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TG+GL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGDGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|AFJ44312.1| chalcone synthase [Lonicera japonica]
Length=389

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/388 (89%), Positives = 367/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGTSTP NCV QS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTSTPPNCVYQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI+KRYMYLTEE LKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    EKSMIRKRYMYLTEEFLKENPSMCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP P +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGSDPVPKVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA+QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNS+FW
Sbjct  241   SASQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE+KL LKPEK+ ATRHVLSEYGNMSSACVLFI+DEMRK S+ EGL T
Sbjct  301   IAHPGGPAILDQVEKKLALKPEKMGATRHVLSEYGNMSSACVLFIMDEMRKKSANEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVS  388



>ref|XP_009370115.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
Length=390

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/389 (88%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             +GEGLEWGVLFGFGPGLTVETVVLHSV A
Sbjct  361   SGEGLEWGVLFGFGPGLTVETVVLHSVVA  389



>gb|AFX71920.1| CHS2 chalcone synthase [Malus domestica]
Length=389

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/389 (88%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+P VKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPYVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRQVLSNYGNMSSACVLFILDEVRRKSTEKGLRT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|AGL50915.1| chalcone synthase [Pyrus communis]
Length=389

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 370/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKTRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVGA  389



>ref|XP_010249317.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
Length=393

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/389 (89%), Positives = 367/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+R AQRAQGPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVSVEEIRNAQRAQGPATVLAIGTATPANCVYQADYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAASKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DPD  +ERPLFQLV
Sbjct  181   NAGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPDTSIERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+G+ DWNSLFW
Sbjct  241   SAAQTILPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGVSDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LK EKLRATR+VLSEYGNMSSACVLFILDEMRK S +EG  T
Sbjct  301   IAHPGGPAILDQVEEKLGLKEEKLRATRNVLSEYGNMSSACVLFILDEMRKKSVEEGRAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS+ A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLPA  389



>dbj|BAB20074.1| chalcone synthase [Torenia hybrid cultivar]
Length=388

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/386 (90%), Positives = 371/386 (96%), Gaps = 1/386 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+R+AQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVTVEEIRRAQRAEGPATILAIGTSTPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTE+ LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEDYLKENPNVCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQ+V
Sbjct  181   NAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDP-MSVERPLFQMV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPG+ISK+IEKSL EAF PLGI DWNS+FW
Sbjct  240   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLKEAFDPLGISDWNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
              AHPGGPAILDQVEEKL LKP+KLRATR VLSEYGNMSSACVLFILDEMRKAS+KEGL +
Sbjct  300   NAHPGGPAILDQVEEKLGLKPDKLRATRTVLSEYGNMSSACVLFILDEMRKASAKEGLGS  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHS  1220
             TGEGL+WGVLFGFGPGLTVETVVLHS
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLHS  385



>gb|AFC37244.1| chalcone synthase 3 [Camellia chekiangoleosa]
Length=389

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/387 (89%), Positives = 367/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+VR+AQRAQGPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVEDVRRAQRAQGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDL EN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLVEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQ+LFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILP S GAIDGHLREVGLTFHLL+DVP LIS ++EKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPGSDGAIDGHLREVGLTFHLLRDVPRLISMNVEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S++EGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>gb|AIC75908.1| chalcone synthase [Hibiscus cannabinus]
Length=389

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 367/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M T+EE+RKAQRA+GPAT++AIGTSTP NCVDQSTYPD+YFR+T SEH  ELKEKFKRMC
Sbjct  1     MSTIEEIRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDFYFRVTKSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTE+ILKENPN+C YMAPSLDARQD+VVVEVPK GKEAA +AIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEDILKENPNVCEYMAPSLDARQDMVVVEVPKFGKEAATRAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVDGIEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S ++G+ T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGVQT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS+ A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSIPA  389



>gb|AEW12813.1| chalcone synthase [Brunfelsia brasiliensis subsp. macrocalyx]
Length=389

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/388 (89%), Positives = 367/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEYRKAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFRRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENP IC YMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPKICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQ GCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQHGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGA A+IIGSDP P +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNESHLDSLVGQALFGDGATAIIIGSDPIPGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL +AF PLGI DWNSLFW
Sbjct  241   SAAQTLLPDSQGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEDAFSPLGITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATR+VL +YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKQEKLRATRNVLRDYGNMSSACVLFILDEMRKASAKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEG EWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGHEWGVLFGFGPGLTVETVVLHSVA  388



>dbj|BAE17123.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/389 (88%), Positives = 368/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSE TAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++++PLF+LV
Sbjct  181   NRGARVLVVCSETTAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVDKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  G  T
Sbjct  301   IAHPGGPAILDQVEAKLALKSEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>ref|XP_004306543.1| PREDICTED: chalcone synthase 2-like [Fragaria vesca subsp. vesca]
Length=389

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/389 (88%), Positives = 369/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++ERPLF+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  G  T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRRSAANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEG EWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGKEWGVLFGFGPGLTVETVVLHSVAA  389



>sp|Q9XJ58.1|CHS1_CITSI RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Citrus sinensis]
 dbj|BAA81663.1| chalcone synthase [Citrus sinensis]
Length=389

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 372/389 (96%), Gaps = 1/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRAQGPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1     MVTVDEVRKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLD RQD+VVVEVP+LGK AA +AIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGK-AATEAIKEWGQP  119

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADY+LTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  120   KSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  179

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+F+LV
Sbjct  180   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQTILPDS G+IDGHLRE GLTFHLLKDVPGLISK+I+KSL EAF+PLGI DWNS+FW
Sbjct  240   STAQTILPDSDGSIDGHLREAGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL T
Sbjct  300   IAHPGGPAILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLET  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
              GEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  360   AGEGLEWGVLFGFGPGLTVETVVLHSVAA  388



>ref|NP_001267879.1| chalcone synthase [Vitis vinifera]
 gb|ABM67586.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 366/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+V E+RKAQRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N G+RVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +ERPLF+LV
Sbjct  181   NAGSRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S +EG  +
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>gb|ACJ54531.1| chalcone synthase [Malus domestica]
Length=389

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/389 (88%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTIL DS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILADSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLET  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|AEC13058.1| chalcone synthase protein [Rosa chinensis]
Length=389

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/389 (88%), Positives = 369/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITKSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  G  T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|AAM90652.1|AF400567_1 chalcone synthase 6 [Rubus idaeus]
Length=391

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 369/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1     MVTVDEVRKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P++ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  G  T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>ref|XP_007223028.1| hypothetical protein PRUPE_ppa006899mg [Prunus persica]
 gb|EMJ24227.1| hypothetical protein PRUPE_ppa006899mg [Prunus persica]
Length=391

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/387 (88%), Positives = 371/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF++V
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+RK ++++GL T
Sbjct  301   IAHPGGPAILDQVESKLSLKPEKLEATRHILSEYGNMSSACVLFILDEVRKRAAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TG+GL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGDGLDWGVLFGFGPGLTVETVVLHSV  387



>ref|XP_008224579.1| PREDICTED: polyketide synthase 5-like [Prunus mume]
Length=391

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/387 (88%), Positives = 373/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC++Q+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIEQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTE+ILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DP P++E+PLF++V
Sbjct  181   NRGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+RK ++K+GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TG+GL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGDGLDWGVLFGFGPGLTVETVVLHSV  387



>sp|Q9AU11.1|PKS1_RUBID RecName: Full=Polyketide synthase 1; Short=RiPKS1; AltName: Full=Naringenin-chalcone 
synthase PKS1 [Rubus idaeus]
 gb|AAK15174.1|AF292367_1 aromatic polyketide synthase [Rubus idaeus]
 gb|ACF72868.1| aromatic polyketide synthase [Rubus idaeus]
Length=391

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/389 (89%), Positives = 368/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1     MVTVDEVRKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP PD+ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPDIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR++LSEYGNMSSACVLFILDE+R+ S   G  T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLFILDEVRRKSVANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|ADD74167.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/389 (89%), Positives = 369/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE++RKAQRA+GPAT+MAIGT+ P NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEDIRKAQRAEGPATVMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENPNIC YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEILKENPNICEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSE+TAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P +E+PLF+LV
Sbjct  181   NRGARVLVVCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTILPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKL  TRH+LSEYGNMSSACVLFILDEMRK S ++GL T
Sbjct  301   IAHPGGPAILDQVEEKLALKPEKLSPTRHILSEYGNMSSACVLFILDEMRKKSIEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS++A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSIAA  389



>gb|ADZ54780.1| naringenin-chalcone synthase [Prunus avium]
Length=391

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/387 (88%), Positives = 369/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGTS P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTSNPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P++E+PLF++V
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+I+KSLNEAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIZKSLNEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+RK ++K+GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TG+GL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGDGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|AAX99413.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/389 (88%), Positives = 368/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLV CTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVSCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++ERPLF+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   STAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  G  T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>ref|XP_008224578.1| PREDICTED: polyketide synthase 5 [Prunus mume]
Length=391

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/387 (88%), Positives = 372/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTE+ILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P++E+PLF++V
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSE+GNMSSACVLFILDE+RK ++++GL T
Sbjct  301   IAHPGGPAILDQVESKLGLKPEKLEATRHILSEFGNMSSACVLFILDEVRKRAAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TG+GL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGDGLDWGVLFGFGPGLTVETVVLHSV  387



>ref|XP_009353802.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
Length=390

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/389 (88%), Positives = 371/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C Y+APSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYVAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             +GEGLEWGVLFGFGPGLTVETVVLHSV A
Sbjct  361   SGEGLEWGVLFGFGPGLTVETVVLHSVVA  389



>dbj|BAE17122.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/389 (88%), Positives = 369/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P+++RPLF+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVDRPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  G  T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRRSAANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEG EWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGKEWGVLFGFGPGLTVETVVLHSVAA  389



>dbj|BAA31259.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/389 (88%), Positives = 366/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+V E+RKAQRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N G+RVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +ERPLF+LV
Sbjct  181   NAGSRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S +EG  +
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKAS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>sp|P48388.1|CHS3_CAMSI RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Camellia sinensis]
 dbj|BAA05642.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/387 (89%), Positives = 367/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+V +AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQ+LFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILP S GAIDGHLREVGLTFHLLKDVP LIS ++EKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPSSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S++EGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>ref|XP_010099134.1| Chalcone synthase [Morus notabilis]
 gb|EXB76928.1| Chalcone synthase [Morus notabilis]
Length=389

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/388 (88%), Positives = 367/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEV +AQRA+GPATIMAIGT+ P NC DQ TYPD+YFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVCRAQRAEGPATIMAIGTANPPNCFDQRTYPDFYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKS+IKKRYMYL EEILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSLIKKRYMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+FQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPIPEVEKPIFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+I+KSL EAF+PLGI DWNS+FW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLTEAFKPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE K  LKPEKLRATRHVLSEYGNMSSACV+FILDEMR+  +++GL T
Sbjct  301   IAHPGGPAILDQVEAKCGLKPEKLRATRHVLSEYGNMSSACVVFILDEMRRKGAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AAM00232.1|AF358432_1 root-specific chalcone synthase [Senna alata]
Length=389

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/388 (87%), Positives = 372/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV VEE+RKAQRA+G AT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1     MVKVEEIRKAQRAEGAATVMAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+CAYMAPS+DARQDIVV+EVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNMCAYMAPSIDARQDIVVLEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAF+PLGI D+NS+FW
Sbjct  241   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFKPLGISDYNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK++ATRHVLSEYGNMSSACVLFI+DEMR+ S+K+GL T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKMQATRHVLSEYGNMSSACVLFIMDEMRRKSTKDGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>sp|Q9ZRR8.1|CHS1_CASGL RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Casuarina glauca]
 emb|CAA10641.1| chalcone synthase [Casuarina glauca]
Length=389

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/388 (88%), Positives = 373/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCLDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKE+PN+CAYMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKEHPNMCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P++E+PLF++V
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEVEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S AQTILPDS GAIDGHLREVG+TFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   STAQTILPDSDGAIDGHLREVGVTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKL ATRHVLSEYGNMSSACVLFILDEMR+ S+++GL T
Sbjct  301   IAHPGGPAILDQVEEKLALKPEKLGATRHVLSEYGNMSSACVLFILDEMRRKSAEKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHS++
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSLT  388



>gb|AHK07000.1| chalcone synthase [Olea europaea]
 gb|AHK07001.1| chalcone synthase [Olea europaea]
Length=390

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/386 (89%), Positives = 367/386 (95%), Gaps = 0/386 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M TVEEVR+AQRA+GPATIMAIGT+TP NCV QSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MFTVEEVRRAQRAEGPATIMAIGTATPSNCVYQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI+KRYM+LTEEILKEN +IC Y APSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIRKRYMHLTEEILKENRHICEYKAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP D HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPDDTHLDSLVGQALFGDGAAAVIVGSDPVIGVERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL L PEKLR+TRHVLSEYGNMSSACVLFILDEMRK+++KEG+ T
Sbjct  301   IAHPGGPAILDQVEEKLALNPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSATKEGMTT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHS  1220
             TGEGL+WGVLFGFGPGLTVETVVLHS
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHS  386



>gb|AGW24283.1| chalcone synthase [Melastoma malabathricum]
Length=391

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/388 (88%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR++QRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRRSQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++CAY APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCAYEAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGA A+IIGSDP P +E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAGAIIIGSDPIPGVEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEK+RATR VLS+YGNMSSACVLFILDEMR++S + G  T
Sbjct  301   IAHPGGPAILDQVEEKLGLKPEKMRATRQVLSDYGNMSSACVLFILDEMRRSSKQNGFKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS++
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSIA  388



