BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79187_g1_i1 len=1276 path=[1:0-1275]

Length=1276
                                                                      Score     E

ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                       466   9e-160   
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       458   9e-157   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       458   1e-156   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                457   2e-156   
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      455   1e-155   
gb|KDP45728.1|  hypothetical protein JCGZ_17335                         455   1e-155   
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      454   5e-155   
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            454   6e-155   
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       453   7e-155   
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       453   8e-155   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            452   1e-154   
gb|ACM47317.1|  peroxidase                                              452   2e-154   Capsicum annuum
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       451   3e-154   
gb|KEH34419.1|  anionic peroxidase swpb3 protein                        451   7e-154   
gb|KHG09190.1|  Peroxidase 4                                            451   7e-154   
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                       449   2e-153   
dbj|BAA82306.1|  peroxidase                                             449   4e-153   Nicotiana tabacum [American tobacco]
ref|XP_011080738.1|  PREDICTED: peroxidase 4-like                       449   4e-153   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       449   5e-153   
ref|XP_007205551.1|  hypothetical protein PRUPE_ppa008607mg             448   6e-153   
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            448   7e-153   Vitis vinifera
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             448   8e-153   
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           447   1e-152   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       447   2e-152   
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       446   4e-152   
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            446   7e-152   Vitis vinifera
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       445   1e-151   
ref|XP_002319968.2|  peroxidase family protein                          445   1e-151   Populus trichocarpa [western balsam poplar]
emb|CDP04065.1|  unnamed protein product                                443   4e-151   
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                       444   5e-151   
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      442   2e-150   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       442   2e-150   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      441   3e-150   
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       440   1e-149   
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                       439   2e-149   
ref|XP_007011229.1|  Peroxidase superfamily protein                     439   2e-149   
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       439   3e-149   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             439   3e-149   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      439   4e-149   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         439   4e-149   
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                438   5e-149   
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       438   5e-149   
gb|KHG18057.1|  Peroxidase 52 -like protein                             438   6e-149   
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      438   8e-149   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           437   1e-148   
ref|XP_008244108.1|  PREDICTED: peroxidase 4                            437   1e-148   
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      437   2e-148   
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       437   3e-148   
gb|ABV24960.2|  putative secretory peroxidase                           436   4e-148   Catharanthus roseus [chatas]
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            436   5e-148   
ref|XP_003538328.1|  PREDICTED: peroxidase 4-like                       436   5e-148   
gb|KHN46282.1|  Peroxidase 4                                            436   6e-148   
gb|AAP76387.1|  class III peroxidase                                    436   7e-148   Gossypium hirsutum [American cotton]
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      435   1e-147   
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       435   1e-147   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                       434   1e-147   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             434   3e-147   
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           434   3e-147   
gb|AAR31108.1|  peroxidase precursor                                    434   4e-147   Quercus suber [cork oak]
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       433   5e-147   
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      433   6e-147   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      433   6e-147   
gb|ACU17608.1|  unknown                                                 433   7e-147   Glycine max [soybeans]
ref|NP_196153.1|  peroxidase 52                                         433   8e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      432   1e-146   
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             432   1e-146   
emb|CDP13933.1|  unnamed protein product                                432   2e-146   
gb|AAL93151.1|AF485265_1  class III peroxidase                          431   3e-146   Gossypium hirsutum [American cotton]
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      431   3e-146   
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                       431   4e-146   
gb|AAP42508.1|  anionic peroxidase swpb3                                431   5e-146   Ipomoea batatas [batate]
ref|XP_010087166.1|  Peroxidase 4                                       431   6e-146   
ref|XP_003615995.1|  Peroxidase                                         431   7e-146   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      430   8e-146   
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       430   8e-146   
gb|ACU24215.1|  unknown                                                 430   1e-145   Glycine max [soybeans]
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    430   1e-145   
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              429   2e-145   
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       429   2e-145   
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           429   2e-145   
gb|AFK45898.1|  unknown                                                 429   3e-145   
emb|CAD67478.1|  peroxidase                                             428   3e-145   Asparagus officinalis
ref|XP_010685964.1|  PREDICTED: peroxidase 4-like                       428   5e-145   
gb|AAR31106.1|  peroxidase precursor                                    428   5e-145   Quercus suber [cork oak]
ref|XP_011080818.1|  PREDICTED: uncharacterized protein LOC105163979    441   6e-145   
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     427   8e-145   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  427   9e-145   Ricinus communis
ref|XP_010543687.1|  PREDICTED: peroxidase 52                           427   1e-144   
gb|ADN96693.1|  peroxidase 6                                            427   1e-144   
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                       426   3e-144   
gb|AAB48184.1|  peroxidase precursor                                    425   1e-143   Linum usitatissimum
ref|XP_002319967.2|  hypothetical protein POPTR_0013s15240g             425   1e-143   Populus trichocarpa [western balsam poplar]
emb|CDX98835.1|  BnaC09g50000D                                          424   2e-143   
gb|KHN44724.1|  Peroxidase 4                                            424   2e-143   
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    424   3e-143   
gb|AFK41406.1|  unknown                                                 424   3e-143   
gb|ACU23245.1|  unknown                                                 424   3e-143   Glycine max [soybeans]
emb|CAD67479.1|  peroxidase                                             423   5e-143   Asparagus officinalis
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             422   9e-143   
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    423   1e-142   
ref|XP_007017044.1|  Peroxidase 68                                      431   2e-142   
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                      421   3e-142   
gb|AAX44001.2|  putative secretory peroxidase                           421   3e-142   Catharanthus roseus [chatas]
ref|XP_004978554.1|  PREDICTED: peroxidase 4-like                       420   1e-141   
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             419   2e-141   
gb|ACT35473.1|  peroxidase 52                                           418   3e-141   Brassica rapa
emb|CDX70158.1|  BnaA10g25070D                                          418   4e-141   
emb|CDY14118.1|  BnaC02g02350D                                          418   5e-141   
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           418   6e-141   
emb|CDY04948.1|  BnaAnng01300D                                          418   7e-141   
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      417   9e-141   
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010          417   1e-140   Sorghum bicolor [broomcorn]
gb|ACU23223.1|  unknown                                                 417   1e-140   Glycine max [soybeans]
ref|XP_009122142.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      417   1e-140   
gb|KHG25850.1|  Peroxidase 4                                            417   1e-140   
gb|KHN48395.1|  Peroxidase 4                                            417   1e-140   
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...    416   1e-140   Brassica rapa subsp. rapa
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                       417   3e-140   
ref|XP_003551174.1|  PREDICTED: peroxidase 4-like                       416   3e-140   
ref|XP_010931330.1|  PREDICTED: peroxidase 4-like                       416   4e-140   
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                      416   5e-140   
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210          415   7e-140   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             415   9e-140   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000          414   9e-140   
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000          413   5e-139   Sorghum bicolor [broomcorn]
ref|XP_004977588.1|  PREDICTED: peroxidase 4-like                       412   6e-139   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      412   7e-139   
gb|KHG17773.1|  Peroxidase 52 -like protein                             412   9e-139   
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                    412   2e-138   
ref|XP_003602462.1|  Peroxidase                                         412   2e-138   
gb|ABR23054.1|  basic peroxidase swpb4                                  411   2e-138   Ipomoea batatas [batate]
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like              411   2e-138   
ref|XP_004490701.1|  PREDICTED: peroxidase 4-like                       410   8e-138   
ref|XP_004502855.1|  PREDICTED: peroxidase 52-like                      409   1e-137   
gb|EPS59568.1|  hypothetical protein M569_15235                         409   1e-137   
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              409   2e-137   
ref|XP_003616748.1|  Peroxidase                                         409   2e-137   
ref|XP_002489046.1|  hypothetical protein SORBIDRAFT_0246s002010        408   3e-137   Sorghum bicolor [broomcorn]
ref|XP_007146856.1|  hypothetical protein PHAVU_006G075900g             409   3e-137   
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like              409   4e-137   
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    408   4e-137   
gb|EMS66985.1|  Peroxidase 4                                            407   8e-137   
gb|ABK21858.1|  unknown                                                 407   1e-136   Picea sitchensis
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                      406   2e-136   
ref|XP_003602463.1|  Peroxidase                                         406   2e-136   
dbj|BAJ97638.1|  predicted protein                                      406   2e-136   
ref|XP_010695716.1|  PREDICTED: peroxidase 4-like                       406   2e-136   
ref|XP_002441703.1|  hypothetical protein SORBIDRAFT_08g000990          406   2e-136   Sorghum bicolor [broomcorn]
emb|CDY02820.1|  BnaC02g10690D                                          406   3e-136   
emb|CDY32701.1|  BnaA02g07630D                                          404   1e-135   
ref|NP_001151940.1|  peroxidase 52 precursor                            405   1e-135   Zea mays [maize]
ref|XP_009126754.1|  PREDICTED: peroxidase 67                           404   2e-135   
tpe|CAH69372.1|  TPA: class III peroxidase 130 precursor                404   2e-135   
gb|EAY79693.1|  hypothetical protein OsI_34840                          404   2e-135   Oryza sativa Indica Group [Indian rice]
ref|NP_001131000.1|  uncharacterized protein LOC100192105 precursor     403   2e-135   Zea mays [maize]
gb|ACN33662.1|  unknown                                                 403   3e-135   Zea mays [maize]
ref|XP_006662662.1|  PREDICTED: peroxidase 4-like                       403   4e-135   
ref|NP_001065971.1|  Os12g0112000                                       402   8e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          402   1e-134   
emb|CAD67477.1|  peroxidase                                             402   1e-134   Asparagus officinalis
ref|XP_006664870.1|  PREDICTED: peroxidase 4-like                       402   1e-134   
ref|XP_003602461.1|  Peroxidase                                         401   3e-134   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              401   3e-134   
gb|KHN29529.1|  Cationic peroxidase 1                                   400   4e-134   
ref|XP_009402215.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    400   4e-134   
emb|CDY02817.1|  BnaC02g10720D                                          400   5e-134   
ref|XP_008465298.1|  PREDICTED: peroxidase 4-like                       400   8e-134   
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              399   1e-133   
gb|AFR44628.1|  class III secretory peroxidase                          399   1e-133   
gb|AIE12239.1|  peroxide                                                399   2e-133   
ref|XP_004172441.1|  PREDICTED: peroxidase 4-like                       398   2e-133   
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              399   2e-133   
gb|KGN47222.1|  hypothetical protein Csa_6G216410                       398   2e-133   
gb|KHN40655.1|  Cationic peroxidase 1                                   399   2e-133   
ref|XP_004149366.1|  PREDICTED: peroxidase 4-like                       398   3e-133   
gb|ABO77632.1|  peroxidase                                              398   3e-133   Medicago truncatula
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              397   4e-133   
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like              398   4e-133   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              397   8e-133   
gb|KFK27367.1|  hypothetical protein AALP_AA8G373800                    397   1e-132   
emb|CAA62597.1|  korean-radish isoperoxidase                            396   1e-132   Raphanus sativus
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           396   1e-132   
emb|CDP16309.1|  unnamed protein product                                396   2e-132   
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                       397   2e-132   
ref|XP_008465299.1|  PREDICTED: peroxidase 4-like                       396   2e-132   
ref|XP_010067586.1|  PREDICTED: peroxidase 4-like                       395   4e-132   
gb|KDP21683.1|  hypothetical protein JCGZ_03354                         394   7e-132   
ref|XP_004150606.1|  PREDICTED: peroxidase 4-like                       395   8e-132   
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                       394   8e-132   
sp|P22195.2|PER1_ARAHY  RecName: Full=Cationic peroxidase 1; AltN...    394   9e-132   Arachis hypogaea [goober]
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like              394   9e-132   
gb|ACN42168.1|  peroxidase 1                                            394   9e-132   Sesuvium portulacastrum [sea-purslane]
ref|XP_004150607.1|  PREDICTED: peroxidase 4-like                       394   1e-131   
ref|XP_008343635.1|  PREDICTED: peroxidase 4-like                       394   1e-131   
ref|XP_008374539.1|  PREDICTED: peroxidase 4-like isoform X1            394   1e-131   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              394   1e-131   
ref|XP_004491048.1|  PREDICTED: peroxidase 4-like                       394   1e-131   
gb|KGN47223.1|  hypothetical protein Csa_6G216420                       393   2e-131   
gb|AFK46186.1|  unknown                                                 393   2e-131   
ref|XP_003544922.1|  PREDICTED: peroxidase 4                            394   2e-131   
gb|EPS67864.1|  hypothetical protein M569_06908                         393   2e-131   
gb|KHN08835.1|  Peroxidase 4                                            393   2e-131   
ref|XP_008374518.1|  PREDICTED: peroxidase P7-like isoform X2           392   4e-131   
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1        392   5e-131   Vitis vinifera
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      392   5e-131   
ref|XP_007033589.1|  Peroxidase superfamily protein                     392   5e-131   
dbj|BAJ91992.1|  predicted protein                                      392   6e-131   
emb|CAH10839.1|  peroxidase                                             392   6e-131   Picea abies
ref|XP_010032327.1|  PREDICTED: peroxidase P7-like                      392   7e-131   
ref|XP_002509730.1|  Lignin-forming anionic peroxidase precursor,...    392   7e-131   Ricinus communis
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       392   8e-131   
ref|XP_010256954.1|  PREDICTED: cationic peroxidase 1-like              392   9e-131   
gb|KDO60611.1|  hypothetical protein CISIN_1g020951mg                   392   9e-131   
emb|CAH10840.1|  peroxidase                                             392   1e-130   Picea abies
ref|XP_008374548.1|  PREDICTED: peroxidase 4-like isoform X2            391   1e-130   
ref|XP_009363835.1|  PREDICTED: peroxidase 4-like                       391   1e-130   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              391   1e-130   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              391   2e-130   
ref|XP_009369253.1|  PREDICTED: peroxidase 4-like                       391   2e-130   
ref|XP_004977590.1|  PREDICTED: cationic peroxidase 1-like              391   2e-130   
gb|KDO41520.1|  hypothetical protein CISIN_1g020615mg                   390   2e-130   
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1           390   2e-130   
ref|XP_009132056.1|  PREDICTED: peroxidase 68-like                      390   3e-130   
gb|KHN48387.1|  Peroxidase 52                                           388   3e-130   
ref|XP_003519284.1|  PREDICTED: peroxidase 4                            390   3e-130   
gb|EPS58134.1|  anionic peroxidase swpb3                                390   3e-130   
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      390   3e-130   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              390   4e-130   
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g             390   5e-130   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                  389   5e-130   
ref|NP_001169614.1|  uncharacterized protein LOC100383495 precursor     390   6e-130   Zea mays [maize]
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3        389   6e-130   
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              389   7e-130   
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              389   7e-130   
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                       389   9e-130   
ref|NP_001130666.1|  uncharacterized protein LOC100191769 precursor     389   2e-129   Zea mays [maize]
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g             388   2e-129   
ref|XP_008463814.1|  PREDICTED: peroxidase 4-like                       389   2e-129   
gb|ABK23423.1|  unknown                                                 388   2e-129   Picea sitchensis
ref|XP_010256951.1|  PREDICTED: peroxidase 4-like                       388   2e-129   
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        388   2e-129   Gossypium hirsutum [American cotton]
gb|AAB02554.1|  cationic peroxidase                                     388   2e-129   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_007142064.1|  hypothetical protein PHAVU_008G249500g             388   3e-129   
gb|ABR18139.1|  unknown                                                 388   3e-129   Picea sitchensis
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              388   3e-129   
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              388   3e-129   
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   387   3e-129   
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2        387   3e-129   Vitis vinifera
emb|CAL25300.1|  properoxidase                                          387   4e-129   Picea abies
dbj|BAM28607.1|  putative peroxidase                                    387   4e-129   
ref|XP_004951344.1|  PREDICTED: peroxidase 70-like                      387   4e-129   
ref|XP_008374993.1|  PREDICTED: peroxidase 4-like                       387   4e-129   
ref|XP_010227239.1|  PREDICTED: peroxidase P7-like                      387   4e-129   
dbj|BAM28608.1|  putative peroxidase                                    387   5e-129   
ref|XP_010067589.1|  PREDICTED: peroxidase P7-like isoform X1           387   6e-129   
gb|KDP25488.1|  hypothetical protein JCGZ_20644                         387   7e-129   
gb|EMT13502.1|  Peroxidase 70                                           386   9e-129   
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like              388   1e-128   
ref|XP_010270786.1|  PREDICTED: lignin-forming anionic peroxidase...    386   1e-128   
dbj|BAM28609.1|  putative peroxidase                                    386   1e-128   
ref|XP_010264469.1|  PREDICTED: peroxidase 2-like                       386   1e-128   
ref|XP_003577141.1|  PREDICTED: peroxidase 4-like                       386   1e-128   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like              386   2e-128   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              385   2e-128   
ref|XP_010270787.1|  PREDICTED: lignin-forming anionic peroxidase...    385   2e-128   
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like              385   2e-128   
gb|ACJ11762.1|  class III peroxidase                                    385   2e-128   Gossypium hirsutum [American cotton]
ref|NP_001065566.1|  Os11g0112200                                       385   3e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030          385   3e-128   Sorghum bicolor [broomcorn]
ref|NP_001046400.2|  Os02g0240100                                       385   3e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    385   3e-128   
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                   385   4e-128   
ref|XP_002269145.1|  PREDICTED: lignin-forming anionic peroxidase       385   4e-128   Vitis vinifera
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like              385   4e-128   
ref|XP_010654887.1|  PREDICTED: lignin-forming anionic peroxidase...    385   4e-128   
tpe|CAH69378.1|  TPA: class III peroxidase 136 precursor                384   5e-128   
emb|CDP08160.1|  unnamed protein product                                385   6e-128   
emb|CBI27505.3|  unnamed protein product                                383   9e-128   
gb|AHL39176.1|  class III peroxidase                                    384   9e-128   
gb|ABK25962.1|  unknown                                                 384   1e-127   
gb|AAW52720.1|  peroxidase 6                                            384   1e-127   
gb|EMT19349.1|  Peroxidase 70                                           384   1e-127   
ref|XP_004305595.1|  PREDICTED: lignin-forming anionic peroxidase...    384   1e-127   
ref|XP_007219210.1|  hypothetical protein PRUPE_ppa017309mg             382   2e-127   
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              383   2e-127   
ref|XP_002269058.1|  PREDICTED: lignin-forming anionic peroxidase...    383   2e-127   
ref|XP_003556178.1|  PREDICTED: lignin-forming anionic peroxidase...    383   2e-127   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              383   2e-127   
ref|XP_010270789.1|  PREDICTED: lignin-forming anionic peroxidase...    384   2e-127   
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg             382   2e-127   
ref|XP_010270788.1|  PREDICTED: lignin-forming anionic peroxidase...    383   2e-127   
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like              383   2e-127   
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like              383   2e-127   
gb|ACZ51443.1|  peroxidase protein                                      383   2e-127   
emb|CBI27503.3|  unnamed protein product                                384   2e-127   
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              383   3e-127   
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like              383   3e-127   
ref|XP_010067590.1|  PREDICTED: peroxidase P7-like isoform X2           383   3e-127   
ref|XP_002509738.1|  Lignin-forming anionic peroxidase precursor,...    383   3e-127   
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like              383   3e-127   
ref|XP_007048724.1|  Peroxidase superfamily protein                     383   3e-127   
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like              382   4e-127   
ref|XP_008792262.1|  PREDICTED: peroxidase 4-like                       392   4e-127   
ref|XP_002283995.1|  PREDICTED: cationic peroxidase 1-like              382   5e-127   
dbj|BAJ90940.1|  predicted protein                                      382   5e-127   
gb|AAO13838.1|AF405326_1  peroxidase 2                                  380   5e-127   
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like              382   5e-127   
emb|CAN80097.1|  hypothetical protein VITISV_011206                     382   5e-127   
ref|XP_010093550.1|  Cationic peroxidase 1                              382   6e-127   
gb|KHN00767.1|  Lignin-forming anionic peroxidase                       382   6e-127   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like              384   7e-127   
ref|XP_002269169.1|  PREDICTED: lignin-forming anionic peroxidase       382   8e-127   
ref|XP_007011212.1|  Peroxidase superfamily protein                     381   1e-126   
ref|XP_003571919.1|  PREDICTED: peroxidase 70-like                      381   1e-126   
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like              381   2e-126   
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      381   2e-126   
ref|XP_002274693.1|  PREDICTED: lignin-forming anionic peroxidase...    381   2e-126   
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like              380   2e-126   
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                       382   2e-126   
ref|XP_003623567.1|  Peroxidase                                         380   3e-126   
dbj|BAK03433.1|  predicted protein                                      380   3e-126   
gb|KHG00581.1|  hypothetical protein F383_17561                         392   3e-126   
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like              380   3e-126   
ref|XP_002299006.2|  hypothetical protein POPTR_0001s46290g             380   3e-126   
gb|ACI03401.1|  peroxidase 1                                            380   3e-126   
ref|XP_006401086.1|  hypothetical protein EUTSA_v10014097mg             380   3e-126   
ref|XP_003552299.1|  PREDICTED: cationic peroxidase 1-like              380   4e-126   
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                      380   4e-126   
ref|NP_200648.1|  peroxidase                                            380   5e-126   
ref|XP_004140410.1|  PREDICTED: lignin-forming anionic peroxidase...    379   6e-126   
ref|XP_009775239.1|  PREDICTED: cationic peroxidase 1-like              379   6e-126   
ref|XP_008233849.1|  PREDICTED: peroxidase 4-like                       380   6e-126   
ref|XP_009381203.1|  PREDICTED: peroxidase P7-like                      379   6e-126   
ref|XP_002453592.1|  hypothetical protein SORBIDRAFT_04g008630          379   7e-126   
dbj|BAJ92357.1|  predicted protein                                      379   7e-126   
ref|XP_007045349.1|  Lignin-forming anionic peroxidase                  379   7e-126   
ref|NP_001242089.1|  uncharacterized protein LOC100815671 precursor     379   7e-126   
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             379   8e-126   
emb|CDX80957.1|  BnaC03g02110D                                          379   8e-126   
ref|XP_008460239.1|  PREDICTED: lignin-forming anionic peroxidase...    379   8e-126   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like              379   9e-126   
gb|EMT19353.1|  Peroxidase 70                                           379   9e-126   
gb|EAY85148.1|  hypothetical protein OsI_06503                          379   1e-125   
dbj|BAM05634.1|  peroxidase 2                                           379   1e-125   
ref|XP_002319407.1|  peroxidase family protein                          378   1e-125   
ref|XP_007131640.1|  hypothetical protein PHAVU_011G030200g             379   1e-125   
dbj|BAM05635.1|  peroxidase 2                                           379   2e-125   
gb|KDP25492.1|  hypothetical protein JCGZ_20648                         378   2e-125   
ref|XP_010483436.1|  PREDICTED: peroxidase 67-like                      378   3e-125   
ref|XP_006370761.1|  Peroxidase 4 precursor family protein              378   3e-125   
gb|EMT21312.1|  Peroxidase 70                                           378   3e-125   
ref|XP_011024237.1|  PREDICTED: lignin-forming anionic peroxidase...    377   4e-125   
ref|XP_006279655.1|  hypothetical protein CARUB_v10026803mg             377   4e-125   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             377   4e-125   
ref|XP_008650762.1|  PREDICTED: peroxidase 70 isoform X1                377   5e-125   
ref|XP_006848019.1|  hypothetical protein AMTR_s00029p00173440          377   5e-125   
ref|XP_009788801.1|  PREDICTED: cationic peroxidase 1-like              377   5e-125   
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      377   5e-125   
ref|XP_011013621.1|  PREDICTED: lignin-forming anionic peroxidase...    377   6e-125   
ref|NP_001106040.1|  peroxidase 70 precursor                            377   6e-125   
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              376   7e-125   
emb|CDP07980.1|  unnamed protein product                                377   7e-125   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              377   7e-125   
ref|XP_004965567.1|  PREDICTED: peroxidase 4-like                       377   7e-125   
ref|XP_009130879.1|  PREDICTED: peroxidase 52-like                      377   8e-125   
ref|XP_002269266.1|  PREDICTED: lignin-forming anionic peroxidase...    377   1e-124   
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like              376   1e-124   
dbj|BAK06463.1|  predicted protein                                      376   1e-124   
ref|XP_003551179.1|  PREDICTED: cationic peroxidase 1-like              376   2e-124   
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g             375   2e-124   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              376   2e-124   
ref|XP_003601028.1|  Peroxidase                                         375   2e-124   
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      375   2e-124   
ref|XP_006842568.1|  hypothetical protein AMTR_s00077p00148760          375   2e-124   
ref|XP_010453676.1|  PREDICTED: peroxidase 67-like                      375   3e-124   
ref|XP_003577842.1|  PREDICTED: peroxidase 4                            375   3e-124   
ref|XP_004298191.1|  PREDICTED: lignin-forming anionic peroxidase...    375   3e-124   
ref|XP_006589469.1|  PREDICTED: lignin-forming anionic peroxidase...    375   3e-124   
ref|XP_009388702.1|  PREDICTED: peroxidase P7-like                      379   4e-124   
gb|EMT19350.1|  Peroxidase 70                                           375   5e-124   
gb|KGN45822.1|  hypothetical protein Csa_6G013940                       372   5e-124   
gb|EMS50650.1|  Peroxidase 70                                           375   5e-124   
ref|XP_010443567.1|  PREDICTED: peroxidase 67                           375   5e-124   
gb|AFK49124.1|  unknown                                                 374   6e-124   
ref|XP_011070595.1|  PREDICTED: lignin-forming anionic peroxidase...    374   6e-124   
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      374   7e-124   
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      374   8e-124   
ref|XP_009419858.1|  PREDICTED: cationic peroxidase 1-like              374   8e-124   
ref|XP_011070598.1|  PREDICTED: lignin-forming anionic peroxidase...    374   9e-124   
ref|XP_004297785.1|  PREDICTED: lignin-forming anionic peroxidase...    374   1e-123   
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                      373   2e-123   
gb|AFK43134.1|  unknown                                                 373   2e-123   
ref|XP_006833057.1|  hypothetical protein AMTR_s00170p00037010          373   2e-123   
ref|XP_011095107.1|  PREDICTED: cationic peroxidase 1-like              373   2e-123   
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              372   2e-123   
ref|XP_002461207.1|  hypothetical protein SORBIDRAFT_02g042840          373   2e-123   
ref|XP_008350979.1|  PREDICTED: lignin-forming anionic peroxidase...    373   2e-123   
ref|XP_011070596.1|  PREDICTED: lignin-forming anionic peroxidase...    373   2e-123   
ref|XP_011032836.1|  PREDICTED: lignin-forming anionic peroxidase...    373   2e-123   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              372   3e-123   
ref|XP_010088521.1|  Lignin-forming anionic peroxidase                  373   3e-123   
ref|XP_002438530.1|  hypothetical protein SORBIDRAFT_10g021630          373   3e-123   
ref|XP_010654860.1|  PREDICTED: lignin-forming anionic peroxidase...    373   3e-123   
gb|AHL39166.1|  class III peroxidase                                    372   3e-123   
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg                372   3e-123   
ref|XP_004492538.1|  PREDICTED: cationic peroxidase 1-like              372   3e-123   
ref|XP_009795618.1|  PREDICTED: peroxidase 2-like                       372   3e-123   
ref|XP_004140450.1|  PREDICTED: lignin-forming anionic peroxidase...    372   4e-123   
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             372   4e-123   
ref|XP_004492537.1|  PREDICTED: cationic peroxidase 1-like              372   6e-123   
ref|XP_004967085.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P...    372   7e-123   
ref|XP_009775854.1|  PREDICTED: peroxidase 2-like                       371   7e-123   
ref|XP_006378807.1|  hypothetical protein POPTR_0010s24330g             371   7e-123   
ref|XP_010925617.1|  PREDICTED: peroxidase P7-like                      371   7e-123   
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like              371   8e-123   
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      371   8e-123   
ref|XP_009395400.1|  PREDICTED: peroxidase P7-like                      372   8e-123   
ref|XP_006470943.1|  PREDICTED: lignin-forming anionic peroxidase...    371   9e-123   
ref|XP_009371986.1|  PREDICTED: cationic peroxidase 1-like isofor...    371   1e-122   
emb|CBI19219.3|  unnamed protein product                                376   1e-122   
gb|EMS50651.1|  Peroxidase 70                                           372   1e-122   
gb|ACU82387.2|  peroxidase 1                                            371   1e-122   
gb|AAM61588.1|  peroxidase                                              370   1e-122   
ref|XP_004951343.1|  PREDICTED: peroxidase 4-like                       370   2e-122   
ref|XP_007045351.1|  Lignin-forming anionic peroxidase                  371   2e-122   
ref|XP_010246463.1|  PREDICTED: peroxidase P7-like                      370   2e-122   
ref|XP_010067587.1|  PREDICTED: peroxidase 4-like                       370   2e-122   
ref|XP_007045348.1|  Lignin-forming anionic peroxidase                  371   2e-122   
ref|XP_011070597.1|  PREDICTED: lignin-forming anionic peroxidase...    370   2e-122   
ref|NP_001046401.1|  Os02g0240300                                       370   2e-122   
gb|KHN44723.1|  Peroxidase 4                                            370   2e-122   
gb|KHN46100.1|  Cationic peroxidase 1                                   369   2e-122   
dbj|BAA77389.1|  peroxidase 3                                           370   2e-122   
ref|XP_006365357.1|  PREDICTED: cationic peroxidase 1-like              370   3e-122   
ref|XP_006365356.1|  PREDICTED: cationic peroxidase 1-like              370   3e-122   
ref|NP_200647.1|  peroxidase                                            370   3e-122   
ref|NP_001057822.1|  Os06g0547400                                       370   3e-122   
ref|XP_006470944.1|  PREDICTED: lignin-forming anionic peroxidase...    370   4e-122   
ref|XP_004303193.1|  PREDICTED: peroxidase 52-like                      370   4e-122   
ref|XP_002311022.2|  hypothetical protein POPTR_0008s02340g             370   4e-122   
ref|XP_007131639.1|  hypothetical protein PHAVU_011G030100g             370   4e-122   
ref|XP_003545648.1|  PREDICTED: peroxidase 4                            370   4e-122   
ref|XP_003623564.1|  Peroxidase                                         369   4e-122   
ref|XP_009404514.1|  PREDICTED: peroxidase P7-like                      369   4e-122   
dbj|BAM05637.1|  peroxidase 2                                           370   4e-122   
ref|XP_010067582.1|  PREDICTED: peroxidase P7-like                      369   5e-122   
ref|XP_006365360.1|  PREDICTED: peroxidase 70-like                      369   5e-122   
ref|XP_006379469.1|  hypothetical protein POPTR_0008s02330g             369   5e-122   
ref|XP_009625317.1|  PREDICTED: cationic peroxidase 1-like              369   6e-122   
emb|CDX88673.1|  BnaA03g09760D                                          371   7e-122   
ref|XP_007140134.1|  hypothetical protein PHAVU_008G086800g             369   7e-122   
ref|XP_004505714.1|  PREDICTED: lignin-forming anionic peroxidase...    369   7e-122   
ref|XP_007208188.1|  hypothetical protein PRUPE_ppa020902mg             369   7e-122   
ref|XP_010264471.1|  PREDICTED: cationic peroxidase 1-like              369   8e-122   
ref|XP_008385017.1|  PREDICTED: cationic peroxidase 1-like              369   9e-122   
gb|KDP22793.1|  hypothetical protein JCGZ_00380                         368   1e-121   
ref|XP_006351920.1|  PREDICTED: lignin-forming anionic peroxidase...    369   1e-121   
ref|XP_004250402.1|  PREDICTED: lignin-forming anionic peroxidase       369   1e-121   
ref|XP_003607863.1|  Peroxidase                                         369   1e-121   
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       369   1e-121   
gb|KEH29221.1|  peroxidase family protein                               369   1e-121   
ref|XP_009371985.1|  PREDICTED: cationic peroxidase 1-like isofor...    369   1e-121   
emb|CAH10841.1|  peroxidase                                             368   1e-121   
ref|XP_010683551.1|  PREDICTED: cationic peroxidase 1-like              369   1e-121   
gb|AES90060.2|  lignin-forming anionic peroxidase                       368   1e-121   
ref|XP_007226601.1|  hypothetical protein PRUPE_ppa023604mg             367   2e-121   
ref|XP_009404515.1|  PREDICTED: peroxidase P7-like                      368   2e-121   
gb|EPS58869.1|  peroxidase                                              367   2e-121   
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           368   2e-121   
ref|XP_011038117.1|  PREDICTED: lignin-forming anionic peroxidase...    368   2e-121   
ref|XP_002521866.1|  Lignin-forming anionic peroxidase precursor,...    368   2e-121   
ref|XP_006657042.1|  PREDICTED: peroxidase P7-like                      367   2e-121   
ref|XP_002437128.1|  hypothetical protein SORBIDRAFT_10g021610          367   2e-121   
ref|XP_009610471.1|  PREDICTED: cationic peroxidase 1-like              367   2e-121   
ref|XP_010067588.1|  PREDICTED: peroxidase 4-like                       367   3e-121   
ref|XP_004249055.1|  PREDICTED: cationic peroxidase 1                   367   3e-121   
ref|XP_007033538.1|  Peroxidase superfamily protein                     367   3e-121   
gb|AHL39158.1|  class III peroxidase                                    367   3e-121   
ref|XP_008790007.1|  PREDICTED: peroxidase P7-like                      367   4e-121   
ref|XP_004253400.1|  PREDICTED: peroxidase 70-like                      367   4e-121   
ref|XP_002531319.1|  Peroxidase 2 precursor, putative                   367   4e-121   
ref|XP_004965566.1|  PREDICTED: peroxidase 52-like                      368   5e-121   
ref|XP_009608056.1|  PREDICTED: lignin-forming anionic peroxidase       367   6e-121   
emb|CAA71493.1|  peroxidase                                             366   6e-121   
ref|XP_010915492.1|  PREDICTED: peroxidase P7-like                      366   7e-121   
ref|XP_009381205.1|  PREDICTED: peroxidase P7-like                      366   7e-121   
ref|XP_002268412.1|  PREDICTED: cationic peroxidase 1                   366   7e-121   
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg                366   8e-121   
ref|XP_010683552.1|  PREDICTED: cationic peroxidase 1-like              367   8e-121   
ref|XP_009597808.1|  PREDICTED: peroxidase 2-like                       366   8e-121   
gb|EMT02760.1|  Peroxidase 4                                            364   1e-120   
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg                366   1e-120   
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg                365   1e-120   
ref|XP_009597807.1|  PREDICTED: peroxidase 2-like                       365   1e-120   
ref|XP_010689717.1|  PREDICTED: peroxidase P7-like                      365   1e-120   
gb|AFK33633.1|  unknown                                                 365   1e-120   
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      365   2e-120   
ref|XP_006470885.1|  PREDICTED: lignin-forming anionic peroxidase...    365   2e-120   
ref|XP_002451848.1|  hypothetical protein SORBIDRAFT_04g008620          363   2e-120   
ref|XP_003517003.1|  PREDICTED: cationic peroxidase 1                   365   2e-120   



>ref|XP_011080739.1| PREDICTED: peroxidase 4-like [Sesamum indicum]
Length=328

 Score =   466 bits (1199),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 228/303 (75%), Positives = 251/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SSS  LST+FY KSCP +F  +KSV+KSA+ EEKRMGASLLRLHFHDCFVQGCD SILLD
Sbjct  28    SSSTHLSTDFYDKSCPTVFSIVKSVVKSAVMEEKRMGASLLRLHFHDCFVQGCDASILLD  87

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +FKGEKTA  NNNSVRGY VID IKS +E VCPGIVSCADIV IAARDS V LGGPN
Sbjct  88    DTPTFKGEKTAGGNNNSVRGYEVIDHIKSKVEAVCPGIVSCADIVTIAARDSVVFLGGPN  147

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             WKV +GRRDSKTASL AANS GVLP P SNLS LI  FQ+QGLS TDLVALSG++TIG++
Sbjct  148   WKVTVGRRDSKTASLEAANS-GVLPGPDSNLSTLIQKFQDQGLSPTDLVALSGTHTIGKA  206

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC +FR+RIYNDT  I ASFAKKRQR+CPR +G GDDN APLD +TP  FD  Y+KNLI 
Sbjct  207   RCVVFRERIYNDT-IIDASFAKKRQRRCPRNSGLGDDNFAPLDNKTPKIFDTAYFKNLIA  265

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ LY+GGSTDSLV+ YSK+P  FN     AMIKMG+I PLTGS GEIRKNCR
Sbjct  266   KKGLLHSDQVLYDGGSTDSLVELYSKSPESFNKDLVVAMIKMGDISPLTGSNGEIRKNCR  325

Query  318   KAN  310
             K N
Sbjct  326   KPN  328



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score =   458 bits (1178),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 220/306 (72%), Positives = 260/306 (85%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F+ SSSAQLSTNFYSKSCP +F T+KS + SA+ +E+RMGASLLRL FHDCFV GCDGSI
Sbjct  18    FVGSSSAQLSTNFYSKSCPNVFTTVKSAVGSAISKERRMGASLLRLFFHDCFVNGCDGSI  77

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             L+DDTS+F GEK A  N NSVRG+NV+DDIKS +EKVCPG+VSCADI+AIAARDS V+LG
Sbjct  78    LVDDTSNFTGEKNAAPNRNSVRGFNVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILG  137

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKVKLGRRD++TAS +AAN+   +P P S+LS LISSFQ++GLST D+VALSGS+TI
Sbjct  138   GPSWKVKLGRRDARTASQAAANTS--IPPPTSSLSNLISSFQSKGLSTKDMVALSGSHTI  195

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN++N I  SFAK RQRKCP  +GSGD+NLAPLDL+TP  FDNNY+KN
Sbjct  196   GQARCTSFRTRIYNESN-IDGSFAKARQRKCPATSGSGDNNLAPLDLQTPTAFDNNYFKN  254

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LIN KGLLHSDQ L+NGGSTDSLV+ YS  P+ F S F+ AMIKMG+I PLTGS GEIR 
Sbjct  255   LINNKGLLHSDQQLFNGGSTDSLVRSYSSKPSTFISDFSAAMIKMGDITPLTGSNGEIRN  314

Query  327   NCRKAN  310
             NCR+ N
Sbjct  315   NCRRVN  320



>ref|XP_004294746.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   458 bits (1178),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 219/306 (72%), Positives = 261/306 (85%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F   SSAQLSTNFYS SCP LF T+KSV++SA+  E R+GASLLRLHFHDCFV GCDGS+
Sbjct  24    FPGRSSAQLSTNFYSGSCPKLFTTVKSVVQSAISNENRIGASLLRLHFHDCFVNGCDGSV  83

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG++V+D IK+ +EK CPG+VSCADIV IAARDS V+LG
Sbjct  84    LLDDTSSFTGEKTAGPNNNSLRGFDVVDKIKTKVEKACPGVVSCADIVTIAARDSVVILG  143

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD+KT +L+AANS GV+P+P ++LS LI+ FQ QGLSTTD+VALSG++TI
Sbjct  144   GPSWSVKLGRRDAKTTTLAAANS-GVIPAPTNDLSDLITKFQAQGLSTTDMVALSGAHTI  202

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT+FRDRIYN+TN I ASFAK RQ  CP  +GSGD+NLAPLD +T   FD  Y++N
Sbjct  203   GKARCTVFRDRIYNETN-IDASFAKTRQNNCPSTSGSGDNNLAPLDTQTTNAFDPKYFQN  261

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LINKKGLLHSDQ L+NGGSTDSLVKKYS +   FN+ FA+AMIKMG+I+PLTGS+GEIRK
Sbjct  262   LINKKGLLHSDQELFNGGSTDSLVKKYSASAKNFNADFAKAMIKMGDIKPLTGSQGEIRK  321

Query  327   NCRKAN  310
             NCRK N
Sbjct  322   NCRKRN  327



>gb|EYU46002.1| hypothetical protein MIMGU_mgv1a009759mg [Erythranthe guttata]
Length=332

 Score =   457 bits (1177),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 214/302 (71%), Positives = 257/302 (85%), Gaps = 2/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             SSAQL+ ++Y K+CP +F T++S +KSA+ +EKRMGASL+RLHFHDCFVQGCD S+LLDD
Sbjct  33    SSAQLTEDYYKKTCPKVFDTVESAVKSAIKKEKRMGASLIRLHFHDCFVQGCDASVLLDD  92

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF GEKTA  NNNS+RG+NV+DDIKS +E VCPG+VSCADI+AIAARDS  +LGGP W
Sbjct  93    TSSFTGEKTAAPNNNSIRGFNVVDDIKSKVESVCPGVVSCADILAIAARDSVSILGGPEW  152

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VK+GRRDSKTASL+AANS GV+P P S L+ L++ FQ +GLST D+VALSG++TIG++R
Sbjct  153   DVKVGRRDSKTASLAAANS-GVIPPPTSTLNNLVNRFQARGLSTKDMVALSGAHTIGQAR  211

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             C++FR RIYN+TN I ASFA+KRQ  CPR TGSGD+NLA LD+++P FFDN YYKNLI K
Sbjct  212   CSLFRTRIYNETN-IDASFARKRQDNCPRTTGSGDNNLASLDVKSPTFFDNAYYKNLIKK  270

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ LYNGGSTDSL++ YSK P  FN  F  AMIKMG+I PLTGS GEIRKNCR+
Sbjct  271   KGLLHSDQILYNGGSTDSLIETYSKKPETFNDDFVTAMIKMGDISPLTGSNGEIRKNCRR  330

Query  315   AN  310
             AN
Sbjct  331   AN  332



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score =   455 bits (1170),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 256/305 (84%), Gaps = 2/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + SSSAQLSTNFYSKSCP L+ TIKS ++SA+++E RMGASLLRL FHDCFV GCDGS+L
Sbjct  20    IGSSSAQLSTNFYSKSCPKLYQTIKSTVQSAINKETRMGASLLRLFFHDCFVNGCDGSLL  79

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEK A  N NSVRG+ VID+IKSA+EK CPGIVSCADI+A+ ARDS V+LGG
Sbjct  80    LDDTSSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGIVSCADILAVTARDSVVILGG  139

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             PNW VKLGRRD++TAS  AANS   +P+P  NL+ LISSF   GLST D+VALSG++TIG
Sbjct  140   PNWNVKLGRRDARTASQGAANSS--IPAPTFNLNRLISSFSAVGLSTKDMVALSGAHTIG  197

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR RIYN+TN I ++FA+ RQ  CPR +GSGD+NLAPLDL+TP+ FDNNY+KNL
Sbjct  198   QARCTTFRARIYNETNNIDSTFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNL  257

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +NKKGLLHSDQ L+NGGS DS+V+ Y  NP+ FNS F  AMIKMG+IRPLTGS GEIRKN
Sbjct  258   VNKKGLLHSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRKN  317

Query  324   CRKAN  310
             CR+ N
Sbjct  318   CRRRN  322



>gb|KDP45728.1| hypothetical protein JCGZ_17335 [Jatropha curcas]
Length=328

 Score =   455 bits (1171),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 219/306 (72%), Positives = 258/306 (84%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLST FYSKSCP LF T+K V+  A+ +E+RMGASL+RL FHDCFV+GCDGSI
Sbjct  25    FNGSSSAQLSTGFYSKSCPKLFETVKPVVADAISKERRMGASLVRLFFHDCFVKGCDGSI  84

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LL+DT+SF GE+TA  NNNSVRG+NVI++IK+ +EKVCPG+VSCADI+AIAARDSTV LG
Sbjct  85    LLEDTASFTGEQTAGPNNNSVRGFNVINNIKAKVEKVCPGVVSCADILAIAARDSTVTLG  144

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GPNW VKLGRRDSKTAS SAANS GV+P P S LS LI+ F+ +GLS  D+VALSG++TI
Sbjct  145   GPNWAVKLGRRDSKTASFSAANS-GVIPPPTSTLSNLINRFKAKGLSARDMVALSGAHTI  203