>dbj|BAO58434.1| chalcone synthase [Vaccinium ashei]
Length=389

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/387 (88%), Positives = 372/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKA RA+GPAT++AIGT+TP +CV+Q+TYPDYYFR+TNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAMRAEGPATVLAIGTATPAHCVEQATYPDYYFRVTNSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSQIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD+HLDSLVGQALFGDGAAA+I+G+DP P++E+PLF++V
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAIIVGADPIPEVEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE+KL LKPEKLRATRHVLSEYGNMSSACVLFI+DEMRK S+++G  T
Sbjct  301   IAHPGGPAILDQVEQKLALKPEKLRATRHVLSEYGNMSSACVLFIMDEMRKKSAEDGFKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSL  387



>ref|NP_001234033.1| chalcone synthase 1 [Solanum lycopersicum]
 sp|P23418.2|CHS1_SOLLC RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Solanum lycopersicum]
 emb|CAA38980.1| chalcone synthase [Solanum lycopersicum]
Length=389

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/389 (89%), Positives = 366/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGK   QKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKRGTQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMP  DYQL KLL ++PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPACDYQLAKLLPVRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+IIGSDP   +ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIIGSDPIIGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT++PDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTLVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATR VLS YGNMSSACVLFILDEMRKAS+KEGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKPEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>sp|B0LDU6.1|PKS5_RUBID RecName: Full=Polyketide synthase 5; Short=RiPKS5; AltName: Full=Naringenin-chalcone 
synthase PKS5 [Rubus idaeus]
 gb|ABV54603.1| polyketide synthase 5 [Rubus idaeus]
Length=391

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/387 (88%), Positives = 367/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVDEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEI AVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P +ERPLF+LV
Sbjct  181   NRGARVLVVCSEIXAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPKIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  GL T
Sbjct  301   IAHPGGPAILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>dbj|BAB84112.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/388 (88%), Positives = 366/388 (94%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+V E+RK+QRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVGEIRKSQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +ERPLF+LV
Sbjct  181   NAGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPDTKIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+P+GI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S +EG  T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS++
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSLA  388



>gb|AFL72079.1| chalcone synthase [Agastache rugosa]
Length=391

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/387 (89%), Positives = 369/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+R+AQRA+GPAT++AIGT+ P NCVDQSTYPDYYFRITNSEH  +LKEKF RMC
Sbjct  1     MVTVEEIRRAQRAEGPATVLAIGTAVPTNCVDQSTYPDYYFRITNSEHKTDLKEKFVRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEE LKENPNI AYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQ 
Sbjct  61    EKSMIKKRYMHLTEEYLKENPNITAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQS  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP   +ERPLF+LV
Sbjct  181   NAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF PLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFAPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAIL+QVE KL LKPEKLR+TRHVLSEYGNMSSACVLFILDEMRK+S+KEGL+T
Sbjct  301   IAHPGGPAILNQVEAKLGLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSAKEGLST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>sp|P06515.1|CHSY_ANTMA RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Antirrhinum majus]
 emb|CAA27338.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29290.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29291.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29292.1| chalcone synthase [Antirrhinum majus]
Length=390

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/387 (88%), Positives = 371/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVR+AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVTVEEVRRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IK+RYM+LTEEILKENP +C YMAPSLDARQDIVVVEVP+LGKEAAQKAIKEWGQP
Sbjct  61    DKSNIKRRYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQ+V
Sbjct  181   NAGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             +AAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF PLGI DWNS+FW
Sbjct  241   TAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLR+TR VLSEYGNMSSACVLFILDEMRK+S+KEG++T
Sbjct  301   IAHPGGPAILDQVEEKLGLKPEKLRSTRQVLSEYGNMSSACVLFILDEMRKSSAKEGMST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|AAM90651.1|AF400566_1 chalcone synthase 11 [Rubus idaeus]
Length=391

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/387 (88%), Positives = 366/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMY QGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYHQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P +ERPLF+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPKIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLIS +IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISNNIEKSLNEAFKPLDITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  GL T
Sbjct  301   IAHPGGPAILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>dbj|BAC66467.1| chalcone synthase [Rosa hybrid cultivar 'Kardinal']
Length=389

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/389 (88%), Positives = 368/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITKSEHKAELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP P++E+P F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEVEKPSFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  G  T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|AHZ97870.1| chalcone synthase [Punica granatum]
Length=398

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/385 (88%), Positives = 363/385 (94%), Gaps = 0/385 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             T+EE+RKAQRA GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH  ELKEKFKRMCEK
Sbjct  8     TIEEIRKAQRASGPATVLAIGTATPSNCVSQADYPDYYFRITNSEHKTELKEKFKRMCEK  67

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMIKKRYM+LTEE LKENPN+CAYMA SLDARQDIVVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  68    SMIKKRYMHLTEEFLKENPNMCAYMATSLDARQDIVVVEVPKLGKEAASKAIKEWGQPKS  127

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAENNK
Sbjct  128   KITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK  187

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DPD  +ERPL+QLVSA
Sbjct  188   GARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPDTKIERPLYQLVSA  247

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI+DWNS+FWIA
Sbjct  248   AQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGINDWNSIFWIA  307

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL LK EK+RATRHVLSEYGNMSSACVLFILDEMRK S KEG  TTG
Sbjct  308   HPGGPAILDQVEAKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRKKSLKEGKATTG  367

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSV  1223
             EGL+WGVLFGFGPGLTVET+VLHSV
Sbjct  368   EGLDWGVLFGFGPGLTVETLVLHSV  392



>ref|XP_008224580.1| PREDICTED: polyketide synthase 5-like [Prunus mume]
Length=391

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/387 (87%), Positives = 371/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNS+H  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSQHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTE+ILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DP P++E+PLF++V
Sbjct  181   NRGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+RK ++K+GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TG+GL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGDGLDWGVLFGFGPGLTVETVVLHSV  387



>sp|P51090.1|CHSY_VITVI RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Vitis vinifera]
 emb|CAA53583.1| chalcone synthase [Vitis vinifera]
 gb|ADG35962.1| chalcone synthase [Vitis hybrid cultivar]
Length=393

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/389 (88%), Positives = 365/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+V E+RKAQRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N G+RVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +E PLF+LV
Sbjct  181   NAGSRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIELPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S +EG  +
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVSA  389



>gb|AIA22214.1| chalcone synthase [Hibiscus cannabinus]
Length=389

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/389 (88%), Positives = 366/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M T+EE+RKAQRA+GPAT++AIGTSTP NCVDQSTYPD+YFR+T SEH  ELKEKFKRMC
Sbjct  1     MSTIEEIRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDFYFRVTKSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTE+ILKENPN+C Y APSLDARQD+VVVEVPKLGKEAA +AIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEDILKENPNVCEYKAPSLDARQDMVVVEVPKLGKEAATRAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVDGIEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTF LLKDVPGLISK+IEKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFRLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S ++G+ T
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGVQT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHS+ A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSIPA  389



>ref|XP_007032052.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOY02978.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=395

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/387 (88%), Positives = 366/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M +VEE+RKAQRAQGPAT++AIGT+TP NCV Q+ YPDYYFRITNSEHL ELKEKFKRMC
Sbjct  3     MASVEEIRKAQRAQGPATVLAIGTATPPNCVSQADYPDYYFRITNSEHLTELKEKFKRMC  62

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  63    DKSMIKKRYMYLTEEILKENPNMCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  122

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  123   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  182

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DPD  +ERPLF+LV
Sbjct  183   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPDTKIERPLFELV  242

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF P+GI+DWNS+FW
Sbjct  243   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFSPIGINDWNSIFW  302

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATRHVLSE+GNMSSACVLFILDEMRK S ++G  T
Sbjct  303   IAHPGGPAILDQVEAKLGLKEEKLKATRHVLSEFGNMSSACVLFILDEMRKQSLEQGKPT  362

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  363   TGEGLEWGVLFGFGPGLTVETVVLHSI  389



>gb|ACS36661.1| CHS4 [Vitis labrusca x Vitis vinifera]
Length=393

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/389 (88%), Positives = 365/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+V E+RKAQRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N G+RVLVVC EITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +ERPLF+LV
Sbjct  181   NAGSRVLVVCPEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S +EG  +
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKAS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLT+ETVVLHSVSA
Sbjct  361   TGEGLEWGVLFGFGPGLTIETVVLHSVSA  389



>gb|AGI02993.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/387 (89%), Positives = 367/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+V +AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C Y+APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPLVCEYVAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQ+LFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILP S GAIDGHLREVGLTFHLLKDVP LIS ++EKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPSSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S++EGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>gb|AFU90825.1| chalcone synthase [Epimedium sagittatum]
Length=389

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/389 (89%), Positives = 369/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPAT+MAIGT+TP NCV QS YPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATVMAIGTATPSNCVLQSEYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IKKRYM+LTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ 
Sbjct  61    DKSQIKKRYMHLTEEILKENPTLCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQS  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIGSDP   +E+PLF++V
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIIGSDPIEGVEKPLFEIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+I+KSL+EA  PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIQKSLDEALAPLGITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKLRATRHVLSEYGNMSSACVLFI+DEMRK+S+K+GL T
Sbjct  301   IAHPGGPAILDQVEEKLHLKPEKLRATRHVLSEYGNMSSACVLFIMDEMRKSSAKQGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEG+EWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGIEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|AHA61354.1| chalcone synthase [Phyllanthus emblica]
Length=390

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/387 (88%), Positives = 364/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA GPAT+MAIGT+ P NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRASGPATVMAIGTAVPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENPNICAYMAPSLDARQDIVVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPNICAYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVG  LFGDGAAA+I+GSDP P++E+PLF++V
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGPGLFGDGAAAIIVGSDPIPEVEKPLFEVV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAFQPL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFQPLNIQDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAIL+QVE KL LKPEKL+ATR +L++YGNMSSACVLFILDEMRK S +EG  T
Sbjct  301   IAHPGGPAILNQVEAKLGLKPEKLKATRQILADYGNMSSACVLFILDEMRKKSKEEGFQT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|AAM90650.1|AF400565_1 chalcone synthase 5 [Rubus idaeus]
Length=391

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/387 (88%), Positives = 366/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1     MVTVDEVRKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPSD HLD LVGQALFGDGAAA+I+G+DP P +ERPLF+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPSDTHLDILVGQALFGDGAAAIIVGADPLPKIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATRH+LSEYGNMSSACVLFILDE+R+ S+  GL T
Sbjct  301   IAHPGGPAILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|AAT75302.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/387 (89%), Positives = 366/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+V +AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSM KKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMNKKRYMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQ+LFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILP S GAIDGHLREVGLTFHLLKDVP LIS ++EKSL EAFQPLGI DWNSLFW
Sbjct  241   SAAQTILPSSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S++EGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>gb|AAM00231.1|AF358431_1 root-specific chalcone synthase [Senna alata]
Length=390

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/388 (88%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+RKAQRAQGPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVSVEEIRKAQRAQGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTE++LKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEDLLKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+ CTTSGVDMPGADYQLTKLLGL+P VKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  241   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KLELKPEK+RATRHVLSEYGNMSSACVLFILDEMR+ S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLELKPEKMRATRHVLSEYGNMSSACVLFILDEMRRKSIQDGLET  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVL SV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLRSVA  388



>emb|CAA05512.1| chalcone synthase [Digitalis lanata]
Length=386

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/382 (89%), Positives = 366/382 (96%), Gaps = 0/382 (0%)
 Frame = +3

Query  78    EVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMI  257
             E+R+AQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT SEH+ ELKEKFKRMCEKSMI
Sbjct  1     EIRRAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSEHMTELKEKFKRMCEKSMI  60

Query  258   KKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKIT  437
             KKRYM+LTEEIL+ENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKIT
Sbjct  61    KKRYMHLTEEILQENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKIT  120

Query  438   HLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNKGAR  617
             HLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAENN GAR
Sbjct  121   HLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGAR  180

Query  618   VLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQT  797
             VLVVCSEITAVTFRGP D HLDS+VGQALFGDGA ALI+GSDP   +ERPLFQ+VSAAQT
Sbjct  181   VLVVCSEITAVTFRGPVDTHLDSMVGQALFGDGAGALIVGSDPVVGVERPLFQVVSAAQT  240

Query  798   ILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIAHPG  977
             +LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF PLGI DWNS+FWIAHPG
Sbjct  241   LLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGISDWNSIFWIAHPG  300

Query  978   GPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGL  1157
             GPAILDQVE+KL LKP+K+RATRHVLSEYGNMSSACVLFILDEMRKAS+KEG++TTGEGL
Sbjct  301   GPAILDQVEDKLALKPDKMRATRHVLSEYGNMSSACVLFILDEMRKASAKEGVSTTGEGL  360

Query  1158  EWGVLFGFGPGLTVETVVLHSV  1223
             +WGVLFGFGPGLTVETVVLHSV
Sbjct  361   DWGVLFGFGPGLTVETVVLHSV  382



>emb|CAK19318.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/387 (88%), Positives = 368/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATI+AIGT+TP NC+ QS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI+KRYM+LTEEILKENPN+CAY APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIRKRYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH+VFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDG+AALIIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIIGADPTPEIEKPIFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVL EYGNMSSACVLFILDEMR+  +++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|AGI02996.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/387 (89%), Positives = 366/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE+V +AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1     MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C Y+APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPLVCEYVAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQ+LFGDGAAA+IIGSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILP S GAIDGHLREVGLTFHLLKDVP LIS ++EKSL EAFQPLGI DWN LFW
Sbjct  241   SAAQTILPSSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNPLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK S++EGL T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>emb|CAK19319.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/387 (88%), Positives = 368/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATI+AIGT+TP NC+ QS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI+KRYM+LTEEILKENPN+CAY APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIRKRYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH+VFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDG+AALIIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIIGADPIPEIEKPIFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVL EYGNMSSACVLFILDEMR+  +++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>ref|XP_003601647.1| Chalcone synthase [Medicago truncatula]
 gb|AES71898.1| chalcone and stilbene synthase family protein [Medicago truncatula]
Length=389

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/388 (87%), Positives = 368/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVT +E+R+AQRA GPAT++AIGT+TPQNCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTFDEIRQAQRADGPATVLAIGTATPQNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+P VKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPQVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  241   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALAEAFQPLGISDYNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK++ATRHVLSEYGNMSSACVLFILDEMR+ S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLSLKPEKMQATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_003553986.1| PREDICTED: chalcone synthase-like [Glycine max]
Length=391