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC IFR+RIYN+TN I +SFA  RQR CPR TGSGD+NLAPLD++TP  FDNNY+KN
Sbjct  204   GQARCVIFRNRIYNETN-IDSSFASTRQRNCPRATGSGDNNLAPLDVQTPNAFDNNYFKN  262

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N+KGLLHSDQ L+NGGSTDSLV+ YS NP  FNS F  AMIKMG+I PLTGS GEIRK
Sbjct  263   LLNQKGLLHSDQVLFNGGSTDSLVRTYSNNPKTFNSDFVSAMIKMGDIDPLTGSSGEIRK  322

Query  327   NCRKAN  310
              C + N
Sbjct  323   KCNRVN  328



>ref|XP_006365326.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=322

 Score =   454 bits (1167),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 215/305 (70%), Positives = 256/305 (84%), Gaps = 2/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + SSSAQLST+FYSKSCP L+ T+KS ++SA+ +E RMGASLLRL FHDCFV GCDGS+L
Sbjct  20    IGSSSAQLSTSFYSKSCPKLYQTVKSTVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLL  79

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEK A  N NSVRG+ VID+IKSA+EK CPG+VSCADI+A+ ARDS V+LGG
Sbjct  80    LDDTSSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAVTARDSVVILGG  139

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             PNW VKLGRRD++TAS  AANS   +P+P  NL+ LISSF   GLST D+VALSGS+TIG
Sbjct  140   PNWNVKLGRRDARTASQGAANSS--IPAPTFNLNRLISSFSAVGLSTKDMVALSGSHTIG  197

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR RIYN+TN+I +SFA+ RQ  CPR +GSGD+NLAPLDL+TP+ FDNNY+KNL
Sbjct  198   QARCTTFRARIYNETNSIDSSFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNL  257

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +NKKGLLHSDQ L+NGGS DS+V+ Y  NP+ FNS F  AMIKMG+IRPLTGS GEIRKN
Sbjct  258   VNKKGLLHSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRKN  317

Query  324   CRKAN  310
             CR+ N
Sbjct  318   CRRRN  322



>ref|XP_008384729.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=327

 Score =   454 bits (1167),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 257/306 (84%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFYSKSCP +F T+KSV+KSA+ +EKRMGASLLRLHFHDCFV GCDGS+
Sbjct  24    FTGSSSAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSL  83

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNSVRG+ V+D IKS +EK CPG+VSCADI+AIA+RDS  +LG
Sbjct  84    LLDDTSSFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILG  143

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W+VKLGRRDSKTASLSAANS GV+P P + L+ L++ F+  GLS  DLVALSG++TI
Sbjct  144   GPSWEVKLGRRDSKTASLSAANS-GVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTI  202

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR R+YN+TN I ASFA+ RQ  CPR  GSGD+NLAPLD+ TP  FD  Y+KN
Sbjct  203   GQARCTTFRARVYNETN-IDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKN  261

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N+KGLLHSDQ L+NGG+TDSLVK YS N   FN+ FA+AMIKMG+ +PLTGS+GEIR 
Sbjct  262   LVNRKGLLHSDQILFNGGATDSLVKSYSGNAETFNADFAKAMIKMGDNKPLTGSKGEIRL  321

Query  327   NCRKAN  310
             NCRK N
Sbjct  322   NCRKPN  327



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   453 bits (1166),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 221/303 (73%), Positives = 256/303 (84%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S+SAQLSTNFYSKSCP +  T KSV++SA+ +E+RMGASLLRL FHDCFV GCDGSILLD
Sbjct  23    SASAQLSTNFYSKSCPNVLSTAKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLD  82

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF+GEKTA  N NSVRGYNVID IKS +E  CPG+VSCADIVAIAARDS VLLGGP+
Sbjct  83    DTSSFQGEKTAGPNQNSVRGYNVIDQIKSKVESACPGVVSCADIVAIAARDSVVLLGGPS  142

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W+VKLGRRD++TASLS ANS GV+P P S LS LIS F+ QGLST D+VALSGS+TIG++
Sbjct  143   WEVKLGRRDARTASLSRANS-GVIPPPTSTLSNLISRFKAQGLSTRDMVALSGSHTIGQA  201

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC  FR RIYND+N I +SF+K RQ KCPR  GSGD+NL+PLDL++P  FDN Y+KNL++
Sbjct  202   RCISFRPRIYNDSN-IDSSFSKTRQGKCPRTAGSGDNNLSPLDLQSPTAFDNAYFKNLLS  260

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
              KGLLHSDQ L+NGG+TDSLVK YS NP  FNS FA AMIKMG+I+PLTGS+GEIRK C 
Sbjct  261   NKGLLHSDQELFNGGTTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICS  320

Query  318   KAN  310
             K N
Sbjct  321   KIN  323



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   453 bits (1165),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 221/303 (73%), Positives = 253/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S+SAQLSTNFYSKSCP +  T+KSV++SA+ +E+RMGASLLRL FHDCFV GCDGSILLD
Sbjct  23    SASAQLSTNFYSKSCPNVLSTVKSVVRSAVSKERRMGASLLRLFFHDCFVNGCDGSILLD  82

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF+GEKTA  NN S+RGYNVID IKS +E  CPG+VSCADIVAIAARDS VLLGGP+
Sbjct  83    DTSSFQGEKTAGPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPS  142

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W+VKLGRRD++TAS S ANS G LP P S LS L S FQ QGLST D+VALSGS+TIG++
Sbjct  143   WEVKLGRRDARTASFSLANS-GALPPPTSTLSNLTSLFQAQGLSTRDMVALSGSHTIGQA  201

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC  FR RIYND+N I +SF+K RQRKCP   GSGD NLAPLDL++P  FDN Y+KNL++
Sbjct  202   RCISFRSRIYNDSN-IDSSFSKTRQRKCPSTVGSGDQNLAPLDLQSPTAFDNAYFKNLLS  260

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
              KGLLHSDQ L+NGGSTDSLVK YS NP  FNS FA AMIKMG+I+PLTGS+GEIRK C 
Sbjct  261   NKGLLHSDQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICS  320

Query  318   KAN  310
             K N
Sbjct  321   KVN  323



>ref|XP_008384730.1| PREDICTED: peroxidase 4-like isoform X2 [Malus domestica]
Length=323

 Score =   452 bits (1164),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 257/306 (84%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFYSKSCP +F T+KSV+KSA+ +EKRMGASLLRLHFHDCFV GCDGS+
Sbjct  20    FTGSSSAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSL  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNSVRG+ V+D IKS +EK CPG+VSCADI+AIA+RDS  +LG
Sbjct  80    LLDDTSSFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W+VKLGRRDSKTASLSAANS GV+P P + L+ L++ F+  GLS  DLVALSG++TI
Sbjct  140   GPSWEVKLGRRDSKTASLSAANS-GVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTI  198

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR R+YN+TN I ASFA+ RQ  CPR  GSGD+NLAPLD+ TP  FD  Y+KN
Sbjct  199   GQARCTTFRARVYNETN-IDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKN  257

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N+KGLLHSDQ L+NGG+TDSLVK YS N   FN+ FA+AMIKMG+ +PLTGS+GEIR 
Sbjct  258   LVNRKGLLHSDQILFNGGATDSLVKSYSGNAETFNADFAKAMIKMGDNKPLTGSKGEIRL  317

Query  327   NCRKAN  310
             NCRK N
Sbjct  318   NCRKPN  323



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score =   452 bits (1163),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 252/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SSSAQLSTNFYSKSCP LF T+KS ++SA++ E RMGASLLRL FHDCFV GCDGS+LLD
Sbjct  24    SSSAQLSTNFYSKSCPKLFQTVKSTVQSAINRETRMGASLLRLFFHDCFVNGCDGSLLLD  83

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEK A  N NSVRG+ VID+IKSA+EK CPG+VSCADI+AI ARDS V+LGGPN
Sbjct  84    DTSSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPN  143

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD++TAS  AANS   +P P SNL+ LISSF   GLSTTD+VALSG++TIG++
Sbjct  144   WNVKLGRRDARTASQGAANSS--IPPPTSNLNQLISSFSAVGLSTTDMVALSGAHTIGQA  201

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN+TN I +SFA  RQR CPR +GSGD+NLAPLDL+TP  FDNNY+KNL++
Sbjct  202   RCTSFRARIYNETNNIDSSFATTRQRNCPRNSGSGDNNLAPLDLQTPTKFDNNYFKNLVS  261

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             K+GLLHSDQ L+NGGS DS+V  YS NP+ F+S F  AMIKMG+ RPLTGS GEIRKNCR
Sbjct  262   KRGLLHSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDNRPLTGSNGEIRKNCR  321

Query  318   KAN  310
               N
Sbjct  322   TRN  324



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score =   451 bits (1161),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 218/303 (72%), Positives = 256/303 (84%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S SAQLSTNFYSK+CP +F T+KS ++SA+ +E RMGASLLRL FHDCFV GCDGSILLD
Sbjct  22    SCSAQLSTNFYSKTCPNVFTTVKSAVRSAISKESRMGASLLRLFFHDCFVNGCDGSILLD  81

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEK A  N NS RG++V+DDIKS +EKVCPG+VSCADI+AIAARDS V+LGG +
Sbjct  82    DTSSFTGEKNANPNRNSARGFDVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGTS  141

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRDSKTAS SAAN+   +P P SNL+ LISSFQ++GLST D+VALSG +TIG++
Sbjct  142   WNVKLGRRDSKTASQSAANNN--IPPPTSNLNNLISSFQSKGLSTKDMVALSGGHTIGQA  199

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN++N I +SFAK RQ +CP  +GSGD+NLAPLDL+TP  FDNNY+KNLIN
Sbjct  200   RCTNFRARIYNESN-IESSFAKTRQGRCPSSSGSGDNNLAPLDLQTPTAFDNNYFKNLIN  258

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             +KGLLHSDQ L+NGGSTDS V+ YS NP+ FNS FA AMIKMG+I PLTGS GEIRKNCR
Sbjct  259   QKGLLHSDQQLFNGGSTDSQVRTYSNNPSTFNSDFAAAMIKMGDISPLTGSNGEIRKNCR  318

Query  318   KAN  310
             + N
Sbjct  319   RVN  321



>gb|KEH34419.1| anionic peroxidase swpb3 protein [Medicago truncatula]
Length=320

 Score =   451 bits (1159),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 215/306 (70%), Positives = 257/306 (84%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + +SSAQLS NFYSK CP +F T++SV+K+A+ +E R+GASLLRLHFHDCFV GCDGSI
Sbjct  17    LIGTSSAQLSENFYSKKCPKVFKTVQSVVKTAVAKENRIGASLLRLHFHDCFVDGCDGSI  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSFKGEKTA  NNNSVRGY VID IKS +E +CPG+VSCADIVAI ARDS V+LG
Sbjct  77    LLDDTSSFKGEKTAGPNNNSVRGYEVIDAIKSKVEAICPGVVSCADIVAITARDSVVILG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP WKVK+GRRDSKTA+ +AAN+ GV+P+P SNL+ LIS+F+ QGLS  D+VALSG++TI
Sbjct  137   GPFWKVKVGRRDSKTANFTAANT-GVIPAPTSNLTTLISTFKAQGLSVKDMVALSGAHTI  195

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR  IYND+N I ++FAK RQ+ CPR TGSGD+NLA LDL TP  FDNNYYKN
Sbjct  196   GRARCTSFRGHIYNDSN-IDSTFAKIRQKNCPRTTGSGDNNLANLDLRTPTHFDNNYYKN  254

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI K+GLLHSDQ L+NGG+TDSLVK YS+N  +F+S F  AMIKMG+ +PLTG +GEIRK
Sbjct  255   LIIKRGLLHSDQVLFNGGTTDSLVKTYSQNGKVFDSDFVAAMIKMGDNKPLTGKQGEIRK  314

Query  327   NCRKAN  310
             NCR+ N
Sbjct  315   NCRRLN  320



>gb|KHG09190.1| Peroxidase 4 [Gossypium arboreum]
Length=322

 Score =   451 bits (1159),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 218/303 (72%), Positives = 255/303 (84%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SS AQLST+FYSKSCP +  T++SV+KSA+ +EKRMGASL+RL FHDCFV+GCDGSILLD
Sbjct  22    SSYAQLSTSFYSKSCPKVLSTVESVVKSAVSKEKRMGASLVRLFFHDCFVKGCDGSILLD  81

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF+GEKTA  NNNSVRG+NV+DDIK+ +EKVCPG+VSCADI+A+AARDS V+LGGP 
Sbjct  82    DTSSFRGEKTAAPNNNSVRGFNVVDDIKAKVEKVCPGVVSCADILALAARDSVVILGGPG  141

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRDSKTAS +AANS GV+P P + LS LI+ FQ +GLS  D+VALSG++TIG++
Sbjct  142   WDVKLGRRDSKTASFAAANS-GVIPPPTATLSQLINRFQARGLSAKDMVALSGAHTIGKA  200

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC +FRDRIYN+TN I ASFAK RQ  CPR +GSGD+NLAPLD+ TP  FD  Y+ NL+N
Sbjct  201   RCVLFRDRIYNETN-IDASFAKARQSSCPRTSGSGDNNLAPLDVATPNSFDLKYFNNLLN  259

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGSTDSLVK YS N   F S F  AMIKMG+I PLTGS GEIRKNCR
Sbjct  260   KKGLLHSDQILFNGGSTDSLVKTYSSNTKKFYSDFVTAMIKMGDITPLTGSNGEIRKNCR  319

Query  318   KAN  310
             K N
Sbjct  320   KPN  322



>ref|XP_008810563.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=319

 Score =   449 bits (1156),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 215/303 (71%), Positives = 250/303 (83%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S+SAQLSTN+Y+ SCP +F  +K V++SA+ +EKRMGASLLRL FHDCFVQGCDGSILLD
Sbjct  20    STSAQLSTNYYASSCPKVFSAVKPVVQSAIAKEKRMGASLLRLFFHDCFVQGCDGSILLD  79

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF+GEKTA  NNNSVRG++V+D IK+A+EKVCPG+VSCADI+AI ARDS V+LGGPN
Sbjct  80    DTSSFQGEKTATPNNNSVRGFDVVDSIKAAVEKVCPGVVSCADILAITARDSVVILGGPN  139

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRDS TAS S AN+   +P P S+LS LIS F  QGLST D+VALSG +TIG++
Sbjct  140   WNVKLGRRDSTTASFSGANNN--IPPPNSSLSNLISKFSAQGLSTKDMVALSGGHTIGQA  197

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  +YNDT+ I +SFAK RQ  CP   GSGD+NLAPLDL+TP  FDNNYYKNLIN
Sbjct  198   RCTNFRAHVYNDTD-IDSSFAKTRQMNCPSTAGSGDNNLAPLDLQTPTCFDNNYYKNLIN  256

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGSTDS V  YS NP+ FNS F   MI MG+I PLTG+RGEIRKNCR
Sbjct  257   KKGLLHSDQELFNGGSTDSQVTTYSNNPSTFNSDFVTGMINMGDINPLTGTRGEIRKNCR  316

Query  318   KAN  310
             + N
Sbjct  317   RVN  319



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score =   449 bits (1154),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 215/306 (70%), Positives = 254/306 (83%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + SSSAQLST FYSKSCP L+ T+KS ++SA+++E RMGASLLRL FHDCFV GCDGS+
Sbjct  18    LIGSSSAQLSTGFYSKSCPKLYQTVKSAVQSAINKETRMGASLLRLFFHDCFVNGCDGSL  77

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG+ VID+IKSA+EKVCPG+VSCADI+A+ ARDS V+LG
Sbjct  78    LLDDTSSFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILG  137

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GPNW VKLGRRDS+TAS SAANS   +P   SNL+ LISSF   GLST D+VALSG++TI
Sbjct  138   GPNWNVKLGRRDSRTASQSAANSG--IPPATSNLNRLISSFSAVGLSTKDMVALSGAHTI  195

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN + ASFA+ RQ  CPR +GSGD+NLAPLDL+TP  FDNNY+KN
Sbjct  196   GQARCTSFRARIYNETNNLDASFARTRQSNCPRSSGSGDNNLAPLDLQTPNKFDNNYFKN  255

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L++KKGLLHSDQ L+NGGS DS+V  YS NP+ F+S F  AMIKMG+IRPLTGS GEIRK
Sbjct  256   LVDKKGLLHSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDIRPLTGSNGEIRK  315

Query  327   NCRKAN  310
             NCR+ N
Sbjct  316   NCRRLN  321



>ref|XP_011080738.1| PREDICTED: peroxidase 4-like [Sesamum indicum]
Length=329

 Score =   449 bits (1155),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 224/303 (74%), Positives = 256/303 (84%), Gaps = 1/303 (0%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SSSAQLST+FY KSCP +F  + SV+KSA+ +EKRMGASLLRLHFHDCFVQGCDGSILLD
Sbjct  28    SSSAQLSTDFYEKSCPNVFSVVNSVVKSAVQKEKRMGASLLRLHFHDCFVQGCDGSILLD  87

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEKTA  N NSVRGY VID IKS +E  CPG++SCADIVAIAARDS VLLGGP 
Sbjct  88    DTSSFTGEKTAGPNINSVRGYEVIDSIKSKVEATCPGVISCADIVAIAARDSVVLLGGPT  147

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W+VK+GRRDSKTASLSAAN+ G LP P S L+ LI+ FQ +GLST D+V LSG+++IG++
Sbjct  148   WEVKVGRRDSKTASLSAANN-GQLPPPTSTLTNLINRFQAKGLSTKDMVVLSGAHSIGQA  206

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT+FRDRIYN+T+ I +SFAK RQ  CPR  GSGD+NLAPLDL+TP FFDN Y+KNLI 
Sbjct  207   RCTVFRDRIYNETSNIDSSFAKLRQGNCPRTNGSGDNNLAPLDLKTPTFFDNAYFKNLIA  266

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ LYNGGSTDSLV+ YSKNP  FN  F  AMI+MG+I PLTGS+GEIRKNCR
Sbjct  267   KKGLLHSDQVLYNGGSTDSLVESYSKNPQSFNGDFVAAMIRMGDITPLTGSKGEIRKNCR  326

Query  318   KAN  310
             K N
Sbjct  327   KPN  329



>ref|XP_009369543.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   449 bits (1154),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 216/306 (71%), Positives = 255/306 (83%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFYSKSCP +F T+KSV+KSA+ +EKRMGASLLRLHFHDCFV GCDGS+
Sbjct  24    FTGSSSAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSL  83

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS RG+ V+D IKS +EK CPG+VSCADI+AIA+RDS  +LG
Sbjct  84    LLDDTSSFTGEKTAGPNNNSARGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILG  143

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W+VKLGRRDSKTASLSAANS GV+P P + L+ L++ F+  GLS  DLVALSG++TI
Sbjct  144   GPSWEVKLGRRDSKTASLSAANS-GVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTI  202

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I ASFA+ RQ  CPR  GSGD+NLAPLD+ TP  FD  Y+KN
Sbjct  203   GQARCTTFRARIYNETN-IDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKN  261

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N+KGLLHSDQ L+N G+T+SLVK YS N   FNS FA+AMIKMG+ +PLTGS+GEIR 
Sbjct  262   LVNQKGLLHSDQILFNSGATNSLVKSYSGNAETFNSDFAKAMIKMGDNKPLTGSKGEIRL  321

Query  327   NCRKAN  310
             NCRK N
Sbjct  322   NCRKPN  327



>ref|XP_007205551.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
 gb|EMJ06750.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
Length=325

 Score =   448 bits (1153),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 256/307 (83%), Gaps = 3/307 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFYSKSCP +F  +KSV++SA+++EKRMGASLLRLHFHDCFV GCDGSI
Sbjct  21    FTGSSSAQLSTNFYSKSCPKVFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSI  80

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNSVRG+ V+D+IKS +EK CPG+VSCADI+AIAARDS  +LG
Sbjct  81    LLDDTSSFTGEKTARPNNNSVRGFEVVDNIKSQVEKTCPGVVSCADILAIAARDSVKILG  140

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRDSKTASL+AANS GV+P P S LS L + FQ  GL+  DLVALSG++TI
Sbjct  141   GPSWNVKLGRRDSKTASLAAANS-GVIPPPTSTLSQLKTRFQAVGLNERDLVALSGAHTI  199

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I ASFAK RQ KCP   GSGD+NLAPLD++TP  FD  Y+KN
Sbjct  200   GQARCTSFRARIYNETN-IDASFAKARQSKCPSTVGSGDNNLAPLDVQTPNTFDTAYFKN  258

Query  507   LINKKGLLHSDQALY-NGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             LIN+KGLLHSDQ LY NGGSTDSLVK YS +   FNS FA+AMIKMG+ +PLTGS GEIR
Sbjct  259   LINQKGLLHSDQILYNNGGSTDSLVKTYSGSANTFNSDFAKAMIKMGDNKPLTGSNGEIR  318

Query  330   KNCRKAN  310
              NCR+ N
Sbjct  319   LNCRRPN  325



>ref|XP_002269918.1| PREDICTED: peroxidase 4 [Vitis vinifera]
 sp|A7NY33.1|PER4_VITVI RecName: Full=Peroxidase 4; Flags: Precursor [Vitis vinifera]
 emb|CBI15844.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   448 bits (1152),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 250/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFYSK+CP +F T+KS ++SA+ +E+RMGASLLRL FHDCFV GCD S+
Sbjct  19    FAGSSSAQLSTNFYSKTCPKVFDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASV  78

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GE+TA  N NS+RG NVID+IKS +E VCPG+VSCADI+AIAARDS V+LG
Sbjct  79    LLDDTSSFTGEQTAVPNKNSIRGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILG  138

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRDSKTASLS AN+   +P P S+LS LIS FQ QGLST D+VALSG++TI
Sbjct  139   GPDWDVKLGRRDSKTASLSGANNN--IPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTI  196

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I +SFAK RQ  CP  +GSGD+NLAPLDL+TP  FDN YYKN
Sbjct  197   GQARCTSFRARIYNETN-IDSSFAKTRQASCPSASGSGDNNLAPLDLQTPTTFDNYYYKN  255

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LIN+KGLLHSDQ LYNGGSTDS VK Y  NP  F S F   MIKMG+I PLTGS GEIRK
Sbjct  256   LINQKGLLHSDQVLYNGGSTDSTVKTYVNNPKTFTSDFVAGMIKMGDITPLTGSEGEIRK  315

Query  327   NCRKAN  310
             +C K N
Sbjct  316   SCGKVN  321



>ref|XP_007205544.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
 gb|EMJ06743.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
Length=326

 Score =   448 bits (1153),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 254/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSA+LST FYSKSCP +F  +KSV++SA+ +EKRMGASLLRLHFHDCFV GCDGS+
Sbjct  21    FTGSSSAKLSTKFYSKSCPKVFNAVKSVVQSAVHKEKRMGASLLRLHFHDCFVHGCDGSL  80

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IKS +EK CPG+VSCADI+AIAARDS  +LG
Sbjct  81    LLDDTSSFTGEKTASPNNNSLRGFKVVDKIKSQVEKTCPGVVSCADILAIAARDSVKILG  140

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRDSKTAS  AAN  GVLPSP S LS L + FQ  GL+  DLVALSG++TI
Sbjct  141   GPSWHVKLGRRDSKTASFFAANRSGVLPSPTSTLSQLKTRFQAVGLNERDLVALSGAHTI  200

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G+++C+ FRDRIYNDTN I ASFAK RQRKCP   GSGD++LAPLD++TP  FD  Y+KN
Sbjct  201   GKAQCSSFRDRIYNDTN-IDASFAKARQRKCPSTVGSGDNHLAPLDVQTPNTFDTAYFKN  259

Query  507   LINKKGLLHSDQALY-NGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             LIN+KGLLHSDQ LY NGGSTDSLVK YS +   FNS FA+AMIKMG+I+PLTGS GEIR
Sbjct  260   LINQKGLLHSDQVLYNNGGSTDSLVKTYSGSANAFNSDFAKAMIKMGDIKPLTGSNGEIR  319

Query  330   KNCRKAN  310
              NCR+ N
Sbjct  320   LNCRRPN  326



>ref|XP_009786874.1| PREDICTED: peroxidase P7 [Nicotiana sylvestris]
Length=319

 Score =   447 bits (1151),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 210/306 (69%), Positives = 254/306 (83%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + SSSAQL+T FYSKSCP L+ T+KSV+ SA+ +E RMGASLLRL FHDCFV GCDGS+
Sbjct  16    LMGSSSAQLTTGFYSKSCPKLYETVKSVVHSAIQKETRMGASLLRLFFHDCFVNGCDGSL  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
              LDDTS+F GEK A  N NS RG+ VIDDIKSA+EKVCPG+VSCADI+A+ ARDS V+LG
Sbjct  76    FLDDTSTFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GPNW VKLGRRD++TAS +AANS   +P P SNL+ LISSF   GLST D+VALSG++TI
Sbjct  136   GPNWDVKLGRRDARTASQAAANSS--IPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN + +S AK RQ  CPR +GSGD+NLAPLDL+TP +FDN+Y+ N
Sbjct  194   GQARCTSFRARIYNETNNLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFIN  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L++KKGLLHSDQ L+NGGS DS+VK YS NP++F + F  AMIKMG+IRPLTGS+GEIRK
Sbjct  254   LVSKKGLLHSDQQLFNGGSADSIVKSYSDNPSIFATDFVTAMIKMGDIRPLTGSKGEIRK  313

Query  327   NCRKAN  310
             NCR+ N
Sbjct  314   NCRRIN  319



>ref|XP_010921101.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   447 bits (1149),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 257/306 (84%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL SSSAQLSTN+YSK+CP LF  +K VI+SA+  EKRMGAS+LRL FHDCFV GCDGS+
Sbjct  18    FLGSSSAQLSTNYYSKTCPNLFSAVKPVIESAISSEKRMGASILRLFFHDCFVNGCDGSL  77

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA AN NSVRG++VID IK+A+E+ CPG+VSCADI+A+AARDS V+LG
Sbjct  78    LLDDTSSFTGEKTANANRNSVRGFDVIDKIKTAVEEACPGVVSCADILAVAARDSVVILG  137

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GPNW VKLGRRD++TASLSAAN+   +P P S+LS LIS F  QGLST ++VAL+G++TI
Sbjct  138   GPNWDVKLGRRDARTASLSAANNN--IPPPTSSLSNLISKFSAQGLSTDEMVALAGAHTI  195

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR  IYNDT+ I +SFAK RQ  CP  +G+GD+NLAPLDL+TP  FDNNYYKN
Sbjct  196   GQARCTSFRAHIYNDTD-INSSFAKTRQANCPSTSGNGDNNLAPLDLQTPTVFDNNYYKN  254

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L++++GLLHSDQ LYN GSTDSLV  YS NP+ F+S F  A+IKMG+I PLTGS+GEIRK
Sbjct  255   LVSQEGLLHSDQELYNKGSTDSLVSTYSTNPSKFSSDFVAAIIKMGDISPLTGSQGEIRK  314

Query  327   NCRKAN  310
             NCRK N
Sbjct  315   NCRKIN  320



>ref|XP_008354764.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=327

 Score =   446 bits (1148),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 215/306 (70%), Positives = 252/306 (82%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  +SSAQLSTNFYSKSCP +F  +KSV+KSA+ +EKRMGASLLRLHFHDCFV GCDGS+
Sbjct  24    FTGNSSAQLSTNFYSKSCPQVFDAVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSL  83

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS RG+ V+D IKS +EK CPG+VSCADI+AIA+RDS  +LG
Sbjct  84    LLDDTSSFTGEKTALPNNNSXRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILG  143

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W+VKLGRRDSKTASLSAANS GVLP P + L+ L + F+  GLS  DLVALSG++TI
Sbjct  144   GPSWEVKLGRRDSKTASLSAANS-GVLPPPTATLNELTTRFRAVGLSQRDLVALSGAHTI  202

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I ASFA+ RQ  CPR  GSGDDNLAP D+ TP  FD  Y+KN
Sbjct  203   GQARCTTFRARIYNETN-IDASFARTRQNTCPRTAGSGDDNLAPFDITTPNTFDTAYFKN  261

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N+KGLLHSDQ L+NGG TDSLVK YS +   FN+ FA+AMIKMG+ +PLTGS+GEIR 
Sbjct  262   LVNQKGLLHSDQILFNGGPTDSLVKSYSGSANTFNADFAKAMIKMGDNKPLTGSKGEIRL  321

Query  327   NCRKAN  310
             NCRK N
Sbjct  322   NCRKPN  327



>ref|XP_002278996.1| PREDICTED: peroxidase 4 [Vitis vinifera]
Length=321

 Score =   446 bits (1146),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 255/306 (83%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL SS+AQLST++YS+SCP LF T+KS +KSA+ +E RMGASLLRL FHDCFV GCDGS+
Sbjct  19    FLGSSTAQLSTDYYSQSCPKLFPTVKSAVKSAVAKEARMGASLLRLFFHDCFVNGCDGSV  78

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NSVRG++V+DDIKS +E  CPG+VSCAD++AIAARDS V+LG
Sbjct  79    LLDDTSSFIGEKNAAPNANSVRGFDVVDDIKSKVETACPGVVSCADVLAIAARDSVVILG  138

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD++TAS +AAN+   +P P SNL+ LIS FQ  GLST DLVAL+GS+TI
Sbjct  139   GPSWNVKLGRRDARTASQAAANNS--IPPPTSNLNQLISRFQALGLSTRDLVALAGSHTI  196

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I  SFAK RQ  CPR +GSGD+NLAPLDL+TP  F+NNYYKN
Sbjct  197   GQARCTSFRARIYNETN-IDNSFAKTRQSNCPRASGSGDNNLAPLDLQTPTAFENNYYKN  255

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI KKGLLHSDQ L+NGGSTDS+V+KYS + + FN+HF   MIKMG+I PLTGS GEIRK
Sbjct  256   LIKKKGLLHSDQQLFNGGSTDSIVRKYSNSRSNFNAHFVAGMIKMGDISPLTGSNGEIRK  315

Query  327   NCRKAN  310
             NCR+ N
Sbjct  316   NCRRVN  321



>ref|XP_006468162.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
 gb|KDO41521.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=323

 Score =   445 bits (1145),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 253/306 (83%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F   SSAQLSTNFYSK+CP L  T+KS ++SA+ +E+RMGASLLRLHFHDCFV GCDGSI
Sbjct  20    FTGKSSAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSI  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKT+  N NS RG+ V+DDIKS +EKVCPG+VSCADI+AIAAR S  +LG
Sbjct  80    LLDDTSSFTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGVVSCADILAIAARHSVAILG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRDSKTASL+AANS GV+P P S LS LI+ FQ +GLS  D+VALSG++TI
Sbjct  140   GPSWNVKLGRRDSKTASLAAANS-GVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTI  198

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC  FR+RIYN++N I +SFAK R+  CPR TGSGD+NLAPLD ++P  FDN YYK+
Sbjct  199   GQARCVAFRNRIYNESN-IESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYKH  257

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N+KGLLHSDQ L+NGGSTDSLV  Y+ N   FNS FA AMIKMG+I PLTGS GEIRK
Sbjct  258   LLNQKGLLHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGEIRK  317

Query  327   NCRKAN  310
             NCR+ N
Sbjct  318   NCRRPN  323



>ref|XP_002319968.2| peroxidase family protein [Populus trichocarpa]
 gb|EEE95891.2| peroxidase family protein [Populus trichocarpa]
 gb|AHL39178.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score =   445 bits (1144),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 218/306 (71%), Positives = 254/306 (83%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F   SSAQLSTNFYSKSCP +FG +KSV++SA+ +E+RMGASL+RL FHDCFV+GCDGSI
Sbjct  22    FTSHSSAQLSTNFYSKSCPKVFGAVKSVVQSAVSKERRMGASLVRLFFHDCFVRGCDGSI  81

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LL+DTSSF GE+TA  NNNSVRG+NV+  IKS +EKVCPGIVSCADIVAIAARDSTV+LG
Sbjct  82    LLEDTSSFTGEQTAGPNNNSVRGFNVVAKIKSQVEKVCPGIVSCADIVAIAARDSTVILG  141

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRDSKTASLSAANS GV+P P S LS LI+ F ++GLS  D+VALSGS+TI
Sbjct  142   GPFWNVKLGRRDSKTASLSAANS-GVIPPPTSTLSNLINRFNSKGLSVKDMVALSGSHTI  200

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I +SFA  RQ+ CP     GD+ LAPLD++TP  FDN YYKN
Sbjct  201   GQARCTSFRARIYNETN-IDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTSFDNKYYKN  259

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI++KGLLHSDQ L+NGGSTDSLV+ YS NP  F+S F  AMIKMG+I PLTGS+GEIRK
Sbjct  260   LISQKGLLHSDQVLFNGGSTDSLVRTYSSNPKTFSSDFVTAMIKMGDIDPLTGSQGEIRK  319

Query  327   NCRKAN  310
              C K N
Sbjct  320   ICSKRN  325



>emb|CDP04065.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   443 bits (1140),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 216/302 (72%), Positives = 251/302 (83%), Gaps = 2/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLST+FYSKSCP + GTI+S ++SA+ +E+RMGASL+RL FHDCFVQGCD SILLDD
Sbjct  17    ASAQLSTSFYSKSCPKVLGTIRSEVQSAVSKERRMGASLVRLFFHDCFVQGCDASILLDD  76

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSFKGEKTAF N NSVRG+ VID+IK  +EKVCPG+VSCADIVAIAARDS V+LGGP+W
Sbjct  77    TSSFKGEKTAFPNINSVRGFGVIDNIKEKVEKVCPGVVSCADIVAIAARDSIVILGGPSW  136

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDSKTASLS ANS G LP P S L+ LI+ FQ  GLS  D+VALSG++TIG++R
Sbjct  137   DVKLGRRDSKTASLSQANS-GRLPGPASTLANLINRFQAVGLSAKDMVALSGAHTIGQAR  195

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR RIYN+T  I  SFAK R+ +CP   G GD+NLAPLDL+TP  FD  Y++NLINK
Sbjct  196   CTNFRTRIYNETK-IDTSFAKTRRSQCPATVGRGDNNLAPLDLQTPTGFDTKYFQNLINK  254

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ LYNGGSTDSLV+KYSK+   FNS F +AMIKMG+I PLT S+GEIRK CRK
Sbjct  255   KGLLHSDQVLYNGGSTDSLVEKYSKDSKTFNSDFVKAMIKMGDINPLTRSQGEIRKKCRK  314

Query  315   AN  310
              N
Sbjct  315   LN  316



>ref|XP_011021038.1| PREDICTED: peroxidase 4-like [Populus euphratica]
Length=325

 Score =   444 bits (1141),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 216/306 (71%), Positives = 255/306 (83%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F   SSA+LSTNFYSKSCP +FG +KSV++SA+ +E+RMGASL+RL FHDCFV+GCDGSI
Sbjct  22    FTSHSSAKLSTNFYSKSCPKVFGVVKSVVQSAVSKERRMGASLVRLFFHDCFVKGCDGSI  81

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LL+DTSSF GE+TA  NNNSVRG+NV+  IKS +EKVCPG+VSCADIVAIAARDSTV+LG
Sbjct  82    LLEDTSSFTGEQTARPNNNSVRGFNVVAKIKSRVEKVCPGVVSCADIVAIAARDSTVILG  141

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRDSKTASLSAANS GV+P P S LS LI+ F+++GLS  D+VALSGS+TI
Sbjct  142   GPFWNVKLGRRDSKTASLSAANS-GVIPPPTSTLSNLINRFKSKGLSVKDMVALSGSHTI  200

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I +SFA  RQ+ CP     GD+ LAPLD++TP  FDN YYKN
Sbjct  201   GQARCTSFRARIYNETN-IDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTAFDNKYYKN  259

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI++KGLLHSDQ L+NGGSTDSLV+ YS+NP  F S F  AMIKMG+I PLTGS+GEIRK
Sbjct  260   LISQKGLLHSDQVLFNGGSTDSLVRTYSRNPKTFRSDFVTAMIKMGDIDPLTGSQGEIRK  319

Query  327   NCRKAN  310
              C K N
Sbjct  320   ICSKRN  325



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score =   442 bits (1137),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 251/306 (82%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + +SSAQLST FYSKSCP L+ T+KS ++SA+ +E RMGASLLRL FHDCFV GCDGS+
Sbjct  18    LIGNSSAQLSTGFYSKSCPKLYQTVKSAVQSAIKKETRMGASLLRLFFHDCFVNGCDGSL  77

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG+ VID+IKSA+EKVCPG+VSCADI+A+ ARDS V+LG
Sbjct  78    LLDDTSSFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILG  137

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GPNW VKLGRRD++TAS +AAN    +P P SNL+ LISSF   GLST D+VALSG++TI
Sbjct  138   GPNWNVKLGRRDARTASQAAANRS--IPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTI  195

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN + ASFA+ RQ  CPR +GSGD++LAPLDL+TP  FDNNY+KN
Sbjct  196   GQARCTTFRARIYNETNNLDASFARTRQSNCPRSSGSGDNSLAPLDLQTPNKFDNNYFKN  255

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+NKKGLLHSDQ L+NGGS DS+V  YS NP  F+S F  AMIKMG+IRPLTGS GEIRK
Sbjct  256   LVNKKGLLHSDQQLFNGGSADSIVTSYSNNPRSFSSDFVTAMIKMGDIRPLTGSNGEIRK  315

Query  327   NCRKAN  310
             NC + N
Sbjct  316   NCGRIN  321



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score =   442 bits (1136),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 213/303 (70%), Positives = 252/303 (83%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SSSAQLSTNFYSK+CP LF T++ VI+SA+  EKRMGAS+LRL FHDCFV GCDGS+LLD
Sbjct  21    SSSAQLSTNFYSKTCPNLFSTVQPVIQSAISSEKRMGASILRLFFHDCFVNGCDGSLLLD  80

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEKTA  N NS RG++VID IK+A+EK CPG+VSCADI+AI+ARDS VLLGGPN
Sbjct  81    DTSSFTGEKTANPNRNSARGFDVIDKIKAAVEKACPGVVSCADILAISARDSVVLLGGPN  140

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD++TASLS AN+   +P P S+LS LIS F  QGLS  ++VALSG++TIG++
Sbjct  141   WNVKLGRRDARTASLSGANNN--IPPPTSSLSNLISKFSAQGLSANEMVALSGAHTIGQA  198

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYNDTN I  SFAK R+  CP  +G+GD+NLAPLDL+TP  FDN+Y+KNL+N
Sbjct  199   RCTSFRARIYNDTN-IDGSFAKTRRSNCPSTSGNGDNNLAPLDLQTPTSFDNDYFKNLVN  257

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             +KGLLHSDQ L+N GSTDSLV  YS NP+ F+S F  AMIKMG+I PLTGS+GEIRKNCR
Sbjct  258   QKGLLHSDQQLFNKGSTDSLVSTYSTNPSKFSSDFVAAMIKMGDISPLTGSQGEIRKNCR  317

Query  318   KAN  310
             K N
Sbjct  318   KIN  320



>ref|XP_009606349.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   441 bits (1134),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 250/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SSSAQL+T FYSKSCP L+ T+KSV+ SA+ +E RMGASLLRL FHDCFV GCDGS+ LD
Sbjct  19    SSSAQLTTGFYSKSCPKLYETVKSVVHSAVQKETRMGASLLRLFFHDCFVNGCDGSLFLD  78

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             D S+F GEK A  N NS RG+ VIDDIKSA+EKVCPG+VSCADI+A+ ARDS V+LGGPN
Sbjct  79    DISTFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPN  138

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD++TAS +AANS   +P P SNL+ LISSF   GLST D+VALSG++TIG++
Sbjct  139   WDVKLGRRDARTASQAAANSS--IPPPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQA  196

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN+TN + +S AK RQ  CPR +GSGD+NLAPLDL+TP +FDN+Y+ NL++
Sbjct  197   RCTSFRARIYNETNNLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINLVS  256

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGS DS+VK YS NP  F + F  AMIKMG+IRPLTGS+GEIRKNCR
Sbjct  257   KKGLLHSDQQLFNGGSADSIVKSYSDNPNSFAADFVTAMIKMGDIRPLTGSKGEIRKNCR  316

Query  318   KAN  310
             + N
Sbjct  317   RIN  319



>ref|XP_009354386.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   440 bits (1131),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 251/306 (82%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F   S A+LSTNFYSKSCP +F  +KSV+KSA+ ++KRMGASLLRLHFHDCFV GCDGS+
Sbjct  24    FTGKSHAKLSTNFYSKSCPQVFDAVKSVVKSAVSKDKRMGASLLRLHFHDCFVNGCDGSL  83

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IKS +EK CPG+VSCADI+AIA+RDS  +LG
Sbjct  84    LLDDTSSFTGEKTALPNNNSLRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILG  143

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W+VKLGRRDSKTASLSAANS GV+P P + L+ L + F+  GLS  DLVALSG++TI
Sbjct  144   GPSWEVKLGRRDSKTASLSAANS-GVIPPPTATLNELTTRFRAVGLSQRDLVALSGAHTI  202

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I ASFA+ RQ  CPR  G GDDNLAPLD+ TP  FD  Y+KN
Sbjct  203   GQARCTTFRARIYNETN-IDASFARTRQNTCPRTAGHGDDNLAPLDITTPNTFDTAYFKN  261

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N+KGLLHSDQ L+NGG TDSLVK YS +   FN+ FA+AMIKMG+ +PLTGS+GEIR 
Sbjct  262   LVNQKGLLHSDQILFNGGPTDSLVKSYSGSANTFNADFAKAMIKMGDNKPLTGSKGEIRL  321

Query  327   NCRKAN  310
             NCRK N
Sbjct  322   NCRKPN  327



>ref|XP_010922691.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   439 bits (1130),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 210/303 (69%), Positives = 248/303 (82%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S+SAQLSTNFY+ SCP +F  +K V+++A+ +E+RMGASLLRL FHDCFVQGCDGSILLD
Sbjct  21    STSAQLSTNFYASSCPQVFSAVKPVVQAAIAKEQRMGASLLRLFFHDCFVQGCDGSILLD  80

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +F GEKTA  NNNSVRG++V+D+IK+A+EKVCPG+VSCADI+AI +RDS V+LGGPN
Sbjct  81    DTPTFMGEKTAVPNNNSVRGFDVVDNIKAAVEKVCPGVVSCADILAITSRDSVVILGGPN  140

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRDS TAS S AN+   +P P S+LS LIS F  QGLST D+VALSG +TIG++
Sbjct  141   WDVKLGRRDSTTASFSGANNN--IPPPNSSLSNLISKFAAQGLSTKDMVALSGGHTIGQA  198

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC  FR  IYNDT+ I +SFAK RQ  CP  +GSGD+NLAPLDL+TP  FDN+YYKNLIN
Sbjct  199   RCLNFRAHIYNDTD-IDSSFAKTRQMNCPSTSGSGDNNLAPLDLQTPTCFDNDYYKNLIN  257

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGSTDS V  YS NP+ FNS F   MI MG+I PLTGS G+IRKNCR
Sbjct  258   KKGLLHSDQELFNGGSTDSQVMTYSNNPSTFNSDFVTGMINMGDITPLTGSSGQIRKNCR  317

Query  318   KAN  310
             K N
Sbjct  318   KVN  320



>ref|XP_007011229.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY20039.1| Peroxidase superfamily protein [Theobroma cacao]
Length=321

 Score =   439 bits (1130),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 209/300 (70%), Positives = 250/300 (83%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQLSTN+YSK+CP LF T+KS + SA+ +E RMGASLLRL FHDCFV GCDGS+LLDDTS
Sbjct  25    AQLSTNYYSKTCPKLFPTVKSTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLLLDDTS  84

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GEK A  N NS RG++V+D+IKSA+E VCPG+VSCADI+ IAARDS  +LGGPNW V
Sbjct  85    SFTGEKNAAPNRNSARGFDVVDNIKSAVEDVCPGVVSCADILTIAARDSVAILGGPNWDV  144

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             KLGRRD++TAS +AAN+   +P P SNL+ LIS F   GLST D+VALSGS+TIG +RCT
Sbjct  145   KLGRRDARTASQAAANNS--IPPPTSNLNRLISRFNALGLSTRDMVALSGSHTIGLARCT  202