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/387 (87%), Positives = 366/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+R AQR+ GPATI+A GT+TP NCV Q+ YPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1     MVTVEEIRNAQRSHGPATILAFGTATPSNCVSQADYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEE LKENPN+C YMAPSLD RQD+VV+EVPKLGK+AA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEFLKENPNMCEYMAPSLDVRQDVVVMEVPKLGKQAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAALIIGSDPDP +ERP+F+++
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPDPAVERPIFEMI  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPG+ISK+IEKSL EAF+P+GI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLVEAFEPIGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKPEKL++TRHVLSEYGNMSSACVLFILDEMRK S +EG +T
Sbjct  301   IAHPGGPAILDQVEEKLRLKPEKLQSTRHVLSEYGNMSSACVLFILDEMRKKSKEEGKST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>ref|XP_007161599.1| hypothetical protein PHAVU_001G083000g [Phaseolus vulgaris]
 gb|ESW33593.1| hypothetical protein PHAVU_001G083000g [Phaseolus vulgaris]
Length=391

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/387 (88%), Positives = 366/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+R AQR+ GPATI+A GT+TP NC+ Q+ YPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1     MVTVEEIRNAQRSHGPATILAFGTATPSNCISQADYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEE LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA+KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAARKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAA+IIG+DPD  +ERP+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAMIIGADPDRSVERPIFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPG+ISK+IEKSL EAF P+GI+DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLTEAFAPIGINDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             +AHPGGPAILDQVEEKL LKPEKLR+TRHVLSEYGNMSSACVLFILDEMRK S +E   +
Sbjct  301   VAHPGGPAILDQVEEKLRLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKKSKEEEKGS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|AAM00230.1|AF358430_1 root-specific chalcone synthase [Senna alata]
Length=389

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/388 (87%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV VEE+RKAQRA+G AT+MAIGT+TP NCV+QSTYPDYYFR+TNSEH+ ELKEKF+RMC
Sbjct  1     MVKVEEIRKAQRAEGAATVMAIGTATPANCVEQSTYPDYYFRVTNSEHMTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENPN+CAYMAPS+DARQDIVV+EVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPNMCAYMAPSIDARQDIVVLEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P +E PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQVETPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAF PLGI D+NS+FW
Sbjct  241   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFNPLGISDYNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK++ATRHVLSEYGNMSSACVLFI+DEMR+ S+K+GL T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKMQATRHVLSEYGNMSSACVLFIMDEMRRKSTKDGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHS++
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSIA  388



>gb|AFM36768.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/388 (86%), Positives = 371/388 (96%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVT++E+RKAQRA GPATI+AIGT+ PQNC++QSTYPDYYFR+TNSEH+VELK+KFKRMC
Sbjct  1     MVTIDEIRKAQRADGPATILAIGTANPQNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILK+NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIG+DP  ++ERP+F+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+ PDS GAIDGHLREVGLTFHLLKDVPG+ISK+IE+ L++AF+PLGI DWNSLFW
Sbjct  241   SAAQTLCPDSEGAIDGHLREVGLTFHLLKDVPGIISKNIERCLDDAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL+LK EK+RATR VLSEYGNMSSACV+FILDEMRK S+ +G  T
Sbjct  301   IAHPGGPAILDQVEEKLKLKEEKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>emb|CAK19317.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/387 (88%), Positives = 367/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATI+AIGT+TP NC+ QS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI+KRYM+LTEEILKENPN+CAY APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIRKRYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH+VFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDG+AALIIG+DP P++E+P F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIIGADPIPEIEKPTFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVL EYGNMSSACVLFILDEMR+  +++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|EYU43821.1| hypothetical protein MIMGU_mgv1a007904mg [Erythranthe guttata]
Length=392

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/386 (87%), Positives = 367/386 (95%), Gaps = 0/386 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             ++E++R+AQRA+GPATI+AIGT+TP NCV+Q+ YPD+YFRITNSEH+ +LKEKF+RMCEK
Sbjct  5     SIEDIRRAQRAEGPATILAIGTATPANCVEQTEYPDFYFRITNSEHMTDLKEKFQRMCEK  64

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             S IKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS
Sbjct  65    SQIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  124

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAENN 
Sbjct  125   KITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNA  184

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             GARVLVVCSEITAVTFRGP+ +HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQLVSA
Sbjct  185   GARVLVVCSEITAVTFRGPNGSHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVSA  244

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISKHI KSL EAF PLGI DWNS+FWIA
Sbjct  245   AQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKHIGKSLKEAFDPLGISDWNSIFWIA  304

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE  L LKPEKLR+TRHVLSEYGNMSSACVLFILDEMRK+S+KEG++TTG
Sbjct  305   HPGGPAILDQVESTLALKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSAKEGMSTTG  364

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSVS  1226
             EGL WGVLFGFGPGLTVETVVLHSV+
Sbjct  365   EGLNWGVLFGFGPGLTVETVVLHSVA  390



>gb|AHY35309.1| chalcone synthase 2 [Morus notabilis]
Length=389

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/388 (88%), Positives = 365/388 (94%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEV +AQ A+GPATIMAIGT+ P NC DQ TYPD+YFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVCRAQCAEGPATIMAIGTANPPNCFDQRTYPDFYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKS+IKKRYMYL EEILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSLIKKRYMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+P+FQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPIPEVEKPIFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+I+KSL EAF+P GI DWNS+FW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLTEAFKPFGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE K  L+PEKLRATRHVLSEYGNMSSACV+FILDEMR+  +++GL T
Sbjct  301   IAHPGGPAILDQVEAKCGLRPEKLRATRHVLSEYGNMSSACVVFILDEMRRKGAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AFM36767.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/388 (86%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVT++E+RKAQRA GPATI+AIGT+ PQNC++QSTYPDYYFR+TNSEH+VELK+KFKRMC
Sbjct  1     MVTIDEIRKAQRADGPATILAIGTANPQNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEIL++NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILEQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIG+DP  ++ERP+F+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+ PDS GAIDGHLRE GLTFHLLKDVPG+ISK+IE+ LN+AF+PLGI DWNSLFW
Sbjct  241   SAAQTLCPDSEGAIDGHLREAGLTFHLLKDVPGIISKNIERCLNDAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL+LK  K+RATR VLSEYGNMSSACV+FILDEMRK S+ +G  T
Sbjct  301   IAHPGGPAILDQVEEKLKLKEGKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>dbj|BAD34456.1| chalcone synthase [Eustoma grandiflorum]
Length=389

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/388 (88%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEEVR+AQRA+GPAT+MAIGT+TP NCVDQSTY DYYF+ITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEVRRAQRAEGPATLMAIGTATPPNCVDQSTYSDYYFKITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI++RYM+LTEE LKENPN+ AYMAPSLDARQDIVV+EVPKLGK+AA KAIKEWGQP
Sbjct  61    DKSMIRQRYMHLTEEYLKENPNVSAYMAPSLDARQDIVVMEVPKLGKDAALKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRTMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NK ARVLVVCSEITAVTFRGP + HLDSLVGQALFGDGAAA+IIGSDP P +ERPLFQLV
Sbjct  181   NKDARVLVVCSEITAVTFRGPCETHLDSLVGQALFGDGAAAIIIGSDPIPGVERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILP+S GAI+GHLRE GLTFHLLKDVPGLISK+I KSL EAF+PLGI DWNS+FW
Sbjct  241   SAAQTILPESDGAIEGHLRETGLTFHLLKDVPGLISKNIMKSLEEAFEPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL L+PEKLRATRHVLSEYGNMSSACVLFILDEMRKAS+K+GL+T
Sbjct  301   IAHPGGPAILDQVEVKLGLEPEKLRATRHVLSEYGNMSSACVLFILDEMRKASAKDGLST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVS  388



>gb|EPS72180.1| chalcone synthase [Genlisea aurea]
Length=390

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/387 (86%), Positives = 371/387 (96%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+R+AQRA+GPA ++AIGT+TP NCV+Q+TYPDYYFRITNSEH+ ELK+KFKRMC
Sbjct  1     MVSVEEIRRAQRAEGPAAVLAIGTATPANCVEQATYPDYYFRITNSEHMTELKDKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIK+RYMYLTEEILKENP++CAYM+PSLDARQDIVVVEVP+LGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKRRYMYLTEEILKENPDMCAYMSPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH++FCTTSGVDMPGADYQL KLLGL+PSV+R M+YQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHVIFCTTSGVDMPGADYQLVKLLGLRPSVRRTMLYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPS++ LDSLVGQALFGDGAAA+I+GSDP   +ERPLFQ+V
Sbjct  181   NRGARVLVVCSEITAVTFRGPSESSLDSLVGQALFGDGAAAVIVGSDPIVGVERPLFQMV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPG+ISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLKEAFEPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+RATR VL+EYGNMSSACVLFILDEMRK+S+K+G NT
Sbjct  301   IAHPGGPAILDQVEAKLALKPEKMRATRRVLAEYGNMSSACVLFILDEMRKSSAKDGANT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>ref|XP_009376348.1| PREDICTED: polyketide synthase 5-like [Pyrus x bretschneideri]
Length=396

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/396 (87%), Positives = 371/396 (94%), Gaps = 7/396 (2%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATI+AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATILAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLF-  959
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+P+GI DWNSLF 
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFC  300

Query  960   --W----IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKAS  1121
               W    +AHPGGPAILDQVE KL LKPEKL ATR VLS+YGNMSSACVLFILDE+R+ S
Sbjct  301   STWSRIAVAHPGGPAILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKS  360

Query  1122  SKEGLNTTGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             + +GL TTGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   ADKGLRTTGEGLEWGVLFGFGPGLTVETVVLHSVAA  396



>sp|Q9AU09.1|PKS3_RUBID RecName: Full=Polyketide synthase 3; Short=RiPKS3; AltName: Full=Naringenin-chalcone 
synthase PKS3 [Rubus idaeus]
 gb|AAK15176.1|AF292369_1 aromatic polyketide synthase [Rubus idaeus]
Length=391

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/389 (88%), Positives = 365/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1     MVTVDEVRKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHRTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQ 
Sbjct  61    DKSRIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQL  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVL VCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP PD+ERPLF+LV
Sbjct  181   NKGARVLAVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPDIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR++LSEYGNMSSACVLFILDE+R+ S   G  T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLFILDEVRRKSVANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>ref|XP_003531225.1| PREDICTED: chalcone synthase 1 isoform X1 [Glycine max]
 ref|XP_006585155.1| PREDICTED: chalcone synthase 1 isoform X2 [Glycine max]
 sp|P24826.1|CHS1_SOYBN RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Glycine max]
 emb|CAA38456.1| naregenin-chalcone synthase [Glycine max]
 dbj|BAB71954.1| chalcone synthase [Glycine max]
 gb|AAQ62590.1| chalcone synthase CHS1 [Glycine max]
 gb|AAQ62597.1| chalcone synthase CHS1 [Glycine max]
 dbj|BAF62128.1| chalcone synthase [Glycine max]
 dbj|BAH70473.1| chalcone synthase [Glycine max]
 dbj|BAH70474.1| chalcone synthase [Glycine max]
Length=388

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/388 (88%), Positives = 368/388 (95%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVT  387



>ref|XP_003524935.1| PREDICTED: chalcone synthase [Glycine max]
 emb|CAA46590.1| naregenin-chalcone synthase [Glycine max]
Length=388

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/388 (88%), Positives = 368/388 (95%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEIRQAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SVS
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVS  387



>gb|ACM17224.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/387 (88%), Positives = 367/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATI+AIGT+TP NC+ QS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI+KRYM+LTEEILKENPN+CAY APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIRKRYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH+VFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HL SLVGQALFGDG+AALIIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLGSLVGQALFGDGSAALIIGADPIPEIEKPVFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVL EYGNMSSACVLFILDEMR+  +++GL T
Sbjct  301   IAHPGGPAILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>sp|O82144.1|CHSY_HYDMC RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Hydrangea macrophylla]
 dbj|BAA32732.1| chalcone synthase [Hydrangea macrophylla]
Length=389

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/388 (88%), Positives = 369/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATI+AIGT+TP N VDQSTYPD+YFR+TNSEH  ELK KF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATILAIGTATPPNYVDQSTYPDFYFRVTNSEHKKELKAKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             + S IKKRYM+LTEEILKENPNICAYMAPSLDARQD+VVVE+PKLGKEAA +AIKEWGQP
Sbjct  61    DNSQIKKRYMHLTEEILKENPNICAYMAPSLDARQDMVVVEIPKLGKEAATRAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIGSDP P++E+PLF++V
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPMPEVEKPLFEIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PL I DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFRPLDISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE+KL LKPEKLRATR+VLS+YGNMSSACVLFI+DEMRK S++EGL T
Sbjct  301   IAHPGGPAILDQVEKKLALKPEKLRATRNVLSDYGNMSSACVLFIMDEMRKNSAEEGLMT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLH VS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHGVS  388



>gb|AEN04070.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/388 (86%), Positives = 370/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVT++E+RKAQRA GPATI+AIGT+ PQNC++QSTYPDYYFR+TNSEH+VELK+KFKRMC
Sbjct  1     MVTIDEIRKAQRADGPATILAIGTANPQNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILK+NPN+CAYMAPSLDARQD+VVVEVP+LGK AA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKAAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIG+DP  ++ERP+F+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+ PDS GAIDGHLREVGLTFHLLKDVPG+ISK+IE+ L++AF+PLGI DWNSLFW
Sbjct  241   SAAQTLCPDSEGAIDGHLREVGLTFHLLKDVPGIISKNIERCLDDAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL+LK EK+RATR VLSEYGNMSSACV+FILDEMRK S+ +G  T
Sbjct  301   IAHPGGPAILDQVEEKLKLKEEKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AGM46641.1| chalcone synthase protein, partial [Apium graveolens]
Length=384