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN++N I +SFA+ RQR CPR TGSGD+NLAPLD++TP FFDNNY+KNLIN++G
Sbjct  203   SFRPRIYNESN-IDSSFAQTRQRNCPRTTGSGDNNLAPLDIQTPTFFDNNYFKNLINRRG  261

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS NP+ F+S F   MIKMG+I PLTGSRGEIRKNCR+ N
Sbjct  262   LLHSDQQLFNGGSTDSIVRGYSNNPSSFSSDFVTGMIKMGDISPLTGSRGEIRKNCRRVN  321



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score =   439 bits (1130),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 251/302 (83%), Gaps = 3/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             + AQLSTNFYSK+CP +F T+KS +++A+++E RMGASLLRL FHDCFV GCDGSILLDD
Sbjct  33    TDAQLSTNFYSKTCPNVFTTVKSQVQAAINKEARMGASLLRLFFHDCFVNGCDGSILLDD  92

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TS+F GEK A  N NS RG++V+D+IKSA+EKVCPG+VSCAD++AI ARDSTV+LGGP+W
Sbjct  93    TSTFTGEKNAAPNKNSARGFDVVDNIKSAVEKVCPGVVSCADLLAITARDSTVILGGPSW  152

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VK+GRRD++TAS +AAN+   +P P SNL+ LIS FQN GLST D+VALSGS+TIG++R
Sbjct  153   NVKVGRRDARTASQAAANNS--IPPPTSNLNNLISFFQNVGLSTRDMVALSGSHTIGQAR  210

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR RIYN+TN + +S AK RQ  CPR  GSGD+NLAPLDL+TP  FDNNYYKNL+  
Sbjct  211   CTNFRTRIYNETN-LDSSLAKTRQSNCPRTVGSGDNNLAPLDLQTPTKFDNNYYKNLLQN  269

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+NGGSTDSLV+ Y  NP+ F S F   MIKMG+I+PLTGS GEIRKNCRK
Sbjct  270   KGLLHSDQQLFNGGSTDSLVRTYGSNPSTFTSDFVAGMIKMGDIKPLTGSSGEIRKNCRK  329

Query  315   AN  310
              N
Sbjct  330   IN  331



>ref|XP_002873207.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49466.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   439 bits (1129),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 210/300 (70%), Positives = 248/300 (83%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T++S +KSA++ E RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQSAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IKSA+EK CPG+VSCADI+AIAARDS V+LGGPNW V
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AANS   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  148   KVGRRDARTASQAAANSN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+TN I A+FA  RQR CPR TGSGD NLAPLD+ T A FDNNY+KNL+ ++G
Sbjct  206   NFRARIYNETN-INAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLMTQRG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS NP+ FNS FA AMIKMG+I PLTGS GEIRK C + N
Sbjct  265   LLHSDQVLFNGGSTDSIVRGYSNNPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   439 bits (1128),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 252/305 (83%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + SS+AQL+TNFYSKSCP L  T+ SV++SA+++E RMGASLLRL FHDCFV GCDGSIL
Sbjct  21    IGSSNAQLTTNFYSKSCPNLLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSIL  80

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEKTA  N+ SVRG+ VID IKSA+EK CPG+VSCADI+ I ARDS V+LGG
Sbjct  81    LDDTSSFTGEKTALPNSGSVRGFEVIDQIKSAVEKACPGVVSCADILTITARDSVVILGG  140

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VKLGRRD++TAS +AAN+   +P P  +LS L+SSF NQGLSTTD+VAL+G +TIG
Sbjct  141   PTWNVKLGRRDARTASRTAANNN--IPQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIG  198

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR RIYN++N I ASFAK RQ  CPR + SG +NLAPLDL+TP  FDN YYKNL
Sbjct  199   QARCTSFRTRIYNESN-IDASFAKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYKNL  257

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +++KGLLHSDQ L++GGST+SLV+ Y  NP+ FN+ F  AMIKMG+I+PLTGS GE+RKN
Sbjct  258   VSQKGLLHSDQQLFSGGSTNSLVQTYGSNPSRFNADFIAAMIKMGDIKPLTGSNGEVRKN  317

Query  324   CRKAN  310
             CRK N
Sbjct  318   CRKTN  322



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   439 bits (1128),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 210/305 (69%), Positives = 253/305 (83%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + +++AQLST+FYSKSCP LF TIK V++SA+++EKRMGASL+RL FHDCFV GCDGS+L
Sbjct  24    ISTTNAQLSTSFYSKSCPNLFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVL  83

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEKTA  N NS RG+ VID IKSA+EK CPG+VSCADI+A+AARDSTV+LGG
Sbjct  84    LDDTSSFTGEKTALPNRNSARGFEVIDSIKSAVEKACPGVVSCADILAVAARDSTVILGG  143

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VKLGRRD++TASLSAAN+   +P P SNL+ LIS F   GLST DLVAL+GS+TIG
Sbjct  144   PTWNVKLGRRDARTASLSAANNG--IPPPTSNLNQLISRFNALGLSTRDLVALTGSHTIG  201

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR RIYN+TN I  SFA+ R+  CPR  G+GD+NLAPLDL+TP  FDNNY+KNL
Sbjct  202   QARCTSFRARIYNETN-IDNSFAQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFKNL  260

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +N+KGLLHSDQ L+NGGSTDS+V+ YS   + F S F   MIKMG+I PLTGS+GEIRKN
Sbjct  261   LNQKGLLHSDQQLFNGGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKN  320

Query  324   CRKAN  310
             CR+ N
Sbjct  321   CRRMN  325



>gb|EYU20115.1| hypothetical protein MIMGU_mgv1a025851mg [Erythranthe guttata]
Length=318

 Score =   438 bits (1127),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/308 (69%), Positives = 259/308 (84%), Gaps = 5/308 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + SSSAQLST++YSKSCP LF T+K+V++SA+  E RMGASLLRL FHDCFV GCDGSI
Sbjct  14    LIGSSSAQLSTDYYSKSCPNLFTTVKTVVRSAIQNEARMGASLLRLFFHDCFVNGCDGSI  73

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  N NSVRG+N++D+IKSA+EKVCP +VSCADI+A+A+RDS V+LG
Sbjct  74    LLDDTSSFTGEKTALPNRNSVRGFNIVDNIKSAVEKVCPNVVSCADILAVASRDSVVILG  133

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKVKLGRRDS+TASL+AAN+   +P P SNL+ LISSF + GLST DLV LSGS+TI
Sbjct  134   GPDWKVKLGRRDSRTASLAAANNS--IPPPTSNLNTLISSFNSLGLSTKDLVVLSGSHTI  191

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN + ASFA+ R+  CPR  G+GD+NLAPLD++TPA FDNNY+KN
Sbjct  192   GQARCTSFRARIYNETN-LDASFAQTRRGNCPRAAGAGDNNLAPLDVQTPANFDNNYFKN  250

Query  507   LINKKGLLHSDQALY--NGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEI  334
             LI+++GLLHSDQ L+  +GG TDS+V+ YS + A F S FA AMIKMG+I+P+TGS GEI
Sbjct  251   LISRRGLLHSDQQLFSGSGGRTDSIVRSYSSDSATFRSDFAAAMIKMGDIKPVTGSNGEI  310

Query  333   RKNCRKAN  310
             RKNCR  N
Sbjct  311   RKNCRILN  318



>ref|XP_006361306.1| PREDICTED: peroxidase 4-like [Solanum tuberosum]
Length=319

 Score =   438 bits (1127),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 208/306 (68%), Positives = 250/306 (82%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + SSSAQL+T FYSKSCP L+ T+KSV+ SA+ +E RMGASLLRL FHDCFV GCDGS+
Sbjct  16    LVGSSSAQLTTGFYSKSCPKLYETVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSL  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
              LDDTS+F GEK A  N NS RG+ VID+IKSA+EKVCPG+VSCADI+A+ ARDS V+LG
Sbjct  76    FLDDTSTFTGEKRAQPNFNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GPNW VKLGRRD++TAS  AAN+   +P+P SNL+ LISSF   GLST D+VALSG++TI
Sbjct  136   GPNWDVKLGRRDARTASQGAANNS--IPTPTSNLNRLISSFSAVGLSTKDMVALSGAHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+T  + AS A+ RQ  CPR +GSGD+NLAPLDL+TP  FDN+Y+ N
Sbjct  194   GQARCTSFRGRIYNETKNMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYFIN  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+NKKGLLHSDQ L+NGGS DS+VK YS NP+ F S F  AMIKMG+ RPLTGS+GEIRK
Sbjct  254   LVNKKGLLHSDQQLFNGGSVDSIVKSYSNNPSSFTSDFVTAMIKMGDNRPLTGSKGEIRK  313

Query  327   NCRKAN  310
             NCR+ N
Sbjct  314   NCRRIN  319



>gb|KHG18057.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=322

 Score =   438 bits (1127),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 207/303 (68%), Positives = 252/303 (83%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S++AQLSTNFYSKSCP L  T+KS + SA+++E RMGASLLRL FHDCFV GCDGS+LLD
Sbjct  23    STNAQLSTNFYSKSCPKLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLD  82

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEK A  N NS RG++V+D+IKSA+E VCPG+VSCADI+AI ARDS  +LGGP 
Sbjct  83    DTSSFTGEKNAIPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAITARDSVEILGGPK  142

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD+++AS SAAN+   +P+P SNL+ L S F   GLST DLVALSG++TIG++
Sbjct  143   WAVKLGRRDARSASQSAANNG--IPAPTSNLNQLTSRFNALGLSTRDLVALSGAHTIGQA  200

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN++N I ASFA+ RQR CPR TGSGD+NLAPLD++TP  FDNNY+KNL++
Sbjct  201   RCTSFRARIYNESN-IDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLVS  259

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             ++GLLHSDQ L+NGGSTDS+V+ Y  +P+ FNS F  AMIKMG+I PLTGSRGEIRKNCR
Sbjct  260   RRGLLHSDQQLFNGGSTDSIVRGYGNSPSSFNSDFVSAMIKMGDISPLTGSRGEIRKNCR  319

Query  318   KAN  310
             + N
Sbjct  320   RVN  322



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   438 bits (1126),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 252/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + ++SAQLSTNFYS SCP LF T+KS ++SA+ +E RMGASLLRLHFHDCFV GCDGS+
Sbjct  17    LMSTTSAQLSTNFYSSSCPRLFSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSL  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG++V+D+IKSA+E VCPG+VSCADI+AIAARDS V LG
Sbjct  77    LLDDTSSFTGEKNAAPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVVTLG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD++TAS +AAN+   +P P  NL+ LIS+F   GLST DLVALSGS+TI
Sbjct  137   GPSWNVKLGRRDARTASQAAANNN--IPPPTRNLNQLISTFSAVGLSTRDLVALSGSHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN + +S A+ R+  CPR +GSGD+NLAPLDL+TP  FDNNY+KN
Sbjct  195   GQARCTSFRPRIYNETN-LDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFKN  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI  KGLLHSDQ L+NGGSTDS+V+ YS +   F+S FA AMIKMG+I+PLTGS GEIRK
Sbjct  254   LIQNKGLLHSDQQLFNGGSTDSIVRAYSNSYNAFSSDFASAMIKMGDIKPLTGSSGEIRK  313

Query  327   NCRKAN  310
             NCRK N
Sbjct  314   NCRKTN  319



>ref|XP_011008654.1| PREDICTED: peroxidase P7 [Populus euphratica]
Length=322

 Score =   437 bits (1125),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 253/305 (83%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + SS+AQLST+FYSKSCP LF T+K V++SA+++E R+GAS+LRL FHDCFV GCDGS+L
Sbjct  21    MGSSNAQLSTDFYSKSCPHLFSTVKPVVQSAINKEARIGASILRLFFHDCFVNGCDGSLL  80

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEK A  N NS RG+ VID+IKSA+EK CPG+VSCAD++AIAARDSTV+LGG
Sbjct  81    LDDTSSFTGEKNAAPNRNSARGFEVIDNIKSAVEKACPGVVSCADVLAIAARDSTVILGG  140

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VKLGRRD++TAS +AAN+   +P P SNL+ LIS F   GLST D+VALSGS+TIG
Sbjct  141   PQWNVKLGRRDARTASQAAANNS--IPPPTSNLNQLISRFNALGLSTRDMVALSGSHTIG  198

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR RIYN+T TI +S A+ R+  CPR +GSGD+NLAPLDL+TP  F+NNYYKNL
Sbjct  199   QARCTNFRARIYNET-TIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNL  257

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +N++GLLHSDQ L+NGGSTDS+V+ YS N   F S F   MIKMG+IRPLTGSRGEIRKN
Sbjct  258   VNRRGLLHSDQQLFNGGSTDSIVRTYSYNENTFRSDFVAGMIKMGDIRPLTGSRGEIRKN  317

Query  324   CRKAN  310
             CR+ N
Sbjct  318   CRRIN  322



>ref|XP_008244108.1| PREDICTED: peroxidase 4 [Prunus mume]
Length=325

 Score =   437 bits (1124),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 251/307 (82%), Gaps = 3/307 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFYSKSCP +F  +KSV++SA++ EKRMGASLLRLHFHDCFV GCDGSI
Sbjct  21    FTGSSSAQLSTNFYSKSCPKVFHAVKSVVQSAVNREKRMGASLLRLHFHDCFVNGCDGSI  80

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSFKGEKTA  NN SVRG+ V+D IKS +EK CPGIVSCADI+AI ARDS  +LG
Sbjct  81    LLDDTSSFKGEKTAGPNNKSVRGFEVVDKIKSQVEKTCPGIVSCADILAITARDSVKILG  140

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             G +W VKLGRRDSKTAS +AANS GVLP P S LS L + FQ  GL+  DLVALSG++TI
Sbjct  141   GSSWNVKLGRRDSKTASFTAANS-GVLPPPTSTLSNLKTRFQAVGLNERDLVALSGAHTI  199

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I ASFAK RQ KCP   GSGD+NLAPLD++TP  FD  Y+KN
Sbjct  200   GKARCTSFRLRIYNETN-IDASFAKVRQSKCPSTAGSGDNNLAPLDVQTPDTFDTAYFKN  258

Query  507   LINKKGLLHSDQALY-NGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             LIN+KGLLHSDQ L+ NGGSTDSLVK YS +   FNS FA+AMIKMG+ +PLTGS GEIR
Sbjct  259   LINQKGLLHSDQILFNNGGSTDSLVKTYSGSANTFNSDFAKAMIKMGDNKPLTGSNGEIR  318

Query  330   KNCRKAN  310
              NCR+ N
Sbjct  319   LNCRRPN  325



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   437 bits (1123),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 203/305 (67%), Positives = 253/305 (83%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + +S+AQLSTNFYS SCP L  T+KSV++SA++ E RMGASLLRL FHDCFV GCDGS+L
Sbjct  22    IGNSNAQLSTNFYSSSCPNLLSTVKSVVQSAVNNEARMGASLLRLFFHDCFVNGCDGSVL  81

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEK AF N  S+RG++V+D IK+A+EK CPG+VSCADI+AI+ARDS V+LGG
Sbjct  82    LDDTSSFTGEKNAFPNAGSLRGFDVVDQIKTAVEKACPGVVSCADILAISARDSVVILGG  141

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VKLGRRD+ TAS SAAN+   +P+P ++LSALI SF +QGLSTTD+VALSG++TIG
Sbjct  142   PTWNVKLGRRDATTASQSAANTN--IPAPTASLSALIKSFSDQGLSTTDMVALSGAHTIG  199

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR RIYN++N I ASFAK RQ  CP  + SG +NLAPLD++TP  FDN YY NL
Sbjct  200   QARCTTFRTRIYNESN-IDASFAKTRQANCPSASTSGSNNLAPLDIQTPNTFDNKYYNNL  258

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +N+KGLLHSDQ L++GGST++LV+ YS NP+ FN+ F  AMI MG+++PLTGS G+IRKN
Sbjct  259   VNQKGLLHSDQQLFSGGSTNALVQTYSSNPSRFNTDFVAAMINMGDVKPLTGSNGQIRKN  318

Query  324   CRKAN  310
             CRK N
Sbjct  319   CRKTN  323



>ref|XP_004500341.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=326

 Score =   437 bits (1123),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 209/305 (69%), Positives = 253/305 (83%), Gaps = 2/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + +SSAQL  NFY K CP +F T+++V+KSA+ +E+R+GASLLRL FHDCFV GCDGSIL
Sbjct  24    IGTSSAQLDENFYCKKCPNVFDTVETVVKSAVSKEQRIGASLLRLFFHDCFVDGCDGSIL  83

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSFKGEKTA  NNNS RG+ VID IKS +E +CPG+VSCADI+AIA+RDS V+LGG
Sbjct  84    LDDTSSFKGEKTAAPNNNSARGFEVIDAIKSKLEAICPGVVSCADILAIASRDSVVILGG  143

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VK+GRRDS+TA+  AAN+ GVLPSP SNL+ LIS+F+ QGLS  D+VALSG++TIG
Sbjct  144   PFWNVKVGRRDSRTANFIAANT-GVLPSPASNLTKLISTFKAQGLSVKDMVALSGAHTIG  202

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             E+RCT FR+ IYN+ N I ++FAK RQRKCP   G+GD+NLA LDL+TP  FDNNYYKNL
Sbjct  203   EARCTSFRNHIYNE-NNIDSTFAKIRQRKCPSTVGTGDNNLANLDLQTPTHFDNNYYKNL  261

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             I KKGLLHSDQ L+NGGSTDSLV+ Y++N   F+S F  AMIKMGN +PLTG +GEIRKN
Sbjct  262   IIKKGLLHSDQELFNGGSTDSLVQTYTQNEKAFDSDFVAAMIKMGNNKPLTGGQGEIRKN  321

Query  324   CRKAN  310
             CR+ N
Sbjct  322   CRRLN  326



>gb|ABV24960.2| putative secretory peroxidase [Catharanthus roseus]
Length=330

 Score =   436 bits (1122),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 252/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + S S QLS+ FYSK+CP ++ T++  ++SA+ +EKRMGASLLRLHFHDCFVQGCDGSI
Sbjct  28    MMRSCSGQLSSEFYSKTCPQVYNTVRKGVESAVSKEKRMGASLLRLHFHDCFVQGCDGSI  87

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSS +GEKTA  N  SVRG++V+D+IKS +EKVCPG+VSCADI+AIAARDS V LG
Sbjct  88    LLDDTSSLRGEKTAGPNVGSVRGFDVVDNIKSDVEKVCPGVVSCADILAIAARDSVVALG  147

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKVK+GRRDSKTASLS ANS   +P P SNL  LISSFQ  GLS  D+V LSGS+TI
Sbjct  148   GPSWKVKVGRRDSKTASLSGANSR--IPPPTSNLRNLISSFQAVGLSAKDMVVLSGSHTI  205

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT+FR RIYN++N I  SFA+ RQ  CP  TG+GD++LAPLDL++P  FD NYYKN
Sbjct  206   GQARCTVFRARIYNESN-IETSFARTRQGNCPLPTGNGDNSLAPLDLQSPNGFDINYYKN  264

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LINKKGLLHSDQ LYNGGST+SLV+ YSK+   F S FA AMIKMG+I PLTGS GE+RK
Sbjct  265   LINKKGLLHSDQELYNGGSTNSLVEAYSKDTKAFYSDFAAAMIKMGDISPLTGSNGEVRK  324

Query  327   NCRKAN  310
             NCR+ N
Sbjct  325   NCRRVN  330



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score =   436 bits (1120),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 211/303 (70%), Positives = 249/303 (82%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S++AQLSTNFY  SCP LF ++KS ++SA+ +E RMGASLLRL FHDCFV GCDGSILLD
Sbjct  21    SANAQLSTNFYYHSCPNLFSSVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLD  80

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEK A  N NS RG+ VID+IKSA+EKVCPG+VSCADI+AIAARDS  +LGGP 
Sbjct  81    DTSSFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPT  140

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD++TAS SAAN+   +P+P SNL+ LIS F   GLST DLVALSG +TIG++
Sbjct  141   WNVKLGRRDARTASQSAANNG--IPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQA  198

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN+TN I  +FA+ RQ+ CPR +GSGD+NLAPLDL+TP  FDN Y+KNL+ 
Sbjct  199   RCTNFRARIYNETN-IETAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQ  257

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGSTDS+V+ YS NP  F+S FA AMIKMG+I PLTGS GEIRKNCR
Sbjct  258   KKGLLHSDQQLFNGGSTDSIVRGYSTNPGTFSSDFAAAMIKMGDISPLTGSNGEIRKNCR  317

Query  318   KAN  310
             + N
Sbjct  318   RIN  320



>ref|XP_003538328.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=329

 Score =   436 bits (1121),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 205/303 (68%), Positives = 256/303 (84%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSA LS NFYSK+CP +F T+KSV+KSA+ +E R+GAS++RL FHDCFVQGCDGSILLD
Sbjct  29    TSSATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLD  88

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +F+GEKTA ANNNSVRGY +IDDIKS +EK+CPG+VSCADI+ IA+RDS VLLGGP 
Sbjct  89    DTPTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPF  148

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W V+LGRRDS++A+ +AAN+ GV+P P SNL+ LI+ FQ+QGLS  D+VALSG++T G++
Sbjct  149   WNVRLGRRDSRSANFTAANT-GVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKA  207

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FRDRIYN TN I  +FA  RQR+CPR  G+GD+NLA LD  TP  FDNNY+KNL+ 
Sbjct  208   RCTSFRDRIYNQTN-IDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLI  266

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             K+GLL+SDQ L+NGGSTDSLV+ YS+N   F+S F +AMI+MG+I+PLTGS+GEIRKNCR
Sbjct  267   KRGLLNSDQVLFNGGSTDSLVRTYSQNNKAFDSDFVKAMIRMGDIKPLTGSQGEIRKNCR  326

Query  318   KAN  310
             + N
Sbjct  327   RVN  329



>gb|KHN46282.1| Peroxidase 4 [Glycine soja]
Length=330

 Score =   436 bits (1121),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 205/303 (68%), Positives = 256/303 (84%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSA LS NFYSK+CP +F T+KSV+KSA+ +E R+GAS++RL FHDCFVQGCDGSILLD
Sbjct  30    TSSATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLD  89

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +F+GEKTA ANNNSVRGY +IDDIKS +EK+CPG+VSCADI+ IA+RDS VLLGGP 
Sbjct  90    DTPTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPF  149

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W V+LGRRDS++A+ +AAN+ GV+P P SNL+ LI+ FQ+QGLS  D+VALSG++T G++
Sbjct  150   WNVRLGRRDSRSANFTAANT-GVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKA  208

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FRDRIYN TN I  +FA  RQR+CPR  G+GD+NLA LD  TP  FDNNY+KNL+ 
Sbjct  209   RCTSFRDRIYNQTN-IDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLI  267

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             K+GLL+SDQ L+NGGSTDSLV+ YS+N   F+S F +AMI+MG+I+PLTGS+GEIRKNCR
Sbjct  268   KRGLLNSDQVLFNGGSTDSLVRTYSQNNKAFDSDFVKAMIRMGDIKPLTGSQGEIRKNCR  327

Query  318   KAN  310
             + N
Sbjct  328   RVN  330



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   436 bits (1120),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 252/303 (83%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S++AQLSTNFYSKSCP L  T+KS + SA+++E RMGASLLRL FHDCFV GCDGS+LLD
Sbjct  31    STNAQLSTNFYSKSCPNLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLD  90

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEK A  N NS RG++V+D+IKSA+E VCPG+VSCADI+AIAARDS  +LGGP 
Sbjct  91    DTSSFTGEKNANPNRNSSRGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVEILGGPK  150

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD+++AS SAAN+   +P P SNL+ L S F   GLST DLVALSG++TIG++
Sbjct  151   WAVKLGRRDARSASQSAANNG--IPPPTSNLNRLTSRFNALGLSTRDLVALSGAHTIGQA  208

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN++N I ASFA+ RQR CPR TGSGD+NLAPLD++TP  FDNNY+KNLI+
Sbjct  209   RCTSFRARIYNESN-IDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLIS  267

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             ++GLLHSDQ L+NGGSTDS+V+ Y  +P+ FNS F  AMIKMG+I PLTGSRGEIRKNCR
Sbjct  268   QRGLLHSDQQLFNGGSTDSIVRGYGNSPSSFNSDFVAAMIKMGDISPLTGSRGEIRKNCR  327

Query  318   KAN  310
             + N
Sbjct  328   RVN  330



>ref|XP_004240883.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=319

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 208/306 (68%), Positives = 249/306 (81%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + SSSAQL+T FYSKSCP L+ T+KSV+ SA+ +E RMGASLLRL FHDCFV GCDGS+
Sbjct  16    LVGSSSAQLTTGFYSKSCPKLYQTVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSL  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
              LDDTS+F GEK A  N NS RG+ VID+IKSA+EKVC G+VSCADI+A+ ARDS V+LG
Sbjct  76    FLDDTSTFTGEKRAQPNFNSARGFEVIDNIKSAVEKVCLGVVSCADILAVTARDSVVILG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GPNW VKLGRRD++TAS  AAN+   +P+P SNL+ LISSF   GLST D+VALSG++TI
Sbjct  136   GPNWDVKLGRRDARTASQGAANNS--IPTPTSNLNRLISSFTAVGLSTKDMVALSGAHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+T  + AS A+ RQ  CPR +GSGD+NLAPLDL+TP  FDN+Y+ N
Sbjct  194   GQARCTSFRGRIYNETKNMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYFIN  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+NKKGLLHSDQ L+NGGS DS+VK YS NP+ F S F  AMIKMG+IRPLTGS GEIRK
Sbjct  254   LVNKKGLLHSDQQLFNGGSVDSIVKSYSNNPSSFISDFVTAMIKMGDIRPLTGSNGEIRK  313

Query  327   NCRKAN  310
             NCR+ N
Sbjct  314   NCRRIN  319



>ref|XP_004307713.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=323

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 249/307 (81%), Gaps = 3/307 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F+ +S+AQLS+NFYSKSCP LF  +KS ++ A+  E RMGAS+LRLHFHDCFV GCDGS+
Sbjct  19    FMGTSTAQLSSNFYSKSCPRLFSIVKSTVQPAIRNEPRMGASILRLHFHDCFVNGCDGSV  78

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT++F GEK A  N NS+RG+NVID+IKSA+E VCPG+VSCADI+AI ARDS  +LG
Sbjct  79    LLDDTANFTGEKNAVPNKNSLRGFNVIDNIKSAVENVCPGVVSCADILAITARDSVAILG  138

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD++TAS +AAN+   +P P SNL+ LIS F   GLST D+VALSGS+TI
Sbjct  139   GPSWNVKLGRRDARTASQAAANNS--IPPPTSNLNQLISRFNALGLSTKDMVALSGSHTI  196

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR R+YN+TN + +S A+ RQ  CPR TGSGD+NLAPLDL++P  FDNNYY N
Sbjct  197   GQARCTSFRARVYNETNNLDSSLAQTRQSNCPRTTGSGDNNLAPLDLQSPTAFDNNYYNN  256

Query  507   LINKKGLLHSDQALY-NGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             LI  +GLLHSDQ L+ NGGSTDS+V+ YS + + F S FA AMIKMGNI PLTGS GEIR
Sbjct  257   LIKNRGLLHSDQQLFLNGGSTDSIVRGYSSSQSTFTSDFAAAMIKMGNINPLTGSNGEIR  316

Query  330   KNCRKAN  310
             KNCRK N
Sbjct  317   KNCRKPN  323



>ref|XP_006470332.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=320

 Score =   434 bits (1117),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 208/303 (69%), Positives = 249/303 (82%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S++AQLSTNFY+ +C  L  T+KSV++SA+ +E RMGASLLRL FHDCFV GCDGS+LLD
Sbjct  21    STNAQLSTNFYANTCKNLLPTVKSVVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLD  80

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEK A AN NS RG+ VID+IKSA+EK CPG+VSCADI+AI ARDS V+LGGP+
Sbjct  81    DTSSFTGEKNANANRNSARGFQVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPS  140

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W+VKLGRRD++TASLSAANS   +P+P SNL+ L S F   GLS  DLVAL+G +TIG++
Sbjct  141   WRVKLGRRDARTASLSAANSG--IPAPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQA  198

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  IYN+TN I ASFA+ RQ  CPR  G+GD+NLAPLDL+TP  FDNNY+KNL+N
Sbjct  199   RCTSFRAHIYNETN-IDASFARTRQGNCPRANGTGDNNLAPLDLQTPTCFDNNYFKNLVN  257

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             +KGLLHSDQ L+NGGSTDS V+ YS NP+ F+S F   MIKMG+I PLTGSRGEIRKNCR
Sbjct  258   RKGLLHSDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRKNCR  317

Query  318   KAN  310
             + N
Sbjct  318   RVN  320



>ref|XP_006376028.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|ERP53825.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|AHL39175.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   434 bits (1115),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 249/305 (82%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + SS+AQLS +FYSKSCP L  T+K V++SA+++E RMGAS+LRL FHDCFV GCDGS+L
Sbjct  21    MGSSNAQLSIDFYSKSCPHLLSTVKPVVQSAINKEARMGASILRLFFHDCFVNGCDGSLL  80

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEK A  N NS RG+ VID+IKSA+EK CPG+VSCADI+AIAARDSTV+LGG
Sbjct  81    LDDTSSFTGEKNAAPNKNSARGFEVIDNIKSAVEKACPGVVSCADILAIAARDSTVILGG  140

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VKLGRRD++TAS +AAN+   +P P SNL+ LIS F   GLST D+VALSGS+TIG
Sbjct  141   PEWDVKLGRRDARTASQAAANNS--IPRPTSNLNQLISRFNALGLSTRDMVALSGSHTIG  198

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR RIYN+T TI +S A+ R+  CPR +GSGD+NLAPLDL+TP  F+NNYYKNL
Sbjct  199   QARCTNFRARIYNET-TIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNL  257

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             IN++GLLHSDQ L+NGGSTDS+V  YS N   F S F   MIKMG+IRPLTGSRGEIR N
Sbjct  258   INRRGLLHSDQQLFNGGSTDSIVSTYSSNENTFRSDFVAGMIKMGDIRPLTGSRGEIRNN  317

Query  324   CRKAN  310
             CR+ N
Sbjct  318   CRRIN  322



>ref|XP_011076613.1| PREDICTED: peroxidase P7 [Sesamum indicum]
Length=321

 Score =   434 bits (1115),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 208/306 (68%), Positives = 251/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL SSSAQLS +FYSKSCP LF T+KSV+ SA+  E RMGASLLRL FHDCFV GCDGSI
Sbjct  19    FLSSSSAQLSPDFYSKSCPNLFATVKSVVHSAVQNEARMGASLLRLFFHDCFVNGCDGSI  78

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG++V+D IKSA+EK CPG+VSCAD++AIAARDS V+LG
Sbjct  79    LLDDTSSFTGEKGAVPNRNSARGFDVVDQIKSAVEKACPGVVSCADVLAIAARDSVVILG  138

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD+KTAS +AAN+   +P P SNL+ALIS F   GLST DLVALSGS+TI
Sbjct  139   GPDWNVKLGRRDAKTASRAAANNG--IPPPTSNLNALISRFNALGLSTKDLVALSGSHTI  196

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN++N +  S A+ R+  CPR +G GD+NLAPLDL+TP  FDNNY+KN
Sbjct  197   GQARCTSFRARIYNESN-LDTSLAQTRKGNCPRASGVGDNNLAPLDLQTPTNFDNNYFKN  255

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L++++GLLHSDQ L+ GG+TDS+V+ YS +P  F S FA AM+KMG+IRPLTGS GE+RK
Sbjct  256   LVSRRGLLHSDQQLFIGGATDSIVRTYSNDPNTFKSDFAAAMLKMGDIRPLTGSNGEVRK  315

Query  327   NCRKAN  310
             NCR+ N
Sbjct  316   NCRRVN  321



>gb|AAR31108.1| peroxidase precursor [Quercus suber]
Length=330

 Score =   434 bits (1115),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 210/307 (68%), Positives = 250/307 (81%), Gaps = 3/307 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  +SSA+LSTNFYSKSCP +F T++SV+ SA+ ++ R GASLLRLHFHDCFV GCDGSI
Sbjct  25    FTGNSSAKLSTNFYSKSCPKVFSTVQSVVHSAVSKQPRQGASLLRLHFHDCFVNGCDGSI  84

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT +F GEKTA  NN S+R + V+D+IKS +EK CPG+VSCADI+AIAARDS  +LG
Sbjct  85    LLDDTPTFTGEKTARPNNGSIRAFEVVDEIKSKVEKECPGVVSCADILAIAARDSVKILG  144

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRDSKTAS SAANS GV+P P S L  LI+ F+ +GLST D+VALSG++T+
Sbjct  145   GPKWDVKLGRRDSKTASFSAANS-GVIPPPTSTLGNLINRFKAKGLSTKDMVALSGAHTV  203

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTG-SGDDNLAPLDLETPAFFDNNYYK  511
             G++RCT+FRDRIY D N I +SFAK RQ KCP+ TG  GD+ +APLDL+TP  FDN YYK
Sbjct  204   GQARCTVFRDRIYKDKN-IDSSFAKTRQNKCPKTTGLPGDNKIAPLDLQTPTAFDNYYYK  262

Query  510   NLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             NLI +KGLL SDQ L+NGGSTDSLVKKYS++   F S F  AMIKMG+I+PLTGS GEIR
Sbjct  263   NLIKEKGLLRSDQQLFNGGSTDSLVKKYSQDTKTFYSDFVNAMIKMGDIQPLTGSSGEIR  322

Query  330   KNCRKAN  310
             KNCRK N
Sbjct  323   KNCRKVN  329



>ref|XP_008244444.1| PREDICTED: peroxidase 4-like [Prunus mume]
Length=322

 Score =   433 bits (1114),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 216/307 (70%), Positives = 256/307 (83%), Gaps = 6/307 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFYSKSCP +F  +KSV++SA+ +EKR+GASLLRLHFHDCFV+GCDGS+
Sbjct  21    FTGSSSAQLSTNFYSKSCPKVFHAVKSVVRSAVKKEKRIGASLLRLHFHDCFVKGCDGSV  80

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IKS +EK CPG+VSCADI+AIAARDS  +LG
Sbjct  81    LLDDTSSFTGEKTAAPNNNSLRGFKVVDKIKSKVEKRCPGVVSCADILAIAARDSVKILG  140

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKVKLGRRDSKTASL+AAN    LP+P S LS L + F+  GL+  DLVALSG++TI
Sbjct  141   GPSWKVKLGRRDSKTASLAAANRS--LPAPTSTLSQLKTGFRAVGLNERDLVALSGAHTI  198

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G+++CT FR RIYN+TN I ASFAK RQRKCPR   +GD+NLAPLD++TP  FD  Y+KN
Sbjct  199   GKAKCTSFRVRIYNETN-IDASFAKARQRKCPRT--AGDNNLAPLDVQTPHTFDTAYFKN  255

Query  507   LINKKGLLHSDQALY-NGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             LIN+KGLLHSDQ LY NGGST+SLVKKYS +   FNS FA+AMIKMG+ +PLTGS GEIR
Sbjct  256   LINQKGLLHSDQILYNNGGSTNSLVKKYSGSAHTFNSDFAKAMIKMGDNKPLTGSNGEIR  315

Query  330   KNCRKAN  310
              NCR+ N
Sbjct  316   LNCRRPN  322



>ref|XP_008369321.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   433 bits (1113),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 250/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + +++AQLST FYS SCP LF T+KS + SA+ +E RMGASLLRLHFHDCFV GCDGS+
Sbjct  17    LMRTTNAQLSTKFYSSSCPKLFSTVKSTVHSAIQKETRMGASLLRLHFHDCFVNGCDGSL  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG+NV+D IKSA+E  CPG+VSCADI+AIAAR+S  +LG
Sbjct  77    LLDDTSSFTGEKNAVPNKNSARGFNVVDKIKSAVENACPGVVSCADILAIAARESVTVLG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD++TAS +AAN+   +P P  NL+ L+S+F   GLST DLVALSGS+TI
Sbjct  137   GPSWDVKLGRRDTRTASQAAANNS--IPPPTRNLNQLVSTFNALGLSTRDLVALSGSHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN + +S A+ RQ  CPR +GSGD+NLAPLDL++P FFDN+Y+KN
Sbjct  195   GQARCTTFRPRIYNETN-LDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTFFDNSYFKN  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI  KGLLHSDQ L+NGGSTDS+V+ YS +   F+S FA+AMIKMG+I+PLTGS GEIRK
Sbjct  254   LIQNKGLLHSDQQLFNGGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSNGEIRK  313

Query  327   NCRKAN  310
             NCRK N
Sbjct  314   NCRKPN  319



>ref|XP_009369255.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   433 bits (1113),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 205/306 (67%), Positives = 251/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + +++AQLST FYS SCP LF T+KS ++SA+ +E R GASLLRLHFHDCFV GCDGS+
Sbjct  17    LMRTTNAQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRTGASLLRLHFHDCFVNGCDGSL  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG+NV+D IKSA+E VCPG+VSCADI+AIAARDS  +LG
Sbjct  77    LLDDTSSFTGEKNAVPNKNSARGFNVVDKIKSAVENVCPGVVSCADILAIAARDSVTILG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD++TAS +AAN+   +P P  NL+ LIS+F   GLST DLVALSGS+TI
Sbjct  137   GPSWDVKLGRRDTRTASQAAANNS--IPPPTRNLNQLISTFNALGLSTRDLVALSGSHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN + +S A+ RQ  CPR +GSGD+NLAPLDL++P  FDN+Y+KN
Sbjct  195   GQARCTTFRPRIYNETN-LDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKN  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI KKGLLHSDQ L+NGGSTDS+V+ Y  + + F+S FA+AMIKMG+I+PLTGS GEIRK
Sbjct  254   LIQKKGLLHSDQQLFNGGSTDSIVRAYRNSYSTFSSDFAKAMIKMGDIKPLTGSNGEIRK  313

Query  327   NCRKAN  310
             NCRK N
Sbjct  314   NCRKPN  319



>gb|ACU17608.1| unknown [Glycine max]
Length=320

 Score =   433 bits (1113),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 247/303 (82%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S++AQLSTNFY  SCP LF ++KS ++SA+ +E RMGASLLRL FHDCFV GCDGSILLD
Sbjct  21    SANAQLSTNFYYHSCPNLFSSVKSAVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLD  80

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEK A  N NS RG+ VID+IKSA+EKVCPG+VSCADI+AIAARDS  +LGGP 
Sbjct  81    DTSSFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPT  140

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD++TAS SAAN+   +P+P SNL+ LIS F   GLST DLVALSG +TIG++
Sbjct  141   WNVKLGRRDARTASQSAANNG--IPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQA  198

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN+TN I  +FA+ RQ+ CPR +GSGD+NLAPLDL+TP  FDN Y+KNL+ 
Sbjct  199   RCTNFRARIYNETN-IGTAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQ  257

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKG LHSDQ L+NGGSTDS+V+ YS NP  F S FA AMIKMG+I PLTGS GE+RKNCR
Sbjct  258   KKGFLHSDQQLFNGGSTDSIVRGYSTNPGTFPSDFAAAMIKMGDISPLTGSNGEVRKNCR  317

Query  318   KAN  310
             + N
Sbjct  318   RIN  320



>ref|NP_196153.1| peroxidase 52 [Arabidopsis thaliana]
 sp|Q9FLC0.1|PER52_ARATH RecName: Full=Peroxidase 52; Short=Atperox P52; AltName: Full=ATP49; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09977.1| peroxidase [Arabidopsis thaliana]
 gb|AAL38746.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED90861.1| peroxidase 52 [Arabidopsis thaliana]
Length=324

 Score =   433 bits (1113),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 246/300 (82%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T+++ +KSA++ E RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IKSA+EK CPG+VSCADI+AIAARDS V LGGPNW V
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AANS   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  148   KVGRRDARTASQAAANSN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+TN I A+FA  RQR CPR +GSGD NLAPLD+ T A FDNNY+KNL+ ++G
Sbjct  206   NFRARIYNETN-INAAFATTRQRTCPRASGSGDGNLAPLDVTTAASFDNNYFKNLMTQRG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS NP+ FNS F  AMIKMG+I PLTGS GEIRK C + N
Sbjct  265   LLHSDQVLFNGGSTDSIVRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_009363847.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
 ref|XP_009363901.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   432 bits (1111),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 205/306 (67%), Positives = 251/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + +++AQLST FYS SCP LF T+KS ++SA+ +E RMGASLLRLHFHDCFV GCDGS+
Sbjct  17    LMRTTNAQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRMGASLLRLHFHDCFVNGCDGSL  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG+NV+D IK A+E VCPG+VSCADI+AIAARDS  +LG
Sbjct  77    LLDDTSSFTGEKNAVPNKNSARGFNVVDKIKFAVENVCPGVVSCADILAIAARDSVTILG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD++TAS +AAN+   +P P  NL+ LIS+F   GLST DLVALSGS+TI
Sbjct  137   GPSWDVKLGRRDTRTASQAAANNS--IPPPTRNLNQLISTFNALGLSTRDLVALSGSHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR R+YN+TN + +S AK RQ  CPR +GSGD+NLAPLDL++P  FDN+Y+KN
Sbjct  195   GQARCTTFRPRVYNETN-LDSSLAKTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKN  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI KKGLLHSDQ L+N GSTDS+V+ YS +   F+S FA+AMIKMG+I+PLTGS+GEIRK
Sbjct  254   LIQKKGLLHSDQQLFNRGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSKGEIRK  313

Query  327   NCRKAN  310
             NCRK N
Sbjct  314   NCRKPN  319



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score =   432 bits (1111),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 210/305 (69%), Positives = 246/305 (81%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             L  ++AQLSTNFY  SCP L  T+KS ++SA+ +E R+GASLLRL FHDCFV GCDGSIL
Sbjct  19    LGCANAQLSTNFYYTSCPKLLSTVKSSMQSAISKETRIGASLLRLFFHDCFVNGCDGSIL  78

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEK A  N NS RGY VID IKSA+EKVCPG+VSCADI+AIAARDS  +LGG
Sbjct  79    LDDTSSFTGEKNANPNRNSARGYEVIDSIKSAVEKVCPGVVSCADILAIAARDSVGILGG  138

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VKLGRRD++TAS SAANS   +P P SNL+ LIS F   GLST D+VALSG +TIG
Sbjct  139   PTWDVKLGRRDARTASQSAANS--AIPPPTSNLNQLISKFSAVGLSTKDMVALSGGHTIG  196

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             +SRCT FR RIYN++N I  SFA+ RQ  CPR +GSGD+NLAPLDL+TP  FDN Y+KNL
Sbjct  197   QSRCTSFRARIYNESN-IDTSFARTRQSSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNL  255

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             + KKGLLHSDQ L+NGGSTDS+V+ YS NP+ F+S F  AMIKMG+I PLTGS+GE+RKN
Sbjct  256   VQKKGLLHSDQQLFNGGSTDSIVRGYSTNPSSFSSDFVTAMIKMGDITPLTGSKGEVRKN  315

Query  324   CRKAN  310
             CR+ N
Sbjct  316   CRRIN  320



>emb|CDP13933.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   432 bits (1110),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 205/305 (67%), Positives = 248/305 (81%), Gaps = 2/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + S+SAQLSTNFY  SCP LF T+KS ++SA+ +E RMGASLLRL FHDCFV GCDGS+L
Sbjct  19    IGSTSAQLSTNFYYHSCPNLFSTVKSTVQSAISKEARMGASLLRLFFHDCFVNGCDGSVL  78

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF+GEK A  N NS RG+ V+D+IKSA+E+ CPG+VSCAD++AIAARDS  +LGG
Sbjct  79    LDDTSSFRGEKRAAPNFNSARGFEVVDNIKSAVERACPGVVSCADVLAIAARDSVEILGG  138

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VKLGRRD++TAS +AAN+   +P P +NL+ALIS F   GLS  DLVALSGS+TIG
Sbjct  139   PRWDVKLGRRDARTASQAAANNS--IPPPTTNLNALISRFSAVGLSARDLVALSGSHTIG  196

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
              +RCT FR RIYN+TN + +S A+ RQ  CP  +GSGD+NLAPLDL+TP  FDNNY+KNL
Sbjct  197   LARCTNFRARIYNETNNLDSSLARTRQSNCPSVSGSGDNNLAPLDLQTPTNFDNNYFKNL  256

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +N++GLLHSDQ L+NGGSTDS V+ YS NP  F S FA AMIKMG+I+PLTGS GEIRKN
Sbjct  257   VNRRGLLHSDQQLFNGGSTDSAVRAYSNNPGSFASDFAAAMIKMGDIKPLTGSNGEIRKN  316

Query  324   CRKAN  310
             CR+ N
Sbjct  317   CRRIN  321



>gb|AAL93151.1|AF485265_1 class III peroxidase [Gossypium hirsutum]
Length=320

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/302 (70%), Positives = 249/302 (82%), Gaps = 2/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             S AQLSTNFYSKSCP +  T++ V+++A+ +E+R+GASLLRL FHDCFV GCDGS+LLDD
Sbjct  21    SYAQLSTNFYSKSCPKVLSTVELVVETAVSKEQRLGASLLRLFFHDCFVNGCDGSVLLDD  80

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF GE+TA  NN S+RG+ V+D+IK+ +EKVCPG+VSCADI+AIAARDS V+LGGP+W
Sbjct  81    TSSFTGEQTATPNNGSLRGFEVVDEIKAKVEKVCPGVVSCADILAIAARDSVVILGGPDW  140

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDSKTAS S ANS GVLP   +NLS LIS FQ QGLST D+VALSG++TIG++R
Sbjct  141   DVKLGRRDSKTASFSDANS-GVLPLGSANLSQLISLFQAQGLSTKDMVALSGAHTIGKAR  199

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             C +FR+RIYNDT  I  SFAK R+  CPR  GSGD+NLAPLDL TP  FD+ Y++NL+NK
Sbjct  200   CLVFRNRIYNDT-IIDTSFAKTRRSSCPRTRGSGDNNLAPLDLATPNSFDSKYFENLLNK  258

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+NGGSTDSLVK YS N   F S F  AMIKMG+I+PLTGS GEIRKNC K
Sbjct  259   KGLLHSDQELFNGGSTDSLVKTYSSNVKKFYSDFIAAMIKMGDIKPLTGSNGEIRKNCGK  318

Query  315   AN  310
              N
Sbjct  319   PN  320



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 206/305 (68%), Positives = 250/305 (82%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + +SSAQLSTNFYS SCP +F  ++S ++SA+  E R+GASLLRLHFHDCFV GCDGS+L
Sbjct  18    MATSSAQLSTNFYSSSCPRVFSAVRSTVQSAIRNEARIGASLLRLHFHDCFVNGCDGSLL  77

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEK A  N NS RG++V+D+IKSA+E VCPG+VSCADI+AIAARDS  +LGG
Sbjct  78    LDDTSSFTGEKNAVPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVAILGG  137

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P+W VKLGRRD++TAS +AAN+   +P P SNL+ LIS F   GLST DLVALSGS+TIG
Sbjct  138   PSWNVKLGRRDARTASQAAANNN--IPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIG  195

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             +SRC  FR RIYN+TN + +SFA+ R+  CPR +GSGD+NLAPLDL+TP  FDNNY+KNL
Sbjct  196   QSRCIQFRPRIYNETN-LDSSFAQTRRSNCPRASGSGDNNLAPLDLQTPTAFDNNYFKNL  254

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             I KKGLLHSDQ L+NGGSTDS+V+ YS +   F+S F  A+IKMG+I+PLTGS GEIRKN
Sbjct  255   IQKKGLLHSDQQLFNGGSTDSIVRTYSNSYNTFSSDFVSAIIKMGDIKPLTGSNGEIRKN  314

Query  324   CRKAN  310
             CRK N
Sbjct  315   CRKPN  319



>ref|XP_010045401.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=321

 Score =   431 bits (1108),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 216/303 (71%), Positives = 248/303 (82%), Gaps = 4/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S+SAQLSTNFYSKSCP    T+KSV++SA+ +E+RMGASLLRL FHDCFV GCDGSILLD
Sbjct  23    SASAQLSTNFYSKSCPNGLSTVKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLD  82

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF+GEKTA  NN S+RGYNVID IKS +E  CPG+VSCADIVAIAARDS VLLGGP+
Sbjct  83    DTSSFQGEKTARPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPS  142

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W+VKLGRRD++TAS S ANS G LP P S LS LIS FQ QGLST D+VALSGS+TIG++
Sbjct  143   WEVKLGRRDARTASFSLANS-GALPPPTSTLSNLISLFQAQGLSTRDMVALSGSHTIGQA  201

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  IYND+N I ++F K RQ +CP   GSGD+N APLDL +P  FDN Y+KNL++
Sbjct  202   RCTSFRPHIYNDSN-IDSAFRKTRQGQCP--FGSGDNNPAPLDLRSPTAFDNAYFKNLLS  258

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
              KGLL SDQ L+NGGSTDSLVK YS NP  FNS FA AMIKMG+I+PL GS+GEIRK C 
Sbjct  259   NKGLLRSDQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLKGSQGEIRKICS  318

Query  318   KAN  310
             K N
Sbjct  319   KVN  321



>gb|AAP42508.1| anionic peroxidase swpb3 [Ipomoea batatas]
Length=320

 Score =   431 bits (1107),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 210/301 (70%), Positives = 248/301 (82%), Gaps = 3/301 (1%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQLS  FYSKSCP LF T+ SV++SA+ +E RMGASLLRL FHDCFV GCDGSILLDDT
Sbjct  23    SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  82

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             SSF GEK A  N  S RG+ VID IKSA+EKVCPG+VSCADI+AIA+RDSTV LGGP+W 
Sbjct  83    SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  142

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             VKLGRRD++TAS +AAN+   +P+P SNL+ LISSF   GLST D+V LSGS+TIG++RC
Sbjct  143   VKLGRRDARTASQAAANNS--IPAPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARC  200

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             T FR RIYN++N I +SFA+ R+  CPR +GSGD+NLAPLDL+TP  FDNNYY NL+NKK
Sbjct  201   TNFRARIYNESN-IDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKK  259

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GLLHSDQ L+NG STDS V+ YS NP+ F S FA AMIKMG+I+PLTG+ GEIRKNCR+ 
Sbjct  260   GLLHSDQQLFNGVSTDSTVRGYSTNPSKFKSDFAAAMIKMGDIKPLTGNNGEIRKNCRRR  319

Query  312   N  310
             N
Sbjct  320   N  320



>ref|XP_010087166.1| Peroxidase 4 [Morus notabilis]
 gb|EXB28405.1| Peroxidase 4 [Morus notabilis]
Length=326

 Score =   431 bits (1107),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 207/306 (68%), Positives = 252/306 (82%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  S SAQL   FY KSCP +F T+KSV+K+A+ +E R+GASLLRLHFHDCFV GCDGSI
Sbjct  23    FTGSCSAQLYPGFYHKSCPKVFATVKSVVKTAISKENRIGASLLRLHFHDCFVNGCDGSI  82

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF+GEKTA  NNNS RG+ V+D IK+ +E+VCPG+VSCADI+AIAARDS  +LG
Sbjct  83    LLDDTSSFRGEKTAGPNNNSARGFGVVDKIKAEVEQVCPGVVSCADILAIAARDSVAILG  142

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP ++VK+GRRDSKTAS SAANS GV+P P S LS LI+ F+N+GLS  D+VALSG +TI
Sbjct  143   GPYYEVKVGRRDSKTASFSAANS-GVIPPPTSTLSNLINRFKNRGLSALDMVALSGGHTI  201

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC +FR RIYN+TN I +SFAK RQ KCPR   SGD+N+A LD+ TP  FDN+Y+ N
Sbjct  202   GKARCRVFRKRIYNETN-IDSSFAKARQSKCPRNAPSGDNNVADLDVATPNSFDNHYFVN  260

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+NKKGLLHSDQ L+NGGSTDSLVK Y++NP  F+S F  A+IKMG+I PLTGS+GEIRK
Sbjct  261   LVNKKGLLHSDQILFNGGSTDSLVKHYNENPKKFHSDFVTAIIKMGDIDPLTGSKGEIRK  320

Query  327   NCRKAN  310
             +C +AN
Sbjct  321   HCARAN  326



>ref|XP_003615995.1| Peroxidase [Medicago truncatula]
 gb|AES98953.1| class III peroxidase [Medicago truncatula]
Length=326

 Score =   431 bits (1107),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 214/307 (70%), Positives = 248/307 (81%), Gaps = 3/307 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              +D S +QLS NFY+K CP +F  + SV+ SA+  E RMG SLLRLHFHDCFV GCDGS+
Sbjct  22    LIDGSFSQLSENFYAKKCPNVFKAVNSVVHSAVAREPRMGGSLLRLHFHDCFVNGCDGSV  81

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT S KGEKTA  N +S+RG+ VID IKS +E VCPG+VSCADIVAIAARDS V LG
Sbjct  82    LLDDTPSNKGEKTALPNKDSLRGFEVIDAIKSKVESVCPGVVSCADIVAIAARDSVVNLG  141

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP WKVKLGRRDSKTASL+ ANS GV+P PFS L+ LI+ F+ QGLST D+VALSG++TI
Sbjct  142   GPFWKVKLGRRDSKTASLNDANS-GVIPPPFSTLNNLINRFKAQGLSTKDMVALSGAHTI  200

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGS-GDDNLAPLDLETPAFFDNNYYK  511
             G++RCT++RDRIYNDTN I + FAK RQR CPRK+G+  D+N+A LD +TP  FDN YYK
Sbjct  201   GKARCTVYRDRIYNDTN-IDSLFAKSRQRNCPRKSGTIKDNNVAVLDFKTPNHFDNLYYK  259

Query  510   NLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             NLINKKGLLHSDQ L+NGGSTDSLVK YS N   F S FA AMIKMGN +PLTGS GEIR
Sbjct  260   NLINKKGLLHSDQELFNGGSTDSLVKSYSNNQNAFESDFAIAMIKMGNNKPLTGSNGEIR  319

Query  330   KNCRKAN  310
             K CR+AN
Sbjct  320   KQCRRAN  326



>ref|XP_010452439.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   430 bits (1106),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 243/300 (81%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T+++ +KSA+  E RMG S+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IKSA+EK CPG+VSCADI+AIAARDS V LGGPNW V
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AANS   +P P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  148   KVGRRDARTASQAAANSN--IPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+TN I A+FA  RQR CPR TGSGD NLAPLD+ T A FDNNY+KNL+ +KG
Sbjct  206   SFRARIYNETN-INAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS NP+ F+S F  AMIKMG+I PLTGS GEIRK C + N
Sbjct  265   LLHSDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|XP_006486214.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   430 bits (1106),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 246/305 (81%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + S++AQLSTNFY+ +C  L  T+KSV++SA+ +E RMGASLLRL FHDCFV GCDGS+L
Sbjct  18    MGSTNAQLSTNFYANTCKNLLPTVKSVVQSAVSKEARMGASLLRLFFHDCFVNGCDGSVL  77

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEK A  N NS RG+ VID+IKSA+EK CPG VSCADI+AI ARDS VLLGG
Sbjct  78    LDDTSSFTGEKNAVPNRNSARGFEVIDNIKSAVEKACPGAVSCADILAITARDSVVLLGG  137

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P+W+VKLGRRDS+TAS SAANS   +P P SNL+ L S F   GLS  DLVAL+G +TIG
Sbjct  138   PSWEVKLGRRDSRTASQSAANSG--IPPPTSNLNQLTSRFNALGLSNKDLVALAGGHTIG  195

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR  IYN+TN I ASFA+ RQ  CPR  G+GD+NLAPLDL+TP  FDNNY+KNL
Sbjct  196   QARCTSFRAHIYNETN-IDASFARTRQGNCPRANGTGDNNLAPLDLQTPTSFDNNYFKNL  254

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +N+KGLLHSDQ L+NGGSTDS V+ YS NP+ F+S F   MIKMG+I PLTGSRGEIRKN
Sbjct  255   VNRKGLLHSDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRKN  314

Query  324   CRKAN  310
             CR+ N
Sbjct  315   CRRIN  319



>gb|ACU24215.1| unknown [Glycine max]
Length=329

 Score =   430 bits (1106),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/303 (67%), Positives = 253/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSA LS NFYSK+CP +F T+KSV+KSA+ +E R+GAS++RL FHDCFVQGCDGSILLD
Sbjct  29    TSSATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLD  88

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +F+GEKTA ANNNSVRGY +IDDIKS +EK+CPG+VSCADI+ IA+RDS VLLGGP 
Sbjct  89    DTPTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPF  148

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W V+LGRRDS++A+ +AAN+ GV+P P SNL+ LI+ FQ+QGLS  D+VALSG++T G++
Sbjct  149   WNVRLGRRDSRSANFTAANT-GVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKA  207

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FRDRIYN TN I  +FA  RQR+CPR  G+GD+NLA LD  TP  FDNNY+KNL  
Sbjct  208   RCTSFRDRIYNQTN-IDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLFI  266

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             K+GLL+ DQ L+NGGSTDSLV+ YS+N   F+  F +AMI+MG+I+PLTGS+GEIRKNCR
Sbjct  267   KRGLLNFDQVLFNGGSTDSLVRTYSQNNKAFDFDFVKAMIRMGDIKPLTGSQGEIRKNCR  326

Query  318   KAN  310
             + N
Sbjct  327   RVN  329



>gb|KFK24955.1| hypothetical protein AALP_AA8G047500 [Arabis alpina]
Length=324

 Score =   430 bits (1105),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 243/300 (81%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T+++ +KSA+  E RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVKSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IK+A+EK CPG+VSCAD++AIAARDS V LGGPNW V
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKAAVEKACPGVVSCADVLAIAARDSVVALGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AANS   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  148   KVGRRDARTASQAAANSN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+TN I A+FA  RQR CPR TGSGD NLAPLD+ TPA FDNNY+KNL+ +KG
Sbjct  206   NFRTRIYNETN-INAAFATTRQRTCPRATGSGDGNLAPLDVATPASFDNNYFKNLLTQKG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ Y+ N   FNS F  AMIKMG+I PLTGS GEIRK C   N
Sbjct  265   LLHSDQELFNGGSTDSIVRGYNNNARSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGSTN  324



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score =   429 bits (1104),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/300 (68%), Positives = 247/300 (82%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+ NFYS SCP L  T++S +KSA++ E RMGAS++RL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTPNFYSTSCPNLLSTVQSAVKSAVNSEARMGASIVRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IK+A+EK CPG+VSCADI+AIAARDS V+LGGPNW V
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKAAVEKACPGVVSCADILAIAARDSVVVLGGPNWTV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AANS   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  148   KVGRRDARTASQAAANSN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+TN I A+FA  RQR CPR +GSGD NLAPLD+ T A FDNNY+KNL+ ++G
Sbjct  206   SFRTRIYNETN-INAAFATTRQRTCPRTSGSGDGNLAPLDVTTAASFDNNYFKNLMTQRG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS NP+ F+S FA AMIKMG+I PLTGS GEIRK C + N
Sbjct  265   LLHSDQELFNGGSTDSIVRGYSNNPSSFSSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_003519407.1| PREDICTED: peroxidase 4-like [Glycine max]
 gb|KHN38568.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/310 (68%), Positives = 247/310 (80%), Gaps = 7/310 (2%)
 Frame = -2

Query  1227  FLDSSSAQ----LSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGC  1060
              L +SSA     L TNFY  SCP LF T+K  ++SA+ +E RMGASLLRL FHDCFV GC
Sbjct  18    LLGTSSANANPTLHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGC  77

Query  1059  DGSILLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDST  880
             DGSILLDDTSSF GEK A  N NS RG+ VID IKSA+EKVCPG+VSCADI+AIAARDS 
Sbjct  78    DGSILLDDTSSFTGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSV  137

Query  879   VLLGGPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSG  700
              +LGGP W VKLGRRDS+TAS SAAN+   +P P SNL+ LIS F   GLST DLVALSG
Sbjct  138   EILGGPTWDVKLGRRDSRTASQSAANND--IPRPTSNLNQLISRFNALGLSTKDLVALSG  195

Query  699   SYTIGESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNN  520
              +TIG++RCT FR RIYN+TN I +SFA+ RQ +CPR +GSGD+NLAP+D  TP FFDN+
Sbjct  196   GHTIGQARCTTFRARIYNETN-IDSSFARMRQSRCPRTSGSGDNNLAPIDFATPRFFDNH  254

Query  519   YYKNLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRG  340
             Y+KNLI KKGL+HSDQ L+NGGSTDS+V+ YS NPA F + F+ AMI+MG+I PLTGSRG
Sbjct  255   YFKNLIQKKGLIHSDQQLFNGGSTDSIVRTYSTNPASFFADFSAAMIRMGDISPLTGSRG  314

Query  339   EIRKNCRKAN  310
             EIR+NCR+ N
Sbjct  315   EIRENCRRVN  324



>ref|XP_010423480.1| PREDICTED: peroxidase 52 [Camelina sativa]
Length=324

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 243/300 (81%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+T FYS SCP L  T+++ +KSA+  E RMG S+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTTFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IKSA+EK CPG+VSCADI+AIAARDS V LGGPNW V
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AANS   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  148   KVGRRDARTASQAAANSN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+TN I A+FA  RQR CPR TGSGD NLAPLD+ T A FDNNY+KNL+ +KG
Sbjct  206   SFRARIYNETN-INAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS NP+ F+S F  AMIKMG+I PLTGS GEIRK C + N
Sbjct  265   LLHSDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>gb|AFK45898.1| unknown [Lotus japonicus]
Length=330

 Score =   429 bits (1103),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 208/304 (68%), Positives = 249/304 (82%), Gaps = 2/304 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S+SAQLS NFY K CP +F  +KSV+ SA+ +E RMG SLLRL FHDCFV GCDGS+LLD
Sbjct  28    SNSAQLSENFYVKKCPSVFNAVKSVVHSAVAKEARMGGSLLRLFFHDCFVNGCDGSVLLD  87

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSFKGEKTA  N+NS+RG++VID IKS +E VCPG+VSCAD+VAIAARDS  +LGGP 
Sbjct  88    DTSSFKGEKTAPPNSNSLRGFDVIDAIKSKVEAVCPGVVSCADVVAIAARDSVAILGGPY  147

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             WKVKLGRRDSKTAS +AANS GV+PSPFS+LS LIS FQ QGLST D+VALSG++TIG++
Sbjct  148   WKVKLGRRDSKTASFNAANS-GVIPSPFSSLSDLISKFQAQGLSTKDMVALSGAHTIGKA  206

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGS-GDDNLAPLDLETPAFFDNNYYKNLI  502
             +C+ FR  +YN+TN I + FAK RQR CPR +G+  D+N+A LD +TP  FDN YYKNLI
Sbjct  207   KCSTFRQHVYNETNNINSLFAKARQRNCPRTSGTIRDNNVAVLDFKTPNQFDNLYYKNLI  266

Query  501   NKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNC  322
             NKKGLLHSDQ L++GGSTDSLV+ YS N   F + F  AMIKMGN + LTGS G+IRK+C
Sbjct  267   NKKGLLHSDQVLFSGGSTDSLVRTYSNNQKAFENDFVNAMIKMGNNKSLTGSNGQIRKHC  326

Query  321   RKAN  310
             R+AN
Sbjct  327   RRAN  330



>emb|CAD67478.1| peroxidase [Asparagus officinalis]
Length=301

 Score =   428 bits (1100),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 248/303 (82%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SSSA LSTNFYS SCP +F TIK V++SA+ +EKRMGAS+LRL FHDCFV GCDGSILL 
Sbjct  2     SSSAHLSTNFYSSSCPKVFSTIKPVLQSAIAKEKRMGASILRLFFHDCFVNGCDGSILLA  61

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT++F+GE+ A  NN SVRG+ VID IK+A+E  CPG+VSCADI+A+AARDS V+LGGP+
Sbjct  62    DTANFRGEQHAGPNNGSVRGFKVIDKIKTAVENACPGVVSCADILAVAARDSVVILGGPD  121

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             WKVKLGRRD++TAS + AN+   +P P S+LS LIS F  QGLST D+VALSG++TIG++
Sbjct  122   WKVKLGRRDARTASATLANNN--IPPPTSSLSNLISKFAAQGLSTKDMVALSGAHTIGQA  179

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  IYND + I ASFA  RQ+ CPRK+GSGD NLAPLDL+TP  FDNNYYKNLIN
Sbjct  180   RCTSFRGHIYNDAD-IDASFASLRQKICPRKSGSGDTNLAPLDLQTPTAFDNNYYKNLIN  238

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+N G+TDSLVK YS +   FNS F +AMIKMG+I PLTGS+GEIRK C 
Sbjct  239   KKGLLHSDQELFNNGATDSLVKSYSNSEGSFNSDFVKAMIKMGDISPLTGSKGEIRKICS  298

Query  318   KAN  310
             K N
Sbjct  299   KIN  301



>ref|XP_010685964.1| PREDICTED: peroxidase 4-like [Beta vulgaris subsp. vulgaris]
Length=319

 Score =   428 bits (1100),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 253/306 (83%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F+ S+SAQLS NFYSKSCP LFGT+KSV++SA+ +E RMGASLLRL FHDCFV GCDGSI
Sbjct  16    FIGSTSAQLSPNFYSKSCPKLFGTVKSVVRSAVAKESRMGASLLRLFFHDCFVNGCDGSI  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF+GEK+A  N NS RG+NVID IKS +E+VCPG+VSCADI+AI ARDS  +LG
Sbjct  76    LLDDTSSFRGEKSAAPNLNSARGFNVIDAIKSKVEQVCPGVVSCADILAITARDSVAILG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GPNW VKLGRRDSKTA+ +AAN+    PS  S+LS+LIS FQ  GLS  D+VALSG++TI
Sbjct  136   GPNWNVKLGRRDSKTANQAAANNGIPPPS--SSLSSLISRFQAHGLSAKDMVALSGAHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC  FR  +YN+T+TI ASFA  RQR CPR  G GD+NLAPLD +TP  FDN Y+K+
Sbjct  194   GQARCITFRSHVYNETSTIDASFASTRQRNCPRTNGQGDNNLAPLDSQTPTTFDNKYFKD  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L++K+GLLHSDQ L+NGGSTDS+V+ +S NP  F S FA AMIKMG+I PLTGS+GEIRK
Sbjct  254   LVSKRGLLHSDQQLFNGGSTDSIVQSFSNNPGYFRSDFATAMIKMGDISPLTGSQGEIRK  313

Query  327   NCRKAN  310
             NCR+AN
Sbjct  314   NCRRAN  319



>gb|AAR31106.1| peroxidase precursor [Quercus suber]
Length=330

 Score =   428 bits (1101),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 248/307 (81%), Gaps = 3/307 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  +SSA+LSTNFY KSCP +F T++SV+ SA+ ++ R GASLLRLHFHDCFV GCDGS+
Sbjct  25    FSGNSSAKLSTNFYYKSCPKVFSTVQSVVHSAISKQPRQGASLLRLHFHDCFVNGCDGSV  84

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT +F GEKTA  N  S+RG+  +D+IKS +EK CPG+VSCADI+AIAARDS  +LG
Sbjct  85    LLDDTPTFTGEKTAGPNKGSIRGFEFVDEIKSKVEKECPGVVSCADILAIAARDSVKILG  144

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRDSKTASL AANS GV+P P S LS LI+ F+ +GLST D+VALSG++TI
Sbjct  145   GPKWDVKLGRRDSKTASLKAANS-GVIPPPTSTLSNLINRFKAKGLSTKDMVALSGAHTI  203

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTG-SGDDNLAPLDLETPAFFDNNYYK  511
             G++RCT+FRDRIY D N I +SFAK RQ  CP+ TG  GD+ +APLDL+TP  FDN YYK
Sbjct  204   GQARCTVFRDRIYKDKN-IDSSFAKTRQNTCPKTTGLPGDNKIAPLDLQTPTAFDNYYYK  262

Query  510   NLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             NLI +KGLL SDQ L+NGGSTDSLVKKYS++   F S F  AMIKMG+I+PLTGS GEIR
Sbjct  263   NLIKQKGLLRSDQQLFNGGSTDSLVKKYSQDTKSFYSDFVNAMIKMGDIQPLTGSSGEIR  322

Query  330   KNCRKAN  310
             KNCRK N
Sbjct  323   KNCRKVN  329



>ref|XP_011080818.1| PREDICTED: uncharacterized protein LOC105163979 [Sesamum indicum]
Length=700

 Score =   441 bits (1135),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 209/283 (74%), Positives = 244/283 (86%), Gaps = 2/283 (1%)
 Frame = -2

Query  1158  TIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFKGEKTAFANNNSVRG  979
             T  SV+K A+ +EKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF+GEKTA  NNNSVRG
Sbjct  420   TGSSVVKDAIAKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFRGEKTAGPNNNSVRG  479

Query  978   YNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVKLGRRDSKTASLSAANS  799
             ++V+DDIKS +E VCPG+VSC+DI+AIAARDS VLLGGPNW VKLGRRDSKTASLSAANS
Sbjct  480   FDVVDDIKSEVESVCPGVVSCSDILAIAARDSVVLLGGPNWNVKLGRRDSKTASLSAANS  539

Query  798   PGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTIFRDRIYNDTNTIAASF  619
              GV+P P S L+ L++ FQ +GLST D+V LSG++TIG++RCT+FRDR+YN+TN I  SF
Sbjct  540   -GVIPPPTSTLNNLVNRFQARGLSTKDMVVLSGAHTIGQARCTLFRDRVYNETN-IDTSF  597

Query  618   AKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGLLHSDQALYNGGSTDSL  439
             A+ RQ  CPR +GSGD+NLAPLD ++P FFDN+YYKNLINKKGLLHSDQ LYNGGSTDSL
Sbjct  598   ARTRQTNCPRNSGSGDNNLAPLDHKSPTFFDNSYYKNLINKKGLLHSDQVLYNGGSTDSL  657

Query  438   VKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             ++ YSK P  FN  F  AMI+MG+I PLTGS GEIRKNCR+AN
Sbjct  658   IESYSKKPEAFNDDFVAAMIRMGDISPLTGSNGEIRKNCRRAN  700


 Score =   352 bits (903),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/290 (61%), Positives = 225/290 (78%), Gaps = 5/290 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             ++AQLSTN YS SCP    TIK+ +  A+ +E+RM ASLLRLHFHDCFV GCD S+LLDD
Sbjct  138   ATAQLSTNHYSTSCPRALFTIKAGVLKAVAKERRMAASLLRLHFHDCFVNGCDASVLLDD  197

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF GEKTA  NNNS+RG+ VID IKS +E +CPG+VSCADI+A++ARDS   +GGP W
Sbjct  198   TSSFTGEKTAGPNNNSLRGFEVIDSIKSELESLCPGVVSCADILAVSARDSVAAVGGPFW  257

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              V LGRRDS TASL AAN+   +PSP  +LS LIS+F N+G S  ++VALSG++TIG++R
Sbjct  258   AVPLGRRDSTTASLDAANTD--IPSPVMDLSDLISAFSNKGFSAKEMVALSGAHTIGQAR  315

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             C +FRDRIYN++N I ASFA   +  CP  +GS DD+L+P+D  TP  FDN+Y+KNL++ 
Sbjct  316   CVVFRDRIYNESN-IFASFATSLKSNCP-SSGS-DDSLSPIDATTPGSFDNSYFKNLVSN  372

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGS  346
             KGL+HSDQ L++G STDS V  Y+ NPA F + FA AMI+MGN+ PLTGS
Sbjct  373   KGLMHSDQQLFSGASTDSQVTAYTNNPAAFFADFASAMIRMGNLSPLTGS  422



>ref|NP_001241914.1| uncharacterized protein LOC100790279 precursor [Glycine max]
 gb|ACU17865.1| unknown [Glycine max]
Length=320

 Score =   427 bits (1099),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 248/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              L S++AQLSTNFY  SCP LF T+KS ++SA+ +E RMGASLLR  FHDCFV GCDGSI
Sbjct  18    ILGSANAQLSTNFYYHSCPNLFSTVKSTVQSAISKETRMGASLLRPFFHDCFVNGCDGSI  77

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RGY VID+IKSA+EK CPG+VSCADI+AIAARDS  +LG
Sbjct  78    LLDDTSSFTGEKNANPNRNSARGYEVIDNIKSAVEKACPGVVSCADILAIAARDSVQILG  137

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VK+GRRD++TAS SAAN+   +P P SNL+ LIS F   GLST DLVALSG +TI
Sbjct  138   GPSWNVKVGRRDARTASQSAANNG--IPPPTSNLNQLISRFSALGLSTKDLVALSGGHTI  195

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN++N I  +FA+ RQ+ CPR +GSGD+NLA LDL+TP  FDN Y+KN
Sbjct  196   GQARCTNFRARIYNESN-IDTAFARARQQSCPRTSGSGDNNLATLDLQTPTEFDNYYFKN  254

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+ KKGLLHSDQ L+NGGSTDS+V+ YS NP+ F+S FA AMIKMG+I PLTGS GEIRK
Sbjct  255   LVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGEIRK  314

Query  327   NCRKAN  310
             NCR+ N
Sbjct  315   NCRRIN  320



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   427 bits (1099),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 211/302 (70%), Positives = 250/302 (83%), Gaps = 5/302 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             S+AQLSTNFYSKSCP LF T+K V++SA+++EKRMGASL+RL FHDCFV GCDGSILLDD
Sbjct  22    SNAQLSTNFYSKSCPNLFSTVKPVVQSAINQEKRMGASLVRLFFHDCFVNGCDGSILLDD  81

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF GE+TA  N NSVRG+ VID IKSA+EK CPG+VSCADI+AIAARDST +LGGP+W
Sbjct  82    TSSFTGEQTAVPNRNSVRGFEVIDSIKSAVEKACPGVVSCADILAIAARDSTAILGGPSW  141

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRD++TASLSAAN+   +P+P SNL+ LIS F   GLST DLVALSG++TIG++R
Sbjct  142   NVKLGRRDARTASLSAANNG--IPAPTSNLNQLISRFSALGLSTRDLVALSGAHTIGQAR  199

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR RIYNDTN I +SFA+ R+  CP  TG GD+NLAPLDL+TP  FDNNY+KNL+ +
Sbjct  200   CTNFRTRIYNDTN-IDSSFAQTRRSNCP-STG-GDNNLAPLDLQTPTSFDNNYFKNLLVQ  256

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+N GSTDS+V+ YS   + F S F   MIKMG+I PLTGS+GEIRKNC K
Sbjct  257   KGLLHSDQELFNNGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCGK  316

Query  315   AN  310
              N
Sbjct  317   VN  318



>ref|XP_010543687.1| PREDICTED: peroxidase 52 [Tarenaya hassleriana]
Length=324

 Score =   427 bits (1098),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/300 (67%), Positives = 247/300 (82%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T++S ++SA++ E R GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSSSCPNLLSTVRSAMQSAVNREARAGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             +F GEK A  N NS RG++VID+IK+A+E+ CPG+VSCADI+A+AARD  VLLGGPNW V
Sbjct  88    NFTGEKNANPNRNSARGFDVIDNIKTAVERACPGVVSCADILAVAARDGVVLLGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             KLGRRD++TAS S ANS   +P+P S+LS LISSF N GLST D+VALSG +TIG++RCT
Sbjct  148   KLGRRDARTASQSGANSN--IPAPTSSLSQLISSFGNVGLSTRDMVALSGGHTIGQARCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+TN I ++FA  RQ+ CPR  GSGD NLAPLD++TPA F+N+Y+KNL+ ++G
Sbjct  206   SFRTRIYNETN-INSAFATTRQQTCPRTAGSGDGNLAPLDIQTPANFNNDYFKNLMAQRG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS NPA FNS F  AMIKMG+I PLTG+ GEIR+NCR+ N
Sbjct  265   LLHSDQELFNGGSTDSIVRTYSSNPATFNSDFVAAMIKMGDISPLTGNSGEIRRNCRRLN  324



>gb|ADN96693.1| peroxidase 6 [Rubia cordifolia]
Length=321

 Score =   427 bits (1098),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/302 (66%), Positives = 245/302 (81%), Gaps = 2/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLS N+Y  +CP L+ T+KS ++SA+ +E RMGASLLRL FHDCFV GCDGSILLDD
Sbjct  22    TSAQLSENYYYSACPKLYSTVKSTVQSAIAKETRMGASLLRLFFHDCFVNGCDGSILLDD  81

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF GEK A  N NS RG+ V+DDIK+A+EKVCPG+VSCADI+AIAA DS  +LGGP+W
Sbjct  82    TSSFTGEKKAAPNVNSARGFEVVDDIKAAVEKVCPGVVSCADILAIAAHDSVEILGGPSW  141

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRD++TAS +AAN    +P P +NL+ LIS F + GLS  DLVALSGS+TIG++R
Sbjct  142   NVKLGRRDARTASQAAANQ--TIPPPTTNLNGLISRFNSFGLSAKDLVALSGSHTIGQAR  199

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR RIYN+TN +  S A+ RQ  CPR TGSGD+NLAPLDLETP  FDN+Y+ NL+++
Sbjct  200   CTNFRARIYNETNNLDTSLARTRQGNCPRATGSGDNNLAPLDLETPTRFDNHYFVNLVSR  259

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ LYNGGSTD++V+ YS NP  F + FA AMIKMG+I+PLTGS+GE+R NCR+
Sbjct  260   KGLLHSDQQLYNGGSTDTIVRGYSSNPGSFAADFAAAMIKMGDIKPLTGSKGEVRSNCRR  319

Query  315   AN  310
              N
Sbjct  320   IN  321



>ref|XP_006595847.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=326

 Score =   426 bits (1096),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 205/298 (69%), Positives = 241/298 (81%), Gaps = 3/298 (1%)
 Frame = -2

Query  1203  LSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF  1024
             L TNFY  SCP LF T+K  ++SA+ +E RMGASLLRL FHDCFV GCDGSILLDDTSSF
Sbjct  32    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  1023  KGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVKL  844
              GEK A  N NS RG+ VID IKSA+EKVCPG+VSCADI+AIAARDS  +L GP W VKL
Sbjct  92    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  151

Query  843   GRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTIF  664
             GRRDS+TAS SAAN+   +P P SNL+ LIS F   GLST DLVALSG +TIG++RCT F
Sbjct  152   GRRDSRTASQSAANNG--IPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTF  209

Query  663   RDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGLL  484
             R RIYN++N I +SFA+ RQ +CPR +GSGD+NLAP+D  TP FFDN+Y+KNLI KKGL+
Sbjct  210   RARIYNESN-IDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGLI  268

Query  483   HSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             HSDQ L+NGGSTDSLV+ YS NPA F + F+ AMI+MG+I PLTGSRGEIR+NCR+ N
Sbjct  269   HSDQELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  326



>gb|AAB48184.1| peroxidase precursor [Linum usitatissimum]
Length=323

 Score =   425 bits (1092),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 245/300 (82%), Gaps = 2/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
              QLST+FYS+SCPML  T++  ++SA+D+E R+ ASLLRLHFHDCFV GCDGSILL+DT 
Sbjct  26    GQLSTDFYSESCPMLMDTVRCEVESAVDKETRIAASLLRLHFHDCFVNGCDGSILLEDTD  85

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+TA  NN SVRGY VI+DIKS +E+VCPG+VSCADIVAIAARDSTV+ GG +W+V
Sbjct  86    SFTGEQTAAPNNGSVRGYYVIEDIKSKVEQVCPGVVSCADIVAIAARDSTVIAGGQSWEV  145

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRDSKTAS +AANS GVLP+P S+L+ LI SF +QGLS  D+V LSGS+TIG +RC 
Sbjct  146   KVGRRDSKTASFNAANS-GVLPAPTSSLNELIKSFGDQGLSANDMVVLSGSHTIGVARCV  204

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FRDRIYN+TN I  SFA + +  CP    SGDDNLAPLDL+TP  FDNNYY NLI +KG
Sbjct  205   SFRDRIYNETN-IDPSFASQSEENCPLAPNSGDDNLAPLDLKTPTSFDNNYYNNLIEQKG  263

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDSLV+ YS++P  F + FA AM+KMG+I+PLTGS+GEIR  C + N
Sbjct  264   LLHSDQVLFNGGSTDSLVRSYSQSPKRFAADFAAAMVKMGDIKPLTGSQGEIRNVCSRPN  323



>ref|XP_002319967.2| hypothetical protein POPTR_0013s15240g [Populus trichocarpa]
 gb|EEE95890.2| hypothetical protein POPTR_0013s15240g [Populus trichocarpa]
 gb|AHL39177.1| class III peroxidase [Populus trichocarpa]
Length=326

 Score =   425 bits (1092),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 249/306 (81%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             +  SSSA LST+FY KSCP LFGT+KSV++SA+ +E+RMGASL+RL FHDCFV+GCD SI
Sbjct  26    YTSSSSAHLSTDFYDKSCPQLFGTVKSVVQSAIAKERRMGASLVRLFFHDCFVKGCDASI  85

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LL+DT++FKGE+ A  NNNSVRGYNV+  IKS +EKVCPGIVSCADIV IAARDSTVLLG
Sbjct  86    LLEDTATFKGEQGAGPNNNSVRGYNVVAKIKSKLEKVCPGIVSCADIVVIAARDSTVLLG  145

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP WKVKLGRRDSKTA+++AA+    LPS  S +S LI  F+++GLS TD+VALSGS+TI
Sbjct  146   GPYWKVKLGRRDSKTANMNAASKS--LPSDTSTVSQLIKRFKSKGLSATDMVALSGSHTI  203

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G+++C  FR RIYN+TN I  SFA  RQ+ CP  T  GDDNLAPLD +TP  FDNNYYKN
Sbjct  204   GQTKCKTFRARIYNETN-IDKSFATMRQKMCPLTT--GDDNLAPLDFQTPNVFDNNYYKN  260

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI+KKGLLHSDQ L++G STDSLV+ YS NP +F S FA AM+KMG+I P TG+RGEIRK
Sbjct  261   LIHKKGLLHSDQVLFSGESTDSLVRTYSNNPDIFFSDFAAAMVKMGDIDPRTGTRGEIRK  320

Query  327   NCRKAN  310
              C   N
Sbjct  321   KCSCPN  326



>emb|CDX98835.1| BnaC09g50000D [Brassica napus]
Length=325

 Score =   424 bits (1091),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 243/300 (81%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T++S +KSA+D + R GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IK+A+E  CPG+VSCADI+AIAARDS VLLGGPNW V
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AANS   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  149   KVGRRDARTASQAAANSN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  206

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR R+YN+TN I A+FA  RQR CPR  GSGD NLAPLD+ +  FFDN+Y+KNL+ ++G
Sbjct  207   NFRTRVYNETN-INAAFATLRQRSCPRAAGSGDGNLAPLDVNSANFFDNSYFKNLVAQRG  265

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V  YS NPA F+S F  AMIKMG+I PLTGS GEIRK C + N
Sbjct  266   LLHSDQELFNGGSTDSIVTGYSNNPASFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>gb|KHN44724.1| Peroxidase 4 [Glycine soja]
Length=318

 Score =   424 bits (1090),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 204/298 (68%), Positives = 241/298 (81%), Gaps = 3/298 (1%)
 Frame = -2

Query  1203  LSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF  1024
             L TNFY  SCP LF T+K  ++SA+ +E RMGASLLRL FHDCFV GCDGSILLDDTSSF
Sbjct  24    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  83

Query  1023  KGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVKL  844
              GEK A  N NS RG+ VID IKSA+EKVCPG+VSCADI+AIAARDS  +L GP W VKL
Sbjct  84    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  143

Query  843   GRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTIF  664
             GRRDS+TAS SAAN+   +P P SNL+ LIS F   GLST DLVALSG +TIG++RCT F
Sbjct  144   GRRDSRTASQSAANNG--IPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTF  201

Query  663   RDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGLL  484
             R RIYN++N I +SFA+ RQ +CPR +GSGD+NLAP++  TP FFDN+Y+KNLI KKGL+
Sbjct  202   RARIYNESN-IDSSFARMRQSRCPRTSGSGDNNLAPINFATPTFFDNHYFKNLIQKKGLI  260

Query  483   HSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             HSDQ L+NGGSTDSLV+ YS NPA F + F+ AMI+MG+I PLTGSRGEIR+NCR+ N
Sbjct  261   HSDQELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  318



>ref|XP_009410536.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=321

 Score =   424 bits (1089),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 208/296 (70%), Positives = 237/296 (80%), Gaps = 3/296 (1%)
 Frame = -2

Query  1197  TNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFKG  1018
             T++YS SCP LF T+  V++SA+ +EKRMGASLLRL FHDCFV GCDGSILLDDTS F G
Sbjct  29    TSYYSSSCPDLFSTVSGVVQSAISKEKRMGASLLRLFFHDCFVNGCDGSILLDDTSGFTG  88

Query  1017  EKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVKLGR  838
             EKTA  N NSVRG++V+DDIK+A+EKVCPG+VSCADI+AIAARDS   LGG +W VKLGR
Sbjct  89    EKTANPNQNSVRGFDVVDDIKTAVEKVCPGVVSCADILAIAARDSVATLGGRSWNVKLGR  148

Query  837   RDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTIFRD  658
             RDS TASLSAAN+   +P P S+LS LIS F +QGLST DLVALSG++TIG++RC  FR 
Sbjct  149   RDSTTASLSAANNN--IPPPSSSLSNLISKFSDQGLSTKDLVALSGAHTIGQARCISFRA  206

Query  657   RIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGLLHS  478
              IY DTN I + FA  RQ  CP   GSGD+NLAPLDL+TP  FDNNYYKNLI+ KGLLHS
Sbjct  207   HIYTDTN-IDSGFANTRQSNCPSTAGSGDNNLAPLDLQTPTTFDNNYYKNLISTKGLLHS  265

Query  477   DQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             DQ LYNGGSTDS VK YS +   F S FA AMIKMG+I PLTGS GEIRKNCRK N
Sbjct  266   DQELYNGGSTDSQVKAYSNSSGSFYSDFAAAMIKMGDISPLTGSSGEIRKNCRKIN  321



>gb|AFK41406.1| unknown [Lotus japonicus]
Length=322

 Score =   424 bits (1089),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 208/306 (68%), Positives = 249/306 (81%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              L S++AQLSTNFYS SCP LF T+KS ++SA+ +E RMGASLLRL FHDCFV GCDGS+
Sbjct  19    ILGSANAQLSTNFYSSSCPKLFSTVKSSVQSAISKEARMGASLLRLFFHDCFVNGCDGSV  78

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG++VID+IKSA+E  CPG+VSCADI+AI+ARDS V LG
Sbjct  79    LLDDTSSFTGEKNANPNRNSARGFDVIDNIKSAVEAACPGVVSCADILAISARDSVVSLG  138

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VK+GRRD+KTAS SAAN+   +P+P S+LS L S F   GLS+ DLVALSG++TI
Sbjct  139   GPTWNVKVGRRDAKTASQSAANTG--IPAPTSSLSQLTSRFSALGLSSKDLVALSGAHTI  196

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+T+TI +SFA  R+  CP  +GSGD+NLAPLDL+TP  FDNNY+KN
Sbjct  197   GQARCTSFRARIYNETSTIESSFATSRKSNCPSTSGSGDNNLAPLDLQTPTSFDNNYFKN  256

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+  KGLLHSDQ L+NGGSTDS V+ YS NP+ F+S FA AM+KMG+I PLTGS GEIRK
Sbjct  257   LVQNKGLLHSDQQLFNGGSTDSTVRGYSTNPSSFSSDFASAMVKMGDISPLTGSNGEIRK  316