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/382 (89%), Positives = 363/382 (95%), Gaps = 0/382 (0%)
 Frame = +3

Query  78    EVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMI  257
             E R   RA GPAT++AIGT+TP NCVDQ+ YPDYYFRITNSEH+ ELKEKFKRMCEKSMI
Sbjct  2     EFRNPHRAPGPATVLAIGTATPSNCVDQAAYPDYYFRITNSEHMTELKEKFKRMCEKSMI  61

Query  258   KKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKIT  437
             KKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA+KAIKEWGQPKSKIT
Sbjct  62    KKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAEKAIKEWGQPKSKIT  121

Query  438   HLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNKGAR  617
             HLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAENNKGAR
Sbjct  122   HLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGAR  181

Query  618   VLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQT  797
             VLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P++ERPLF+LVSAAQT
Sbjct  182   VLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEVERPLFELVSAAQT  241

Query  798   ILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIAHPG  977
             ILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FWIAHPG
Sbjct  242   ILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPG  301

Query  978   GPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGL  1157
             GPAILDQVE KL LKPEKLRAT HVLS+YGNMSSACVLFILDEMRK S+++GL TTGEGL
Sbjct  302   GPAILDQVEAKLGLKPEKLRATSHVLSDYGNMSSACVLFILDEMRKTSAEDGLATTGEGL  361

Query  1158  EWGVLFGFGPGLTVETVVLHSV  1223
             +WGVLFGFGPGLTVETVVLHSV
Sbjct  362   DWGVLFGFGPGLTVETVVLHSV  383



>sp|P51082.1|CHSB_PEA RecName: Full=Chalcone synthase 1B; AltName: Full=Naringenin-chalcone 
synthase 1B [Pisum sativum]
 emb|CAA56317.1| naringenin-chalcone synthase [Pisum sativum]
Length=389

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/388 (86%), Positives = 366/388 (94%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+E+R+AQ+A+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1     MVTVDEIRQAQKAEGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+P VKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPQVEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NSLFW
Sbjct  241   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK  K++ATRHVLSEYGNMSSACVLFILDEMR+ S +E L T
Sbjct  301   IAHPGGPAILDQVEAKLSLKQRKMQATRHVLSEYGNMSSACVLFILDEMRRKSKEEQLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AAQ62588.1| chalcone synthase CHS4 [Glycine max]
 gb|AAQ62595.1| chalcone synthase CHS4 [Glycine max]
Length=388

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/388 (87%), Positives = 368/388 (95%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVT  387



>ref|XP_006585154.1| PREDICTED: chalcone synthase 3-like isoform X2 [Glycine max]
Length=388

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/388 (87%), Positives = 367/388 (95%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+R AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVT  387



>dbj|BAO58435.1| chalcone synthase [Vaccinium ashei]
Length=398

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/388 (88%), Positives = 363/388 (94%), Gaps = 1/388 (0%)
 Frame = +3

Query  66    VTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCE  245
             V+VEE+RKAQRAQGPAT++AIGT+TP NCV+Q+ YPD+YFRITNSEH  ELKEKFKRMCE
Sbjct  6     VSVEEIRKAQRAQGPATVLAIGTATPANCVNQAEYPDFYFRITNSEHKTELKEKFKRMCE  65

Query  246   KSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPK  425
             KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPK
Sbjct  66    KSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPK  125

Query  426   SKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENN  605
             SKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAENN
Sbjct  126   SKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN  185

Query  606   KGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVS  785
              G+RVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P  ERPLFQLVS
Sbjct  186   AGSRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPTPP-ERPLFQLVS  244

Query  786   AAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWI  965
             A+QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWN LFWI
Sbjct  245   ASQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFAPVGISDWNELFWI  304

Query  966   AHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTT  1145
             AHPGGPAILDQVE KL LK EKL+ATRHVLSEYGNMSSACVLFILDEMRK S +EG  TT
Sbjct  305   AHPGGPAILDQVELKLGLKEEKLKATRHVLSEYGNMSSACVLFILDEMRKKSVEEGSGTT  364

Query  1146  GEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             GEGLEWGVLFGFGPGLTVETVVLHS+ A
Sbjct  365   GEGLEWGVLFGFGPGLTVETVVLHSLPA  392



>gb|ABC71308.1| chalcone synthase [Saussurea medusa]
Length=389

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/388 (88%), Positives = 366/388 (94%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKA RA+GPATIMAIGT+TP NCV QS YPDYYFR+T SEH  ELKEKF+RMC
Sbjct  1     MVTVEEVRKATRAEGPATIMAIGTATPPNCVLQSAYPDYYFRVTKSEHKKELKEKFRRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEEIL+E PNICAYMAPSLD RQDIVVVEVPKLGKEAA +AIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEILQEKPNICAYMAPSLDERQDIVVVEVPKLGKEAATRAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP++ HLDSLVGQALFGDGAAA+I+GSDP   +E+PLF++V
Sbjct  181   NKGARVLVVCSEITAVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPLLGVEKPLFEIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISKHIEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLLEAFRPLGIFDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LKP+KLRATRHVLSEYGNMSSACVLFIL+EMR AS+ +G NT
Sbjct  301   IAHPGGPAILDQVEEKLSLKPDKLRATRHVLSEYGNMSSACVLFILNEMRHASATDGFNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVET+VLHSVS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETLVLHSVS  388



>ref|WP_039310897.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91191.1| hypothetical protein QW71_36090 [Paenibacillus sp. IHB B 3415]
Length=370

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/369 (92%), Positives = 357/369 (97%), Gaps = 0/369 (0%)
 Frame = +3

Query  120   MAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKRYMYLTEEILKE  299
             MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC+KSMIKKRYMYLTEEILKE
Sbjct  1     MAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKE  60

Query  300   NPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPG  479
             NPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKSKITHLVFCTTSGVDMPG
Sbjct  61    NPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPG  120

Query  480   ADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEITAVTFR  659
             ADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAENNKGARVLVVCSEITAVTFR
Sbjct  121   ADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFR  180

Query  660   GPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQTILPDSGGAIDGHLR  839
             GPSDAHLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LVSAAQTILPDS GAIDGHLR
Sbjct  181   GPSDAHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTILPDSDGAIDGHLR  240

Query  840   EVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIAHPGGPAILDQVeeklel  1019
             EVGLTFHLLKDVPGLISK+IEKSLNEAFQPL I DWNSLFWIAHPGGPAILDQVE KL L
Sbjct  241   EVGLTFHLLKDVPGLISKNIEKSLNEAFQPLNITDWNSLFWIAHPGGPAILDQVELKLAL  300

Query  1020  kpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGLEWGVLFGFGPGLTV  1199
             KPEKLRATRHVLSEYGNMSSACVLFILDEMRK+S+K+GL TTGEGL+WGVLFGFGPGLTV
Sbjct  301   KPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSAKKGLKTTGEGLDWGVLFGFGPGLTV  360

Query  1200  ETVVLHSVS  1226
             ETVVLHSVS
Sbjct  361   ETVVLHSVS  369



>ref|NP_001276296.1| chalcone synthase [Glycine max]
 ref|XP_003531220.1| PREDICTED: chalcone synthase 3-like [Glycine max]
 gb|AAQ62589.1| chalcone synthase CHS3 [Glycine max]
 gb|AAQ62596.1| chalcone synthase CHS3 [Glycine max]
 gb|ACN81822.1| chalcone synthase [Glycine max]
 gb|KHN15230.1| Chalcone synthase 3 [Glycine soja]
Length=388

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/388 (87%), Positives = 367/388 (95%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+R AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVT  387



>ref|XP_006468926.1| PREDICTED: chalcone synthase 2-like [Citrus sinensis]
 gb|ACB47461.1| chalcone synthase [Citrus sinensis]
Length=391

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/387 (86%), Positives = 363/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC
Sbjct  1     MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DPD  +ERPL+QLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S +QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL+EAF P+GI DWNS+FW
Sbjct  241   STSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATR VLSEYGNMSSACVLFILDEMRK S++E   T
Sbjct  301   IAHPGGPAILDQVESKLGLKEEKLKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|AHJ80976.1| chalcone synthase [Erythranthe lewisii]
Length=390

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/388 (86%), Positives = 367/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M ++EE+R+AQRA+GPATI+AIGT+TP NCV QS YPD+YFRIT+SEH+ +LKEKFKRMC
Sbjct  1     MASIEEIRRAQRAEGPATILAIGTATPANCVTQSEYPDFYFRITDSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKS I KRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSQINKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPG DYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGP+ +HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQL+
Sbjct  181   NAGARVLVVCSEITAVTFRGPNGSHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLI  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+LPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF PLGI DWNS+FW
Sbjct  241   SAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE  L LKPEKLR+TRHVL EYGNMSSACVLFILDEMRK+S+K+G+++
Sbjct  301   IAHPGGPAILDQVESTLALKPEKLRSTRHVLGEYGNMSSACVLFILDEMRKSSAKDGMSS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_003531219.1| PREDICTED: chalcone synthase 5-like [Glycine max]
 ref|XP_003531226.1| PREDICTED: chalcone synthase 5-like [Glycine max]
 sp|P48406.1|CHS5_SOYBN RecName: Full=Chalcone synthase 5; AltName: Full=Naringenin-chalcone 
synthase 5 [Glycine max]
 gb|AAB01004.1| chalcone synthase [Glycine max]
Length=388

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/388 (87%), Positives = 368/388 (95%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEIRQAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVT  387



>ref|XP_004504355.1| PREDICTED: chalcone synthase 1-like [Cicer arietinum]
Length=389

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/387 (88%), Positives = 364/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV V+E+RKAQRA+GPAT+MAIGT+TP N +DQS YPDYYFR+TNSEH  ELKEKFKRMC
Sbjct  1     MVNVDEIRKAQRAEGPATVMAIGTATPPNFIDQSDYPDYYFRVTNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP PD+ERPLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPLPDVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAF+PLGI D+NS+FW
Sbjct  241   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFKPLGISDYNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE+KL LKPEKL ATRHVLSEYGNMSSACVLFILD MR  S + GL T
Sbjct  301   IAHPGGPAILDQVEDKLGLKPEKLEATRHVLSEYGNMSSACVLFILDAMRNKSKENGLAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVL SV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLRSV  387



>gb|KHN12336.1| Chalcone synthase 1 [Glycine soja]
Length=388

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/388 (87%), Positives = 367/388 (95%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VE +RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEAIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQL+
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLI  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVT  387



>gb|KDO45963.1| hypothetical protein CISIN_1g016330mg [Citrus sinensis]
Length=391

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/387 (86%), Positives = 363/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC
Sbjct  1     MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DPD  +ERPL+QLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S +QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL+EAF P+GI DWNS+FW
Sbjct  241   STSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATR VLSEYGNMSSACVLFILDEMRK S++E   T
Sbjct  301   IAHPGGPAILDQVESKLGLKEEKLKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|AEO36981.1| chalcone synthase [Dimocarpus longan]
Length=393

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/387 (87%), Positives = 364/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M  +EE+RKAQRA+GPA I+AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1     MAGIEEIRKAQRAEGPANILAIGTATPANCVLQADYPDYYFRITNSEHMTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTE+ILKENPN+CAYMAPS+DARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEDILKENPNMCAYMAPSIDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIG+DPD  +ERPLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIIGADPDTSIERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI+DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGINDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMR+   +EG  T
Sbjct  301   IAHPGGPAILDQVEAKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRRKCLEEGKLT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVL SV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLPSV  387



>dbj|BAD34457.1| chalcone synthase [Eustoma grandiflorum]
Length=389

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/388 (87%), Positives = 368/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEEVR+AQRA+GPAT+MAIGT+TP NCVDQSTY DYYF+ITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEVRRAQRAEGPATLMAIGTATPPNCVDQSTYSDYYFKITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI++RYM+LTEE LKEN N+ AYMAPSLDARQDIVV+EVPKLGK+AA KAIKEWGQP
Sbjct  61    DKSMIRQRYMHLTEEYLKENLNVSAYMAPSLDARQDIVVMEVPKLGKDAALKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRTMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NK ARVLVVCSEITAVTFRGP + HLDSLVGQALFGDGAAA+IIGSDP P +ERPLFQLV
Sbjct  181   NKDARVLVVCSEITAVTFRGPCETHLDSLVGQALFGDGAAAIIIGSDPIPGVERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILP+S GAI+GHLRE GLTFHLLKDVPGLISK+I KSL EAF+PLGI DWNS+FW
Sbjct  241   SAAQTILPESDGAIEGHLRETGLTFHLLKDVPGLISKNIMKSLEEAFEPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL L+PEKLRATRHVLSEYGNMSSACVLFILDEMRKAS+K+GL+T
Sbjct  301   IAHPGGPAILDQVEVKLGLEPEKLRATRHVLSEYGNMSSACVLFILDEMRKASAKDGLST  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVS  388



>dbj|BAJ14518.1| chalcone synthase type 4 [Dahlia pinnata]
 dbj|BAJ14769.1| chalcone synthase type 2 [Dahlia pinnata]
Length=389

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/388 (87%), Positives = 362/388 (93%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+++E R AQRA GPA I+AIGT+TP NCV QS YPDYYFR+T SEH  +LKEKF RMC
Sbjct  1     MVSIQEFRNAQRADGPAAILAIGTATPPNCVLQSEYPDYYFRVTKSEHKKDLKEKFTRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI+KRYMYLTEEILKE PNICAYMAPSLD RQDIVVVEVPKLGKEAA +AIKEWGQP
Sbjct  61    EKSMIRKRYMYLTEEILKEKPNICAYMAPSLDERQDIVVVEVPKLGKEAATRAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP D HLDSLVGQALFGDGAAA+I+GSDP PD+E+PLF+++
Sbjct  181   NKGARVLVVCSEITAVTFRGPDDTHLDSLVGQALFGDGAAAIIVGSDPLPDVEKPLFEII  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA QTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIE SL +AFQPLGI+DWNSLFW
Sbjct  241   SAGQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIETSLVDAFQPLGINDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL L P+KLRA+RHVLSEYGNMSSACVLFIL+EMR +S+ +G NT
Sbjct  301   IAHPGGPAILDQVEEKLALTPDKLRASRHVLSEYGNMSSACVLFILNEMRHSSATDGFNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVS  388