Query  327   NCRKAN  310
             NCRK N
Sbjct  317   NCRKTN  322



>gb|ACU23245.1| unknown [Glycine max]
Length=326

 Score =   424 bits (1089),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 204/298 (68%), Positives = 239/298 (80%), Gaps = 3/298 (1%)
 Frame = -2

Query  1203  LSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF  1024
             L TNFY  SCP LF T+K  ++SA+ +E RMGASLLRL FHDCFV GCDGSILLDDTSSF
Sbjct  32    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  1023  KGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVKL  844
              GEK A  N NS RG+ VID IKSA+EKVCPG+VSCADI+AIAARDS  +L GP W VKL
Sbjct  92    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  151

Query  843   GRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTIF  664
             GRRDS+TAS SAAN+   +P P SNL+ LIS F   GLST DLVALSG +TIG++RCT F
Sbjct  152   GRRDSRTASQSAANNG--IPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTF  209

Query  663   RDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGLL  484
             R RIYN++N I +SFA+ RQ +CPR +GSGD+NLAP+D  TP FFDN+Y+KNLI KKG +
Sbjct  210   RARIYNESN-IDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGFI  268

Query  483   HSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             HSDQ L+NGGSTDSLV  YS NPA F + F+ AMI+MG+I PLTGSRGEIR+NCR+ N
Sbjct  269   HSDQELFNGGSTDSLVGTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  326



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score =   423 bits (1087),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 202/303 (67%), Positives = 244/303 (81%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQL+ NFYS SCP LF TIKSV++SA+  EKRMGASLLRL FHDCFV GCDGS+LLD
Sbjct  21    ASSAQLTPNFYSSSCPTLFPTIKSVVQSAISSEKRMGASLLRLFFHDCFVNGCDGSLLLD  80

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEK A  N  SVRG++VID IK+A+E+ CPG+VSCADI+A+ ARDS VLLGGP 
Sbjct  81    DTSSFTGEKNAIPNKGSVRGFDVIDKIKTAVEQACPGVVSCADILAVTARDSVVLLGGPT  140

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRDS+TAS S AN+   +P P S+LS LIS F  QGLS  ++VAL G++TIG++
Sbjct  141   WNVKLGRRDSRTASQSGANNN--IPPPTSSLSNLISKFSAQGLSAKEMVALVGAHTIGQA  198

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  +YNDT+ I A+FAK RQ  CP  +GSGD+NLAPLDL+TP  FDNNY+KNL++
Sbjct  199   RCTNFRAHVYNDTD-IDATFAKTRQSNCPSTSGSGDNNLAPLDLQTPVAFDNNYFKNLVS  257

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ +++GGST+S V  YS +P+ ++S F  AMIKMG+I PLTG  GEIRKNCR
Sbjct  258   KKGLLHSDQQVFSGGSTNSQVSTYSTSPSTWSSDFVAAMIKMGDISPLTGKSGEIRKNCR  317

Query  318   KAN  310
             K N
Sbjct  318   KTN  320



>ref|XP_006398996.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
 gb|ESQ40449.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
Length=324

 Score =   422 bits (1086),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 202/300 (67%), Positives = 245/300 (82%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T+++ +KSA+  + RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSSSCPNLLSTVQTAVKSAVSSQNRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IKSA+EK CPG+VSCADI+AIAARDS V+LGGPNW V
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVILGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             KLGRRD++TAS +AANS   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  148   KLGRRDARTASQAAANSN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR R+YN+TN I A+FA  RQR CPR  GSGD NLAPLD+ + A FDN+Y+KNL+ ++G
Sbjct  206   NFRARVYNETN-INAAFATLRQRSCPRTAGSGDGNLAPLDVNSAASFDNSYFKNLMAQRG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS  P+ F+S FA AMIKMG+I PLTG+ GEIRK C + N
Sbjct  265   LLHSDQELFNGGSTDSIVRGYSNTPSSFSSDFAAAMIKMGDISPLTGTSGEIRKLCGRTN  324



>ref|XP_009384773.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578} [Musa 
acuminata subsp. malaccensis]
Length=356

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 243/303 (80%), Gaps = 4/303 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLST+FYS SCP LF T+K V++SA+ +EKR+GAS+LRL FHDCFV GCDGS+LLDD
Sbjct  57    TSAQLSTSFYSSSCPKLFSTVKPVVQSAISKEKRLGASVLRLFFHDCFVLGCDGSVLLDD  116

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T +F GEKTA  NNNS+RG+ VID IK+A+EK CPG+VSCADI+A+AARDS V+LGGPNW
Sbjct  117   TPTFTGEKTAKPNNNSIRGFEVIDQIKTAVEKACPGVVSCADILAVAARDSVVILGGPNW  176

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDS+ AS+S AN    +P P S+LS LIS F  +GLST D+VALSGS+TIG +R
Sbjct  177   DVKLGRRDSRRASISKANKQ--IPPPTSSLSNLISKFSAKGLSTKDMVALSGSHTIGLAR  234

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR  IYNDTN I ASFAKKRQ  CP  +GSGD+NLAPLDL+TP  FDNNYYKNL+  
Sbjct  235   CTSFRGHIYNDTN-IDASFAKKRQANCPSASGSGDNNLAPLDLQTPTAFDNNYYKNLVRF  293

Query  495   KGLLHSDQALYN-GGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KGLLHSDQ LYN   STDSLVK Y  +   F S F   MIKMG+I+PLTGS GEIRKNCR
Sbjct  294   KGLLHSDQQLYNVSDSTDSLVKAYISSTGTFFSDFVSGMIKMGDIKPLTGSNGEIRKNCR  353

Query  318   KAN  310
             K N
Sbjct  354   KIN  356



>ref|XP_007017044.1| Peroxidase 68 [Theobroma cacao]
 gb|EOY34663.1| Peroxidase 68 [Theobroma cacao]
Length=592

 Score =   431 bits (1108),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/291 (72%), Positives = 246/291 (85%), Gaps = 2/291 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S+SAQLSTNFYSKSCP +F T+KS ++SA+ +E+RMGASL+RL FHDCFV GCDGSILLD
Sbjct  26    STSAQLSTNFYSKSCPKVFSTVKSAVQSAVSKERRMGASLVRLFFHDCFVNGCDGSILLD  85

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSFKGEKTA  NNNSVRG+NV+DDIK+ +EKVCPG+VSCADIVAIAARDS V+LGGP+
Sbjct  86    DTSSFKGEKTAGPNNNSVRGFNVVDDIKAKVEKVCPGVVSCADIVAIAARDSVVILGGPD  145

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRDSKTAS SAANS GV+P P S LS LI+ FQ +GLS  D+VALSG++TIG++
Sbjct  146   WDVKLGRRDSKTASFSAANS-GVIPPPTSTLSQLINRFQARGLSAKDMVALSGAHTIGKA  204

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC +FR RIYN+TN I +SFAK R+  CPR +GSGD+NLAPLD+ TP  FD NY++NL+N
Sbjct  205   RCILFRARIYNETN-IDSSFAKARRSSCPRTSGSGDNNLAPLDIGTPDSFDTNYFQNLLN  263

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGS  346
             +KGLLHSDQ L+NGGSTDSLVK YS     F S F  AMIKMG+I PLTGS
Sbjct  264   QKGLLHSDQILFNGGSTDSLVKTYSSRTKTFYSDFVTAMIKMGDITPLTGS  314


 Score =   422 bits (1085),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 238/280 (85%), Gaps = 1/280 (0%)
 Frame = -2

Query  1149  SVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFKGEKTAFANNNSVRGYNV  970
             S +KSA+ +E RMGASL+RL FHDCFV GCDGSILLDDTSSF GEKTA  NNNSVRG++V
Sbjct  314   SSVKSAVSKEPRMGASLVRLFFHDCFVNGCDGSILLDDTSSFIGEKTAAPNNNSVRGFHV  373

Query  969   IDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVKLGRRDSKTASLSAANSPGV  790
             +DDIKS +EKVCPGIVSCADI+AIAARDS VLLGGP W+VKLGRRDSKTA+ +AA + G 
Sbjct  374   VDDIKSEVEKVCPGIVSCADILAIAARDSVVLLGGPGWEVKLGRRDSKTANFTAAKNGGF  433

Query  789   LPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTIFRDRIYNDTNTIAASFAKK  610
             +PSP SNLSALISSF+ QGLS  D+VALSG++TIG++RCT+FR RIYN+ N I +SFA+ 
Sbjct  434   IPSPTSNLSALISSFRVQGLSAKDMVALSGAHTIGKARCTVFRSRIYNEAN-IDSSFAET  492

Query  609   RQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGLLHSDQALYNGGSTDSLVKK  430
             R+R CP  +GSGDDNLAPLD+ TP  FD  Y++NL+NK+GLLHSDQ L+NGGSTDSLVKK
Sbjct  493   RRRNCPSASGSGDDNLAPLDVRTPDCFDKKYFQNLMNKQGLLHSDQVLFNGGSTDSLVKK  552

Query  429   YSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             Y  +   FNS F  A+IKMG+++PLTGSRGEIRKNCRK N
Sbjct  553   YGSSTKAFNSDFVTAIIKMGDVKPLTGSRGEIRKNCRKPN  592



>ref|XP_010552918.1| PREDICTED: peroxidase P7-like [Tarenaya hassleriana]
Length=319

 Score =   421 bits (1082),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 201/300 (67%), Positives = 242/300 (81%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
              QL+TNFY+ SCP L  T++SV++SA+  E R+GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  23    GQLTTNFYASSCPKLIPTVRSVMQSAVKREARIGASILRLFFHDCFVNGCDGSILLDDTS  82

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GEK A  N NSVRG++VID+IK+A EK CPGIVSCADI+AIAARD  VLLGGP+W+V
Sbjct  83    SFTGEKNAGPNRNSVRGFDVIDNIKTAAEKACPGIVSCADILAIAARDGVVLLGGPSWEV  142

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             KLGRRDS+TAS SAAN    +P+P  NLS L+SSF N GLS  D+VALSG +TIG++RCT
Sbjct  143   KLGRRDSRTASQSAANRD--IPAPTFNLSRLVSSFSNVGLSARDMVALSGGHTIGQARCT  200

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+ N I ++FA  RQR CPR  GSGD NLAPLD++TP  FDNNY+KNL+ +KG
Sbjct  201   TFRARIYNEKN-INSAFAATRQRNCPRTNGSGDGNLAPLDIQTPTKFDNNYFKNLMVQKG  259

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ Y   PA F+S F  AMI+MG+I PLTG +GEIR+NCR+ N
Sbjct  260   LLHSDQELFNGGSTDSIVRTYGTKPATFSSDFTAAMIRMGDISPLTGKKGEIRRNCRRVN  319



>gb|AAX44001.2| putative secretory peroxidase [Catharanthus roseus]
Length=318

 Score =   421 bits (1082),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 251/306 (82%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + SSSAQLST++YSKSCP +F T+KS + SA+ +E RMGASLLRL FHDCFV GCDGSI
Sbjct  15    LIGSSSAQLSTDYYSKSCPNVFNTVKSQVHSAILKEARMGASLLRLFFHDCFVNGCDGSI  74

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG+ V+D+IKSA+E VCPG+VSCADI+AIAARDS  +LG
Sbjct  75    LLDDTSSFTGEKRAAPNFNSARGFEVVDNIKSAVENVCPGVVSCADILAIAARDSVQILG  134

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD+ TAS +AAN+   +P P SNL+AL+S F   GLST DLVALSGS+TI
Sbjct  135   GPSWNVKLGRRDATTASQAAANNS--IPPPTSNLNALVSRFNALGLSTNDLVALSGSHTI  192

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN + A+ A+ R+  CPR +GS D+NLAPLDL+TP  FDNNYYKN
Sbjct  193   GQARCTNFRARIYNETNNLDAALAQTRRSNCPRPSGSRDNNLAPLDLQTPRAFDNNYYKN  252

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N++GLLHSDQ L+NGGSTDS+V+ YS NPA F S FA AMIKMG+I PLTGS G+IRK
Sbjct  253   LVNRRGLLHSDQQLFNGGSTDSIVRSYSGNPASFASDFAAAMIKMGDISPLTGSNGQIRK  312

Query  327   NCRKAN  310
             NCR+ N
Sbjct  313   NCRRIN  318



>ref|XP_004978554.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=331

 Score =   420 bits (1079),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 241/303 (80%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SSSAQLST FYS SCP ++  +KSV+++A+  E+RMGAS+LRL FHDCFVQGCD S+LLD
Sbjct  32    SSSAQLSTGFYSYSCPGVYDAVKSVVQAAIAREQRMGASILRLFFHDCFVQGCDASLLLD  91

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF+GEK A  NN SVRG+ VID IKSA+EKVCPG+VSCADI+AIAARDS V+LGGPN
Sbjct  92    DTSSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPN  151

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG++
Sbjct  152   WDVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  209

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  +YNDTN I  +FA+ RQ  CPR +GSGD+NLAPLDL+TP  F+NNYYKNL+ 
Sbjct  210   RCTNFRAHVYNDTN-IDGAFARTRQSACPRTSGSGDNNLAPLDLQTPTAFENNYYKNLVC  268

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGSTD+ V+ Y  + + F + F   MIKMG I PLTGS GEIRKNCR
Sbjct  269   KKGLLHSDQELFNGGSTDAQVQSYVSSQSAFFADFVTGMIKMGGITPLTGSNGEIRKNCR  328

Query  318   KAN  310
             + N
Sbjct  329   RIN  331



>ref|XP_006288218.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
 gb|EOA21116.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
Length=324

 Score =   419 bits (1077),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 247/300 (82%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFY+ SCP L  T+++ +KSA++ E+RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYATSCPNLLSTVQAAVKSAVNSERRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IKSA+EK CPG+VSCADI+AIAARDS V+LGGPNW V
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AANS   +P P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  148   KVGRRDARTASQAAANSN--IPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+TN I A+FA  RQR CPR TGSGD NLAPLD+ T A FDNNY+KNL+ ++G
Sbjct  206   SFRARIYNETN-INAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQRG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS NP+ F+S F  AMIKMG+I PLTGS GEIRK C + N
Sbjct  265   LLHSDQVLFNGGSTDSIVRGYSSNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>gb|ACT35473.1| peroxidase 52, partial [Brassica rapa]
Length=306

 Score =   418 bits (1074),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/300 (67%), Positives = 242/300 (81%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T++S +KSA+D + R GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  10    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  69

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IK+A+E  CPG+VSCADI+AIAARDS VLLGGPNW V
Sbjct  70    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  129

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AAN+   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  130   KVGRRDARTASQAAANNN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  187

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR R+YN+TN I A+FA  RQR CPR  GSGD NLAPLD+ +   FDN+Y+KNL+ ++G
Sbjct  188   NFRTRVYNETN-INAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRG  246

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V  YS NP+ F+S F  AMIKMG+I PLTGS GEIRK C + N
Sbjct  247   LLHSDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  306



>emb|CDX70158.1| BnaA10g25070D [Brassica napus]
Length=325

 Score =   418 bits (1075),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 200/300 (67%), Positives = 242/300 (81%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T++S +KSA+D + R GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IK+A+E  CPG+VSCADI+AIAARDS VLLGGPNW V
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AAN+   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  149   KVGRRDARTASQAAANNN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  206

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR R+YN+TN I A+FA  RQR CPR  GSGD NLAPLD+ +   FDN+Y+KNL+ ++G
Sbjct  207   NFRTRVYNETN-INAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRG  265

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V  YS NP+ F+S F  AMIKMG+I PLTGS GEIRK C + N
Sbjct  266   LLHSDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>emb|CDY14118.1| BnaC02g02350D [Brassica napus]
Length=324

 Score =   418 bits (1074),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 241/300 (80%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T+KS +KSA+  + RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+ VID+IKSA+EK CPG+VSCADI+AIAARDS V LGGPNW V
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD+KTAS +AANS   +P+P  +LS LISSF   GLST D+VALSG++TIG+SRC 
Sbjct  148   KVGRRDAKTASQAAANSN--IPAPNMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCV  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR R+YN+TN I A+FA  RQR CPR  GSGD NLAPLD+ +   FDN+Y+KNL+ ++G
Sbjct  206   NFRARVYNETN-INAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS +P+ FNS FA AMIKMG+I PLTGS GEIRK C K N
Sbjct  265   LLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFASAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_009125598.1| PREDICTED: peroxidase P7 [Brassica rapa]
Length=324

 Score =   418 bits (1074),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 240/300 (80%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T+KS +KSA+  + RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+ VID IKSA+EK CPG+VSCADI+AIAARDS V LGGPNW V
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD+KTAS +AANS   +P+P  +LS LISSF   GLST D+VALSG++TIG+SRC 
Sbjct  148   KVGRRDAKTASQAAANSN--IPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCV  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR R+YN+TN I A+FA  RQR CPR  GSGD NLAPLD+ +   FDN+Y+KNL+ ++G
Sbjct  206   NFRARVYNETN-INAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS +P+ FNS FA AMIKMG+I PLTGS GEIRK C K N
Sbjct  265   LLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>emb|CDY04948.1| BnaAnng01300D [Brassica napus]
Length=324

 Score =   418 bits (1074),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 240/300 (80%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T+KS +KSA+  + RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+ VID IKSA+EK CPG+VSCADI+AIAARDS V LGGPNW V
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD+KTAS +AANS   +P+P  +LS LISSF   GLST D+VALSG++TIG+SRC 
Sbjct  148   KVGRRDAKTASQAAANSN--IPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCV  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR R+YN+TN I A+FA  RQR CPR  GSGD NLAPLD+ +   FDN+Y+KNL+ ++G
Sbjct  206   NFRARVYNETN-INAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS +P+ FNS FA AMIKMG+I PLTGS GEIRK C K N
Sbjct  265   LLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_008456761.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Cucumis melo]
Length=323

 Score =   417 bits (1072),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 241/306 (79%), Gaps = 2/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL + SAQLST FYS SCP L  T+KS ++SA+  E RMGAS+LRL FHDCFV GCDGSI
Sbjct  20    FLGNVSAQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLXFHDCFVNGCDGSI  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK+A  N NS RG++VID+IK+A+E  CPG+VSCADI+AIAARDS V LG
Sbjct  80    LLDDTSSFTGEKSANPNRNSARGFDVIDNIKTAVENACPGVVSCADILAIAARDSVVFLG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRDS TAS S AN+   +P P S+LS L S F   GLS TDLVALSG +TI
Sbjct  140   GPSWNVKLGRRDSTTASQSQANND--IPGPNSSLSQLSSRFSALGLSNTDLVALSGGHTI  197

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIY++++ I + FA+ RQ  CP  +GSGD+NLAPLDL+TP  FDNNY+KN
Sbjct  198   GQARCTTFRSRIYSNSSNIESLFARTRQSNCPNTSGSGDNNLAPLDLQTPNSFDNNYFKN  257

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+  KGLL SDQ L+NGGSTDS+V+ Y+  PA F S FA AM+KMG+I PLTGS G+IRK
Sbjct  258   LVQNKGLLQSDQVLFNGGSTDSVVRNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRK  317

Query  327   NCRKAN  310
             NCR+ N
Sbjct  318   NCRRVN  323



>ref|XP_002450133.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
 gb|EES09121.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
Length=328

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 197/303 (65%), Positives = 245/303 (81%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLST FYS SCP ++G +KSV+KSA+  EKRMGAS++RL FHDCFVQGCD S+LLD
Sbjct  29    TSSAQLSTGFYSYSCPGVYGAVKSVMKSAIANEKRMGASIVRLFFHDCFVQGCDASLLLD  88

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT++F+GEK A  NN SVRG+ VID +KSA+EKVCPG+VSCADI+AIAARDS V+LGGP+
Sbjct  89    DTATFQGEKMATPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPS  148

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG++
Sbjct  149   WDVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  206

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  IYNDT+ I ++FAK RQ  CP  +G+GD+NLAPLDL+TP  F+NNYYKNL++
Sbjct  207   RCTNFRAHIYNDTD-INSAFAKTRQSGCPSTSGAGDNNLAPLDLQTPTVFENNYYKNLLS  265

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGG+TD+LV+ Y  + + F + F   MIKMG+I PLTGS G+IRKNCR
Sbjct  266   KKGLLHSDQELFNGGATDTLVQSYVGSQSTFFTDFVTGMIKMGDITPLTGSNGQIRKNCR  325

Query  318   KAN  310
             + N
Sbjct  326   RVN  328



>gb|ACU23223.1| unknown [Glycine max]
Length=328

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 255/303 (84%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSA LS NFYSK+CP +F T+KSV+KSA+  E R+GAS++RL FHDCFVQGCDGSILLD
Sbjct  28    TSSANLSKNFYSKTCPNVFNTVKSVVKSAVVREPRIGASIVRLFFHDCFVQGCDGSILLD  87

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +F+GEKTA ANNNSVRG+ VID IKS +EK+CPG+VSCADI+ IA+RDS VLLGGP 
Sbjct  88    DTPTFQGEKTAAANNNSVRGFEVIDAIKSEVEKICPGVVSCADILDIASRDSVVLLGGPF  147

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             WKV+LGRRDS+TA+ +AAN+ GV+P P SNL+ LI+ F++QGLS  D+VALSG++T G++
Sbjct  148   WKVRLGRRDSRTANFTAANT-GVIPPPTSNLTNLITRFRDQGLSARDMVALSGAHTFGKA  206

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FRDRIYN TN I  +FA  RQR+CPR  G+GD+NLA LD  TP  FDNNY+KNL+ 
Sbjct  207   RCTSFRDRIYNQTN-IDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLI  265

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             K+GLL+SDQ L+NGGSTDSLV+ YS+N   F++ F +AMI+MG+I+PLTGS+GEIRKNCR
Sbjct  266   KRGLLNSDQVLFNGGSTDSLVRTYSQNNKAFDTDFVKAMIRMGDIKPLTGSQGEIRKNCR  325

Query  318   KAN  310
             + N
Sbjct  326   RVN  328



>ref|XP_009122142.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Brassica rapa]
Length=325

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/300 (66%), Positives = 241/300 (80%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T++S +KSA+D + R GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IK+A+E  CPG+VSCADI+AIAARDS VLLGGPNW V
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AAN+   +P+P S+LS LISSF   GLST D+VALSG++TIG+SRCT
Sbjct  149   KVGRRDARTASQAAANNN--IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCT  206

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR R+YN+TN I A+FA  RQR CPR  GSGD NLAPLD+ +   FDN+Y+KNL+ ++G
Sbjct  207   NFRTRVYNETN-INAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRG  265

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGG TDS+V  YS NP+ F+S F  AMIKMG+I PLTGS GEIRK C + N
Sbjct  266   LLHSDQELFNGGXTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>gb|KHG25850.1| Peroxidase 4 [Gossypium arboreum]
Length=323

 Score =   417 bits (1071),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 252/303 (83%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SS+AQLST++YSKSCP LF T+K  + SA+ +E RMGASLLRL FHDCFV GCDGS+LLD
Sbjct  24    SSNAQLSTDYYSKSCPNLFSTVKFTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLLLD  83

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTSSF GEK A  N NS RG++VIDDIKSA+E VCPG+VSCADI+AIAARDS  LLGGPN
Sbjct  84    DTSSFTGEKNAVPNRNSARGFDVIDDIKSAVENVCPGVVSCADILAIAARDSVKLLGGPN  143

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD+++AS +AAN+   +P+P SNL+ LIS F   GLST DLVALSG++TIG++
Sbjct  144   WDVKLGRRDARSASRAAANNG--IPAPTSNLNRLISRFNALGLSTRDLVALSGAHTIGQA  201

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN++N I  SFAK +Q  CPR +GSGD+NLAPLD++TP +FDN Y+ NLI 
Sbjct  202   RCTSFRARIYNESN-IDLSFAKTKQSNCPRSSGSGDNNLAPLDIQTPTYFDNKYFNNLIG  260

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             K+GLLHSDQ L+NGGSTDS+V+ YSKNP+ F+S F  AMIKMG+I PLTGS+GEIRKNCR
Sbjct  261   KRGLLHSDQELFNGGSTDSIVRAYSKNPSSFSSDFVTAMIKMGDISPLTGSKGEIRKNCR  320

Query  318   KAN  310
             + N
Sbjct  321   RVN  323



>gb|KHN48395.1| Peroxidase 4 [Glycine soja]
Length=328

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 255/303 (84%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSA LS NFYSK+CP +F T+KSV+KSA+  E R+GAS++RL FHDCFVQGCDGSILLD
Sbjct  28    TSSANLSKNFYSKTCPNVFNTVKSVVKSAVVREPRIGASIVRLFFHDCFVQGCDGSILLD  87

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +F+GEKTA ANNNSVRG+ VID IKS +EK+CPG+VSCADI+ IA+RDS VLLGGP 
Sbjct  88    DTPTFQGEKTAAANNNSVRGFEVIDAIKSEVEKICPGVVSCADILDIASRDSVVLLGGPF  147

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             WKV+LGRRDS+TA+ +AAN+ GV+P P SNL+ LI+ F++QGLS  D+VALSG++T G++
Sbjct  148   WKVRLGRRDSRTANFTAANT-GVIPPPTSNLTNLITRFRDQGLSARDMVALSGAHTFGKA  206

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FRDRIYN TN I  +FA  RQR+CPR  G+GD+NLA LD  TP  FDNNY+KNL+ 
Sbjct  207   RCTSFRDRIYNQTN-IDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLI  265

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             K+GLL+SDQ L+NGGSTDSLV+ YS+N   F++ F +AMI+MG+I+PLTGS+GEIRKNCR
Sbjct  266   KRGLLNSDQVLFNGGSTDSLVRTYSQNNKAFDTDFVKAMIRMGDIKPLTGSQGEIRKNCR  325

Query  318   KAN  310
             + N
Sbjct  326   RVN  328



>sp|P00434.3|PERP7_BRARR RecName: Full=Peroxidase P7; AltName: Full=TP7 [Brassica rapa 
subsp. rapa]
Length=296

 Score =   416 bits (1068),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/299 (68%), Positives = 240/299 (80%), Gaps = 3/299 (1%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
             QL+TNFYS SCP L  T+KS +KSA+  + RMGAS+LRL FHDCFV GCDGSILLDDTSS
Sbjct  1     QLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSS  60

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F GE+ A  N NS RG+ VI+DIKSA+EK CPG+VSCADI+AIAARDS V LGGPNW VK
Sbjct  61    FTGEQNAGPNRNSARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVK  120

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             +GRRD+KTAS +AANS   +P+P  +LS LISSF   GLST D+VALSG++TIG+SRC  
Sbjct  121   VGRRDAKTASQAAANSN--IPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVN  178

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGL  487
             FR R+YN+TN I A+FA  RQR CPR  GSGD NLAPLD+ +   FDN+Y+KNL+ ++GL
Sbjct  179   FRARVYNETN-INAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGL  237

Query  486   LHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LHSDQ L+NGGSTDS+V+ YS +P+ FNS FA AMIKMG+I PLTGS GEIRK C K N
Sbjct  238   LHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  296



>ref|XP_004978553.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=355

 Score =   417 bits (1072),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 197/303 (65%), Positives = 242/303 (80%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLST FYS SCP ++  +KSV++SA+D+EKRMGAS++RL FHDCFVQGCDGS+LLD
Sbjct  56    TSSAQLSTGFYSSSCPGVYSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDGSLLLD  115

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT SF+GEK A  NN SVRG+ VID IKSA+EKVCPG+VSCADI+AIAARDS V+LGGPN
Sbjct  116   DTPSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPN  175

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG +
Sbjct  176   WNVKVGRRDSMTASFSGANNS--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLA  233

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  +YN+TN I  + A+ RQ  CP  +G+GD+NLAPLDL+TP  F+NNYYKNL++
Sbjct  234   RCTNFRAHVYNETN-IDGALARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENNYYKNLVS  292

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGG+TD+ V+ Y  + + F + F   MIKMG+I PLTGS GEIRKNCR
Sbjct  293   KKGLLHSDQELFNGGATDAQVQSYVSSQSAFFADFVTGMIKMGDITPLTGSNGEIRKNCR  352

Query  318   KAN  310
             + N
Sbjct  353   RIN  355



>ref|XP_003551174.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=328

 Score =   416 bits (1069),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/303 (67%), Positives = 255/303 (84%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSA LS NFYSK+CP +F T+KSV+KSA+  E R+GAS++RL FHDCFVQGCDGSILLD
Sbjct  28    TSSANLSKNFYSKTCPNVFNTVKSVVKSAVVREPRIGASIVRLFFHDCFVQGCDGSILLD  87

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +F+GEKTA ANNNSVRG+ VID IKS +EK+CPG+VSCADI+ +A+RDS VLLGGP 
Sbjct  88    DTPTFQGEKTAAANNNSVRGFEVIDAIKSEVEKICPGVVSCADILDLASRDSVVLLGGPF  147

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             WKV+LGRRDS+TA+ +AAN+ GV+P P SNL+ LI+ F++QGLS  D+VALSG++T G++
Sbjct  148   WKVRLGRRDSRTANFTAANT-GVIPPPTSNLTNLITRFRDQGLSARDMVALSGAHTFGKA  206

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FRDRIYN TN I  +FA  RQR+CPR  G+GD+NLA LD  TP  FDNNY+KNL+ 
Sbjct  207   RCTSFRDRIYNQTN-IDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLI  265

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             K+GLL+SDQ L+NGGSTDSLV+ YS+N   F++ F +AMI+MG+I+PLTGS+GEIRKNCR
Sbjct  266   KRGLLNSDQVLFNGGSTDSLVRTYSQNNKAFDTDFVKAMIRMGDIKPLTGSQGEIRKNCR  325

Query  318   KAN  310
             + N
Sbjct  326   RVN  328



>ref|XP_010931330.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=319

 Score =   416 bits (1068),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 197/299 (66%), Positives = 243/299 (81%), Gaps = 3/299 (1%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
              L+ +FY+KSCP LF T+K V+++A+ +EKRMGASLLRL FHDCFVQGCD SILLDDT +
Sbjct  24    HLTPDFYAKSCPKLFSTVKPVVQAAIAKEKRMGASLLRLVFHDCFVQGCDASILLDDTPT  83

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F+GEKTA  NNNSVRG++VID IK+A+EKVCPG+VSCADI+ I ARDS V+LGGP W+VK
Sbjct  84    FRGEKTAAPNNNSVRGFDVIDKIKAAVEKVCPGVVSCADILEITARDSVVILGGPFWEVK  143

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             LGRRDS TAS S AN    +P P S+LS LI+ F  QGLST D+VALSG++TIG++RC  
Sbjct  144   LGRRDSTTASFSLANQN--IPPPTSSLSNLINKFAAQGLSTKDMVALSGAHTIGKARCIN  201

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGL  487
             FR+RIYN+T+ I ++FAKKRQ  CP+  GSGD+NLAPLD++TP +FDN+YY+NLI+K+GL
Sbjct  202   FRNRIYNETD-INSAFAKKRQANCPKTAGSGDNNLAPLDVQTPTYFDNDYYQNLIHKEGL  260

Query  486   LHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LHSDQ LYNGGSTD  VK YS +P  F   F   MI + +I PLTGS+GEIRKNCR+ N
Sbjct  261   LHSDQVLYNGGSTDFQVKTYSISPGSFYHDFVVGMINIADINPLTGSKGEIRKNCRRVN  319



>ref|XP_010491069.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   416 bits (1068),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 205/300 (68%), Positives = 243/300 (81%), Gaps = 3/300 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             AQL+TNFYS SCP L  T+++ +KSA+  E RMG S+LRL FHDCFV GCDGSILLDDTS
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             SF GE+ A  N NS RG+NVID+IKSA+EK CPG+VSCADI+AIAARDS V LGGPNW V
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K+GRRD++TAS +AANS   +P P S+LS LISSF   GLST D+VALSG++TIG++RCT
Sbjct  148   KVGRRDARTASQAAANSN--IPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQARCT  205

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FR RIYN+TN I A+FA  RQR CPR TGSGD NLAPLD+ T A FDNNY+KNL+ +KG
Sbjct  206   SFRARIYNETN-INAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKG  264

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NGGSTDS+V+ YS +P+ F+S F  AMIKMG+I PLTGS GEIRK C + N
Sbjct  265   LLHSDQELFNGGSTDSIVRGYSNSPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|XP_006843746.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
 gb|ERN05421.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
Length=318

 Score =   415 bits (1066),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 199/303 (66%), Positives = 241/303 (80%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SS AQL+ ++Y+ SCP    TI+S +KSA+  +KR+GA LLRL FHDCFV GCDGS+LLD
Sbjct  19    SSYAQLTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLD  78

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTS+F GEK A  N NS RG+N++D+IKSA+EK CPG+VSCAD +A+AARDS VLLGGP+
Sbjct  79    DTSTFIGEKNAQPNRNSARGFNIVDNIKSAVEKACPGVVSCADTLAVAARDSVVLLGGPD  138

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W+VKLGRRD++TAS +AAN+   +P P  NL+ LI+SF NQGLS  D+VALSG +T+G +
Sbjct  139   WQVKLGRRDARTASQAAANNS--IPPPTFNLNQLINSFANQGLSQKDMVALSGGHTLGVA  196

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC   RDRIYN+TN I  SFAK RQ  CPR  GSGD+N+ PL+L+TP  FDN Y+KNLIN
Sbjct  197   RCINIRDRIYNETN-IDPSFAKTRQSNCPRTAGSGDNNVNPLELQTPTAFDNKYFKNLIN  255

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGS DSLV+ YS N  LFN  F  AMIKMG+I+PLTGS GEIRKNCR
Sbjct  256   KKGLLHSDQQLFNGGSADSLVRSYSSNSDLFNKDFVAAMIKMGDIKPLTGSNGEIRKNCR  315

Query  318   KAN  310
             K N
Sbjct  316   KIN  318



>ref|XP_007141708.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
 gb|ESW13702.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
Length=320

 Score =   415 bits (1066),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 203/302 (67%), Positives = 241/302 (80%), Gaps = 3/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             ++A L TNFYS SCP L  T+K  ++SA+ +E RMGASLLRL FHDCFV GCDGSILLDD
Sbjct  22    ANATLYTNFYSSSCPKLLDTVKCAVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDD  81

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF GEK A  N NS RG++VID IKSA+E+VCPG+VSCADI+AIAARDS  +LGGP+W
Sbjct  82    TSSFTGEKNARPNKNSARGFDVIDKIKSAVEEVCPGVVSCADILAIAARDSVHILGGPSW  141

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDS+TAS SAAN+   +P P SN++ LIS F + GLS  DLVALSG++TIG++R
Sbjct  142   NVKLGRRDSRTASQSAANNG--IPPPTSNVNQLISRFNSLGLSPKDLVALSGAHTIGQAR  199

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR RIYN+TN I +SFA  RQ  CP  +GSGD+NLAPLDL TP FFDN+Y+KNLI K
Sbjct  200   CTTFRARIYNETN-IDSSFAHIRQSTCPPNSGSGDNNLAPLDLATPTFFDNHYFKNLIQK  258

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+NG STDSLV+ Y+ NP  F + F+ AMIKMG+I PLTGS GEIR  CR+
Sbjct  259   KGLLHSDQQLFNGASTDSLVRTYNTNPGSFFADFSAAMIKMGDISPLTGSLGEIRNKCRR  318

Query  315   AN  310
              N
Sbjct  319   VN  320



>ref|XP_006843744.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
 gb|ERN05419.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
Length=318

 Score =   414 bits (1065),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 199/303 (66%), Positives = 242/303 (80%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SS AQL+ ++Y+ SCP    TI+S +KSA+  +KR+GA LLRL FHDCFV GCDGS+LLD
Sbjct  19    SSYAQLTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLD  78

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTS+F GEK A  N NS RG+N++D+IKSA+EK CPG+VSCAD +A+AARDS VLLGGP+
Sbjct  79    DTSTFIGEKNAAPNRNSARGFNIVDNIKSAVEKACPGVVSCADTLAVAARDSVVLLGGPD  138

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W+VKLGRRD++TAS +AAN+   +P P  NL+ LI+SF NQGLS  D+VALSG +TIG +
Sbjct  139   WQVKLGRRDARTASQAAANNS--IPPPTFNLNQLINSFANQGLSQKDMVALSGGHTIGVA  196

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC   R+RIYN+TN I  SFAK RQ  CPR  GSGD+N+ PLDL+TP  FDN Y+KNLIN
Sbjct  197   RCINIRNRIYNETN-IDPSFAKTRQSNCPRTAGSGDNNVNPLDLQTPTAFDNKYFKNLIN  255

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGS+DSLV+ YS N  LF+  F  AMIKMG+I+PLTGS GEIRKNCR
Sbjct  256   KKGLLHSDQQLFNGGSSDSLVRSYSSNSDLFDKDFVAAMIKMGDIKPLTGSNGEIRKNCR  315

Query  318   KAN  310
             K N
Sbjct  316   KIN  318



>ref|XP_002450132.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
 gb|EES09120.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
Length=331

 Score =   413 bits (1062),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 242/303 (80%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLST+FYS SCP ++ ++KS I+SA+  E+RMGAS++RL FHDCFVQGCD S+LLD
Sbjct  32    TSSAQLSTSFYSSSCPGVYDSVKSAIQSAIATEQRMGASIVRLFFHDCFVQGCDASLLLD  91

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT+SF+GEK A  NN SVRG+ VID +KSA+EKVCPG+VSCADI+AIAARDS V+LGGP+
Sbjct  92    DTASFQGEKMATPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPS  151

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG++
Sbjct  152   WDVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  209

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  +YNDTN I  +FA+ RQ  CPR +GSGD+NLAPLDL+TP  F+NNYYKNL+ 
Sbjct  210   RCTNFRAHVYNDTN-IDGTFARTRQSGCPRTSGSGDNNLAPLDLQTPTVFENNYYKNLVC  268

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGG+TD+ V+ Y  + + F S F   MIKMG+I PLTGS G+IRKNCR
Sbjct  269   KKGLLHSDQELFNGGATDAQVQSYISSQSTFFSDFVTGMIKMGDITPLTGSNGQIRKNCR  328

Query  318   KAN  310
               N
Sbjct  329   MIN  331



>ref|XP_004977588.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=321

 Score =   412 bits (1060),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 241/303 (80%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLST FYS SCP +   +KSV++SA+D+EKRMGAS++RL FHDCFVQGCD S+LLD
Sbjct  22    TSSAQLSTGFYSSSCPGVSSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDASLLLD  81

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT SF+GEK A  NN SVRG+ VID IKSA+EKVCPG+VSCADI+AIAARDS V+LGGPN
Sbjct  82    DTPSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPN  141

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG +
Sbjct  142   WNVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLA  199

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  +YN+TN I  +FA+ RQ  CP  +G+GD+NLAPLDL+TP  F+NNYY+NL++
Sbjct  200   RCTNFRAHVYNETN-IDGAFARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENNYYRNLVS  258

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGG+TD+ V+ Y  + + F + F   MIKMG+I PLTGS GEIRKNCR
Sbjct  259   KKGLLHSDQELFNGGATDAQVQSYVSSQSAFFADFVTGMIKMGDITPLTGSNGEIRKNCR  318

Query  318   KAN  310
             + N
Sbjct  319   RMN  321



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   412 bits (1060),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 237/301 (79%), Gaps = 3/301 (1%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             S QLST FYS SCP L  T+KS ++SA+  E RMGAS+LRL FHDCFV GCDGSILLDDT
Sbjct  25    SGQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSILLDDT  84

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             SSF GEK A  N NS RG++VID+IK+A+EK CPG+VSCADI+AIAARDS VLLGGP+W 
Sbjct  85    SSFTGEKNANPNRNSARGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWN  144

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             VKLGRRDS TAS S AN+   +P P S+LS L S F   GLS+TDLVALSG +TIG++RC
Sbjct  145   VKLGRRDSTTASQSQANND--IPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARC  202

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             T FR RIY++++ I +SFA+ RQ  CP  +G+GD+NLAPLD  TP  FDNNYYKNL+  K
Sbjct  203   TTFRSRIYSNSSNIESSFARTRQSNCPNTSGTGDNNLAPLDF-TPTSFDNNYYKNLVQNK  261

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GLL SDQ L+NGGSTDS+V+ Y+  PA F S FA AM+KMG+I PLTGS G+IRKNCR  
Sbjct  262   GLLQSDQVLFNGGSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRMV  321

Query  312   N  310
             N
Sbjct  322   N  322



>gb|KHG17773.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=325

 Score =   412 bits (1060),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 203/308 (66%), Positives = 246/308 (80%), Gaps = 5/308 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F   ++A+LSTNFYSKSCP L  T+K ++ SA+ +E RMGASLLRL FHDCFV GCDGSI
Sbjct  21    FHGRTNAKLSTNFYSKSCPNLLPTVKFIVHSAIMKEARMGASLLRLFFHDCFVNGCDGSI  80

Query  1047  LLDD-TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLL  871
             LLDD  SSF GEK A  N NS RG+NV+DDIKSA+E VCPG+VSCADI+AI+ARDS  +L
Sbjct  81    LLDDDISSFIGEKNAAPNRNSARGFNVVDDIKSAVEIVCPGLVSCADILAISARDSVTIL  140

Query  870   GGPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYT  691
             GGP W VKLGRRD++TAS +AAN+   +PSP SNL+ LIS F   GL+  DLVALSG +T
Sbjct  141   GGPYWDVKLGRRDARTASQAAANNN--IPSPSSNLNQLISGFNAHGLAPRDLVALSGGHT  198

Query  690   IGESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYK  511
             IG++RCT FR R+YN++N I  SFA+ RQR CPR+TGSGD+NLAPLD+ TP +FDN+Y+K
Sbjct  199   IGQARCTTFRARVYNESN-IDPSFARTRQRNCPRETGSGDNNLAPLDIHTPTYFDNSYFK  257

Query  510   NLINKKGLLHSDQALYNGGS-TDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEI  334
             NLI+++GL HSDQ L+ GG  TDS+V+ YS NP  F S FA AMIKMG+I PLTGS GEI
Sbjct  258   NLIDRRGLFHSDQQLFTGGGFTDSIVRGYSNNPRSFRSDFAAAMIKMGDISPLTGSMGEI  317

Query  333   RKNCRKAN  310
             RKNCR+ N
Sbjct  318   RKNCRRVN  325



>gb|AFW64595.1| hypothetical protein ZEAMMB73_885092 [Zea mays]
Length=333

 Score =   412 bits (1059),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/304 (65%), Positives = 241/304 (79%), Gaps = 4/304 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLST FYS SCP ++  +KSV++SA+  E+RMGAS++RL FHDCFVQGCD S+LLD
Sbjct  33    TSSAQLSTGFYSSSCPGVYDAVKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLLLD  92

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT SF+GEK A  NN SVRG+ VID +KSA+EKVCPG+VSCADI+AIAARDS V+LGGP 
Sbjct  93    DTPSFQGEKMANPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPT  152

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG++
Sbjct  153   WDVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  210

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTG-SGDDNLAPLDLETPAFFDNNYYKNLI  502
             RCT FR  +YNDTN I  SFA+ RQ  CPR +G SGD+NLAPLDL+TP  F+NNYYKNL+
Sbjct  211   RCTNFRAHVYNDTN-IDGSFARTRQSGCPRSSGSSGDNNLAPLDLQTPTVFENNYYKNLV  269

Query  501   NKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNC  322
              KKGLLHSDQ L+NGG+TD+LV+ Y+   + F S F   M+KMG+I PLTGS G+IRKNC
Sbjct  270   CKKGLLHSDQELFNGGATDALVQSYASGQSEFFSDFVTGMVKMGDITPLTGSGGQIRKNC  329

Query  321   RKAN  310
             R+ N
Sbjct  330   RRVN  333



>ref|XP_003602462.1| Peroxidase [Medicago truncatula]
 gb|AES72713.1| class III peroxidase [Medicago truncatula]
Length=322

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 240/306 (78%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + S +AQLSTNFYSK+CP L   ++  ++SA+ +E R+GAS+LRL FHDCFV GCDGSI
Sbjct  20    IIGSVNAQLSTNFYSKTCPKLSSIVQRQVQSAISKEARIGASILRLFFHDCFVNGCDGSI  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTS+F GEK A  N NSVRG++VID+IK+A+E VCPG+VSCADI+AIAA DS  +LG
Sbjct  80    LLDDTSNFTGEKNALPNKNSVRGFDVIDNIKTAVENVCPGVVSCADILAIAATDSVAILG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRD+ TAS S AN+   +P P SNL+ L S F+N GLST DLVALSG++TI
Sbjct  140   GPTWNVKLGRRDATTASQSDANT--AIPRPTSNLNILTSMFKNVGLSTKDLVALSGAHTI  197

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I  SFA  RQ  CP+ +GSGD+NLAPLDL TP  FDN YY+N
Sbjct  198   GQARCTTFRVRIYNETN-IDTSFASTRQSNCPKTSGSGDNNLAPLDLHTPTSFDNCYYRN  256

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+  KGLLHSDQ L+NGGST+S+V  Y  N   F S FA AMIKMG+I+PLTGS GEIRK
Sbjct  257   LVQNKGLLHSDQQLFNGGSTNSIVSGYFNNQNSFFSDFATAMIKMGDIKPLTGSNGEIRK  316

Query  327   NCRKAN  310
             NCRK N
Sbjct  317   NCRKPN  322



>gb|ABR23054.1| basic peroxidase swpb4 [Ipomoea batatas]
Length=320

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 247/301 (82%), Gaps = 3/301 (1%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQLS  FYSKSCP LF T+ SV++SA+ +E RMGASLLRL FHDCFV GCDGSILLDDT
Sbjct  23    SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  82

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             SSF GEK A  N  S RG+ VID IKSA+EKVCPG+VSCADI+AIA+RDSTV LGGP+W 
Sbjct  83    SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  142

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             VKLGRRD++ AS +AAN+   +P+P SNL+ LISSF   GLST D+V LSGS+TIG++RC
Sbjct  143   VKLGRRDARAASQAAANNS--IPAPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARC  200

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             T FR RIYN++N I +SFA+ R+  CPR +GSGD+NLAPLDL+TP  FDNNYY NL+NKK
Sbjct  201   TNFRARIYNESN-IDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKK  259

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GLLHSDQ L+NG STDS V+ YS NP+ F S FA AMIKMG+I+PLTG+ GEIRKNCR+ 
Sbjct  260   GLLHSDQQLFNGVSTDSTVRGYSTNPSKFRSDFAAAMIKMGDIKPLTGNNGEIRKNCRRR  319

Query  312   N  310
             N
Sbjct  320   N  320



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/301 (68%), Positives = 239/301 (79%), Gaps = 5/301 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQLS+ FY K+CP    TIKS + SA++ E+RMGASLLRLHFHDCFVQGCD S+LLDDT
Sbjct  21    SAQLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDT  80

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             SSFKGEKTA  N  S+RG+NVID IKS +E +CPG+VSCADI+A+AARDS V LGGP W 
Sbjct  81    SSFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGPTWT  140

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V+LGRRDS TASLS+ANS   LP+P S+LSALISSF N+G S+ +LVALSGS+TIG+++C
Sbjct  141   VQLGRRDSTTASLSSANSD--LPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQC  198

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             + FR RIYNDTN I +SFAK  Q  CP  TG G   LAPLD  +P  FDN Y+KNL +KK
Sbjct  199   SSFRTRIYNDTN-IDSSFAKSLQGNCP-STGGG-STLAPLDTTSPNTFDNAYFKNLQSKK  255

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GLLHSDQ L+NGGSTDS V  YS NPA F + FA AMIKMGN+ PLTGS G+IR NCRK 
Sbjct  256   GLLHSDQELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRTNCRKT  315

Query  312   N  310
             N
Sbjct  316   N  316



>ref|XP_004490701.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=335

 Score =   410 bits (1054),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 205/301 (68%), Positives = 237/301 (79%), Gaps = 3/301 (1%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             A+LS N Y K CP +F  I SV+ SA+ +E RMGASLLRL FHDCFV GCDGS+LLDDTS
Sbjct  37    AELSENLYVKKCPNVFNAINSVVHSAVAKEPRMGASLLRLFFHDCFVNGCDGSVLLDDTS  96

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             S KGEK A  N +S+RG+ VID IKS +E +CPG+VSCADI+AI ARDS V LGGP WKV
Sbjct  97    SIKGEKNAGPNKDSLRGFEVIDAIKSKVEALCPGVVSCADILAITARDSVVNLGGPYWKV  156

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             KLGRRDSK AS + ANS GV+P PFS L  LIS FQ QGLST D+VALSG++TIG++RC 
Sbjct  157   KLGRRDSKRASFNDANS-GVIPPPFSTLKNLISRFQAQGLSTKDMVALSGAHTIGKARCI  215

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGS-GDDNLAPLDLETPAFFDNNYYKNLINKK  493
             ++RD IYNDTN I + FAK R+R CPR +GS  D+N+A LD +TP  FDN YYKNLINKK
Sbjct  216   VYRDHIYNDTN-IDSLFAKSRKRNCPRTSGSIKDNNVAVLDFKTPNHFDNLYYKNLINKK  274

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GLLHSDQ L+NGGSTDSLVK YS N   F + F  AMIKMGN  PLTGS+GEIRKNCR+A
Sbjct  275   GLLHSDQELFNGGSTDSLVKTYSNNQKAFENDFVIAMIKMGNNNPLTGSKGEIRKNCRRA  334

Query  312   N  310
             N
Sbjct  335   N  335



>ref|XP_004502855.1| PREDICTED: peroxidase 52-like [Cicer arietinum]
Length=322

 Score =   409 bits (1052),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/305 (67%), Positives = 244/305 (80%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + S++AQLS NFYS SC  L  T+KS ++SA+ +E R+GAS+LRL FHDCFV GCDGSIL
Sbjct  21    VGSANAQLSENFYSSSCSQLSSTVKSTMQSAISKEARIGASILRLFFHDCFVNGCDGSIL  80

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEK A  N NS RG+ VID+IK+A+EKVCPGIVSCADI+AIAA+DS  +LGG
Sbjct  81    LDDTSSFTGEKNANPNRNSARGFEVIDNIKTAVEKVCPGIVSCADILAIAAKDSVEILGG  140

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VK+GRRD+KTAS SAAN+   +P+P S+L+ L S F   GLST DLVALSG++TIG
Sbjct  141   PTWNVKVGRRDAKTASQSAANTG--IPAPSSSLTQLTSRFSALGLSTKDLVALSGAHTIG  198

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR RIYN+TN I  SFA  R+  CP  +GSGD+NLAPLDL+TP  FDNNY+KNL
Sbjct  199   QARCTNFRARIYNETN-IDTSFATTRKSSCPSTSGSGDNNLAPLDLQTPTSFDNNYFKNL  257

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             I KKGLLHSDQ L+NGGS DS+V  YS NP  F+S F+ AMIKMG+I PLTGS GEIRKN
Sbjct  258   IQKKGLLHSDQQLFNGGSADSIVTGYSTNPTSFSSAFSAAMIKMGDISPLTGSNGEIRKN  317

Query  324   CRKAN  310
             CR+ N
Sbjct  318   CRRTN  322



>gb|EPS59568.1| hypothetical protein M569_15235, partial [Genlisea aurea]
Length=314

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 242/303 (80%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SSSAQLS ++Y  SCP LF T++SV++SA+  E R+GASLLRL FHDCFV GCDGS+LLD
Sbjct  15    SSSAQLSVDYYCDSCPDLFATVRSVVESAVQAEARIGASLLRLFFHDCFVNGCDGSVLLD  74

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT SF+GEK A  N NS RG++V+D IKSA+E VCPG+VSCADI+A+A+RDS  +LGGP+
Sbjct  75    DTPSFRGEKGALPNLNSARGFDVVDRIKSAVENVCPGVVSCADILAVASRDSVGILGGPS  134

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD++TAS++AAN+   +P P SNL+ALISSF ++GLS  DLV LSGS+TIG++
Sbjct  135   WDVKLGRRDARTASITAANTS--IPPPTSNLNALISSFSSKGLSLNDLVVLSGSHTIGQA  192

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN+TN IA  FA+ R+  CPR  G GD NLAPLDL+TP  FDNNYYKNL++
Sbjct  193   RCTSFRTRIYNETN-IAQDFAQLRRNGCPRPAGVGDGNLAPLDLQTPTRFDNNYYKNLLS  251

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGG+ D +VKKY  +   F   FA A+IKMG+I PLTGS GEIR NCR
Sbjct  252   KKGLLHSDQELFNGGAADWIVKKYLDDKDGFFRDFAAALIKMGDISPLTGSAGEIRTNCR  311

Query  318   KAN  310
               N
Sbjct  312   LVN  314



>ref|XP_008782619.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=320

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 239/303 (79%), Gaps = 6/303 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLS  FY  SCP    TI+S +K+A+ +E+RMGASLLRLHFHDCFVQGCDGS+LLDD
Sbjct  23    TSAQLSPTFYDTSCPKALSTIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDD  82

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TS+F GEKTA  NNNS+RG++VID IKS +E VC   VSCADI+A+AARDS V LGGP+W
Sbjct  83    TSTFTGEKTAGPNNNSIRGFDVIDTIKSRVEAVCKQTVSCADILAVAARDSVVALGGPSW  142

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPF-SNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
              V+LGRRDS TASLS ANS   +PSP  S+LSALIS+F  +GL+T+D+VALSG++TIG++
Sbjct  143   TVQLGRRDSTTASLSLANSD--IPSPITSDLSALISAFSKKGLATSDMVALSGAHTIGQA  200

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR+RIYN+TN I +SFA   Q  CP     GD NLAPLD+ TP  FDN YY+NL+N
Sbjct  201   RCTSFRNRIYNETN-IDSSFATSLQSNCP--VSGGDSNLAPLDVSTPTIFDNFYYRNLLN  257

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGSTDS V  YS N A F S FA AM+ MGNI PLTG+ GEIR +CR
Sbjct  258   KKGLLHSDQQLFNGGSTDSQVSSYSTNSAKFFSDFASAMVNMGNISPLTGTSGEIRISCR  317

Query  318   KAN  310
             K N
Sbjct  318   KTN  320



>ref|XP_003616748.1| Peroxidase [Medicago truncatula]
 gb|AES99706.1| class III peroxidase [Medicago truncatula]
Length=325

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 239/305 (78%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + S++A LS ++Y  SCP LF T+K  ++SA+ +E RMGASLLRL FHDCFV GCDGSIL
Sbjct  24    IGSANANLSKDYYYSSCPKLFETVKCEVQSAISKETRMGASLLRLFFHDCFVNGCDGSIL  83

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTSSF GEKTA  N NS RG+ VID IKSA+EKVCPG VSCADI+ I ARDS  +LGG
Sbjct  84    LDDTSSFTGEKTANPNKNSARGFEVIDKIKSAVEKVCPGAVSCADILTITARDSVEILGG  143

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W VKLGRRD++TAS SAAN+   +P+P S+L+ LIS F   GLST DLVALSG +TIG
Sbjct  144   PTWDVKLGRRDARTASKSAANND--IPAPTSSLNQLISRFNALGLSTKDLVALSGGHTIG  201

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR  IYND+N I  SFA+ RQ  CP+ +GSGD+NLAPLDL TP  FDN+Y+KNL
Sbjct  202   QARCTTFRAHIYNDSN-IDTSFARTRQSGCPKTSGSGDNNLAPLDLATPTSFDNHYFKNL  260

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             ++ KGLLHSDQ L+NGGSTDS+V +YS  P+ F+S F  AMIKMG+I PLTGS GEIRK 
Sbjct  261   VDSKGLLHSDQQLFNGGSTDSIVHEYSLYPSSFSSDFVTAMIKMGDISPLTGSNGEIRKQ  320

Query  324   CRKAN  310
             CR  N
Sbjct  321   CRSVN  325



>ref|XP_002489046.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
 gb|EES20431.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
Length=320

 Score =   408 bits (1049),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/303 (63%), Positives = 239/303 (79%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +S AQLST FYS SCP L+  +K V++SA+D EKR+GAS++RL FHDCFVQGCD S+LLD
Sbjct  21    TSWAQLSTGFYSSSCPGLYSAVKPVVQSAIDSEKRVGASIVRLFFHDCFVQGCDASLLLD  80

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT++F+GEK A  NN SVRG+ VID  KSA+E VCPG+VSCADI+AIAARDS V+LGGP+
Sbjct  81    DTATFQGEKMATPNNGSVRGFEVIDAAKSAVENVCPGVVSCADILAIAARDSVVILGGPS  140

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG++
Sbjct  141   WDVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  198

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FRD IYNDTN +  +FA+ RQ  CP  +G+GD+NLAPLDL+TP  F+N+YYKNL++
Sbjct  199   RCTNFRDHIYNDTN-VDGAFARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENDYYKNLVS  257

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
               GLLHSDQ L+NGG+TD+LV+ Y  + + F + F   MIKMG+I PLTGS GEIRKNCR
Sbjct  258   NMGLLHSDQELFNGGATDALVQSYVSSQSAFFADFVTGMIKMGDITPLTGSAGEIRKNCR  317

Query  318   KAN  310
             + N
Sbjct  318   RIN  320



>ref|XP_007146856.1| hypothetical protein PHAVU_006G075900g [Phaseolus vulgaris]
 gb|ESW18850.1| hypothetical protein PHAVU_006G075900g [Phaseolus vulgaris]
Length=331

 Score =   409 bits (1050),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 207/303 (68%), Positives = 251/303 (83%), Gaps = 2/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLS NFYSK+CP +F T+K+V+KSA+ +E R+GAS+LRL FHDCFV GCDGS+LLD
Sbjct  31    TSSAQLSNNFYSKTCPNVFNTVKAVVKSAVAKEPRIGASILRLFFHDCFVDGCDGSLLLD  90

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT S  GEKTA ANNNSVRG+ VID IKS +EK+CPG+VSCADI+ IA+RDS VLLGGP 
Sbjct  91    DTPSLLGEKTAAANNNSVRGFEVIDGIKSRVEKLCPGVVSCADILTIASRDSVVLLGGPF  150

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             WKVK+GRRDS+TA+ SAANS GV+P P SNL+ LI +F+ QGLS  D+VALSG++TIG++
Sbjct  151   WKVKVGRRDSRTANFSAANS-GVIPPPTSNLTNLIKTFEAQGLSAKDMVALSGAHTIGKA  209

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC  FRD IYN +N I   FA  RQRKCPR +G+GD+NLA LDL T   FDNNY+KNL+ 
Sbjct  210   RCASFRDHIYNGSN-IERRFALARQRKCPRTSGTGDNNLAVLDLRTSKHFDNNYFKNLLK  268

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLL+SDQ L+NGGSTDSLV+ YS+N  +F+S F  AMIKMG+ +PLTGSRGEIRKNCR
Sbjct  269   KKGLLNSDQVLFNGGSTDSLVRTYSQNNKVFDSDFVTAMIKMGDNKPLTGSRGEIRKNCR  328

Query  318   KAN  310
             + N
Sbjct  329   RVN  331



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score =   409 bits (1051),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 239/301 (79%), Gaps = 5/301 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQLS+ FY+K+CP    TIKS + SA++ E+RMGASLLRLHFHDCFVQGCD S+LLDDT
Sbjct  47    SAQLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDT  106

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             SSF GEKTA  N  S+RG++VID IKS +E +CPG+VSCADI+A+AARDS V LGG  W 
Sbjct  107   SSFTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWT  166

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V+LGRRDS TASLS+ANS   LP P S+LSALISSF N+G S+ +LVALSGS+TIG+++C
Sbjct  167   VQLGRRDSTTASLSSANSD--LPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQC  224

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             + FR RIYNDTN I +SFAK  Q  CP  TG GD NLAPLD  +P  FDN Y+KNL +KK
Sbjct  225   SSFRTRIYNDTN-IDSSFAKSLQGNCP-STG-GDSNLAPLDTTSPNTFDNAYFKNLQSKK  281

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GLLHSDQ L+NGGSTDS V  YS NPA F + FA AMIKMGN+ PLTGS G+IR NCRK 
Sbjct  282   GLLHSDQELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKT  341

Query  312   N  310
             N
Sbjct  342   N  342



>ref|XP_009403860.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   408 bits (1048),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 241/303 (80%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S+SAQLST FYS SCP L  T+K V+ SA+  E+RMGASLLRL FHDCFV GCD S+LLD
Sbjct  17    SASAQLSTGFYSSSCPSLSSTVKPVVHSAISSEQRMGASLLRLFFHDCFVNGCDASLLLD  76

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTS+F GEKTA  N NSVRG++VID IK+A+EK CPG+VSCADI+AI ARD+  +LGGPN
Sbjct  77    DTSNFTGEKTATPNQNSVRGFDVIDKIKTAVEKACPGVVSCADILAITARDAVAILGGPN  136

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD+KTASLS AN+   +P P S+LS LIS F  QGLS  D+VAL+G++TIG++
Sbjct  137   WDVKLGRRDAKTASLSGANNN--IPPPSSSLSNLISKFSAQGLSRQDMVALAGAHTIGQA  194

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC  FR RIYNDTN I +S A  RQ  CP  +GSGD NLAPLDL+TP  FDN+Y+KNL+N
Sbjct  195   RCISFRSRIYNDTN-IDSSLATTRQSNCPSTSGSGDGNLAPLDLQTPTTFDNDYFKNLVN  253

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
              KGLLHSDQ L++ GSTDSLVK YS +P+ F S FA AMIKMG+I PLTGS+GEIR NCR
Sbjct  254   LKGLLHSDQQLFSNGSTDSLVKTYSASPSKFASDFAAAMIKMGDISPLTGSQGEIRNNCR  313

Query  318   KAN  310
               N
Sbjct  314   MVN  316



>gb|EMS66985.1| Peroxidase 4 [Triticum urartu]
Length=321

 Score =   407 bits (1046),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 236/302 (78%), Gaps = 3/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLST FYS SCP   G + SV++SA+ +E RMGAS+LRL FHDCFVQGCDGS+LLDD
Sbjct  23    ASAQLSTGFYSSSCPGALGAVASVVQSAVAKEPRMGASILRLFFHDCFVQGCDGSLLLDD  82

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T SF+GEKTA  NN SVRG+ VID IK A+E +CPG+VSCAD++AIAARDS V LGGPNW
Sbjct  83    TPSFQGEKTAMPNNGSVRGFEVIDAIKVAVENICPGVVSCADVLAIAARDSVVALGGPNW  142

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSGS+TIG++R
Sbjct  143   AVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQAR  200

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR  IYN+T+ I + FA  RQ  CP  +GSGD+NLAPLDL+TP  F+NNYYKNL+ K
Sbjct  201   CTNFRAHIYNETD-IDSGFAGTRQSGCPPNSGSGDNNLAPLDLQTPIAFENNYYKNLVAK  259

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+NGG+TD LV+ Y+ + + F + F   MIKMG+I PL G+ GEIRKNCRK
Sbjct  260   KGLLHSDQELFNGGATDPLVQYYASSQSAFFADFVAGMIKMGDISPLIGNNGEIRKNCRK  319

Query  315   AN  310
             +N
Sbjct  320   SN  321



>gb|ABK21858.1| unknown [Picea sitchensis]
Length=326

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/299 (69%), Positives = 235/299 (79%), Gaps = 5/299 (2%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
             QL   FY  SCP  F  + SV+  A+ +EKRMGASLLRLHFHDCFV GCDGSILLDDTS+
Sbjct  33    QLCPRFYDISCPSAFSIVNSVVTQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTST  92

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F+GEKTA  N NSVRG+ VID IK+ +E  CPG+VSCADIVAIAARD+ V LGGP W V 
Sbjct  93    FQGEKTAVPNKNSVRGFEVIDAIKTQVEAACPGVVSCADIVAIAARDAVVQLGGPTWLVL  152

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             LGRRDS TASLSAANS   LP P SNLSALISSFQ+ GLS  DLVALSGS+TIG++RCT 
Sbjct  153   LGRRDSTTASLSAANSN--LPPPASNLSALISSFQSHGLSIRDLVALSGSHTIGQARCTN  210

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGL  487
             FR+RI++++N I  SFA+ RQ  CP  TG GDDNLAPLDL TP  FDNNYYKNL  ++GL
Sbjct  211   FRNRIHSESN-IDLSFARARQANCP-STG-GDDNLAPLDLLTPTTFDNNYYKNLERRRGL  267

Query  486   LHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LHSDQ L+NGGSTD+LV  Y+  P  F+  FA AM+KMG+I PLTG+ GEIRKNCRK N
Sbjct  268   LHSDQQLFNGGSTDNLVSFYTTYPIAFSIDFAVAMVKMGSIEPLTGNNGEIRKNCRKIN  326



>ref|XP_010041552.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=322

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 244/306 (80%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              +  S AQLS +FYSKSCP  F  +KS ++SA+ +E  +GASLLRL FHDCFV GCDGS+
Sbjct  20    LMGCSDAQLSPDFYSKSCPDAFTGVKSQVESAVSKEPGIGASLLRLFFHDCFVNGCDGSV  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT +F GEK A  N NS RG+ VIDD+KSA+EKVCPG+VSCAD++AI ARDS VLLG
Sbjct  80    LLDDTPTFTGEKNAAPNRNSARGFEVIDDVKSAVEKVCPGVVSCADLLAITARDSVVLLG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD++TAS +AANS   LPSP SNL+ LISSF++ GLSTTDLVALSGS++I
Sbjct  140   GPSWSVKLGRRDARTASQAAANSS--LPSPASNLTDLISSFESAGLSTTDLVALSGSHSI  197

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G+++C  FR RIYN+T+ +  SF + R++ CP   G GD+NLA LDL++P  +DN YY N
Sbjct  198   GQAKCANFRARIYNETD-LDRSFGEIRRKNCPSSAGPGDNNLASLDLQSPVAYDNTYYTN  256

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+  KGLLHSDQ L++GGSTDSLV+ Y+ +P+ F+S FA AMIKMG+I PLTGS GE+RK
Sbjct  257   LLQFKGLLHSDQQLFSGGSTDSLVRTYASSPSTFSSDFAAAMIKMGDILPLTGSDGEVRK  316

Query  327   NCRKAN  310
             NCRK N
Sbjct  317   NCRKIN  322



>ref|XP_003602463.1| Peroxidase [Medicago truncatula]
 gb|AES72714.1| horseradish peroxidase-like protein [Medicago truncatula]
Length=322

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/306 (66%), Positives = 244/306 (80%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + S++AQLST+FYS SCP L  T++S ++SA+  E RMGAS+LRL FHDCFV GCDGSI
Sbjct  20    IIGSANAQLSTSFYSSSCPKLSSTVQSTVQSAISNEARMGASILRLFFHDCFVNGCDGSI  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTS+F GEK A  N NS RG++VID+IK+A+E VCPG+VSCADI+AIAA DS  +LG
Sbjct  80    LLDDTSNFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRD+KTAS SAAN+   +P+P SNL+ L S F   GLS+ DLV LSG++TI
Sbjct  140   GPTWNVKLGRRDAKTASQSAANT--AIPAPTSNLNTLTSMFSAVGLSSKDLVTLSGAHTI  197

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I  SFA  RQ  CP  +GSGD+NLAPLDL+TP  FDNNY+KN
Sbjct  198   GQARCTTFRARIYNETN-IDTSFASTRQSNCPNTSGSGDNNLAPLDLQTPTSFDNNYFKN  256

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+  KGLLHSDQ L+NGGST+S+V  YS NP+ F+S FA AMIKMG+I PLTGS GEIRK
Sbjct  257   LVQNKGLLHSDQQLFNGGSTNSIVSGYSTNPSSFSSDFATAMIKMGDISPLTGSNGEIRK  316

Query  327   NCRKAN  310
             NCRK N
Sbjct  317   NCRKPN  322



>dbj|BAJ97638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 235/302 (78%), Gaps = 3/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLST FYS SCP   G + SV++SA+  E RMGAS+LRL FHDCFVQGCDGS+LLDD
Sbjct  22    ASAQLSTGFYSSSCPGALGAVASVVQSAVANEPRMGASILRLFFHDCFVQGCDGSLLLDD  81

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T+SF+GEK A  NN SVRG+ VID IK A+EK+CPG+VSCAD++AIAARDS V LGGPNW
Sbjct  82    TASFQGEKMATPNNGSVRGFEVIDAIKVAVEKICPGVVSCADVLAIAARDSVVALGGPNW  141

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSGS+TIG++R
Sbjct  142   AVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQAR  199

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR  +YN+TN I + FA  R+  CP  +GSGD+NLAPLDL+TP  F+NNYYKNL+ K
Sbjct  200   CTNFRAHVYNETN-IDSGFAGTRRSGCPPNSGSGDNNLAPLDLQTPTAFENNYYKNLVAK  258

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGL+HSDQ L+NGG+TD LV+ Y  + + F + F   MIKMG+I PLTG+ GE+RKNCRK
Sbjct  259   KGLMHSDQELFNGGATDPLVQYYVSSQSAFFADFVEGMIKMGDISPLTGNNGEVRKNCRK  318

Query  315   AN  310
              N
Sbjct  319   IN  320



>ref|XP_010695716.1| PREDICTED: peroxidase 4-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 239/302 (79%), Gaps = 1/302 (0%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             S+AQL T+ Y+K+CP LF TI++V++SA+ +E RMGASLLRLHFHDCFV GCD S LLDD
Sbjct  23    SNAQLDTSLYAKTCPQLFPTIRAVVQSAIKKEARMGASLLRLHFHDCFVNGCDASNLLDD  82

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             + SFK EK A  N NS RG+ VID IKSA+EKVCPG+VSCADI+AI ARDS  +LGGP W
Sbjct  83    SPSFKSEKAATPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAITARDSVAILGGPAW  142

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGR+DS TA+ + AN+   +P+  ++LSAL+SSFQN GLST DLVAL G++TIG +R
Sbjct  143   DVKLGRKDSLTANFALANATNTIPAANASLSALLSSFQNHGLSTRDLVALYGAHTIGVAR  202

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR  IY D N I  SFA+  Q +CP+  G+GD+NLAPLD ++P  FDN Y+K L+NK
Sbjct  203   CTNFRQHIYQDKN-IDPSFARSNQGRCPKNNGNGDNNLAPLDAQSPTRFDNTYFKTLLNK  261

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             + +LHSDQ LYNGGSTD+LV+ Y+ NP  F S F  ++IKMG+I+PLTGS+G+IRKNCR+
Sbjct  262   QAILHSDQELYNGGSTDALVRTYATNPHAFISDFTASIIKMGDIKPLTGSQGQIRKNCRR  321

Query  315   AN  310
             AN
Sbjct  322   AN  323



>ref|XP_002441703.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
 gb|EES15541.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
Length=328

 Score =   406 bits (1044),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 239/303 (79%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQL T+FYS SCP ++  ++SV+++A+  E+RMGAS+LRL FHDCFVQGCD S+LLD
Sbjct  29    TSSAQLCTSFYSHSCPGVYDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLLLD  88

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT SF+GEK A  NN S RG+ VID IKSA++KVCPG+VSCADI+AIAARDS V+LGGP+
Sbjct  89    DTPSFQGEKMANPNNGSARGFEVIDAIKSAVDKVCPGVVSCADILAIAARDSVVILGGPS  148

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS+TAS S AN+   +P P S L  L S F  QGLS  D+VALSG++TIG +
Sbjct  149   WDVKVGRRDSRTASFSGANNN--IPPPTSGLVNLTSLFAAQGLSQKDMVALSGAHTIGLA  206

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  IYNDTN I  SFA+ RQ  CPR +GSGD+NLAPLDL+TP  F+NNYYKNL+ 
Sbjct  207   RCTNFRAHIYNDTN-IDGSFARSRQSVCPRTSGSGDNNLAPLDLQTPTVFENNYYKNLVY  265

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKG+LHSDQ L+NGGSTD+ V+ Y  + + F + F   MIKMG+I PLTGS GEIRKNCR
Sbjct  266   KKGILHSDQELFNGGSTDAQVQSYVSSQSAFFADFVTGMIKMGDIMPLTGSNGEIRKNCR  325

Query  318   KAN  310
             + N
Sbjct  326   RIN  328



>emb|CDY02820.1| BnaC02g10690D [Brassica napus]
Length=326

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 243/302 (80%), Gaps = 2/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             + AQLS++FY++SCP LF  ++ V++ A+ +E+RM ASLLRL FHDCF+ GCDGSILLDD
Sbjct  27    THAQLSSDFYAESCPSLFPAVRGVMQRAVAKERRMAASLLRLFFHDCFINGCDGSILLDD  86

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF+GEKTA  NNNSVRG+ VID IKS +EK+CPG+VSCADIVAI+ARDS +LLGGP W
Sbjct  87    TSSFRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRW  146

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDSK A  SAANS GV+PSPFS L  LI+ F+ QGLS  D+VALSG++TIG++ 
Sbjct  147   SVKLGRRDSKKAGFSAANS-GVIPSPFSTLKNLINRFKAQGLSVRDMVALSGAHTIGQAN  205

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             C  FR+RIYN++N I  SFA  R++ CP  +GSGD+  APLD+ +P  FD++YY  L++K
Sbjct  206   CLTFRNRIYNESN-IDLSFALSRRKNCPATSGSGDNKKAPLDIGSPTRFDHSYYNQLLDK  264

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLL SDQ L+NGGSTDSLV KYS++   F   F RAMIKMG+I+PLTGS G+IR+NCR+
Sbjct  265   KGLLTSDQVLFNGGSTDSLVGKYSRSLNTFYRDFVRAMIKMGDIKPLTGSHGQIRRNCRR  324

Query  315   AN  310
              N
Sbjct  325   PN  326



>emb|CDY32701.1| BnaA02g07630D [Brassica napus]
Length=326

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 242/302 (80%), Gaps = 2/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             + AQLS++FY++SCP LF  ++ V++ A+ +E+RM ASLLRL FHDCFV GCDGSILLDD
Sbjct  27    TQAQLSSDFYAESCPSLFPAVRRVMQRAVAKERRMAASLLRLFFHDCFVNGCDGSILLDD  86

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF+GEKTA  NNNSVRG+ VID IKS +EK+CPG+VSCADIVAI+ARDS +LLGGP W
Sbjct  87    TSSFRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRW  146

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDSK A  SAANS GV+PSPFS L  LI+ F+ QGLS  D+VALSG++TIG++ 
Sbjct  147   SVKLGRRDSKKAGFSAANS-GVIPSPFSTLKNLINRFKAQGLSVRDMVALSGAHTIGQAN  205

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             C  FR+RIYN++N I  SFA  R++ CP  +GSGD+  APLD+ +P  FD++YY  L++K
Sbjct  206   CLTFRNRIYNESN-IDLSFALSRRKNCPATSGSGDNKKAPLDIGSPTRFDHSYYNQLLDK  264

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLL SDQ L+NGGSTDSLV  YS++   F   F RAMIKMG+I+PLTGS G+IR+NCR+
Sbjct  265   KGLLTSDQVLFNGGSTDSLVGTYSRSLNTFYRDFVRAMIKMGDIKPLTGSHGQIRRNCRR  324

Query  315   AN  310
              N
Sbjct  325   PN  326



>ref|NP_001151940.1| peroxidase 52 precursor [Zea mays]
 gb|ACG45093.1| peroxidase 52 precursor [Zea mays]
Length=334

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 197/305 (65%), Positives = 239/305 (78%), Gaps = 5/305 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLST FYS SCP ++  +KSV++SA+  E+RMGAS++RL FHDCFVQGCD S+LLD
Sbjct  33    TSSAQLSTGFYSSSCPGVYDAVKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLLLD  92

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT SF+GEK A  NN SVRG+ VID +KSA+EKVCPG+VSCADI+AIAARDS V+LGGP 
Sbjct  93    DTPSFQGEKMANPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGPT  152

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG++
Sbjct  153   WDVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  210

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPR--KTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             RCT FR  +YNDTN I  SFA+ RQ  CPR     SGD+NLAPLDL+TP  FDNNYYKNL
Sbjct  211   RCTNFRAHVYNDTN-IDGSFARTRQSGCPRSSSGSSGDNNLAPLDLQTPTVFDNNYYKNL  269

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             + KKGLLHSDQ L+NGG+TD+LV+ Y+   + F S F   M+KMG+I PLTGS G+IRKN
Sbjct  270   VCKKGLLHSDQELFNGGATDALVQSYASGQSEFFSDFVTGMVKMGDITPLTGSGGQIRKN  329

Query  324   CRKAN  310
             CR+ N
Sbjct  330   CRRVN  334



>ref|XP_009126754.1| PREDICTED: peroxidase 67 [Brassica rapa]
Length=326

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 242/302 (80%), Gaps = 2/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             + AQLS++FY++SCP LF  ++ V++ A+ +E+RM ASLLRL FHDCF+ GCDGSILLDD
Sbjct  27    TQAQLSSDFYAESCPSLFPAVRRVMQRAVAKERRMAASLLRLFFHDCFINGCDGSILLDD  86

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF+GEKTA  NNNSVRG+ VID IKS +EK+CPG+VSCADIVAI+ARDS +LLGGP W
Sbjct  87    TSSFRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRW  146

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDSK A  SAANS GV+PSPFS L  LI+ F+ QGLS  D+VALSG++TIG++ 
Sbjct  147   SVKLGRRDSKKAGFSAANS-GVIPSPFSTLKNLINRFKAQGLSVRDMVALSGAHTIGQAN  205

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             C  FR+RIYN++N I  SFA  R++ CP  +GSGD+  APLD+ +P  FD++YY  L++K
Sbjct  206   CLTFRNRIYNESN-IDLSFALSRRKNCPATSGSGDNKKAPLDIGSPTRFDHSYYNQLLDK  264

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLL SDQ L+NGGSTDSLV  YS++   F   F RAMIKMG+I+PLTGS G+IR+NCR+
Sbjct  265   KGLLTSDQVLFNGGSTDSLVGTYSRSLNTFYRDFVRAMIKMGDIKPLTGSHGQIRRNCRR  324

Query  315   AN  310
              N
Sbjct  325   PN  326



>tpe|CAH69372.1| TPA: class III peroxidase 130 precursor [Oryza sativa Japonica 
Group]
 gb|ABA91159.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ00524.1| hypothetical protein OsI_22542 [Oryza sativa Indica Group]
 gb|EAZ17186.1| hypothetical protein OsJ_32693 [Oryza sativa Japonica Group]
 dbj|BAH01350.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score =   404 bits (1037),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 238/302 (79%), Gaps = 3/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             SSAQLS +FYS SCP +F  +K  ++SA+  EKR+GAS++RL FHDCFVQGCD S+LLDD
Sbjct  26    SSAQLSPSFYSYSCPGVFDAVKCGMQSAIANEKRIGASIVRLFFHDCFVQGCDASLLLDD  85

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T+SF GEK A  NN SVRG+ VID IKSA+E +CPG+VSCADI+AIAARDS  +LGGP+W
Sbjct  86    TASFTGEKMANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGPSW  145

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VK+GRRDS+TASLS AN+   +P P S L+ L S F  QGLS  D+VALSGS+TIG++R
Sbjct  146   DVKVGRRDSRTASLSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQAR  203

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR  IYN+TN I + FA  RQ  CPR +GSGD+NLAPLDL+TP  F+NNYYKNL+ K
Sbjct  204   CTNFRAHIYNETN-IDSGFAMSRQSGCPRSSGSGDNNLAPLDLQTPTVFENNYYKNLVVK  262

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+NGG+TD+LV+ Y  + + F + F   MIKMG+I PLTGS GEIRKNCR+
Sbjct  263   KGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRKNCRR  322

Query  315   AN  310
              N
Sbjct  323   IN  324



>gb|EAY79693.1| hypothetical protein OsI_34840 [Oryza sativa Indica Group]
Length=329

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 239/302 (79%), Gaps = 3/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             S AQLS +FYS SCP +F  +K  ++SA+  EKR+GAS++RL FHDCFVQGCD S+LLDD
Sbjct  31    SWAQLSPSFYSFSCPGVFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLLLDD  90

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T+SF GEKTA  NN SVRG+ VID IKSA+E +CPG+VSCADI+AIAARDS  +LGGP+W
Sbjct  91    TASFTGEKTANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGPSW  150

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VK+GRRDS+TASLS AN+   +P P S L+ L S F  QGLS  D+VALSGS+TIG++R
Sbjct  151   DVKVGRRDSRTASLSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQAR  208

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR  IYN+TN I + FA +RQ  CPR +GSGD+NLAPLDL+TP  F+NNYYKNL+ K
Sbjct  209   CTNFRAHIYNETN-IDSGFAMRRQSGCPRNSGSGDNNLAPLDLQTPTVFENNYYKNLVVK  267

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+NGG+TD+LV+ Y  + + F + F   MIKMG+I PLTGS GEIRKNCR+
Sbjct  268   KGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRKNCRR  327

Query  315   AN  310
              N
Sbjct  328   IN  329



>ref|NP_001131000.1| uncharacterized protein LOC100192105 precursor [Zea mays]
 gb|ACF79421.1| unknown [Zea mays]
 gb|ACL53914.1| unknown [Zea mays]
Length=320

 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 242/305 (79%), Gaps = 5/305 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLST FYS SCP ++G +KSV++SA+  EKRMGAS+LRL FHDCFVQGCD S+LLD
Sbjct  19    TSSAQLSTGFYSYSCPGVYGAVKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLLLD  78

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT SF+GEK A  NN SVRG+ VID +KSA+EK+CPG+VSCADI+AIAARDS V+LGGP 
Sbjct  79    DTPSFQGEKMANPNNGSVRGFEVIDAVKSAVEKLCPGVVSCADILAIAARDSVVILGGPT  138

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG++
Sbjct  139   WDVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  196

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGS-GDDNLAPLDLETPAFFDNNYYKNLI  502
             RCT FR  IYNDT+ I A+FA+ RQ  CP  +G+ GD+NLAPLDL+TP  F+NNYY+NL+
Sbjct  197   RCTNFRAHIYNDTD-IDAAFARTRQSGCPSTSGAGGDNNLAPLDLQTPTVFENNYYRNLL  255

Query  501   NKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGS-RGEIRKN  325
              KKGLLHSDQ L+NGG+TD+LV+ Y  + + F + F   MIKMG+I PLTGS  G+IRKN
Sbjct  256   AKKGLLHSDQELFNGGATDALVQSYVGSQSAFFADFVAGMIKMGDITPLTGSNNGQIRKN  315

Query  324   CRKAN  310
             CR+ N
Sbjct  316   CRRVN  320



>gb|ACN33662.1| unknown [Zea mays]
Length=320

 Score =   403 bits (1036),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 241/305 (79%), Gaps = 5/305 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLST FYS SCP ++G +KSV++SA+  EKRMGAS+LRL FHDCFVQGCD S+LLD
Sbjct  19    TSSAQLSTGFYSYSCPGVYGAVKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLLLD  78

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT SF+GEK A  NN SVRG+ VID +KSA+EK+CPG+VSCADI+AIAARDS V+LGGP 
Sbjct  79    DTPSFQGEKMANPNNGSVRGFEVIDAVKSAVEKLCPGVVSCADILAIAARDSVVILGGPT  138

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VK+GRRDS TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG++
Sbjct  139   WDVKVGRRDSTTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  196

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGS-GDDNLAPLDLETPAFFDNNYYKNLI  502
             RCT FR  IYNDT+ I A+FA+ RQ  CP  +G+ GD NLAPLDL+TP  F+NNYY+NL+
Sbjct  197   RCTNFRAHIYNDTD-IDAAFARTRQSGCPSTSGAGGDSNLAPLDLQTPTVFENNYYRNLL  255

Query  501   NKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGS-RGEIRKN  325
              KKGLLHSDQ L+NGG+TD+LV+ Y  + + F + F   MIKMG+I PLTGS  G+IRKN
Sbjct  256   AKKGLLHSDQELFNGGATDALVQSYVGSQSAFFADFVAGMIKMGDITPLTGSNNGQIRKN  315

Query  324   CRKAN  310
             CR+ N
Sbjct  316   CRRVN  320



>ref|XP_006662662.1| PREDICTED: peroxidase 4-like [Oryza brachyantha]
Length=324

 Score =   403 bits (1035),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 234/302 (77%), Gaps = 3/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             SS QLS +FYS SCP +F  +K  ++SA+ +EKR+GAS++RL FHDCFVQGCD S+LLDD
Sbjct  26    SSVQLSESFYSYSCPGVFDAVKGGMQSAIAQEKRIGASIVRLFFHDCFVQGCDASLLLDD  85

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T SF+GEKTA  NN SVRG+ VID IKSA+E +CP +VSCADI+AIAARDS  +LGGP+W
Sbjct  86    TPSFQGEKTATPNNGSVRGFEVIDAIKSAVETICPAVVSCADILAIAARDSVAILGGPSW  145

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDS+TAS S AN+   +P P S L+ L S F  QGLS TD+VALSGS+TIG++R
Sbjct  146   DVKLGRRDSRTASFSGANNN--IPPPTSGLANLTSFFAAQGLSQTDMVALSGSHTIGQAR  203

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR  IYN+TN I   FA  RQ  CP  +GSGD NLAPLDL+TP  F+NNYYKNL+ +
Sbjct  204   CTNFRAHIYNETN-IDVGFAMMRQSGCPSTSGSGDSNLAPLDLQTPTVFENNYYKNLVVQ  262

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+NGG+TDSLV+ Y  + + F + F   MIKMG+I PLTGS GEIR NCR+
Sbjct  263   KGLLHSDQELFNGGATDSLVQTYISSQSTFFADFVTGMIKMGDISPLTGSNGEIRTNCRR  322

Query  315   AN  310
              N
Sbjct  323   VN  324



>ref|NP_001065971.1| Os12g0112000 [Oryza sativa Japonica Group]
 tpe|CAH69377.1| TPA: class III peroxidase 135 precursor [Oryza sativa Japonica 
Group]
 gb|ABA96259.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28990.1| Os12g0112000 [Oryza sativa Japonica Group]
 gb|EAZ19424.1| hypothetical protein OsJ_34981 [Oryza sativa Japonica Group]
 dbj|BAG91443.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK99332.1| peroxidase [Oryza sativa Japonica Group]
Length=327

 Score =   402 bits (1033),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 238/302 (79%), Gaps = 3/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             S AQLS +FYS SCP +F  +K  ++SA+  EKR+GAS++RL FHDCFVQGCD S+LLDD
Sbjct  29    SWAQLSPSFYSYSCPGVFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLLLDD  88

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T+SF GEKTA  NN SVRG+ VID IKSA+E +CPG+VSCADI+AIAARDS  +LGGP+W
Sbjct  89    TASFTGEKTANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGPSW  148

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VK+GRRDS+TASLS AN+   +P P S L+ L S F  Q LS  D+VALSGS+TIG++R
Sbjct  149   DVKVGRRDSRTASLSGANNN--IPPPTSGLANLTSLFAAQALSQKDMVALSGSHTIGQAR  206

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR  IYN+TN I + FA +RQ  CPR +GSGD+NLAPLDL+TP  F+NNYYKNL+ K
Sbjct  207   CTNFRAHIYNETN-IDSGFAMRRQSGCPRNSGSGDNNLAPLDLQTPTVFENNYYKNLVVK  265

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+NGG+TD+LV+ Y  + + F + F   MIKMG+I PLTGS GEIRKNCR+
Sbjct  266   KGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRKNCRR  325

Query  315   AN  310
              N
Sbjct  326   IN  327



>ref|XP_006842420.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
 gb|ERN04095.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
Length=315

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 240/303 (79%), Gaps = 5/303 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +S AQLS+ FY+ SCP    TI++ ++SA++ E RMGASLLRLHFHDCFV GCDGS+LLD
Sbjct  18    ASYAQLSSTFYNSSCPNALSTIQTAVRSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLD  77

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             D ++F GEKTA  NNNSVRG+ V+D+IKS +E +CPG+VSCADI+A+AARDS V+LGGP 
Sbjct  78    DNATFTGEKTARPNNNSVRGFEVVDNIKSQLESLCPGVVSCADILAVAARDSVVVLGGPT  137