>ref|XP_002518132.1| Chalcone synthase, putative [Ricinus communis]
 gb|EEF44265.1| Chalcone synthase, putative [Ricinus communis]
Length=390

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/388 (86%), Positives = 367/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+V++VR+ QRA+GPAT++AIGT TP N VDQSTYPDYYFR+TNSEH  ELKEKFKRMC
Sbjct  1     MVSVQDVRRTQRAEGPATVLAIGTVTPTNSVDQSTYPDYYFRVTNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTEE+LKENPNICAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEEMLKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PS+KR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSIKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSE+TAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PL++LV
Sbjct  181   NKGARVLVVCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPVPNVEKPLYELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAFQPLGI DWNS+FW
Sbjct  241   FTAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL L+P KL+ATRH+LSE+GNMSSACVLFI+D MRK S+++GL +
Sbjct  301   IAHPGGPAILDQVEAKLGLEPNKLQATRHILSEFGNMSSACVLFIMDYMRKKSAEDGLES  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_011006130.1| PREDICTED: chalcone synthase [Populus euphratica]
Length=391

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/385 (87%), Positives = 364/385 (95%), Gaps = 0/385 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             ++EE+RKAQRA GPATI+AIG +TP NCV Q+ YPDYYFRIT SEH+ ELKEKFKRMC+K
Sbjct  4     SIEEIRKAQRASGPATILAIGKATPSNCVSQADYPDYYFRITKSEHMTELKEKFKRMCDK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  64    SMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAENNK
Sbjct  124   KITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             G+RVLVVCSEITAVTFRGPSD HLDS+VGQALFGDGAAA+I+G+DPD  +ERPLFQLVSA
Sbjct  184   GSRVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAVIVGADPDTSIERPLFQLVSA  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI+DWNS+FWIA
Sbjct  244   AQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFAPIGINDWNSIFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL+LK EKLRATR+VLS+YGNMSSACVLFILDEMR  S +EG +TTG
Sbjct  304   HPGGPAILDQVEIKLDLKEEKLRATRNVLSDYGNMSSACVLFILDEMRNKSLEEGKSTTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSV  1223
             EGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  364   EGLEWGVLFGFGPGLTVETVVLHSV  388



>sp|P51075.2|CHSY_BETPN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Betula pendula]
 emb|CAA71904.1| chalcone synthase [Betula pendula]
Length=395

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/387 (87%), Positives = 360/387 (93%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M +VEE+RKAQRA GPAT++AIGT+TP NC+ Q+ YPDYYFRIT S+H+ ELKEKFKRMC
Sbjct  1     MASVEEIRKAQRAHGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEIL ENPN+CAYMAPSLDARQ IVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILNENPNMCAYMAPSLDARQTIVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DPD  +ERPLF+L+
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLFELI  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPG+ISK+IEKSL EAF PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLAEAFAPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMR+ S + G  T
Sbjct  301   IAHPGGPAILDQVESKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRRNSLEGGKVT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>emb|CAH61575.1| chalcone synthase [Dictamnus albus]
Length=391

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/387 (87%), Positives = 365/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M TVEE+ KA+RA+GPATI+AIGT+TP N V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC
Sbjct  1     MATVEEIIKAKRAEGPATILAIGTATPANSVNQADYPDYYFRITKSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTE+ILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEDILKENPNMCAYMAPSLDARQDVVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAALI+G+DPD  +ERPL+QLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAALIVGADPDTTVERPLYQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA+QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI+DWNS+FW
Sbjct  241   SASQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFSPIGINDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL LK EKLRATRHVLSEYGNMSSACVLFILDEMRK   +EG  T
Sbjct  301   IAHPGGPAILDQVEEKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKCVEEGKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>sp|Q9FSB7.1|CHS3_RUTGR RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Ruta graveolens]
 emb|CAC14061.2| putative chalcone synthase [Ruta graveolens]
Length=393

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/386 (88%), Positives = 364/386 (94%), Gaps = 0/386 (0%)
 Frame = +3

Query  66    VTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCE  245
             VTVEE+RKAQRA GPAT++AIGT+TP N V Q+ YPDYYFRIT SEH+ +LKEKFKRMC+
Sbjct  4     VTVEEIRKAQRADGPATVLAIGTATPANYVTQADYPDYYFRITKSEHMTDLKEKFKRMCD  63

Query  246   KSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPK  425
             KSMI+KRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPK
Sbjct  64    KSMIRKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAAKAIKEWGQPK  123

Query  426   SKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENN  605
             SKITHL+FCTTSGVDMPG DYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAENN
Sbjct  124   SKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN  183

Query  606   KGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVS  785
             +GARVLVVCSEITAVTFRGP D HLDSLVGQALFGDGAAA+I+G+DPD  +ERPL+QLVS
Sbjct  184   RGARVLVVCSEITAVTFRGPVDTHLDSLVGQALFGDGAAAVIVGADPDESIERPLYQLVS  243

Query  786   AAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWI  965
             AAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNS+FWI
Sbjct  244   AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPIGISDWNSIFWI  303

Query  966   AHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTT  1145
             AHPGGPAILDQVEEKLELK EKLRATRHVLSEYGNMSSACVLFILDEMRK  ++EG+ TT
Sbjct  304   AHPGGPAILDQVEEKLELKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKCAEEGMATT  363

Query  1146  GEGLEWGVLFGFGPGLTVETVVLHSV  1223
             GEGLEWGVLFGFGPGLTVETVVL SV
Sbjct  364   GEGLEWGVLFGFGPGLTVETVVLRSV  389



>gb|AGE10597.1| chalcone synthase [Lonicera japonica]
Length=393

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/388 (88%), Positives = 360/388 (93%), Gaps = 0/388 (0%)
 Frame = +3

Query  66    VTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCE  245
             VTVEE+RKAQRAQGPAT++AIGT+TP NCV Q+ YPD+YFRIT SEH  ELKEKFKRMCE
Sbjct  4     VTVEEIRKAQRAQGPATVLAIGTATPANCVYQADYPDFYFRITKSEHKAELKEKFKRMCE  63

Query  246   KSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPK  425
             KSMI+KRYM+L EEILKENP IC YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPK
Sbjct  64    KSMIRKRYMHLNEEILKENPGICEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPK  123

Query  426   SKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENN  605
             SKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAENN
Sbjct  124   SKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN  183

Query  606   KGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVS  785
              GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +ERPLF+LVS
Sbjct  184   AGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDKSVERPLFELVS  243

Query  786   AAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWI  965
             AAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNSLFWI
Sbjct  244   AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFAPIGITDWNSLFWI  303

Query  966   AHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTT  1145
             AHPGGPAILDQVE KL LK EKLR TRHVLSEYGNMSSACVLFILDE+RK S +EG  TT
Sbjct  304   AHPGGPAILDQVEIKLGLKEEKLRPTRHVLSEYGNMSSACVLFILDELRKKSIEEGKATT  363

Query  1146  GEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             G+GLEWGVLFGFGPGLTVETVVLHSV A
Sbjct  364   GDGLEWGVLFGFGPGLTVETVVLHSVPA  391



>dbj|BAF49290.1| chalcone synthase [Clitoria ternatea]
Length=389

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/389 (87%), Positives = 366/389 (94%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+RKAQRA GPAT++AIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVSVEEIRKAQRAVGPATVLAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEEILKENP+IC YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ 
Sbjct  61    EKSMIKKRYMHLTEEILKENPSICEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQA  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DP   +E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPLAGIEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  241   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILDEMR+ S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDEMRRKSIEKGLGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|ACQ41890.1| chalcone synthase [Citrus unshiu]
Length=391

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/387 (86%), Positives = 362/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC
Sbjct  1     MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DPD  +ERPL+QLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S +QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL+EAF PLGI DWNS+FW
Sbjct  241   STSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATR VLSEYGNM SACVLFILDEMRK S++E   T
Sbjct  301   IAHPGGPAILDQVESKLGLKEEKLKATRQVLSEYGNMPSACVLFILDEMRKKSAEEAKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|KDP41871.1| hypothetical protein JCGZ_26889 [Jatropha curcas]
Length=391

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/387 (87%), Positives = 364/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  66    VTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCE  245
             VTV+++RKAQRA+GPAT++AIGT+TP NCV Q+ YPDYYFRIT S+HL ELKEKFKRMC+
Sbjct  4     VTVDQIRKAQRAEGPATVLAIGTATPANCVIQADYPDYYFRITKSDHLTELKEKFKRMCD  63

Query  246   KSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPK  425
             KSMIKKRYMYL EEILKENP++CAY  PSLDARQDIVVVEVPKLGKEAA KAIKEWGQPK
Sbjct  64    KSMIKKRYMYLNEEILKENPSMCAYWEPSLDARQDIVVVEVPKLGKEAAAKAIKEWGQPK  123

Query  426   SKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENN  605
             SKITHL+FCTTSGVDMPG DYQLTKLLGL+PSVKRFMMYQQGC+AGGTV+RLAKDLAENN
Sbjct  124   SKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCYAGGTVLRLAKDLAENN  183

Query  606   KGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVS  785
             KGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGA ALI+G+DPD  +ERPLF+LVS
Sbjct  184   KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAGALIVGADPDTSVERPLFELVS  243

Query  786   AAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWI  965
             AAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI+DWNS+FWI
Sbjct  244   AAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGINDWNSIFWI  303

Query  966   AHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTT  1145
             AHPGGPAILDQVE KL LKPEK++ATRHVLSEYGNMSSACVLFILDEMRK S +EG  TT
Sbjct  304   AHPGGPAILDQVEAKLSLKPEKMKATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKATT  363

Query  1146  GEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             GEGLEWGVLFGFGPGLTVET+VLHSV+
Sbjct  364   GEGLEWGVLFGFGPGLTVETIVLHSVA  390



>gb|ACB78187.1| chalcone synthase [Senna tora]
Length=390

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/387 (87%), Positives = 368/387 (95%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+V E+RKAQRA+GPAT+MAIGT+TP NCVDQS YPDYYFRIT SEH+ ELKEKF+RMC
Sbjct  1     MVSVSEIRKAQRAEGPATVMAIGTATPPNCVDQSEYPDYYFRITQSEHMTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM++TE+ILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMHVTEDILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+P VKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPEIEKPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  241   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KLELKPEK+RATRHVLSEYGNMSSACVLFILDEMR+ S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLELKPEKMRATRHVLSEYGNMSSACVLFILDEMRRKSIEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVL SV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLRSV  387



>ref|XP_006446902.1| hypothetical protein CICLE_v10015535mg [Citrus clementina]
 sp|Q9XJ57.1|CHS2_CITSI RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Citrus sinensis]
 dbj|BAA81664.1| chalcone synthase [Citrus sinensis]
 gb|ESR60142.1| hypothetical protein CICLE_v10015535mg [Citrus clementina]
Length=391

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/387 (86%), Positives = 362/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC
Sbjct  1     MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DPD  +ERPL+QLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S +QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL+EAF PLGI DWNS+FW
Sbjct  241   STSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATR VLSEYGNMSSACVLFILDEMRK S +E   T
Sbjct  301   IAHPGGPAILDQVESKLGLKGEKLKATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>gb|ABD24222.1| chalcone synthase [Populus alba]
 gb|ABD24224.1| chalcone synthase [Populus alba]
 gb|ABD24225.1| chalcone synthase [Populus alba]
Length=396

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/385 (87%), Positives = 364/385 (95%), Gaps = 0/385 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             ++EE+RKAQRA GPATI+AIG +TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC+K
Sbjct  4     SIEEIRKAQRASGPATILAIGKATPANCVSQADYPDYYFRITNSEHMTELKEKFKRMCDK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMIKKRYM++TEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  64    SMIKKRYMHITEEILKENPSMCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAENNK
Sbjct  124   KITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             G+RVLVVCSEITAVTFRGPSD HLDS+VGQALFGDGAAA+I+G+DPD  +ERPLFQLVSA
Sbjct  184   GSRVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAVIVGADPDTSIERPLFQLVSA  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI+DWNS+FWIA
Sbjct  244   AQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFAPIGINDWNSIFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL+LK EKLRATR+VLS+YGNMSSACVLFILDEMR  S +EG +TTG
Sbjct  304   HPGGPAILDQVEIKLDLKEEKLRATRNVLSDYGNMSSACVLFILDEMRNKSLEEGKSTTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSV  1223
             EGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  364   EGLEWGVLFGFGPGLTVETVVLHSV  388



>gb|AFM36766.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/388 (85%), Positives = 368/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVT++E+RKAQRA GPATI+AIGT+ P NC++QSTYPDYYFR+TNSEH+VELK+KFKRMC
Sbjct  1     MVTIDEIRKAQRADGPATILAIGTANPPNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILK+NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIG+DP  ++ERP+F+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+ PDS GAIDGHLRE GLTFHLLKDVPG+ISK+IE+ L++AF+PLGI DWNSLFW
Sbjct  241   SAAQTLCPDSEGAIDGHLREAGLTFHLLKDVPGIISKNIERCLDDAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL+LK EK+RATR VLSEYGNMSSACV+FILDEMRK S+ +G  T
Sbjct  301   IAHPGGPAILDQVEEKLKLKEEKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETV LHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVALHSVA  388



>ref|XP_002303819.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE78798.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/388 (87%), Positives = 365/388 (94%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRK QRA+GPATIMAIGTS P NCVDQSTYPDYYFR+TNSEH  ELKEKFKRMC
Sbjct  1     MVTVDEVRKGQRAEGPATIMAIGTSNPPNCVDQSTYPDYYFRVTNSEHRAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRY+YLTE++LKENP++ AYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ 
Sbjct  61    EKSMIKKRYIYLTEDMLKENPDMRAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQS  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITA+ FRGP+D HLDSL+GQALFGDGAAA+IIGSDP   +E+PLF++V
Sbjct  181   NKGARVLVVCSEITAIIFRGPNDTHLDSLIGQALFGDGAAAIIIGSDPVVGVEKPLFEIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILP+S GAIDGHLRE GLTFHLLKDVPGLIS ++EKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPNSDGAIDGHLREAGLTFHLLKDVPGLISNNVEKSLTEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRK S+++GL +
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQS  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|ACX31605.1| chalcone synthase [Lilium hybrid cultivar]
Length=393

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/385 (86%), Positives = 363/385 (94%), Gaps = 0/385 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             TVEEVRKAQRAQGPAT++AIGT+TP N   QS YPDYYFRIT SEHL +LKEKFKRMC+K
Sbjct  4     TVEEVRKAQRAQGPATVLAIGTATPSNVFYQSDYPDYYFRITQSEHLTDLKEKFKRMCDK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMIKKRYM+L EEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  64    SMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHL+FCTTSGVDMPGADYQLTKLLGL+PS+ RFMMYQQGCFAGGTV+R AKDLAENN+
Sbjct  124   KITHLIFCTTSGVDMPGADYQLTKLLGLRPSINRFMMYQQGCFAGGTVLRFAKDLAENNR  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             GARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP+P +ER LFQ+VSA
Sbjct  184   GARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPEPSVERSLFQIVSA  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             +QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL +AF PLGI DWNS+FWIA
Sbjct  244   SQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVQAFAPLGITDWNSIFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL L+ +K+RATRHVLSEYGNMSSACVLFILDEMRKAS+++G  TTG
Sbjct  304   HPGGPAILDQVELKLALEKKKMRATRHVLSEYGNMSSACVLFILDEMRKASAEQGKATTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSV  1223
             EGL+WGVLFGFGPGLTVETVVLHS+
Sbjct  364   EGLDWGVLFGFGPGLTVETVVLHSL  388



>gb|ACX37403.1| chalcone synthase [Citrus maxima]
Length=391

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/387 (86%), Positives = 363/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC
Sbjct  1     MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DPD  +ERPL+QLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             S +QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL+EAF P+GI DW+S+FW
Sbjct  241   STSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWSSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ATR VLSEYGNMSSACVLFILDEMRK S++E   T
Sbjct  301   IAHPGGPAILDQVESKLGLKEEKLKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>sp|Q9AU10.1|PKS2_RUBID RecName: Full=Inactive polyketide synthase 2; Short=RiPKS2; AltName: 
Full=Inactive naringenin-chalcone synthase PKS2 [Rubus 
idaeus]
 gb|AAK15175.1|AF292368_1 aromatic polyketide synthase [Rubus idaeus]
Length=391

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/389 (87%), Positives = 363/389 (93%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTV+EVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1     MVTVDEVRKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHRTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQ 
Sbjct  61    DKSRIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQL  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVL VCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP PD+ERPLF+LV
Sbjct  181   NKGARVLAVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPDIERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHL EVGLTFHLLKDVPGLISK+IEKSLNEAF+PL I DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLHEVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL ATR++LSEYGNMSSACVL ILDE+R+ S   G  T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLLILDEVRRKSVANGHKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLTVETVVLHSV+A
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVAA  389



>gb|ABF59866.1| chalcone synthase [Lupinus luteus]
Length=390

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/389 (86%), Positives = 368/389 (95%), Gaps = 1/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+R AQ+AQGPATIMAIGT+TP NCVDQSTYPD+YFR+TNSEH  ELKEKFKRMC
Sbjct  1     MVSVEEIRNAQKAQGPATIMAIGTATPSNCVDQSTYPDFYFRVTNSEHKAELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTE+ILKENP+ICAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEDILKENPSICAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLG-LQPSVKRFMMYQQGCFAGGTVIRLAKDLAE  599
             KSKITHL+FCTTSGVDMPGADYQLTKLLG L+P VKR+MMYQQGCFAGGTV+RLAKDLAE
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGRLRPHVKRYMMYQQGCFAGGTVLRLAKDLAE  180

Query  600   NNKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQL  779
             NNKGARVLVVCSE+TAVTFRGPSD HLDSLVGQALFGDGAAALI+GSDP P++E+PLF+L
Sbjct  181   NNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPLFEL  240

Query  780   VSAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLF  959
             V  AQTI PDS GAIDGHLREVGLTFHLLKDVPG++SK+I+K+L EAF PL I+D+NS+F
Sbjct  241   VWTAQTIAPDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALVEAFNPLNINDYNSIF  300

Query  960   WIAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLN  1139
             WIAHPGGPAILDQVE KL LKPEK+RATRHVLSEYGNMSSACVLFILDEMR+ S ++GL 
Sbjct  301   WIAHPGGPAILDQVEAKLALKPEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLK  360

Query  1140  TTGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TTGEGLEWGVLFGFGPGLT+ETVVLHSV+
Sbjct  361   TTGEGLEWGVLFGFGPGLTIETVVLHSVA  389



>gb|ADZ45296.1| chalcone synthase 2 [Glycyrrhiza uralensis]
Length=390

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/386 (87%), Positives = 364/386 (94%), Gaps = 0/386 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             TV E+RKAQRA+GPAT++AIGT+TP NCV+QS+YPDYYFRITNSEH  ELKEKFKRMCEK
Sbjct  4     TVGEIRKAQRAEGPATVLAIGTATPPNCVEQSSYPDYYFRITNSEHKTELKEKFKRMCEK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMIKKRYM+LTEEILKENPNIC YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  64    SMIKKRYMHLTEEILKENPNICGYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHL+FCTTSGVDMPGADYQLTKLLGL+P VKR+MMYQQGCFAGGTV+RLAKDLAENNK
Sbjct  124   KITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV  
Sbjct  184   GARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEVEKPLFELVWT  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPL I D+NS+FWIA
Sbjct  244   AQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLNISDYNSIFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILDEMR+ S + GL TTG
Sbjct  304   HPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDEMRRKSKENGLATTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSVS  1226
             EGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  364   EGLEWGVLFGFGPGLTVETVVLHSVA  389



>ref|XP_003624524.1| Chalcone synthase [Medicago truncatula]
 gb|AES80742.1| chalcone and stilbene synthase family protein [Medicago truncatula]
Length=391

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/387 (86%), Positives = 364/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+RKAQR+ GPATI+A GT+TP +CV Q+ YPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1     MVTVEEIRKAQRSNGPATILAFGTATPSHCVTQAEYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM++TEE LKENPN+CAYMAPSLDARQD+VVVEVPKLGK+AA+KAI EWGQP
Sbjct  61    EKSMIKKRYMHITEEFLKENPNMCAYMAPSLDARQDLVVVEVPKLGKDAAKKAIAEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH+VFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHVVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NK ARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +ERP+F++V
Sbjct  181   NKNARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPDLTVERPIFEIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPG+ISK+IEKSL EAF P+GI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLVEAFAPIGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             +AHPGGPAILDQVEEKL LK EKLR+TRHVLSEYGNMSSACVLFILDEMRK S +EG  T
Sbjct  301   VAHPGGPAILDQVEEKLRLKEEKLRSTRHVLSEYGNMSSACVLFILDEMRKRSKEEGKIT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>sp|P19168.1|CHS3_SOYBN RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Glycine max]
 emb|CAA37909.1| naregenin-chalcone synthase [Glycine max]
Length=388

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/388 (87%), Positives = 366/388 (94%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+R AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHL EVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLGEVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVT  387



>ref|XP_003516867.1| PREDICTED: chalcone synthase 6-like [Glycine max]
Length=388

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/388 (87%), Positives = 366/388 (94%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNS+H+ ELKEKFKRMC
Sbjct  1     MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSDHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P  E+PLF+LV
Sbjct  181   NTGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVILGSDPLP-AEKPLFELV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+I+K+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIQKALVEAFQPLGIDDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLEWGVLFGFGPGLTVETVVLRSVT  387



>ref|XP_004493096.1| PREDICTED: chalcone synthase-like [Cicer arietinum]
Length=391

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/387 (86%), Positives = 361/387 (93%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+R AQR+ GPATI+A GT+TP NC+ Q+ YPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1     MVTVEEIRNAQRSNGPATILAFGTATPSNCITQADYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEE LKEN N+CAYMAPSLD RQDIVVVEVPKLGKEAA+KAI EWGQP
Sbjct  61    EKSMIKKRYMHLTEEFLKENTNMCAYMAPSLDVRQDIVVVEVPKLGKEAAKKAISEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NK ARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +ERP+F++V
Sbjct  181   NKNARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPDLTVERPIFEIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPG+ISK+IEKSL EAF P+GI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLVEAFSPIGITDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             +AHPGGPAILDQVEEKL LK +KLR+TRHVLSEYGNMSSACVLFILDE+RK S +EG NT
Sbjct  301   VAHPGGPAILDQVEEKLRLKEDKLRSTRHVLSEYGNMSSACVLFILDELRKKSKEEGKNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TG+G EWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGDGFEWGVLFGFGPGLTVETVVLHSV  387



>gb|AHL69646.1| chalcone synthase 1 [Phyllanthus emblica]
Length=390

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/387 (88%), Positives = 363/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA GPAT+MAIGT+ P NCVDQSTYPDYYFRITNSEH  E KEKF+RMC
Sbjct  1     MVTVEEVRKAQRASGPATVMAIGTAVPPNCVDQSTYPDYYFRITNSEHKTEPKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP+ICAYMAPSLDARQDIVVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPDICAYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+P VKR MMYQQGCFAGGTV+RLAKDLAE+
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLKPPVKRLMMYQQGCFAGGTVLRLAKDLAED  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NK ARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E+P+F+LV
Sbjct  181   NKAARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPMFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PL I+DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLNINDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKL+ATR VL+ YGNMSSACVLFI+DEMRK S + GL T
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLKATRQVLAGYGNMSSACVLFIMDEMRKKSVEGGLQT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>gb|ACM62742.1| chalcone synthase [Garcinia mangostana]
Length=394

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/385 (88%), Positives = 360/385 (94%), Gaps = 0/385 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             TVEEVR AQRAQGPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH  ELKEKF+RMCEK
Sbjct  4     TVEEVRNAQRAQGPATVLAIGTATPSNCVLQAEYPDYYFRITNSEHKTELKEKFRRMCEK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMIKKRYM+LTEEILKENP +C Y +PSLDARQDIVVVE+PKLGKEAA KAIKEWGQPKS
Sbjct  64    SMIKKRYMHLTEEILKENPKMCDYWSPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHLVFCTTSGVDMPGADYQLTKLLGL+P VKR MMYQQGCFAGGTV+RLAKDLAENNK
Sbjct  124   KITHLVFCTTSGVDMPGADYQLTKLLGLRPHVKRLMMYQQGCFAGGTVLRLAKDLAENNK  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             GARVLV+CSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDPDP +ERPLFQ+VSA
Sbjct  184   GARVLVICSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPDPAIERPLFQIVSA  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNSLFWIA
Sbjct  244   AQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL LK EKLRATRHVLSE+GNMSSACVLFILDEMRK + +EG  TTG
Sbjct  304   HPGGPAILDQVEVKLGLKEEKLRATRHVLSEFGNMSSACVLFILDEMRKKALEEGKPTTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSV  1223
             EGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  364   EGLDWGVLFGFGPGLTVETVVLHSV  388



>emb|CAC19808.1| chalcone synthase [Humulus lupulus]
Length=389

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/387 (87%), Positives = 365/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATI+AIGT+TP NC+ QS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MVTVEEVRKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
              KSMI+KRYM+LTEEILKENPN+CAY APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    GKSMIRKRYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KS+ITH+VFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSEITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLV QALFGDG+AALIIG+DP P++E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPNDTHLDSLVAQALFGDGSAALIIGADPIPEIEKPIFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+PLGI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             I HPGGPAILDQVE KL LKPEKLRATRHVL EYGNMSSACVLFILDEMR+  +++G+ T
Sbjct  301   ITHPGGPAILDQVESKLGLKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGVKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>gb|AFU90824.1| chalcone synthase [Epimedium sagittatum]
Length=393

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/388 (87%), Positives = 362/388 (93%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+R AQRA+GPAT++AIGTSTP NCV Q+ YPDYYFRIT SEH+ +LKEKFKRMC
Sbjct  1     MVSVEEIRNAQRAKGPATVLAIGTSTPSNCVTQADYPDYYFRITKSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KS IKKRYM++TEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSQIKKRYMHITEEILKENPSMCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DPD  +ERPLF+LV
Sbjct  181   NAGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVILGADPDLSVERPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNSLFW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGITDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLRATRHVLSEYGNMSSACVLFILDEMR+ S +EG  T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRRKSEEEGKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
              GEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   FGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>ref|XP_003531223.1| PREDICTED: chalcone synthase 1 [Glycine max]
 gb|ABQ63059.1| chalcone synthase 9 [Glycine max]
Length=388

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/388 (87%), Positives = 366/388 (94%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VE +RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEAIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKK YMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKLYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQL+
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLI  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVT  387



>gb|ADZ45294.1| chalcone synthase 3 [Glycyrrhiza uralensis]
Length=390

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/386 (87%), Positives = 364/386 (94%), Gaps = 0/386 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             TV E+RKAQRA+GPAT++AIGT+TP NCV+QS+YPDYYFRITNSEH  ELKEKFKRMCEK
Sbjct  4     TVGEIRKAQRAEGPATVLAIGTATPPNCVEQSSYPDYYFRITNSEHKTELKEKFKRMCEK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMIK+RYM+LTEEILKENPNIC YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  64    SMIKRRYMHLTEEILKENPNICEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHL+FCTTSGVDMPGADYQLTKLLGL+P VKR+MMYQQGCFAGGTV+RLAKDLAENNK
Sbjct  124   KITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV  
Sbjct  184   GARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEVEKPLFELVWT  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPL I D+NS+FWIA
Sbjct  244   AQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLNISDYNSIFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILDEMR+ S + GL TTG
Sbjct  304   HPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDEMRRKSKENGLATTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSVS  1226
             EGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  364   EGLEWGVLFGFGPGLTVETVVLHSVA  389