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W V LGRRDS TASLS ANS   +P+P  +LS LI+SF N+GLS++++VALSGS+TIG++
Sbjct  138   WTVLLGRRDSTTASLSTANSD--IPAPSLSLSGLITSFSNKGLSSSEMVALSGSHTIGQA  195

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  IYN+TN I +++A   +  CP     GD+NL+PLD+ +P  FDN YYKNL+N
Sbjct  196   RCTTFRTHIYNETN-IDSTYATSLKSNCPFS--GGDNNLSPLDVTSPTVFDNAYYKNLVN  252

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGSTDS V  Y+ + + F + FA+AM+KMGNI PLTGS G++R NCR
Sbjct  253   KKGLLHSDQELFNGGSTDSQVTGYTSSSSTFPTDFAKAMVKMGNISPLTGSSGQVRTNCR  312

Query  318   KAN  310
             K N
Sbjct  313   KVN  315



>emb|CAD67477.1| peroxidase [Asparagus officinalis]
Length=315

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 237/303 (78%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SS+AQLST FYS SCP +F TIK V++ A+++EKRMGAS+LRL FHDCFV GCDGSILL 
Sbjct  16    SSNAQLSTTFYSNSCPNVFTTIKPVLQHAIEKEKRMGASILRLFFHDCFVNGCDGSILLA  75

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT  F GE+ A  NN S RG+ VID IK+A+EK CPG+VSCADI+AIAARDS V+LGGPN
Sbjct  76    DTPHFVGEQHANPNNRSARGFKVIDRIKTAVEKACPGVVSCADILAIAARDSVVILGGPN  135

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRDS+TA+ +AAN+   +P P S+L+ L S F  +GLST D+VALSG++TIG++
Sbjct  136   WDVKLGRRDSRTANKTAANNE--IPPPTSSLANLTSLFAAKGLSTKDMVALSGAHTIGQA  193

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  IYND++ I  SFA  R+  CP+++GSGD NLAPLDL+TP  FDNNYY+NL+ 
Sbjct  194   RCTSFRSHIYNDSD-IDPSFATLRKSNCPKQSGSGDMNLAPLDLQTPTTFDNNYYRNLVV  252

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGL+HSDQ L+NGGSTDSLVK YS     F S F   MIKMG++ PL GS GEIRK C 
Sbjct  253   KKGLMHSDQELFNGGSTDSLVKSYSDGTGKFYSAFVEGMIKMGDVSPLVGSNGEIRKICS  312

Query  318   KAN  310
             K N
Sbjct  313   KVN  315



>ref|XP_006664870.1| PREDICTED: peroxidase 4-like [Oryza brachyantha]
Length=323

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 234/302 (77%), Gaps = 3/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             SSAQLS +FYS SCP +   +K  ++SA+ +EKR+GAS++RL FHDCFVQGCD S+LLDD
Sbjct  25    SSAQLSASFYSYSCPGVLDVVKGGMQSAIAQEKRIGASIVRLFFHDCFVQGCDASLLLDD  84

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T SF+GEKTA  NN SVRG+ VID IKSA+E +CP +VSCADI+AIAARDS  +LGGP+W
Sbjct  85    TPSFQGEKTATPNNGSVRGFEVIDAIKSAVETICPAVVSCADILAIAARDSVAILGGPSW  144

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDS+TAS S AN+   +P P S L+ L S F  QGLS TD+VALSGS+TIG++R
Sbjct  145   DVKLGRRDSRTASFSGANNN--IPPPTSGLANLTSFFAAQGLSQTDMVALSGSHTIGQAR  202

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR  IYN+TN I   FA  RQ  CP  +GSGD NLAPLDL+TP  F+NNYYKNL+ +
Sbjct  203   CTNFRAHIYNETN-IDGGFAMMRQSGCPSTSGSGDSNLAPLDLQTPTVFENNYYKNLVVQ  261

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L+NGG+TDSLV+ Y  + + F + F   MIKMG+I PLTGS GEIR NCR+
Sbjct  262   KGLLHSDQELFNGGATDSLVQTYISSQSTFFADFVTGMIKMGDISPLTGSNGEIRTNCRR  321

Query  315   AN  310
              N
Sbjct  322   VN  323



>ref|XP_003602461.1| Peroxidase [Medicago truncatula]
 gb|AES72712.1| horseradish peroxidase-like protein [Medicago truncatula]
Length=322

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 205/306 (67%), Positives = 250/306 (82%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + S++AQLSTNFYSK+CP L  T+KS +++A+ +E RMGAS+LRL FHDCFV GCDGSI
Sbjct  20    IIGSANAQLSTNFYSKTCPKLSTTVKSTLQTAISKEARMGASILRLFFHDCFVNGCDGSI  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG++VID+IK+A+E VCPG+VSCADI+AIAA DS  +LG
Sbjct  80    LLDDTSSFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRD+KTAS SAAN+   +P+P SNL+ L S F   GLS+ DLV LSG++TI
Sbjct  140   GPTWNVKLGRRDAKTASQSAANT--AIPAPTSNLNTLTSMFSAVGLSSKDLVTLSGAHTI  197

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I A+FA  RQ  CP+ +GSGD+NLAPLDL+TP+ FDNNY+KN
Sbjct  198   GQARCTNFRARIYNETN-INAAFASTRQSNCPKASGSGDNNLAPLDLQTPSSFDNNYFKN  256

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+  KGLLHSDQ L+NGGST+S+V  YS +P+ F+S FA AMIKMGNI+PLTGS GEIRK
Sbjct  257   LVQNKGLLHSDQQLFNGGSTNSIVSGYSTSPSSFSSDFAAAMIKMGNIKPLTGSNGEIRK  316

Query  327   NCRKAN  310
             NCRK N
Sbjct  317   NCRKTN  322



>ref|XP_010653358.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=325

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 232/306 (76%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F+  +SAQL+TNFY+K+CP     IKS + SA+  E RMGASLLRLHFHDCFV GCD SI
Sbjct  25    FIGMASAQLTTNFYAKTCPNALSIIKSAVNSAVKSEARMGASLLRLHFHDCFVNGCDASI  84

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTS+F GEKTA  N NSVRGY V+D IKS +E  CPG+VSCADI+A+AARDS V L 
Sbjct  85    LLDDTSNFTGEKTAGPNANSVRGYEVVDTIKSQLEASCPGVVSCADILAVAARDSVVALR  144

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W V+LGRRDS TASLSAANS   +P+P  NLS LIS+F N+G +  ++VALSGS+TI
Sbjct  145   GPSWMVRLGRRDSTTASLSAANSN--IPAPTLNLSGLISAFTNKGFNAREMVALSGSHTI  202

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+ N I ASF    Q  CP  +  GD+ L+PLD +TP  FDN YY N
Sbjct  203   GQARCTTFRTRIYNEAN-IDASFKTSLQANCP--SSGGDNTLSPLDTQTPTTFDNAYYTN  259

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+NKKGLLHSDQ L+NGGSTD++V  YS     F + FA AM+KMGN+ PLTG+ G+IR 
Sbjct  260   LVNKKGLLHSDQQLFNGGSTDAVVNTYSTRSTTFFTDFANAMVKMGNLSPLTGTSGQIRT  319

Query  327   NCRKAN  310
             NCRK N
Sbjct  320   NCRKTN  325



>gb|KHN29529.1| Cationic peroxidase 1 [Glycine soja]
Length=314

 Score =   400 bits (1028),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 202/301 (67%), Positives = 237/301 (79%), Gaps = 7/301 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQLS+ FY+K+CP    TIKS + SA++ E+RMGASLLRLHFHDCF  GCD S+LLDDT
Sbjct  21    SAQLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCF--GCDASVLLDDT  78

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             SSF GEKTA  N  S+RG++VID IKS +E +CPG+VSCADI+A+AARDS V LGG  W 
Sbjct  79    SSFTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWT  138

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V+LGRRDS TASLS+ANS   LP P S+LSALISSF N+G S+ +LVALSGS+TIG+++C
Sbjct  139   VQLGRRDSTTASLSSANSD--LPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQC  196

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             + FR RIYNDTN I +SFAK  Q  CP  TG GD NLAPLD  +P  FDN Y+KNL +KK
Sbjct  197   SSFRTRIYNDTN-IDSSFAKSLQGNCP-STG-GDSNLAPLDTTSPNTFDNAYFKNLQSKK  253

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GLLHSDQ L+NGGSTDS V  YS NPA F + FA AMIKMGN+ PLTGS G+IR NCRK 
Sbjct  254   GLLHSDQELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKT  313

Query  312   N  310
             N
Sbjct  314   N  314



>ref|XP_009402215.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=320

 Score =   400 bits (1028),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 196/304 (64%), Positives = 238/304 (78%), Gaps = 4/304 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S++A+LST+FYS SCP L  T+KSV++SA+ +EKR+GAS+LRL FHDCFV GCD S+LLD
Sbjct  20    STAAELSTSFYSSSCPRLSSTVKSVVRSAISKEKRLGASILRLFFHDCFVLGCDASVLLD  79

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +F+GEKTA  NNNS+RG+ VID IK+A+EK CPG+VSCADI+A+A+RDS V+LGGP 
Sbjct  80    DTPTFQGEKTAKPNNNSLRGFEVIDQIKNAVEKACPGVVSCADILAVASRDSVVILGGPY  139

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRDS+ AS S AN    +P P  +LS LIS F  +GLST D+VALSG++TIG++
Sbjct  140   WDVKLGRRDSRKASFSKANKD--IPPPTLSLSKLISKFSAKGLSTKDMVALSGAHTIGQA  197

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR  IYNDTN I  SFAK R+  CPR TGSGD+NLAPLDL TP  FDN+YY NLIN
Sbjct  198   RCTSFRGHIYNDTN-IDVSFAKTRRSNCPRTTGSGDNNLAPLDLRTPTHFDNSYYNNLIN  256

Query  498   KKGLLHSDQALYN-GGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNC  322
              +GLLH+DQ LYN  G   S+VK YS +   F S F   MI MG+IRPLTGS GEIR++C
Sbjct  257   FQGLLHTDQQLYNISGFISSVVKAYSGSTHTFFSDFVSGMINMGDIRPLTGSEGEIRRSC  316

Query  321   RKAN  310
             RK N
Sbjct  317   RKIN  320



>emb|CDY02817.1| BnaC02g10720D [Brassica napus]
Length=320

 Score =   400 bits (1027),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 239/299 (80%), Gaps = 2/299 (1%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
              LS++FY++SCP LF  ++ V++ A+ +E+RM ASLLRL FHDCF+ GCDGSILLDDTSS
Sbjct  24    HLSSDFYAESCPSLFPAVRGVMQRAVAKERRMAASLLRLFFHDCFINGCDGSILLDDTSS  83

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F+GEKTA  NNNSVRG+ VID IKS +EK+CPG+VSCADIVAI+ARDS +LLGGP W VK
Sbjct  84    FRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRWSVK  143

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             LGRRDSK A  +AANS GV+PSPFS L  LI+ F+ QGLS  D+VALSG++TIG++ C  
Sbjct  144   LGRRDSKKAGFTAANS-GVIPSPFSTLKTLINRFKAQGLSVRDMVALSGAHTIGQANCLT  202

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGL  487
             FR+RIYN++N I  SFA  R++ CP  +GSGD+  APLD+ +P  FD++YY  L++KKGL
Sbjct  203   FRNRIYNESN-IDLSFALSRRKHCPATSGSGDNKKAPLDIGSPTRFDHSYYNQLLDKKGL  261

Query  486   LHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             L SDQ L+NGGSTDSLV  YS++   F   F RAM+KMG+I+PLTGS G+IR+NCR+ N
Sbjct  262   LTSDQVLFNGGSTDSLVGTYSRSRNTFYRDFVRAMVKMGDIKPLTGSHGQIRRNCRRPN  320



>ref|XP_008465298.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=324

 Score =   400 bits (1027),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 237/306 (77%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFY KSCP L  T+++ I +A+ +E RMGASLLRLHFHDCFV GCDGSI
Sbjct  24    FTGSSSAQLSTNFYYKSCPKLLNTVRAGIHAAVAKEARMGASLLRLHFHDCFVNGCDGSI  83

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LL+DT +F GE+TA  NN SVRG++VI+ IK  +EK+CPG+VSCADI+ ++ARD+ V+LG
Sbjct  84    LLEDTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDAVVVLG  143

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKVKLGRRDSKTAS S  +  G +P P S L  LI+ F  +GLS  DLVALSG++TI
Sbjct  144   GPSWKVKLGRRDSKTASFS--DVTGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTI  201

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC  F++RIYN+TN I  SFA++RQR CP  T  GDDN APLDL TP  FDN YYKN
Sbjct  202   GQARCLFFKNRIYNETN-IDESFAEERQRICP--TNGGDDNRAPLDLRTPKLFDNYYYKN  258

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+ KK LL SDQ L+NGGSTDSLV+ YS +   F   F  AMIKMG+I+PLTGS+GEIRK
Sbjct  259   LLEKKALLRSDQVLHNGGSTDSLVELYSDDSDAFEHDFVTAMIKMGDIQPLTGSQGEIRK  318

Query  327   NCRKAN  310
              C + N
Sbjct  319   ICSRPN  324



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score =   399 bits (1025),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 235/303 (78%), Gaps = 5/303 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SS+  LS NFYS SCP +   IK+ + SA+  E RMGASLLRLHFHDCFV GCD S+LLD
Sbjct  19    SSAQSLSANFYSSSCPNVLSVIKTAVNSAVSSEARMGASLLRLHFHDCFVNGCDASVLLD  78

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTS+F GEKTA  N+ S+RG++VID IK+ +E  C GIVSCADI+A+AARDS V LGGP+
Sbjct  79    DTSNFTGEKTAGPNSGSIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGPS  138

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W V LGRRDS TASLSAANS   LP P S+LSALISSF N+GL+  ++VALSGS+TIG++
Sbjct  139   WTVLLGRRDSTTASLSAANSN--LPGPTSSLSALISSFSNKGLTAREMVALSGSHTIGQA  196

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR R+YN+ N I ASFA   +  CP+    GD+NL+PLD+ +P  FDN YYKNL  
Sbjct  197   RCTTFRTRLYNEAN-INASFATTVKANCPQS--GGDNNLSPLDITSPTSFDNAYYKNLQI  253

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             +KGLLHSDQ L+NGGSTDS+V  YS N A F++ FA AM+KMGN+ PLTG+ G+IRKNCR
Sbjct  254   QKGLLHSDQVLFNGGSTDSIVNTYSSNSATFSTDFANAMVKMGNLSPLTGTNGQIRKNCR  313

Query  318   KAN  310
             K N
Sbjct  314   KTN  316



>gb|AFR44628.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03453.1| class III peroxidase [Ginkgo biloba]
Length=316

 Score =   399 bits (1024),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 238/306 (78%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F+ S+  QLS  FY+KSCP +  T+KS +K A+ +E RMGASLLRLHFHDCFV GCDGSI
Sbjct  16    FMTSAYGQLSPTFYAKSCPNVLSTVKSAVKQAVAKEARMGASLLRLHFHDCFVNGCDGSI  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDD+S+  GEKTA  N NS RG++VID+IKS +E VC G+VSCADI+ IAARDS V LG
Sbjct  76    LLDDSSTLTGEKTAVPNANSARGFDVIDNIKSQVEAVCSGVVSCADILTIAARDSVVELG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W V LGRRDS+TASLS AN+   +P P S+L+ L+S FQ QGLST D+VAL+G +TI
Sbjct  136   GPSWAVPLGRRDSRTASLSGANNN--IPPPTSSLANLMSKFQAQGLSTKDMVALAGGHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR  IYNDTN I  ++A   + KCPR TGS D+N++PLD+ TP  FDNNY+KN
Sbjct  194   GQARCTSFRAHIYNDTN-IDTTYANSLKAKCPR-TGS-DNNISPLDVVTPTSFDNNYFKN  250

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L  KKGLLHSDQ L+NGGSTDS V  Y  +P  F + FA +M+KMGNI+PLTG+ GEIRK
Sbjct  251   LRAKKGLLHSDQELFNGGSTDSQVTSYVTSPITFRNDFATSMVKMGNIKPLTGTNGEIRK  310

Query  327   NCRKAN  310
             NCRK N
Sbjct  311   NCRKPN  316



>gb|AIE12239.1| peroxide [Momordica charantia]
Length=324

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 243/305 (80%), Gaps = 5/305 (2%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + SSSAQLST FYSK+CP L  T+++ ++SA+ +E R+GASLLRLHFHDCFV GCDGSIL
Sbjct  25    MGSSSAQLSTTFYSKTCPNLLSTVRAGVRSAIAKEARIGASLLRLHFHDCFVNGCDGSIL  84

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDT +F GE+TA  NN SVRG++VI DIKS++EKVCP +VSCADI+ + +RDS V+LGG
Sbjct  85    LDDTPTFMGEQTAPPNNRSVRGFDVIKDIKSSVEKVCPSVVSCADILTLTSRDSVVILGG  144

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P+W+VKLGRRDSKT S SAA+S GV+P P S LS LI+ F   GLST D+VALSG++TIG
Sbjct  145   PSWEVKLGRRDSKTVSFSAASS-GVIPPPTSTLSNLINRFNAVGLSTKDMVALSGAHTIG  203

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RC  FR+RIYN++N I ASFAK RQR CPR    GDDNLAPLD+ TP  FDN YYKNL
Sbjct  204   QARCVSFRNRIYNESN-IDASFAKLRQRNCPR--SGGDDNLAPLDVVTPKLFDNYYYKNL  260

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +N+KGLLHSDQ L+NGGSTDSLV+ YSK    F++ F  AMI+MG  +PLT +R + +K 
Sbjct  261   LNQKGLLHSDQVLHNGGSTDSLVELYSKTIRTFDADFVAAMIRMGEHQPLTITRRD-QKV  319

Query  324   CRKAN  310
             C + N
Sbjct  320   CSRPN  324



>ref|XP_004172441.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 194/306 (63%), Positives = 236/306 (77%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFY K+CP L  T+++ I SA+ +E RMGASLLRLHFHDCFV GCDGSI
Sbjct  13    FTGSSSAQLSTNFYYKTCPKLLNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSI  72

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LL+DT +F GE+TA  NN SVRG++VI+ IK  +EK+CPG+VSCADI+ ++ARDS V+LG
Sbjct  73    LLEDTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLG  132

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKVKLGRRDSKTAS S     G +P P S L  LI+ F  +GLS  DLVALSG++TI
Sbjct  133   GPSWKVKLGRRDSKTASFSDVT--GAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTI  190

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC  F++RIYN+TN I  SFA++RQR CP  T  GDDN APLD +TP  FDN YYKN
Sbjct  191   GQARCLFFKNRIYNETN-IDESFAEERQRTCP--TNGGDDNRAPLDFKTPKLFDNYYYKN  247

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+ KK LL SDQ L++GGSTDSLV+ YS +   F   F  AMIKMG+I+PLTGS+GEIRK
Sbjct  248   LLEKKALLRSDQVLHDGGSTDSLVELYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIRK  307

Query  327   NCRKAN  310
              C + N
Sbjct  308   ICSRPN  313



>ref|XP_010921098.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=319

 Score =   399 bits (1024),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 202/302 (67%), Positives = 237/302 (78%), Gaps = 5/302 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLS+ FY  SCP    TI+S +K+A+ +E RMGASLLRLHFHDCFVQGCDGS+LLDD
Sbjct  23    TSAQLSSTFYDTSCPNALSTIQSAVKAAVAKEARMGASLLRLHFHDCFVQGCDGSVLLDD  82

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TS+F GEKTA  N NS+RG++VID IKS +E VC   VSCADI+A+AARDS V LGGP+W
Sbjct  83    TSTFTGEKTAKPNINSIRGFDVIDTIKSQVEAVCNQTVSCADILAVAARDSVVALGGPSW  142

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              V LGRRDS TASLS ANS   +P P S+LSALIS+F  +GLST+D+VALSGS+TIG++R
Sbjct  143   TVLLGRRDSTTASLSLANSD--IPPPTSDLSALISAFSKKGLSTSDMVALSGSHTIGQAR  200

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR RIYN+TN I +S+A   Q  CP     GD+NL+PLD+ TP  FDN YY+NL+NK
Sbjct  201   CTSFRARIYNETN-IDSSYATSLQSNCP--VSGGDNNLSPLDVSTPTTFDNFYYRNLVNK  257

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ LYNGGSTDS V  Y+ N A F S FA AM+KMGNI PLTGS GEIR NCRK
Sbjct  258   KGLLHSDQQLYNGGSTDSQVSSYNTNSATFFSDFAAAMVKMGNISPLTGSSGEIRINCRK  317

Query  315   AN  310
              N
Sbjct  318   TN  319



>gb|KGN47222.1| hypothetical protein Csa_6G216410 [Cucumis sativus]
Length=302

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 194/306 (63%), Positives = 235/306 (77%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFY K+CP L  T+++ I SA+ +E RMGASLLRLHFHDCFV GCDGSI
Sbjct  2     FTGSSSAQLSTNFYYKTCPKLLNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSI  61

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LL+DT +F GE+TA  NN SVRG++VI+ IK  +EK+CPG+VSCADI+ ++ARDS V+LG
Sbjct  62    LLEDTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLG  121

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKVKLGRRDSKTAS S     G +P P S L  LI+ F  +GLS  DLVALSG++TI
Sbjct  122   GPSWKVKLGRRDSKTASFSDVT--GAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTI  179

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC  F++RIYN+TN I  SFA++RQR CP  T  GDDN APLD  TP  FDN YYKN
Sbjct  180   GQARCLFFKNRIYNETN-IDESFAEERQRTCP--TNGGDDNRAPLDFRTPKLFDNYYYKN  236

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+ KK LL SDQ L++GGSTDSLV+ YS +   F   F  AMIKMG+I+PLTGS+GEIRK
Sbjct  237   LLEKKALLRSDQVLHDGGSTDSLVELYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIRK  296

Query  327   NCRKAN  310
              C + N
Sbjct  297   ICSRPN  302



>gb|KHN40655.1| Cationic peroxidase 1 [Glycine soja]
Length=334

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 239/319 (75%), Gaps = 23/319 (7%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQ-----------  1066
             SAQLS+ FY K+CP    TIKS + SA++ E+RMGASLLRLHFHDCFVQ           
Sbjct  21    SAQLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQASQLSLCPFFH  80

Query  1065  -------GCDGSILLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADI  907
                    GCD S+LLDDTSSFKGEKTA  N  S+RG+NVID IKS +E +CPG+VSCADI
Sbjct  81    YDLFSLSGCDASVLLDDTSSFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADI  140

Query  906   VAIAARDSTVLLGGPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLS  727
             +A+AARDS V LGGP W V+LGRRDS TASLS+ANS   LP+P S+LSALISSF N+G S
Sbjct  141   LAVAARDSVVALGGPTWTVQLGRRDSTTASLSSANSD--LPAPTSSLSALISSFSNKGFS  198

Query  726   TTDLVALSGSYTIGESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDL  547
             + +LVALSGS+TIG+++C+ FR RIYNDTN I +SFAK  Q  CP  TG G   LAPLD 
Sbjct  199   SKELVALSGSHTIGQAQCSSFRTRIYNDTN-IDSSFAKSLQGNCP-STGGG-STLAPLDT  255

Query  546   ETPAFFDNNYYKNLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGN  367
              +P  FDN Y+KNL +KKGLLHSDQ L+NGGSTDS V  YS NPA F + FA AMIKMGN
Sbjct  256   TSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGN  315

Query  366   IRPLTGSRGEIRKNCRKAN  310
             + PLTGS G+IR NCRK N
Sbjct  316   LSPLTGSSGQIRTNCRKTN  334



>ref|XP_004149366.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   398 bits (1022),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/306 (63%), Positives = 235/306 (77%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F  SSSAQLSTNFY K+CP L  T+++ I SA+ +E RMGASLLRLHFHDCFV GCDGSI
Sbjct  13    FTGSSSAQLSTNFYYKTCPKLLNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSI  72

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LL+DT +F GE+TA  NN SVRG++VI+ IK  +EK+CPG+VSCADI+ ++ARDS V+LG
Sbjct  73    LLEDTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLG  132

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKVKLGRRDSKTAS S     G +P P S L  LI+ F  +GLS  DLVALSG++TI
Sbjct  133   GPSWKVKLGRRDSKTASFSDVT--GAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTI  190

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC  F++RIYN+TN I  SFA++RQR CP  T  GDDN APLD  TP  FDN YYKN
Sbjct  191   GQARCLFFKNRIYNETN-IDESFAEERQRTCP--TNGGDDNRAPLDFRTPKLFDNYYYKN  247

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+ KK LL SDQ L++GGSTDSLV+ YS +   F   F  AMIKMG+I+PLTGS+GEIRK
Sbjct  248   LLEKKALLRSDQVLHDGGSTDSLVELYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIRK  307

Query  327   NCRKAN  310
              C + N
Sbjct  308   ICSRPN  313



>gb|ABO77632.1| peroxidase [Medicago truncatula]
Length=322

 Score =   398 bits (1022),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 249/306 (81%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + S++AQLSTNFYSK+CP L  T+KS +++A+ +E RMGAS+LRL FHDCFV GCDGSI
Sbjct  20    IIGSANAQLSTNFYSKTCPKLSTTVKSTLQTAISKEARMGASILRLFFHDCFVNGCDGSI  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEK A  N NS RG++VID+IK+A+E VCPG+VSCADI+AIAA DS  +LG
Sbjct  80    LLDDTSSFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRD+KTAS SAAN+   +P+P SNL+ L S F   GLS+ DLV LSG++TI
Sbjct  140   GPTWNVKLGRRDAKTASQSAANT--AIPAPTSNLNTLTSMFSAVGLSSKDLVTLSGAHTI  197

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I A+ A  RQ  CP+ +GSGD+NLAPLDL+TP+ FDNNY+KN
Sbjct  198   GQARCTNFRARIYNETN-INAAXASTRQSNCPKASGSGDNNLAPLDLQTPSSFDNNYFKN  256

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+  KGLLHSDQ L+NGGST+S+V  YS +P+ F+S FA AMIKMGNI+PLTGS GEIRK
Sbjct  257   LVQNKGLLHSDQQLFNGGSTNSIVSGYSTSPSSFSSDFAAAMIKMGNIKPLTGSNGEIRK  316

Query  327   NCRKAN  310
             NCRK N
Sbjct  317   NCRKTN  322



>ref|XP_010931328.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=316

 Score =   397 bits (1021),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 194/299 (65%), Positives = 233/299 (78%), Gaps = 5/299 (2%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
             QLS  FY  SCP    TI++ +++A+ +E+RMGASLLRLHFHDCFV GCDGSILLDDT +
Sbjct  23    QLSPTFYETSCPGALYTIQNAVRAAVFKERRMGASLLRLHFHDCFVNGCDGSILLDDTPT  82

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F GEKTA  NNNSVRG++VID IKS +E +C  +VSCADI+A+AARDS V LGGP+W V+
Sbjct  83    FTGEKTAGPNNNSVRGFDVIDTIKSQVEAICTQVVSCADILAVAARDSVVALGGPSWAVQ  142

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             LGRRD+ TAS S ANS   +PSP S+LSALIS+F  +GLSTTD+VALSG++TIG++RCT+
Sbjct  143   LGRRDATTASFSGANSD--IPSPTSDLSALISAFSKKGLSTTDMVALSGAHTIGQARCTV  200

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGL  487
             FR R+YN+TN I AS A   +  CP  +  GDDNL+PLD  TP   DN YYK+L+NKKGL
Sbjct  201   FRTRLYNETN-IDASLATSLKSNCP--SSGGDDNLSPLDAITPTIVDNFYYKDLVNKKGL  257

Query  486   LHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LHSDQ LYNGGSTDS V  Y+ N A F S FA AM+ MGNI PLTG+ GEIR NCRK N
Sbjct  258   LHSDQQLYNGGSTDSQVTTYANNFAKFYSDFAAAMVNMGNISPLTGTSGEIRTNCRKIN  316



>ref|XP_010264472.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=325

 Score =   398 bits (1022),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 201/301 (67%), Positives = 237/301 (79%), Gaps = 5/301 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQLS+ +Y  SCP  F TIKS + +A+ +EKRMGASLLRLHFHDCFV GCDGSILLDDT
Sbjct  30    SAQLSSTYYDTSCPKAFSTIKSGVTAAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDT  89

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             SSF GEKTA AN NSVRG++VID IKS +E VCPG+VSCADI+A+AARDS V LGGP+W 
Sbjct  90    SSFTGEKTATANANSVRGFDVIDTIKSKVESVCPGVVSCADILAVAARDSVVALGGPSWT  149

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V+LGRRD+ TASLSAANS   +P+P  +LS L S+F  +GL+  ++VALSG++TIG++RC
Sbjct  150   VQLGRRDATTASLSAANSD--IPAPTLDLSDLTSAFSKKGLTAKEMVALSGAHTIGQARC  207

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             T FR RIYN+TN I +S A   +  CP  TG GD NL+PLD  +P  FDN Y+KNL+N K
Sbjct  208   TSFRSRIYNETN-INSSLATSLKSNCP-STG-GDSNLSPLDATSPTAFDNAYFKNLVNNK  264

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GLLHSDQ LYNGGSTDS V  YS N A F+S FA AM+KMGNI PLTGS GEIR NCRK 
Sbjct  265   GLLHSDQQLYNGGSTDSQVSSYSSNSATFSSDFASAMVKMGNISPLTGSNGEIRTNCRKT  324

Query  312   N  310
             N
Sbjct  325   N  325



>ref|XP_010653359.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=326

 Score =   397 bits (1020),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 232/306 (76%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              L  +SAQL+TN+YS SCP     IKS + +A++ E RMGASLLRLHFHDCFV GCD SI
Sbjct  26    LLGMASAQLTTNYYSSSCPNALSIIKSAVNTAVNNEARMGASLLRLHFHDCFVNGCDASI  85

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTS+F GEKTA  N NSVRG++VID IKS +E  CPG+VSCADI+A+ ARDS V LG
Sbjct  86    LLDDTSNFTGEKTAVPNANSVRGFDVIDTIKSQVESSCPGVVSCADILAVVARDSVVALG  145

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W V+LGRRDS TASLS ANS   +P+P  NLS LISSF N+G S  ++VALSGS+TI
Sbjct  146   GPSWTVRLGRRDSTTASLSTANSD--IPAPTLNLSGLISSFSNKGFSANEMVALSGSHTI  203

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FRDR+YN+TN I ASF    Q  CP  +  GD+NL+PLD ++P  FDN Y+ N
Sbjct  204   GQARCTNFRDRLYNETN-IDASFQSSLQANCP--SSGGDNNLSPLDTKSPTTFDNAYFTN  260

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N KGLLHSDQ L+NGGSTDS V  YS     F + FA A++KMGN+ PLTG+ G+IR 
Sbjct  261   LVNNKGLLHSDQQLFNGGSTDSQVTTYSTKSTTFFTDFANAIVKMGNLSPLTGTSGQIRT  320

Query  327   NCRKAN  310
             NCRK N
Sbjct  321   NCRKTN  326



>gb|KFK27367.1| hypothetical protein AALP_AA8G373800 [Arabis alpina]
Length=325

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/304 (63%), Positives = 235/304 (77%), Gaps = 2/304 (1%)
 Frame = -2

Query  1221  DSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILL  1042
             D + AQL ++FY +SCP LF  ++ V++ A+  E+RM ASLLRL FHDCFV GCDGSILL
Sbjct  24    DQAQAQLDSDFYRESCPSLFPAVRRVVQRAVARERRMAASLLRLFFHDCFVNGCDGSILL  83

Query  1041  DDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGP  862
             DDTSSF GEKTA  NNNSVRG+ VID IKS +E++CPG+VSCADI+AI ARDS  LLGGP
Sbjct  84    DDTSSFVGEKTAGPNNNSVRGFEVIDRIKSRVERLCPGVVSCADILAITARDSVRLLGGP  143

Query  861   NWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGE  682
              W VKLGRRDS TASLSAANS GV+P P S L+ LI+ F+ QGLS  DLVALSG++TIG+
Sbjct  144   GWSVKLGRRDSTTASLSAANS-GVIPPPTSTLNNLINRFRAQGLSQRDLVALSGAHTIGQ  202

Query  681   SRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLI  502
             ++C  FR+RIYN++N I  +FA  +Q  CP  +GSGD+N A LDL +P  FD NYY+ L+
Sbjct  203   AKCATFRNRIYNESN-IDLTFALSKQSSCPASSGSGDNNQATLDLRSPGRFDLNYYRQLL  261

Query  501   NKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNC  322
             N +GLL SDQ LYN GSTDSLV  YS++   F S F RAM+KMG+I PLTGS G+IR NC
Sbjct  262   NHRGLLTSDQVLYNNGSTDSLVVAYSRSLNAFYSDFVRAMVKMGDISPLTGSNGQIRTNC  321

Query  321   RKAN  310
             R+ N
Sbjct  322   RRPN  325



>emb|CAA62597.1| korean-radish isoperoxidase [Raphanus sativus]
Length=315

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 238/306 (78%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              L    AQL+TNFYS SCP L  T+KS +KSA+  + RMGAS+LRL FHDCFV GCDGSI
Sbjct  15    LLQGGEAQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSI  74

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTS F GE+ A  N NS RG+NVID+IKSA+EK CPG+VSCADI+AIAARDS V LG
Sbjct  75    LLDDTS-FTGEQNAGPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLG  133

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GPNW VK+GRRD+KTAS +AANS   +P+P  +LS LISSF+  GLST D+VALSG++TI
Sbjct  134   GPNWNVKVGRRDAKTASQAAANSN--IPAPSMSLSQLISSFRAVGLSTRDMVALSGAHTI  191

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G+SRCT FR RIYN+TN I A+FA  RQ+ CPR          PLD+ +P  FDN+Y+KN
Sbjct  192   GQSRCTNFRTRIYNETN-INAAFATLRQKSCPRAAFR-RRKPQPLDINSPTSFDNSYFKN  249

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+ ++GLLHSDQ L+NGGSTDS+V+ YS +P+ FNS FA AMIKMG+I PLTGS GEIRK
Sbjct  250   LMAQRGLLHSDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRK  309

Query  327   NCRKAN  310
              C + N
Sbjct  310   VCGRTN  315



>ref|XP_008374511.1| PREDICTED: peroxidase P7-like isoform X1 [Malus domestica]
Length=318

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 235/307 (77%), Gaps = 7/307 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++  + +A+  E R+GASLLRLHFHDCFV GCD S+
Sbjct  18    FLESN-CELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASV  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AARDSTV LG
Sbjct  77    LLDDTSSFVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKV LGRRDS TAS SAAN+   LPSP SN+SALISSF  QGLS  DLVALSGS+TI
Sbjct  137   GPSWKVGLGRRDSTTASRSAANT--FLPSPTSNISALISSFSAQGLSLRDLVALSGSHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYND+  I A+FA+  Q  CPR     DDNLA LDL+TP  FDN YYKN
Sbjct  195   GLARCTTFRSRIYNDS-AIDATFAQSLQGICPRS--GNDDNLASLDLQTPTHFDNEYYKN  251

Query  507   LINKKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             L+ +KGLLHSDQ L+NG  STD+LV+ Y+ N   F  HFA AM+KMGNI PLTGS+GEIR
Sbjct  252   LLKEKGLLHSDQELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNISPLTGSQGEIR  311

Query  330   KNCRKAN  310
              NCRK N
Sbjct  312   TNCRKVN  318



>emb|CDP16309.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 235/302 (78%), Gaps = 2/302 (1%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             + AQLS  FY  +CP    TI++ I+ A+  E+RM ASL+RLHFHDCFVQGCDGS+LLD 
Sbjct  23    TEAQLSPTFYDATCPRALDTIRTSIRRAVSRERRMAASLIRLHFHDCFVQGCDGSVLLDQ  82

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TS+ + EKTA ANNNS RG+ VI+  K  +EK+CPG+VSCADI+++AARD++V +GGP W
Sbjct  83    TSTIQSEKTALANNNSARGFEVIEAAKLEVEKICPGVVSCADILSVAARDASVAVGGPTW  142

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
             +VKLGRRDS TAS SAA+S   LPSPF+NL  LI+ FQN+GLS  D+VALSGS+TIG+++
Sbjct  143   QVKLGRRDSTTASRSAADSN--LPSPFANLGDLITKFQNKGLSPRDMVALSGSHTIGQAQ  200

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             C +FR+R+Y++   I A FA  R+R+CP   G+GD NLAPLDL TP  FDNNY+KNL+ K
Sbjct  201   CFVFRNRVYSNGTDIDAGFASTRRRQCPSAIGNGDSNLAPLDLVTPNSFDNNYFKNLMRK  260

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLL SDQ L++GGSTDS+V +YS+NP  F + FA AM+KMG+I PLTG+ G IRK C  
Sbjct  261   KGLLISDQVLFSGGSTDSIVAEYSRNPGTFLADFASAMVKMGDIEPLTGTSGIIRKVCSA  320

Query  315   AN  310
              N
Sbjct  321   VN  322



>ref|XP_008369323.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=335

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 240/306 (78%), Gaps = 7/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++  + +A+  E R+GASLLRLHFHDCFV GCD S+
Sbjct  37    FLESN-CKLTKNFYKSKCPKALSIVQEEVIAAIKNETRVGASLLRLHFHDCFVNGCDASV  95

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTS+F GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AARDS V+ G
Sbjct  96    LLDDTSNFVGEKTAVPNNNSIRGFEVVDGIKAKLEKACPGVVSCADLLALAARDS-VVYG  154

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKV+LGRRDS TAS SAAN+   +P P SN+SALISSF  QGLS  DLVALSGS+TI
Sbjct  155   GPSWKVRLGRRDSTTASRSAANTS--IPPPTSNISALISSFSAQGLSLRDLVALSGSHTI  212

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYN++ TI A+FAK  Q  CPR +GS D+NLA LDL+TP  FDN YYKN
Sbjct  213   GLARCTSFRSRIYNES-TINAAFAKSLQGSCPR-SGS-DNNLASLDLQTPTHFDNLYYKN  269

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+ +KGLLHSDQ LYNG STD LVKKY+ N  +F  HFA+AM+KMGNI PLTGS+GEIR 
Sbjct  270   LLKEKGLLHSDQELYNGTSTDKLVKKYANNTFVFFKHFAKAMVKMGNIDPLTGSQGEIRT  329

Query  327   NCRKAN  310
             NCRK N
Sbjct  330   NCRKVN  335



>ref|XP_008465299.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=326

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 204/305 (67%), Positives = 247/305 (81%), Gaps = 4/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + +SSAQLS +FYSK+CP L   ++S ++SA+ +E R+GASLLRLHFHDCFV GCDGSIL
Sbjct  26    IGTSSAQLSVSFYSKTCPKLLSIVRSGVQSAIAKEARIGASLLRLHFHDCFVNGCDGSIL  85

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDT++F+GE+TA  NN SVRG++VI  IKS +EKVCPG+VSCADI+ + ARDS  +LGG
Sbjct  86    LDDTATFRGEQTAPPNNRSVRGFDVIKAIKSNVEKVCPGVVSCADILTLTARDSVNILGG  145

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P+W+VKLGRRDSKTAS SAA+S GV+P P S LS LI+ F   GLS  D+VALSG++TIG
Sbjct  146   PSWEVKLGRRDSKTASFSAASS-GVIPPPTSTLSNLINRFNAVGLSAKDMVALSGAHTIG  204

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
              +RC  FR+RIYN++N I  SFAK RQR CPR    GDDNLAPLD+ TP  FDNNYYKNL
Sbjct  205   LARCVTFRNRIYNESN-IDVSFAKLRQRSCPRS--GGDDNLAPLDVATPKLFDNNYYKNL  261

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +N KGLLHSDQ L+NGGSTDSLVK+YS+N   F++ F  AMIKMG+IRPLTGS+GEIRK 
Sbjct  262   LNNKGLLHSDQVLHNGGSTDSLVKRYSQNDKTFDTDFVTAMIKMGDIRPLTGSQGEIRKV  321

Query  324   CRKAN  310
             C K N
Sbjct  322   CSKPN  326



>ref|XP_010067586.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=322

 Score =   395 bits (1015),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 240/306 (78%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              +  + AQLST+FY+K+CP LF T+K ++++A+  E RMGASLLRL FHDCFV GCDGS 
Sbjct  20    LMGGTRAQLSTDFYAKTCPKLFPTVKKIVRAAIANETRMGASLLRLFFHDCFVNGCDGSN  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT +F GEK A  N NS+RG++V+D IKSA+EKVCP IVSCAD++AI ARDS  +LG
Sbjct  80    LLDDTPTFTGEKNAMPNQNSLRGFDVVDRIKSAVEKVCPSIVSCADLLAIIARDSVGILG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRD++TAS +AAN+   +P P +NLSALISSFQNQGLS  DLVAL G +TI
Sbjct  140   GPMWDVKLGRRDARTASQAAANNS--IPPPTNNLSALISSFQNQGLSLKDLVALYGGHTI  197

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN++N + +SFA+  +  CPR TG GD+NLA LD ++   FDN+YY N
Sbjct  198   GQARCTNFRARIYNESN-LDSSFARVAKSNCPRVTGVGDNNLAGLDFQSATSFDNSYYIN  256

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI K+GLLHSDQ L+NGGSTDS ++ Y+K+ + F   F  ++IKMG+I+PLTGS GEIRK
Sbjct  257   LIKKRGLLHSDQQLFNGGSTDSFIRTYAKSQSTFFKDFVASIIKMGDIKPLTGSNGEIRK  316

Query  327   NCRKAN  310
              CR+ N
Sbjct  317   KCRRVN  322



>gb|KDP21683.1| hypothetical protein JCGZ_03354 [Jatropha curcas]
Length=316

 Score =   394 bits (1013),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 237/303 (78%), Gaps = 7/303 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             S+ +LS ++YS++CP     +++ +K A+  E R+GASLLRLHFHDCFV GCDGSILLDD
Sbjct  20    SNGKLSPDYYSRTCPKALSVVEAGVKKAIKNETRIGASLLRLHFHDCFVNGCDGSILLDD  79

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
              ++F GEKTA  NNNSVRG+NVIDDIKS +EK CPG+VSCADIVA+AARDS V LGGP+W
Sbjct  80    NATFIGEKTAAPNNNSVRGFNVIDDIKSKLEKACPGVVSCADIVALAARDSAVYLGGPSW  139

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
             KV LGR+DS TAS + AN+   +P P SNLSALI+SF  QGLS  D+VALSGS+TIG +R
Sbjct  140   KVGLGRKDSLTASRALANTS--IPPPTSNLSALITSFSAQGLSLRDMVALSGSHTIGLAR  197

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDN-LAPLDLETPAFFDNNYYKNLIN  499
             CT +R  IYND+N I  SFAK  Q+ CPR   SG DN LAPLD +TP  FDN YYKNL+N
Sbjct  198   CTSYRGHIYNDSN-IDPSFAKSLQQICPR---SGKDNVLAPLDRQTPTRFDNLYYKNLLN  253

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NG S DSLV+KY+  P  F   FA+AM+KM NI+PLTGS G++RKNCR
Sbjct  254   KKGLLHSDQELFNGRSADSLVRKYASKPFTFFKDFAQAMVKMSNIKPLTGSHGQVRKNCR  313

Query  318   KAN  310
             + N
Sbjct  314   RVN  316



>ref|XP_004150606.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
 ref|XP_004171847.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
 gb|KGN47221.1| hypothetical protein Csa_6G213910 [Cucumis sativus]
Length=325

 Score =   395 bits (1014),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 246/306 (80%), Gaps = 4/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + +S AQLS +FYS +CP L   I+S ++SA+ +E R+GASLLRLHFHDCFV GCDGSI
Sbjct  24    LMSTSFAQLSVSFYSNTCPKLLSVIRSGVQSAITKEARIGASLLRLHFHDCFVNGCDGSI  83

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT++F+GE+TA  NN SVRG++VI  IKS IEKVCPG+VSCADI+ +AARDS  +LG
Sbjct  84    LLDDTATFRGEQTAPPNNRSVRGFDVIKAIKSNIEKVCPGVVSCADILTLAARDSVNILG  143