>gb|ADB44077.1| chalcone synthase [Litchi chinensis]
Length=393

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/387 (86%), Positives = 364/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M ++E++RKAQRA+GPAT++AIGT+TP NCV+Q+ YPDYYFRIT  EH+ ELK KF+ MC
Sbjct  1     MASIEQIRKAQRAEGPATVLAIGTATPSNCVNQADYPDYYFRITKCEHMTELKAKFQLMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYM+LTE+ILKENPN+CAYMAPS+DARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    DKSMIKKRYMHLTEDILKENPNMCAYMAPSIDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DPD  +ERPLFQ+V
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPDTSIERPLFQIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI+DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFTPIGINDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKLR+TRHVLSEYGNMSSACVLFILDEMR+   +EG  T
Sbjct  301   IAHPGGPAILDQVEAKLGLKEEKLRSTRHVLSEYGNMSSACVLFILDEMRRKCLEEGKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSV  387



>sp|P17957.1|CHS2_SOYBN RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Glycine max]
 emb|CAA36317.1| chalcone synthase [Glycine max]
Length=388

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/388 (87%), Positives = 367/388 (95%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1     MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQLV
Sbjct  181   NKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLP-VEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPLGI D+NS+F 
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFR  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGL+WGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLDWGVLFGFGPGLTVETVVLRSVT  387



>ref|XP_008797107.1| PREDICTED: chalcone synthase 1 [Phoenix dactylifera]
Length=392

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/387 (86%), Positives = 363/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M  VEE+R +QRA+GPATI+AIGT+TP N V Q+ YPDYYFRIT SEHL +LKEKFKRMC
Sbjct  1     MAKVEEIRSSQRAEGPATILAIGTATPANVVYQADYPDYYFRITKSEHLTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI+KRYM+L EEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIRKRYMHLNEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KS+ITHLVFCTTSGVDMPGADYQLTKLLGL+PSV R MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSRITHLVFCTTSGVDMPGADYQLTKLLGLRPSVNRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+IIG+DPDP +ERPLFQLV
Sbjct  181   NRGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIIGADPDPAIERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA+QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK++EKSL EAF PLGI DWNS+FW
Sbjct  241   SASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLAEAFAPLGISDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL L+ EK+RATRHVLSEYGNMSSACVLFILDEMR+ S+++G  T
Sbjct  301   IAHPGGPAILDQVEAKLGLEKEKMRATRHVLSEYGNMSSACVLFILDEMRRRSAEDGKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHS+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSL  387



>gb|AFM36770.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/388 (85%), Positives = 367/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVT++E+RKAQRA GPATI+AIGT+ P NC++QSTYPDYYFR+T SEH+VELK+KFKRMC
Sbjct  1     MVTIDEIRKAQRADGPATILAIGTANPPNCIEQSTYPDYYFRVTKSEHMVELKQKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEIL++NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILEQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIG+DP  ++ERP+F+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+ PDS GAIDGHLRE GLTFHLLKDVPG+ISK+IE+ L++AF+PLGI DWNSLFW
Sbjct  241   SAAQTLCPDSEGAIDGHLREAGLTFHLLKDVPGIISKNIERCLDDAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL+LK  K+RATR VLSEYGNMSSACV+FILDEMRK S+ +G  T
Sbjct  301   IAHPGGPAILDQVEEKLKLKEGKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>gb|AFM36769.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/388 (85%), Positives = 368/388 (95%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVT++E+RKAQRA GPATI+AIGT+ P NC++QSTYPDYYFR+TNSEH+VEL++KFKRMC
Sbjct  1     MVTIDEIRKAQRADGPATILAIGTANPPNCIEQSTYPDYYFRVTNSEHMVELEQKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYMYLTEEILK+NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMYLTEEILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N+GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+IIG+DP  ++ERP+F+LV
Sbjct  181   NRGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAMIIGADPVENVERPIFKLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+ PDS GAIDGHLRE GLTFHLLKDVPG+ISK+IE+ L++AF+PLGI DWNSLFW
Sbjct  241   SAAQTLCPDSEGAIDGHLREAGLTFHLLKDVPGIISKNIERCLDDAFKPLGISDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL+LK EK+RATR VLSEYGNMSSACV+FILDEMRK S+ +G   
Sbjct  301   IAHPGGPAILDQVEEKLKLKEEKMRATREVLSEYGNMSSACVVFILDEMRKRSAAQGKGA  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVA  388



>dbj|BAA19548.1| chalcone synthase [Perilla frutescens]
Length=379

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/379 (88%), Positives = 364/379 (96%), Gaps = 0/379 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVE++R+AQRA+GPAT++AIGT+TP+NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1     MVTVEDIRRAQRAEGPATVLAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI+KRYM+LTEE LKENPN+ AYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61    EKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKRFMMYQQGC+AGGTV+R+AKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCYAGGTVLRMAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+I+GSDP   +ERPLFQLV
Sbjct  181   NAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF PLGI DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGISDWNSVFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEKLR+TRHVL EYGNMSSACVLFILDEMRK+S+KEG+++
Sbjct  301   IAHPGGPAILDQVEAKLGLKPEKLRSTRHVLGEYGNMSSACVLFILDEMRKSSAKEGMSS  360

Query  1143  TGEGLEWGVLFGFGPGLTV  1199
             TGEGL+WGVLFGFGPGLTV
Sbjct  361   TGEGLDWGVLFGFGPGLTV  379



>ref|XP_002450870.1| hypothetical protein SORBIDRAFT_05g020160 [Sorghum bicolor]
 sp|Q9SBL5.1|CHS4_SORBI RecName: Full=Chalcone synthase 4; AltName: Full=Naringenin-chalcone 
synthase 4 [Sorghum bicolor]
 gb|AAD41876.1|AF152551_1 chalcone synthase 4 [Sorghum bicolor]
 gb|EES09858.1| hypothetical protein SORBIDRAFT_05g020160 [Sorghum bicolor]
Length=401

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/386 (85%), Positives = 364/386 (94%), Gaps = 0/386 (0%)
 Frame = +3

Query  66    VTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCE  245
             VTVEEVRKAQRA GPAT++AIGT+TP NCV Q+ YPDYYFRIT SEH+ ELKEKFKRMC+
Sbjct  6     VTVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCD  65

Query  246   KSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPK  425
             KS I+KRYM+LTEE L ENPN+CAYMAPSLDARQDIVVVEVPKLGK AAQKAIKEWGQPK
Sbjct  66    KSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPK  125

Query  426   SKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENN  605
             SKITHLVFCTTSGVDMPGADYQLTK+LGL+PSVKR MMYQQGCFAGGTV+R+AKDLAENN
Sbjct  126   SKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENN  185

Query  606   KGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVS  785
             +GARVLVVCSEITAVTFRGPS++HLDS+VGQALFGDGAAA+I+G+DPD  +ERPLFQLVS
Sbjct  186   RGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQLVS  245

Query  786   AAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWI  965
             A+QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IE+SL EAF+PLGI D+NS+FW+
Sbjct  246   ASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLEEAFKPLGITDYNSIFWV  305

Query  966   AHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTT  1145
             AHPGGPAILDQVE K+ LK E++RATRHVLSEYGNMSSACVLFILDEMRK S+++G  TT
Sbjct  306   AHPGGPAILDQVEAKVGLKKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATT  365

Query  1146  GEGLEWGVLFGFGPGLTVETVVLHSV  1223
             GEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  366   GEGLDWGVLFGFGPGLTVETVVLHSV  391



>gb|AFW98276.1| chalone synthase [Senna tora]
Length=390

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/387 (87%), Positives = 365/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+V E+RKAQRA+GPAT+MAIGT+TP NCVDQS YPDYYFRIT SEH+ ELKEKFKRMC
Sbjct  1     MVSVSEIRKAQRAEGPATVMAIGTATPPNCVDQSEYPDYYFRITQSEHMTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI KRYM++TE+ILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMITKRYMHVTEDILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+P VKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P++E PLF+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPEIEEPLFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK IEK+L EAFQPLGI D+NS+FW
Sbjct  241   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKDIEKALVEAFQPLGISDYNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KLELKPEK+RATRHVLSEYGNMSSACVLFILDEMR+ S ++GL T
Sbjct  301   IAHPGGPAILDQVEAKLELKPEKMRATRHVLSEYGNMSSACVLFILDEMRRKSIEDGLKT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGL+WGVLFGFGPGLTVETVVL SV
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLRSV  387



>gb|AFA55180.1| chalcone synthase [Acacia confusa]
Length=389

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/387 (86%), Positives = 363/387 (94%), Gaps = 0/387 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEE+R AQR++GPATI+A GT+TP NCV Q+ YPDYYFRIT SEH+ +LKEKFKRMC
Sbjct  1     MVTVEEIRNAQRSRGPATILAFGTATPSNCVLQADYPDYYFRITQSEHMTDLKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMIKKRYM+LTEE+LKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    EKSMIKKRYMHLTEELLKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+IIG+DPD  +ERP+F++V
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPDTSVERPIFEMV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQTILPDS GAIDGHLREVGLTFHLLKDVPG+ISK+IEKSL EAF P+GI+DWNS+FW
Sbjct  241   SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLVEAFTPIGINDWNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             +AHPGGPAILDQVE KL LK EKL  TRH+LSEYG+MSSACV+FILDE+R+ S KEG  T
Sbjct  301   VAHPGGPAILDQVEAKLGLKEEKLATTRHILSEYGDMSSACVIFILDELRRRSVKEGKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSV  1223
             TGEGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSV  387



>ref|XP_010028921.1| PREDICTED: chalcone synthase 3 [Eucalyptus grandis]
Length=396

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/385 (86%), Positives = 363/385 (94%), Gaps = 0/385 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             +VEE+RKAQRA+GPAT++AIGT+TP NC+ Q+ YPDYYFRITNSEH+ +LKEKFKRMC+K
Sbjct  6     SVEEIRKAQRAEGPATVLAIGTATPNNCISQADYPDYYFRITNSEHMTDLKEKFKRMCDK  65

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMIKKRYM+LTE+ LKENP +CAYMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQ KS
Sbjct  66    SMIKKRYMHLTEDFLKENPAMCAYMANSLDARQDVVVVEVPKLGKEAAAKAIKEWGQSKS  125

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAENN+
Sbjct  126   KITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNR  185

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+G+DPD  +ERPL+QLVSA
Sbjct  186   GARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPDTAVERPLYQLVSA  245

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI DWNSLFWIA
Sbjct  246   AQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFSPIGISDWNSLFWIA  305

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL LK EK+RATRHVLSEYGNMSSACVLFILDEMR+ S++EG  TTG
Sbjct  306   HPGGPAILDQVEAKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAEEGRPTTG  365

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSV  1223
             EGL+WGVLFGFGPGLTVETVVLHSV
Sbjct  366   EGLDWGVLFGFGPGLTVETVVLHSV  390



>gb|ADZ45298.1| chalcone synthase 1 [Glycyrrhiza uralensis]
Length=390

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/386 (87%), Positives = 363/386 (94%), Gaps = 0/386 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             TV E+RKAQRA+GPAT++AIGT+TP NCV+QS+YPDYYFRITNSEH  ELKEKFKRMCEK
Sbjct  4     TVGEIRKAQRAEGPATVLAIGTATPPNCVEQSSYPDYYFRITNSEHKTELKEKFKRMCEK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMI KRYM+LTEEILKENPNIC YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  64    SMINKRYMHLTEEILKENPNICEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHL+FCTTSGVDMPGADYQLTKLLGL+P VKR+MMYQQGCFAGGTV+RLAKDLAENNK
Sbjct  124   KITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+I+GSDP P++E+PLF+LV  
Sbjct  184   GARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEVEKPLFELVWT  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEK+L EAFQPL I D+NS+FWIA
Sbjct  244   AQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLNISDYNSIFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILDEMR+ S + GL TTG
Sbjct  304   HPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDEMRRKSKENGLATTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSVS  1226
             EGLEWGVLFGFGPGLTVETVVLHSV+
Sbjct  364   EGLEWGVLFGFGPGLTVETVVLHSVA  389



>dbj|BAJ14517.1| chalcone synthase type 3 [Dahlia pinnata]
Length=389

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/388 (86%), Positives = 362/388 (93%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+++E R AQRA GPA I+AIGT+TP NCV QS YPDYYFR+T SEH  +LKEKF RMC
Sbjct  1     MVSIQEFRNAQRADGPAAILAIGTATPPNCVLQSEYPDYYFRVTKSEHKKDLKEKFTRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI+KRYMYLTEEILKE PNICAYMAPSLD RQDIVVVEVPKLGKEAA +AIKEWGQP
Sbjct  61    EKSMIRKRYMYLTEEILKEKPNICAYMAPSLDERQDIVVVEVPKLGKEAATRAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRFSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP D HLDSLVGQALFGDGAAA+I+GSDP PD+E+PLF+++
Sbjct  181   NKGARVLVVCSEITAVTFRGPDDTHLDSLVGQALFGDGAAAIIVGSDPLPDVEKPLFEII  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA QTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIE SL +AFQPLGI+DWNSLFW
Sbjct  241   SAGQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIETSLVDAFQPLGINDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL L P+KL+A+RHVLSEYGNMSSACVLFIL+EMR +S+ +G NT
Sbjct  301   IAHPGGPAILDQVEEKLALTPDKLQASRHVLSEYGNMSSACVLFILNEMRHSSATDGFNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVS  388



>gb|AHC07953.1| chalcone synthase [Indosasa hispida]
Length=398

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/386 (84%), Positives = 363/386 (94%), Gaps = 0/386 (0%)
 Frame = +3

Query  66    VTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCE  245
             VTVEEVR+AQRA+GPAT++AIGT+TP NCV Q+ YP+YYFRIT SEHL ELKEKFKRMC+
Sbjct  5     VTVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPEYYFRITKSEHLAELKEKFKRMCD  64

Query  246   KSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPK  425
             KSMI+KRYM+LTEEIL+ENPN+CAYMAPSLDARQDIVVVEVPKLGK AAQKAIKEWGQP+
Sbjct  65    KSMIRKRYMHLTEEILQENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPR  124

Query  426   SKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENN  605
             SKITHLVFCTTSGVDMPGADYQL KLLGL+PSV R MMYQQGCFAGGTV+R+AKDLAENN
Sbjct  125   SKITHLVFCTTSGVDMPGADYQLAKLLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENN  184

Query  606   KGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVS  785
             +GARVLVVCSEITAVTFRGPS++HLDSLVGQALFGDGAAA+IIG+DPD  +ERPLFQLVS
Sbjct  185   RGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIIGADPDESVERPLFQLVS  244

Query  786   AAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWI  965
             A+QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IE++L +AF PLGI DWNS+FW+
Sbjct  245   ASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALVDAFAPLGIDDWNSIFWV  304

Query  966   AHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTT  1145
             AHPGGPAILDQVE K+ L   ++RATRHVLSEYGNMSSACVLFILDEMRK S+++G  TT
Sbjct  305   AHPGGPAILDQVEAKVSLDKARMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGHATT  364

Query  1146  GEGLEWGVLFGFGPGLTVETVVLHSV  1223
             GEG++WGVLFGFGPGLTVETVVLHSV
Sbjct  365   GEGMDWGVLFGFGPGLTVETVVLHSV  390



>gb|AAO32821.1| chalcone synthase [Arachis hypogaea]
 gb|ABZ80827.1| chalcone synthase [Arachis hypogaea]
Length=389

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/388 (85%), Positives = 365/388 (94%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV V E+RKAQRA+GPATIMAIGT+TPQNCVDQSTYPDYYFRITNS+H+ ELKEKF+RMC
Sbjct  1     MVNVSEIRKAQRAEGPATIMAIGTATPQNCVDQSTYPDYYFRITNSQHMTELKEKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLTEEILKENPNMCKYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGPS+ HLDSLVGQALFGDGAAALI+GSDP P +E+P+F+LV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSETHLDSLVGQALFGDGAAALIVGSDPLPQIEKPVFELV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQT+ PDS GAIDGHLREVGLTFHLLKDVPG++SK+I K+L EAF PLGI D+NS+FW
Sbjct  241   WTAQTLAPDSEGAIDGHLREVGLTFHLLKDVPGIVSKNINKALTEAFDPLGISDYNSIFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE+KL+LKP KLRATR VLS+YGNMSSACVLFILD MR  S ++GL T
Sbjct  301   IAHPGGPAILDQVEDKLKLKPHKLRATRDVLSDYGNMSSACVLFILDHMRNKSLQQGLQT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLT+ETVVLHSV+
Sbjct  361   TGEGLEWGVLFGFGPGLTIETVVLHSVA  388



>ref|XP_002321081.1| chalcone synthase family protein [Populus trichocarpa]
 gb|ABD24226.1| chalcone synthase [Populus trichocarpa]
 gb|ABK95168.1| unknown [Populus trichocarpa]
 gb|EEE99396.1| chalcone synthase family protein [Populus trichocarpa]
Length=396

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/385 (86%), Positives = 363/385 (94%), Gaps = 0/385 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             ++EE+RKAQRA GPATI+AIG +TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC+K
Sbjct  4     SIEEIRKAQRASGPATILAIGKATPANCVSQADYPDYYFRITNSEHMTELKEKFKRMCDK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMIKKRYM+LTEEILKEN ++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  64    SMIKKRYMHLTEEILKENSSMCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAENNK
Sbjct  124   KITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNK  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
             G+RVLVVCSEITAVTFRGPSD HLDS+VGQALFGDGAAA+I+G+DPD  +ERPLFQ+VSA
Sbjct  184   GSRVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAVIVGADPDTSIERPLFQIVSA  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF P+GI+DWNS+FWIA
Sbjct  244   AQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFAPIGINDWNSIFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVE KL+LK EKLRATR+VLS+YGNMSSACVLFILDEMR  S +EG +TTG
Sbjct  304   HPGGPAILDQVEIKLDLKEEKLRATRNVLSDYGNMSSACVLFILDEMRNKSLEEGKSTTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSV  1223
             EGLEWGVLFGFGPGLTVETVVLHSV
Sbjct  364   EGLEWGVLFGFGPGLTVETVVLHSV  388



>gb|AAK39111.1|AF358655_1 chalcone synthase [Ipomoea purpurea]
 gb|AAK39115.1|AF358659_1 chalcone synthase [Ipomoea purpurea]
 dbj|BAA20387.1| chalcone synthase [Ipomoea purpurea]
 dbj|BAA36224.1| chalcone synthase [Ipomoea purpurea]
Length=388

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/389 (86%), Positives = 366/389 (94%), Gaps = 1/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT S+H+ +LK+KF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI KRYM+LTEEILKENP+ C YMAPSLDARQDIVVVEVPKLGKEAAQ AIKEWGQP
Sbjct  61    DKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH++FCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEIT VTFRGP++ HLDSLVGQALFGDGAAA+I+GSDP P +E+PLFQLV
Sbjct  181   NKGARVLVVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP-VEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+ PDS GAIDGHLREVGLTFHLLKDVP ++S +IEK L+EAF PLGI DWNS+FW
Sbjct  240   SAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE+KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASS +GL T
Sbjct  300   IAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLT+ETVVLHSV A
Sbjct  360   TGEGLEWGVLFGFGPGLTIETVVLHSVPA  388



>sp|O22045.1|CHSD_IPONI RecName: Full=Chalcone synthase D; AltName: Full=Naringenin-chalcone 
synthase D; Short=CHS-D [Ipomoea nil]
 dbj|BAA21787.1| chalcone synthase [Ipomoea nil]
 dbj|BAA87336.1| chalcone synthase [Ipomoea nil]
 dbj|BAH28850.1| chalcone synthase [Ipomoea nil]
 dbj|BAH28851.1| chalcone synthase [Ipomoea nil]
Length=388

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/389 (86%), Positives = 365/389 (94%), Gaps = 1/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MVTVEEVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNS+H+ +LK+KF+RMC
Sbjct  1     MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI KRYM+LTEEILKENP+ C YMAPSLDARQDIVVVEVPKLGKEAAQ AIKEWGQP
Sbjct  61    DKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITH++FCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+R+AKDLAEN
Sbjct  121   KSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NK ARVLVVCSEIT VTFRGP++ HLDSLVGQALFGDGAAA+I+GSDP P  E+PLFQLV
Sbjct  181   NKAARVLVVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP-AEKPLFQLV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SAAQT+ PDS GAIDGHLREVGLTFHLLKDVP ++S +IEK L+EAF PLGI DWNS+FW
Sbjct  240   SAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE+KL LKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASS +GL T
Sbjct  300   IAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGLEWGVLFGFGPGLT+ETVVLHSV A
Sbjct  360   TGEGLEWGVLFGFGPGLTIETVVLHSVPA  388



>ref|XP_003533807.1| PREDICTED: chalcone synthase 6 [Glycine max]
 sp|P30080.1|CHS6_SOYBN RecName: Full=Chalcone synthase 6; AltName: Full=Naringenin-chalcone 
synthase 6 [Glycine max]
 gb|AAA33951.1| chalcone synthase [Glycine max]
Length=388

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/388 (87%), Positives = 365/388 (94%), Gaps = 1/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNS+H+ ELKEKFKRMC
Sbjct  1     MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSDHMNELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMIKKRYMYL EEILKENP++CAYM PSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61    DKSMIKKRYMYLNEEILKENPSVCAYMEPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHL+FCTTSGVDMPGADYQLTKLLGL+PSVKR+MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             N GARVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+GSDP P  E+PLF+LV
Sbjct  181   NTGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLP-AEKPLFELV  239

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
               AQTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+I+K+L EAFQPLGI D+NS+FW
Sbjct  240   WTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIQKALVEAFQPLGIDDYNSIFW  299

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LKPEK+ ATRHVLSEYGNMSSACVLFILD+MRK S + GL T
Sbjct  300   IAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGT  359

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVL SV+
Sbjct  360   TGEGLEWGVLFGFGPGLTVETVVLRSVT  387



>gb|AEK70334.1| chalcone synthase [Paeonia lactiflora]
Length=393

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/389 (86%), Positives = 361/389 (93%), Gaps = 0/389 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             M +VEE+R AQRAQGPATI+AIGT+TP +C++Q+ YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1     MASVEEIRNAQRAQGPATILAIGTATPAHCINQAEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             +KSMI KRYMYLTEEILKENPN+C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61    DKSMINKRYMYLTEEILKENPNMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+PSVKR MMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKG RVLVVCSEITAVTFRGPSD HLDSLVGQALFGDGAAA+I+G+DPD  +ERPLFQ+V
Sbjct  181   NKGPRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPDVKIERPLFQIV  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL EAF+P+GI+DWNS+ W
Sbjct  241   SAGQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPIGINDWNSILW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVE KL LK EKL+ TRHVLSEYGNMSSACVLFILDE RK S +EG  T
Sbjct  301   IAHPGGPAILDQVELKLGLKEEKLKNTRHVLSEYGNMSSACVLFILDETRKRSLEEGKAT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVSA  1229
             TGEGL+WGVLFGFGPGLTVETVVLHSV A
Sbjct  361   TGEGLDWGVLFGFGPGLTVETVVLHSVPA  389



>dbj|BAJ14516.1| chalcone synthase type 2 [Dahlia pinnata]
 dbj|BAK08887.1| chalcone synthase 1 [Dahlia pinnata]
Length=389

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/388 (86%), Positives = 361/388 (93%), Gaps = 0/388 (0%)
 Frame = +3

Query  63    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  242
             MV+++E R AQRA GPA I+AIGT+TP NCV QS YPDYYFR+T SEH  +LKEKF RMC
Sbjct  1     MVSIQEFRNAQRADGPAAILAIGTATPPNCVLQSEYPDYYFRVTKSEHKKDLKEKFTRMC  60

Query  243   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  422
             EKSMI+KRYMYLTEEILKE PNICAYMAPSLD RQDIVVVEVPKLGKEAA +AIKEWGQP
Sbjct  61    EKSMIRKRYMYLTEEILKEKPNICAYMAPSLDERQDIVVVEVPKLGKEAATRAIKEWGQP  120

Query  423   KSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAEN  602
             KSKITHLVFCTTSGVDMPGADYQLTKLLGL+ SVKRFMMYQQGCFAGGTV+RLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAEN  180

Query  603   NKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLV  782
             NKGARVLVVCSEITAVTFRGP + HLDSLVGQALFGDGAAA+I+GSDP PD+E+PLF ++
Sbjct  181   NKGARVLVVCSEITAVTFRGPDNTHLDSLVGQALFGDGAAAIIVGSDPLPDVEKPLFDII  240

Query  783   SAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFW  962
             SA QTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIE SL +AFQPLGI+DWNSLFW
Sbjct  241   SAGQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIETSLVDAFQPLGINDWNSLFW  300

Query  963   IAHPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNT  1142
             IAHPGGPAILDQVEEKL L P+KL+A+RHVLSEYGNMSSACVLFIL+EMR +S+ +G NT
Sbjct  301   IAHPGGPAILDQVEEKLALTPDKLQASRHVLSEYGNMSSACVLFILNEMRHSSATDGFNT  360

Query  1143  TGEGLEWGVLFGFGPGLTVETVVLHSVS  1226
             TGEGLEWGVLFGFGPGLTVETVVLHSVS
Sbjct  361   TGEGLEWGVLFGFGPGLTVETVVLHSVS  388



>gb|ADK78881.1| chalcone synthase [Lilium hybrid cultivar]
Length=393

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/385 (86%), Positives = 364/385 (95%), Gaps = 0/385 (0%)
 Frame = +3

Query  69    TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  248
             TVEEVRKAQRAQGPAT++AIGT+TP N + QS YPDYYFRIT SEH+ +LKEKFKRMC+K
Sbjct  4     TVEEVRKAQRAQGPATVLAIGTATPSNIIYQSDYPDYYFRITESEHMTDLKEKFKRMCDK  63

Query  249   SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  428
             SMI+KRYM+LTE ILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  64    SMIRKRYMHLTEVILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKS  123

Query  429   KITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK  608
             KITHLVFCTTSGVD PGADYQLTKLLGL+PSV R MMYQQGCFAGGTV+RLAKDLAENNK
Sbjct  124   KITHLVFCTTSGVDTPGADYQLTKLLGLRPSVNRLMMYQQGCFAGGTVLRLAKDLAENNK  183

Query  609   GARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSA  788
              ARVLVVCSEITAVTFRGP+D+HLDSLVGQALFGDGAAA+IIG+DPD  +ERPLFQLVSA
Sbjct  184   SARVLVVCSEITAVTFRGPNDSHLDSLVGQALFGDGAAAIIIGADPDLAVERPLFQLVSA  243

Query  789   AQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIA  968
             +QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL  AFQPLGI DWNS+FWIA
Sbjct  244   SQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTGAFQPLGISDWNSIFWIA  303

Query  969   HPGGPAILDQVeeklelkpeklRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG  1148
             HPGGPAILDQVEE+L LK EK++ATRHVLSEYGNMSSACVLFILD+MRKAS+++G+ TTG
Sbjct  304   HPGGPAILDQVEERLALKKEKMKATRHVLSEYGNMSSACVLFILDQMRKASAEQGMATTG  363

Query  1149  EGLEWGVLFGFGPGLTVETVVLHSV  1223
             EGL+WGVLFGFGPGLTVETVVLHS+
Sbjct  364   EGLDWGVLFGFGPGLTVETVVLHSL  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4076304488165