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W+VKLGRRDSKTAS SAA+S G++P P S LS LI+ F   GLS  D+VALSG++TI
Sbjct  144   GPTWEVKLGRRDSKTASFSAASS-GIIPPPTSTLSNLINRFNVVGLSAKDMVALSGAHTI  202

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC  FR+RIYN++N I  SFAK RQR CPR    GDDNLAPLD  TP FFDNNYYKN
Sbjct  203   GQARCVTFRNRIYNESN-IDVSFAKLRQRSCPRS--GGDDNLAPLDFTTPKFFDNNYYKN  259

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N KGLLHSDQ L+NGGSTDSLV++YS+N   F++ F  AMIKMG+I+PLTGS+GEIRK
Sbjct  260   LLNNKGLLHSDQVLHNGGSTDSLVQQYSQNDKTFDTDFVTAMIKMGDIQPLTGSQGEIRK  319

Query  327   NCRKAN  310
              C + N
Sbjct  320   VCNRPN  325



>ref|XP_008364165.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   394 bits (1013),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 233/307 (76%), Gaps = 7/307 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++  + +A+  E R+GASLLRLHFHDCFV GCD S+
Sbjct  18    FLESN-CELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASV  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AARDSTV LG
Sbjct  77    LLDDTSSFVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKV LGRRDS TAS SAAN+    P P SN+SALISSF  QGLS  DLVALSGS+TI
Sbjct  137   GPSWKVGLGRRDSTTASRSAANT--XJPXPTSNISALISSFSAQGLSJRDLVALSGSHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYND+  I A+FA+  Q  CPR     DDNLA LDL+TP  FDN YYKN
Sbjct  195   GLARCTXFRSRIYNDS-AIDATFAQSLQGICPRS--GNDDNLASLDLQTPTHFDNEYYKN  251

Query  507   LINKKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             L+ +KGLLHSDQ L+NG  STD+LV+ Y+ N   F  HFA AM+KMGNI PLTGS+GEIR
Sbjct  252   LLKEKGLLHSDQELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIR  311

Query  330   KNCRKAN  310
              NCRK N
Sbjct  312   TNCRKVN  318



>sp|P22195.2|PER1_ARAHY RecName: Full=Cationic peroxidase 1; AltName: Full=PNPC1; Flags: 
Precursor [Arachis hypogaea]
 gb|AAB06183.1| cationic peroxidase [Arachis hypogaea]
Length=316

 Score =   394 bits (1012),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 230/301 (76%), Gaps = 5/301 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQLS+NFY+  CP    TIKS + SA+ +E RMGASLLRLHFHDCFVQGCD S+LLDDT
Sbjct  21    SAQLSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDT  80

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             S+F GEKTA  N NS+RG+ VID IKS +E +CPG+VSCADI+A+AARDS V LGG +W 
Sbjct  81    SNFTGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWN  140

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V LGRRDS TASLS+ANS   LP+PF NLS LIS+F N+G +T +LV LSG++TIG+++C
Sbjct  141   VLLGRRDSTTASLSSANSD--LPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQC  198

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             T FR RIYN++N I  ++AK  Q  CP     GD NL+P D+ TP  FDN YY NL NKK
Sbjct  199   TAFRTRIYNESN-IDPTYAKSLQANCPSV--GGDTNLSPFDVTTPNKFDNAYYINLRNKK  255

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GLLHSDQ L+NG STDS V  YS N A FN+ F  AMIKMGN+ PLTG+ G+IR NCRK 
Sbjct  256   GLLHSDQQLFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKT  315

Query  312   N  310
             N
Sbjct  316   N  316



>ref|XP_010685954.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=318

 Score =   394 bits (1012),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 183/306 (60%), Positives = 236/306 (77%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              L ++ AQLSTN+YSK+CP    TIK+ +  A+  E RMGASLLRLHFHDCFV GCD S+
Sbjct  18    LLGTAQAQLSTNYYSKTCPRALFTIKTAVHKAVAAEHRMGASLLRLHFHDCFVNGCDASV  77

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LL+D+S+F GE+TA  N  S+RG+ VIDDIKS +E VCPG+VSCADI+A+AARDS  LLG
Sbjct  78    LLNDSSTFTGEQTAGGNAGSLRGFTVIDDIKSQVESVCPGVVSCADILAVAARDSVALLG  137

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W V+LGRRDS TASLS ANS   +PSP  +LS L+SSF N+GL+  ++VAL+G++TI
Sbjct  138   GPTWPVQLGRRDSTTASLSIANSD--IPSPTMDLSGLLSSFSNKGLTAKEMVALAGAHTI  195

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC +FR+R+YN++N I AS+    +  CP     GD+NL PLD  TP  FDN Y+K+
Sbjct  196   GQARCVVFRNRVYNESN-IDASYVSSVKPNCPNN--GGDNNLTPLDSNTPVIFDNGYFKD  252

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L++ KGL+HSDQ L+NGGSTDS V  YSKNP  F++ FA+AM+KMGN+ PLTG++G+IR 
Sbjct  253   LVSNKGLMHSDQQLFNGGSTDSQVTSYSKNPTSFHADFAQAMVKMGNLSPLTGTKGQIRT  312

Query  327   NCRKAN  310
             NC K N
Sbjct  313   NCWKTN  318



>gb|ACN42168.1| peroxidase 1 [Sesuvium portulacastrum]
Length=318

 Score =   394 bits (1012),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 243/306 (79%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F+ SSSAQL+TNFY KSCP LF  ++ V++SA+ +E RMGASLLRLHFHDCFV GCDGS 
Sbjct  16    FVGSSSAQLTTNFYEKSCPHLFPVVRDVVQSAIRKEARMGASLLRLHFHDCFVNGCDGSN  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSFKGEK+A  N  S RG+ VID IK+A+E+VCPG+VSCADI+A+ ARDS V LG
Sbjct  76    LLDDTSSFKGEKSASPNFQSARGFEVIDQIKAAVERVCPGVVSCADILAVTARDSVVGLG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W VKLGRRD++TA+ +AANS   +P   S+LS LISSFQNQGL+  DLVAL G ++I
Sbjct  136   GPTWDVKLGRRDARTANQAAANSS--IPPASSSLSRLISSFQNQGLTIKDLVALYGGHSI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR  IYND++ I ASFAK  +  CP K G+GD+NLAPLD +TP  FD+ Y++ 
Sbjct  194   GQARCTNFRAHIYNDSD-INASFAKSLKANCPPKNGTGDNNLAPLDPQTPNKFDHIYFQG  252

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+NKK  LHSDQ L NG ST S ++KYS NP+LF+S F  +MIKMG+I+PLTGS GEIRK
Sbjct  253   LVNKKAPLHSDQELTNGASTSSWIQKYSTNPSLFSSDFGTSMIKMGDIKPLTGSNGEIRK  312

Query  327   NCRKAN  310
             NCR+ N
Sbjct  313   NCRRIN  318



>ref|XP_004150607.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=326

 Score =   394 bits (1013),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 231/305 (76%), Gaps = 5/305 (2%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + +SSA LS NFY  +CP L   +++ ++SA+ +E RMGASLLRLHFHDCFV GCDGSIL
Sbjct  27    MGTSSAHLSPNFYHNTCPNLLSLVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSIL  86

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDT +F GE+TA  NN SVRG+NVI +IK  IEK+CPG+VSCADI+ ++ARDS V LGG
Sbjct  87    LDDTPTFLGEQTAAPNNRSVRGFNVIANIKEKIEKICPGVVSCADILTLSARDSVVALGG  146

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P+WKVKLGRRDSKTAS S     G +P P S L+ LI+ F  +GLS  DLVALSG++TIG
Sbjct  147   PSWKVKLGRRDSKTASFSDVT--GAIPPPTSTLATLINRFNTKGLSPKDLVALSGAHTIG  204

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RC  F++RIYN+TN I  SFAKKRQ+ CPR    GDDN  P D  TP  FDNNYYKNL
Sbjct  205   KARCLFFKNRIYNETN-IDKSFAKKRQKNCPRN--GGDDNRTPFDFRTPNLFDNNYYKNL  261

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             + KK LL SDQ L+NGGSTDSLV+ YS + A F S F  AMIKMG+I PLTG +GEIRK 
Sbjct  262   LEKKALLRSDQVLHNGGSTDSLVELYSHDSAAFESDFVAAMIKMGDIEPLTGLQGEIRKV  321

Query  324   CRKAN  310
             C + N
Sbjct  322   CSRPN  326



>ref|XP_008343635.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   394 bits (1012),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 233/307 (76%), Gaps = 7/307 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++  + +A+  E R+GASLLRLHFHDCFV GCD S+
Sbjct  18    FLESN-CELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASV  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AARDSTV LG
Sbjct  77    LLDDTSSFVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKV LGRRDS TAS SAAN+   LP P SN+SALISSF  QGLS  DLVALSGS+TI
Sbjct  137   GPSWKVGLGRRDSTTASRSAANT--XLPXPTSNISALISSFSAQGLSLRDLVALSGSHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYND+  I A+FA+  Q  CPR     DDNLA LDL+TP  FDN YYKN
Sbjct  195   GLARCTTFRSRIYNDS-AIDATFAQSLQGICPRS--GNDDNLASLDLQTPTHFDNEYYKN  251

Query  507   LINKKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             L+ +KGLLHSDQ L+NG  STD+LV+ Y  N   F  HFA AM+KMGNI PLTGS+GEIR
Sbjct  252   LLKEKGLLHSDQELFNGTTSTDNLVQIYXNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIR  311

Query  330   KNCRKAN  310
              NCRK N
Sbjct  312   TNCRKVN  318



>ref|XP_008374539.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=318

 Score =   394 bits (1012),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 233/307 (76%), Gaps = 7/307 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++  + +A+  E R GASLLRLHFHDCFV GCD S+
Sbjct  18    FLESN-CELTQNFYKSKCPKALSIVQEGVIAAIKNETRXGASLLRLHFHDCFVNGCDASV  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AARDSTV LG
Sbjct  77    LLDDTSSFVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKV LGRRDS TAS SAAN+   LPSP SN+SALISSF  QGLS  DLVALSGS+TI
Sbjct  137   GPSWKVGLGRRDSTTASRSAANT--FLPSPTSNISALISSFSAQGLSLRDLVALSGSHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYND+  I A+FA+  Q  CPR     DDNLA LDL+TP  FDN YYKN
Sbjct  195   GLARCTTFRSRIYNDS-AIDATFAQSLQGICPRS--GNDDNLASLDLQTPTHFDNXYYKN  251

Query  507   LINKKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             L+ +KGLLHSDQ L+NG  STD+LV+ Y  N   F  HFA AM+KMGNI PLTGS+GEIR
Sbjct  252   LLKEKGLLHSDQELFNGTTSTDNLVQIYXNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIR  311

Query  330   KNCRKAN  310
              NCRK N
Sbjct  312   TNCRKVN  318



>ref|XP_010066394.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   394 bits (1012),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 233/303 (77%), Gaps = 5/303 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             ++SAQLS+ FYSKSCP    TIKS + SA+  E RMGASLLRLHFHDCFV GCD SILLD
Sbjct  22    TASAQLSSTFYSKSCPSALRTIKSGVSSAVSSEARMGASLLRLHFHDCFVNGCDASILLD  81

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT++F GEKTA ANNNS+RGY VID IKS +E  CPG+VSCADI+AIAARDS V LGGP+
Sbjct  82    DTTNFTGEKTAGANNNSIRGYEVIDTIKSHLESSCPGVVSCADILAIAARDSVVALGGPS  141

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W V LGRRDS TASL+ ANS   +P+P  +LS LI+SF N+G +  ++VALSGS+TIG++
Sbjct  142   WTVLLGRRDSTTASLTDANSD--IPAPTLSLSDLITSFSNKGFTAKEMVALSGSHTIGQA  199

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR R+YN+ N I A+FA      CP  +  GD+NL+PLD  +P +FDN Y+KNL  
Sbjct  200   RCTSFRTRLYNE-NDINATFATSLNANCP--SSGGDNNLSPLDTTSPTYFDNAYFKNLQT  256

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             +KGLLHSDQ L++GGSTD+ V  YS N A F + FA AM+ MGN+ PLTGS G+IRKNCR
Sbjct  257   QKGLLHSDQQLFSGGSTDAQVNTYSSNSATFMTDFANAMVTMGNLSPLTGSSGQIRKNCR  316

Query  318   KAN  310
             K N
Sbjct  317   KVN  319



>ref|XP_004491048.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=323

 Score =   394 bits (1012),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 237/305 (78%), Gaps = 3/305 (1%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             L S +A LS ++Y  SCP L  T+K  ++SA+ +E RMGASLLRL FHDCFV GCDGSIL
Sbjct  21    LGSVNATLSKDYYYSSCPKLLDTVKCTVESAISKEPRMGASLLRLFFHDCFVNGCDGSIL  80

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDTS+F GEK A  N NS RG+ VID IKSA+E+VCPG++SCADIV IAARDS  +LGG
Sbjct  81    LDDTSNFFGEKNAIPNKNSARGFEVIDKIKSAVEEVCPGVISCADIVTIAARDSVEILGG  140

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P+W VKLGRRDS+TAS SAAN+   +P+P SNL+ LIS F   GLST DLVAL GS+TIG
Sbjct  141   PSWDVKLGRRDSRTASRSAANNG--IPAPTSNLNQLISRFSALGLSTKDLVALFGSHTIG  198

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RCT FR  IYN++N I  SFA  RQ +CP+  GSGD+NLAPLDL T   FDN+Y+KNL
Sbjct  199   QARCTTFRGHIYNESN-IDTSFANTRQTECPKSRGSGDNNLAPLDLTTSTSFDNHYFKNL  257

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             +  KGLLHSDQ L+NGGSTDS+V  YS N + F S FA AMIKMG+I PLTGS GEIRKN
Sbjct  258   VENKGLLHSDQQLFNGGSTDSIVSGYSMNSSSFFSDFASAMIKMGDISPLTGSNGEIRKN  317

Query  324   CRKAN  310
             CR+ N
Sbjct  318   CRRVN  322



>gb|KGN47223.1| hypothetical protein Csa_6G216420 [Cucumis sativus]
Length=311

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 231/305 (76%), Gaps = 5/305 (2%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + +SSA LS NFY  +CP L   +++ ++SA+ +E RMGASLLRLHFHDCFV GCDGSIL
Sbjct  12    MGTSSAHLSPNFYHNTCPNLLSLVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSIL  71

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDT +F GE+TA  NN SVRG+NVI +IK  IEK+CPG+VSCADI+ ++ARDS V LGG
Sbjct  72    LDDTPTFLGEQTAAPNNRSVRGFNVIANIKEKIEKICPGVVSCADILTLSARDSVVALGG  131

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P+WKVKLGRRDSKTAS S     G +P P S L+ LI+ F  +GLS  DLVALSG++TIG
Sbjct  132   PSWKVKLGRRDSKTASFSDVT--GAIPPPTSTLATLINRFNTKGLSPKDLVALSGAHTIG  189

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             ++RC  F++RIYN+TN I  SFAKKRQ+ CPR    GDDN  P D  TP  FDNNYYKNL
Sbjct  190   KARCLFFKNRIYNETN-IDKSFAKKRQKNCPRN--GGDDNRTPFDFRTPNLFDNNYYKNL  246

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
             + KK LL SDQ L+NGGSTDSLV+ YS + A F S F  AMIKMG+I PLTG +GEIRK 
Sbjct  247   LEKKALLRSDQVLHNGGSTDSLVELYSHDSAAFESDFVAAMIKMGDIEPLTGLQGEIRKV  306

Query  324   CRKAN  310
             C + N
Sbjct  307   CSRPN  311



>gb|AFK46186.1| unknown [Lotus japonicus]
Length=316

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 231/301 (77%), Gaps = 5/301 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQLS+ FY+K+CP++  TIK+ +  A+ +E RMGASLLRLHFHDCFVQGCD SILLDDT
Sbjct  21    SAQLSSTFYAKTCPLVLATIKTQVNLAVAKEARMGASLLRLHFHDCFVQGCDASILLDDT  80

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             SSF GEKTA  N NSVRGY+VID IKS +E +CPG+VSCADIVA+AARDS V LGG +W 
Sbjct  81    SSFTGEKTAGPNANSVRGYDVIDTIKSKVESLCPGVVSCADIVAVAARDSVVALGGFSWA  140

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V LGRRDS TASLS+ANS   LP P SNL  L ++F N+G +T ++VALSGS+TIG++RC
Sbjct  141   VPLGRRDSTTASLSSANSE--LPGPSSNLDGLNTAFSNKGFTTREMVALSGSHTIGQARC  198

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
               FR RIYN+TN I ++FAK  Q  CP     GD NL+PLD  +P  FD+ YY+NL +KK
Sbjct  199   LFFRTRIYNETN-IDSTFAKNLQGNCPFN--GGDSNLSPLDTTSPTTFDDGYYRNLQSKK  255

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             GL HSDQ  +NGGSTDS V  Y  NPA F + FA AM+KMGN+ PLTGS G+IR NCRK 
Sbjct  256   GLFHSDQVPFNGGSTDSQVNSYVTNPASFKTDFANAMVKMGNLSPLTGSSGQIRTNCRKT  315

Query  312   N  310
             N
Sbjct  316   N  316



>ref|XP_003544922.1| PREDICTED: peroxidase 4 [Glycine max]
Length=324

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/308 (64%), Positives = 236/308 (77%), Gaps = 9/308 (3%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + SSSAQLS NFY   CP +F  +KSV++SAL +E R GAS++RL FHDCFV GCDGS+L
Sbjct  23    IGSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVL  82

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LD  SS   EK A  N NS+RGY VID IKS +E +CPG+VSCADIV IAARDS  +LGG
Sbjct  83    LDGPSS---EKIALPNKNSLRGYEVIDAIKSKVEALCPGVVSCADIVTIAARDSVAILGG  139

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             PNWKVKLGRRDS T   + ANS GVLP P S+LS+LI  F +QGLST D+VALSG++TIG
Sbjct  140   PNWKVKLGRRDSTTGFFNLANS-GVLPGPNSSLSSLIQRFDDQGLSTKDMVALSGAHTIG  198

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSG---DDNLAPLDLETPAFFDNNYY  514
             ++RC  +RDRIYN+ N I + FAK RQ+ CP K  SG   D+N+APLD +TP  FDN Y+
Sbjct  199   KARCVSYRDRIYNENN-IDSLFAKARQKNCP-KGSSGTPKDNNVAPLDFKTPNHFDNEYF  256

Query  513   KNLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEI  334
             KNLINKKGLL SDQ L+NGGSTDSLV+ YS N  +F + F  AMIKMGNI+PLTGS G+I
Sbjct  257   KNLINKKGLLRSDQELFNGGSTDSLVRTYSNNQRVFEADFVTAMIKMGNIKPLTGSNGQI  316

Query  333   RKNCRKAN  310
             RK CR+ N
Sbjct  317   RKQCRRPN  324



>gb|EPS67864.1| hypothetical protein M569_06908, partial [Genlisea aurea]
Length=312

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/308 (61%), Positives = 238/308 (77%), Gaps = 5/308 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F    SAQLST+FYS SCP L+ T++SV+ SA+  E RMGASLLRL FHDCFV GCDGSI
Sbjct  8     FFGVCSAQLSTDFYSNSCPKLYSTVRSVVDSAIQAEARMGASLLRLFFHDCFVNGCDGSI  67

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLD T++  GEK A  N NSVRG++V+D IKSA+E VCPG+VSCAD++AI ARDS  +LG
Sbjct  68    LLDSTATITGEKGALPNANSVRGFDVVDRIKSAVESVCPGVVSCADVLAITARDSVEILG  127

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VK+GRRDSKTASLSAAN+   +P P S+L+ L+S +   GLS  DLVALSG++TI
Sbjct  128   GPSWNVKVGRRDSKTASLSAANNG--IPPPTSSLATLVSRYNALGLSQKDLVALSGAHTI  185

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+T+ + ASFA+ R+  CPR  G GD+NLAPLD++TP  FDN+Y++N
Sbjct  186   GQARCTTFRARIYNETD-VEASFAQLRRNGCPRSAGVGDNNLAPLDVQTPTRFDNDYFRN  244

Query  507   LINKKGLLHSDQALYNGG--STDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEI  334
             L++++GLLHSDQ LY GG  ST S V+ Y+ +   F   F  AMI+MG+I PLTGS GEI
Sbjct  245   LLSQRGLLHSDQELYAGGSASTASDVRTYAADSNAFGRDFVAAMIRMGDISPLTGSNGEI  304

Query  333   RKNCRKAN  310
             R NCR+ N
Sbjct  305   RTNCRRVN  312



>gb|KHN08835.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/308 (64%), Positives = 236/308 (77%), Gaps = 9/308 (3%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + SSSAQLS NFY   CP +F  +KSV++SAL +E R GAS++RL FHDCFV GCDGS+L
Sbjct  23    IGSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVL  82

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LD  SS   EK A  N NS+RGY VID IKS +E +CPG+VSCADIV IAARDS  +LGG
Sbjct  83    LDGPSS---EKIALPNKNSLRGYEVIDAIKSKVEALCPGVVSCADIVTIAARDSVAILGG  139

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             PNWKVKLGRRDS T   + ANS GVLP P S+LS+LI  F +QGLST D+VALSG++TIG
Sbjct  140   PNWKVKLGRRDSTTGFFNLANS-GVLPGPNSSLSSLIQRFDDQGLSTKDMVALSGAHTIG  198

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSG---DDNLAPLDLETPAFFDNNYY  514
             ++RC  +RDRIYN+ N I + FAK RQ+ CP K  SG   D+N+APLD +TP  FDN Y+
Sbjct  199   KARCVSYRDRIYNENN-IDSLFAKARQKNCP-KGSSGTPKDNNVAPLDFKTPNHFDNEYF  256

Query  513   KNLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEI  334
             KNLINKKGLL SDQ L+NGGSTDSLV+ YS N  +F + F  AMIKMGNI+PLTGS G+I
Sbjct  257   KNLINKKGLLRSDQELFNGGSTDSLVRTYSNNQRVFEADFVTAMIKMGNIKPLTGSNGQI  316

Query  333   RKNCRKAN  310
             RK CR+ N
Sbjct  317   RKQCRRPN  324



>ref|XP_008374518.1| PREDICTED: peroxidase P7-like isoform X2 [Malus domestica]
Length=317

 Score =   392 bits (1008),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 235/307 (77%), Gaps = 8/307 (3%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++ VI +A+  E R+GASLLRLHF DCFV GCD S+
Sbjct  18    FLESN-CKLTQNFYKSKCPKALSIVQGVI-AAIKNETRVGASLLRLHFQDCFVNGCDASV  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AARDSTV LG
Sbjct  76    LLDDTSSFVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKV LGRRDS TAS SAAN+   LPSP SN+SALISSF  QGLS  DLVALSGS+TI
Sbjct  136   GPSWKVGLGRRDSTTASRSAANT--FLPSPTSNISALISSFSAQGLSLRDLVALSGSHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYND+  I A+FA+  Q  CPR     DDNLA LDL+TP  FDN YYKN
Sbjct  194   GLARCTTFRSRIYNDS-AIDATFAQSLQGICPRS--GNDDNLASLDLQTPTHFDNEYYKN  250

Query  507   LINKKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             L+ +KGLLHSDQ L+NG  STD+LV+ Y+ N   F  HFA AM+KMGNI PLTGS+GEIR
Sbjct  251   LLKEKGLLHSDQELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNISPLTGSQGEIR  310

Query  330   KNCRKAN  310
              NCRK N
Sbjct  311   TNCRKVN  317



>ref|XP_002285723.1| PREDICTED: cationic peroxidase 1 isoform X1 [Vitis vinifera]
Length=317

 Score =   392 bits (1007),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 237/306 (77%), Gaps = 6/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              L  + AQLS+NFY+ SCP    TI++ + +A+ +E+RMGASLLRLHFHDCFV GCD SI
Sbjct  16    LLGMAHAQLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASI  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT+SF GEKTA  N +SVRGY VID IKS +E +CPG+VSCADIVA+AARDS V LG
Sbjct  76    LLDDTASFTGEKTAGPNKDSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W ++LGRRDS TASLS ANS   LP P S+LS LIS F N+G +T ++VALSG++TI
Sbjct  136   GPTWTLQLGRRDSTTASLSTANSD--LPGPASDLSTLISRFSNKGFTTKEMVALSGTHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RCT FR RIYN+TN I A+FA  +Q+ CP  TG GD+NL+ LD ET   FDN Y++N
Sbjct  194   GKARCTSFRSRIYNETN-IDAAFATSKQKICP-STG-GDNNLSDLD-ETTTVFDNVYFRN  249

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L  KKGLLHSDQ LYNGGSTDS+V+ YS N A F +  A AMIKMGN+ PLTG+ GEIR 
Sbjct  250   LKAKKGLLHSDQQLYNGGSTDSIVETYSTNSATFFTDVANAMIKMGNLSPLTGTNGEIRT  309

Query  327   NCRKAN  310
             +C+K N
Sbjct  310   DCKKIN  315



>ref|XP_009420366.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=317

 Score =   392 bits (1007),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 233/299 (78%), Gaps = 4/299 (1%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
             QLS+ FYS SCP+   TI+  +++A+ +E RMGASLLRLHFHDCFV GCDGS+LLDDTS 
Sbjct  23    QLSSTFYSTSCPLAIQTIRLAVRAAVAKEARMGASLLRLHFHDCFVNGCDGSVLLDDTSG  82

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F GEKTA  NNNS+RG++VID+IKS +E VC  +VSCADI+A+AAR+S   LGGP W V+
Sbjct  83    FTGEKTAVPNNNSLRGFDVIDNIKSQVEAVCKQVVSCADILAVAARESVAALGGPLWTVQ  142

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             LGRRD+ TASL AAN+   +PSP S+L  LIS++  +GL TTD+VALSG++TIG++RC  
Sbjct  143   LGRRDATTASLDAANTE--IPSPKSDLDDLISAYSKKGLGTTDMVALSGAHTIGQARCIS  200

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGL  487
             FRDRIYN+T +I +S A  RQ  CP  +G GDDNL+PLD  T   FDN Y++NL+ KKGL
Sbjct  201   FRDRIYNET-SIDSSLATSRQSNCP-SSGDGDDNLSPLDAVTCTLFDNFYFRNLVKKKGL  258

Query  486   LHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LHSDQ L++GGSTDSLV  YS N A F S FA AM+KMGNI PLTG+ GE+R NCRK N
Sbjct  259   LHSDQQLFSGGSTDSLVTTYSTNTARFFSDFAAAMVKMGNISPLTGTDGEVRLNCRKTN  317



>ref|XP_007033589.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04515.1| Peroxidase superfamily protein [Theobroma cacao]
Length=322

 Score =   392 bits (1008),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 233/302 (77%), Gaps = 5/302 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLS+NFY+ +CP    TIKS + SA+ +E RMGASLLRLHFHDCFV GCD SILLDD
Sbjct  26    ASAQLSSNFYATTCPRALATIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASILLDD  85

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T++  GEKTA  NNNSVRGY VID IKS +E +CP +VSCADIVA+AARDS V LGGP+W
Sbjct  86    TANITGEKTAGPNNNSVRGYEVIDTIKSQLESLCPAVVSCADIVAVAARDSVVALGGPSW  145

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              V LGRRDS TASL+AANS   +P+P  +LS LIS+F N+G +  ++VALSGS+TIG++R
Sbjct  146   SVLLGRRDSTTASLNAANSN--IPAPTLSLSGLISAFSNKGFTAKEMVALSGSHTIGQAR  203

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR RIYN+T TI  SFA   +  CP  TG GD+NL+PLD  +P  FDN YYKNL ++
Sbjct  204   CTTFRSRIYNET-TIDPSFATSLRANCP-STG-GDNNLSPLDTTSPTSFDNAYYKNLQSQ  260

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L++GGSTDS V  YS N   F + FA AMIKMGN+ PLTG+ G+IR NCRK
Sbjct  261   KGLLHSDQQLFSGGSTDSQVNAYSSNLGSFRTDFANAMIKMGNLSPLTGTSGQIRTNCRK  320

Query  315   AN  310
              N
Sbjct  321   VN  322



>dbj|BAJ91992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   392 bits (1007),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 194/309 (63%), Positives = 236/309 (76%), Gaps = 6/309 (2%)
 Frame = -2

Query  1227  FLDSSSA--QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDG  1054
             FL SS+A  QLS +FY+ SCP+L  T+++ + +AL  E+RMGASLLRLHFHDCFVQGCDG
Sbjct  16    FLLSSAAYGQLSPSFYATSCPLLELTVRATMVTALLAERRMGASLLRLHFHDCFVQGCDG  75

Query  1053  SILLDDT-SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTV  877
             SILLDD  +SF GEKTAF N NSVRGY+VID IKSA+E +CPG+VSCADIVA+AARD T 
Sbjct  76    SILLDDVGTSFTGEKTAFPNVNSVRGYDVIDRIKSAVELLCPGVVSCADIVALAARDGTF  135

Query  876   LLGGPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGS  697
             LLGGP+W V LGRRDS TASL+ AN+   LP P  NL  LI +F  + L+  DL ALSG+
Sbjct  136   LLGGPSWTVPLGRRDSTTASLAEANAD--LPGPTLNLDQLIRAFDKKQLTPRDLTALSGA  193

Query  696   YTIGESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNY  517
             +TIG S+C  FRD IYN TN I  +FA  R++ CP    +GD NLAPLD +T   FDN Y
Sbjct  194   HTIGFSQCQFFRDHIYNGTN-IDPAFAALRRQTCPAAAPAGDANLAPLDAQTQLVFDNAY  252

Query  516   YKNLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGE  337
             Y+NL+ ++GLLHSDQ L+NGGS D+LV++Y  NPALF + F  AMIKMGNI PLTG+ G+
Sbjct  253   YRNLVAQRGLLHSDQQLFNGGSQDALVRQYGTNPALFAADFVAAMIKMGNIAPLTGTNGQ  312

Query  336   IRKNCRKAN  310
             IR+NCR  N
Sbjct  313   IRRNCRVVN  321



>emb|CAH10839.1| peroxidase [Picea abies]
Length=317

 Score =   392 bits (1007),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 192/304 (63%), Positives = 230/304 (76%), Gaps = 5/304 (2%)
 Frame = -2

Query  1221  DSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILL  1042
             +++  QL++ FY+K CP     +K+ +  A++ EKRMGASLLRLHFHDCFV GCDGSILL
Sbjct  19    NAAHGQLTSTFYNKLCPTALSIVKAAVNKAVNNEKRMGASLLRLHFHDCFVNGCDGSILL  78

Query  1041  DDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGP  862
             DD S+F GEKTA  N NSVRG++VID IK+ +E  C G+VSCADI+AI ARDS V LGGP
Sbjct  79    DDNSTFTGEKTALPNANSVRGFDVIDTIKTQVEAACSGVVSCADILAIVARDSVVQLGGP  138

Query  861   NWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGE  682
              W V LGRRDS TASLSAAN+   +PSP SNLSALISSF   GLST DLVALSG +TIG+
Sbjct  139   TWTVLLGRRDSTTASLSAANNN--IPSPASNLSALISSFTAHGLSTKDLVALSGGHTIGQ  196

Query  681   SRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLI  502
             +RCT FR RIYN++N I  SFA   +  CP  +  GD+ L+PLDL TP  FDN YY +L 
Sbjct  197   ARCTTFRARIYNESN-IDTSFATSVKSSCP--SAGGDNTLSPLDLATPTTFDNKYYTDLG  253

Query  501   NKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNC  322
             N+KGLLHSDQ L++GGST+S V  YS N   F + FA AM+KMGNI PLTG+ G+IRKNC
Sbjct  254   NRKGLLHSDQQLFSGGSTNSQVTTYSANQNTFFTDFAAAMVKMGNISPLTGTSGQIRKNC  313

Query  321   RKAN  310
             RKAN
Sbjct  314   RKAN  317



>ref|XP_010032327.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=322

 Score =   392 bits (1007),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 245/306 (80%), Gaps = 3/306 (1%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              +  S AQLS +FYSKSCP +F  +KS ++SA+ +E  +GASLLRL FHDCFV GCDGS+
Sbjct  20    LMGCSDAQLSPDFYSKSCPDVFTGVKSQVESAVSKEPGIGASLLRLFFHDCFVNGCDGSV  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT +F GEK A  N NS RG+ VIDD+KSA+EKVCPG+VSCAD++AI ARDS VLLG
Sbjct  80    LLDDTPTFTGEKNAAPNRNSARGFEVIDDVKSAVEKVCPGVVSCADLLAITARDSVVLLG  139

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRD+++AS +AANS   LPSP SNL+ LISSF++ GLSTTDLVALSGS++I
Sbjct  140   GPSWSVKLGRRDARSASQAAANS--SLPSPASNLTDLISSFESAGLSTTDLVALSGSHSI  197

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G+++C  FR RIYN+T+ +  SF + R++ CP   G GD+NLAPLD+++   FDN YY N
Sbjct  198   GQAKCENFRARIYNETD-LDRSFGEIRRKNCPSSAGPGDNNLAPLDVQSSVAFDNTYYTN  256

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+  KGLLHSDQ L++GGSTDSLV+ Y+ +P+ F+S FA AMIKMG+I PLTGS GE+RK
Sbjct  257   LLQFKGLLHSDQQLFSGGSTDSLVRTYASSPSTFSSDFAAAMIKMGDILPLTGSDGEVRK  316

Query  327   NCRKAN  310
             NCRK N
Sbjct  317   NCRKIN  322



>ref|XP_002509730.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51117.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=323

 Score =   392 bits (1007),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 188/304 (62%), Positives = 236/304 (78%), Gaps = 6/304 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             S AQLS+NFY  +CP    TI++ I+SA+  E+RM ASL+RLHFHDCFVQGCDGSILLDD
Sbjct  24    SHAQLSSNFYDNTCPNALSTIRTAIRSAVSRERRMSASLVRLHFHDCFVQGCDGSILLDD  83

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSS  GEK A  NNNSVRG+ VID+ K+ +E +CPGIVSCADIVA+AARD++V +GGP+W
Sbjct  84    TSSMTGEKFARNNNNSVRGFQVIDNAKAQVESICPGIVSCADIVAVAARDASVAVGGPSW  143

Query  855   KVKLGRRDSKTAS--LSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGE  682
              VKLGRRDS +AS  L+ AN PG   S    L +LIS F+ +GLS  D+VALSG++TIG+
Sbjct  144   TVKLGRRDSTSASQRLADANLPGFTDS----LESLISLFERKGLSARDMVALSGAHTIGQ  199

Query  681   SRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLI  502
             +RC  FR RIYN+ + I A FA  R+R+CP   G+GD NLA LDL TP  FDNNY++NLI
Sbjct  200   ARCLTFRGRIYNNASDIDAGFASTRRRQCPANNGNGDGNLAALDLVTPNSFDNNYFRNLI  259

Query  501   NKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNC  322
              KKGLL SDQ L++GGSTD++V +YS++P+ F+S FA AM+KMG+I PLTGS+GEIR+ C
Sbjct  260   QKKGLLQSDQVLFSGGSTDNIVNEYSRSPSTFSSDFASAMVKMGDIEPLTGSQGEIRRLC  319

Query  321   RKAN  310
                N
Sbjct  320   NVVN  323



>ref|XP_006466288.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   392 bits (1006),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 240/306 (78%), Gaps = 7/306 (2%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             LD +++QLSTN+Y  +CP     +++ I +A+  E R+GASLLRLHFHDCFV GCDGS+L
Sbjct  20    LDQANSQLSTNYYKSTCPKALSIVRAGIIAAIKNETRVGASLLRLHFHDCFVNGCDGSVL  79

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDT++F GEKTA  NNNS RG+NV+D IK+ +EK CP +VSCADI+AIAARDS V+ GG
Sbjct  80    LDDTANFIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVVFGG  139

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P+WKV+LGRRDS TAS +AAN+   +P P SNLSALISSF  QGLS  ++VAL+G +T+G
Sbjct  140   PSWKVRLGRRDSTTASRAAANTS--IPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVG  197

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDN-LAPLDLETPAFFDNNYYKN  508
             ++RCT FR  IYND+N I  SFA+  Q++CPR+   G+DN LA LD +TP  FDN YYKN
Sbjct  198   KARCTSFRGHIYNDSN-IDTSFARSLQQRCPRR---GNDNVLANLDRQTPTCFDNLYYKN  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+NKKGLLHSDQ L+NG S D LVK+Y+ + ++F   FAR MIKMGNI+PLTGS G+IR 
Sbjct  254   LLNKKGLLHSDQQLFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQIRI  313

Query  327   NCRKAN  310
             NCRK N
Sbjct  314   NCRKIN  319



>ref|XP_010256954.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=323

 Score =   392 bits (1006),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 236/303 (78%), Gaps = 5/303 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             ++SAQLS+ +YS SCP    TIKS + SA+ +E+RMGASLLRLHFHDCFV GCDGSILLD
Sbjct  26    TASAQLSSTYYSTSCPEALSTIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDGSILLD  85

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT+SF GEKTA  N NS+RG++VID IKS +E VC G+VSCADI+A+AARDS V LGGP 
Sbjct  86    DTTSFTGEKTATPNANSLRGFDVIDTIKSQVESVCAGVVSCADILAVAARDSVVALGGPT  145

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W V+LGRRD+ TASLSAANS   +P+P  +LS LIS+F N+G +  ++VALSG++TIG++
Sbjct  146   WTVQLGRRDATTASLSAANSD--IPAPTLDLSGLISAFSNKGFTAKEMVALSGAHTIGQA  203

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FRDRIYN+TN I +SFA   + KCP  +  GD+NL+PLD  +   FDN Y+ NL+N
Sbjct  204   RCTSFRDRIYNETN-INSSFATSLKSKCP--SAGGDNNLSPLDATSATTFDNAYFTNLVN  260

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
              KGLLHSDQ LYN GSTDS V  YS N A F S FA AM+KMGN+ PLTGS GE+R NCR
Sbjct  261   NKGLLHSDQQLYNSGSTDSQVSSYSSNSATFFSDFASAMVKMGNLSPLTGSSGEVRTNCR  320

Query  318   KAN  310
             K N
Sbjct  321   KTN  323



>gb|KDO60611.1| hypothetical protein CISIN_1g020951mg [Citrus sinensis]
Length=319

 Score =   392 bits (1006),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 240/306 (78%), Gaps = 7/306 (2%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             LD +++QLSTN+Y  +CP     +++ I +A+  E R+GASLLRLHFHDCFV GCDGS+L
Sbjct  20    LDQANSQLSTNYYKSTCPKALSIVRAGIIAAIKNETRVGASLLRLHFHDCFVNGCDGSVL  79

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDDT++F GEKTA  NNNS RG+NV+D IK+ +EK CP +VSCADI+AIAARDS V+ GG
Sbjct  80    LDDTANFIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVVFGG  139

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P+WKV+LGRRDS TAS +AAN+   +P P SNLSALISSF  QGLS  ++VAL+G +T+G
Sbjct  140   PSWKVRLGRRDSTTASRAAANTS--IPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVG  197

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDN-LAPLDLETPAFFDNNYYKN  508
             ++RCT FR  IYND+N I  SFA+  Q++CPR+   G+DN LA LD +TP  FDN YYKN
Sbjct  198   KARCTSFRGHIYNDSN-IDTSFARSLQQRCPRR---GNDNVLANLDRQTPTCFDNLYYKN  253

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+NKKGLLHSDQ L+NG S D LVK+Y+ + ++F   FAR MIKMGNI+PLTGS G+IR 
Sbjct  254   LLNKKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQIRI  313

Query  327   NCRKAN  310
             NCRK N
Sbjct  314   NCRKIN  319



>emb|CAH10840.1| peroxidase [Picea abies]
Length=320

 Score =   392 bits (1006),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 234/305 (77%), Gaps = 5/305 (2%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             +++ + QLS+ FY+KSCP +   +K+V+K A+ +EKRMGASL+RLHFHDCFV GCDGSIL
Sbjct  21    INAVNGQLSSTFYAKSCPRVQSIVKTVVKQAVAKEKRMGASLVRLHFHDCFVNGCDGSIL  80

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LDD ++F GEKTA  N NS RG++VID IK+ +E  C G+VSCADI+ IAARDS V L G
Sbjct  81    LDDNATFTGEKTAGPNANSARGFDVIDTIKTQVEAACSGVVSCADILTIAARDSIVELQG  140

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P W V LGRRDS TASLSAAN+   +PSP S+LS LI+SFQN GLST DLVALSG++TIG
Sbjct  141   PTWTVMLGRRDSPTASLSAANNN--IPSPASSLSTLITSFQNHGLSTKDLVALSGAHTIG  198

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNL  505
             +SRC  FR RIYN++N I A+FA   +  CP  +  GD+ L+PLD+ TP  FDN YY NL
Sbjct  199   QSRCAFFRTRIYNESN-INAAFATSVKPNCP--SAGGDNTLSPLDVVTPTTFDNKYYSNL  255

Query  504   INKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKN  325
               +KGLLHSDQ L+NGGSTDS V  YS N   F + FA AM+KMGNI PLTG+ G+IRKN
Sbjct  256   KVQKGLLHSDQQLFNGGSTDSQVTTYSTNQNSFFTDFAAAMVKMGNISPLTGTSGQIRKN  315

Query  324   CRKAN  310
             CRKAN
Sbjct  316   CRKAN  320



>ref|XP_008374548.1| PREDICTED: peroxidase 4-like isoform X2 [Malus domestica]
Length=317

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 234/307 (76%), Gaps = 8/307 (3%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++ VI +A+  E R+GASLLRLHF DCFV GCD S+
Sbjct  18    FLESN-CKLTQNFYKSKCPKALSIVQGVI-AAIKNETRVGASLLRLHFQDCFVNGCDASV  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AARDSTV LG
Sbjct  76    LLDDTSSFVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKV LGRRDS TAS SAAN+   LPSP SN+SALISSF  QGLS  DLVALSGS+TI
Sbjct  136   GPSWKVGLGRRDSTTASRSAANT--FLPSPTSNISALISSFSAQGLSLRDLVALSGSHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYND+  I A+FA+  Q  CPR     DDNLA LDL+TP  FDN YYKN
Sbjct  194   GLARCTTFRSRIYNDS-AIDATFAQSLQGICPRS--GNDDNLASLDLQTPTHFDNXYYKN  250

Query  507   LINKKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             L+ +KGLLHSDQ L+NG  STD+LV+ Y  N   F  HFA AM+KMGNI PLTGS+GEIR
Sbjct  251   LLKEKGLLHSDQELFNGTTSTDNLVQIYXNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIR  310

Query  330   KNCRKAN  310
              NCRK N
Sbjct  311   TNCRKVN  317



>ref|XP_009363835.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=318

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 238/307 (78%), Gaps = 7/307 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++  + +A+  E R+GASLLRLHFHDCFV GCD S+
Sbjct  18    FLESN-CKLTKNFYKSKCPKALSIVQEEVIAAIKNETRVGASLLRLHFHDCFVNGCDASV  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AAR+STV LG
Sbjct  77    LLDDTSSFVGEKTAVPNNNSIRGFEVVDRIKAKLEKACPGVVSCADLLALAARESTVYLG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W+V LGRRDS TAS SAAN+   +P P SN+SALISSF  QGLS  DLVAL+G++TI
Sbjct  137   GPPWEVGLGRRDSTTASRSAANTS--IPPPTSNISALISSFSAQGLSLRDLVALAGAHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYN++ TI A+FAK  QR CPR +GS D+NLA LDL+TP  FDN YYKN
Sbjct  195   GRARCTSFRSRIYNES-TINAAFAKSLQRSCPR-SGS-DNNLASLDLQTPTHFDNLYYKN  251

Query  507   LINKKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             L+ +KGLLHSD  LYNG  ST+ LVKKY+ N  +F  HFA+AM+KMGNI  LTGS+GEIR
Sbjct  252   LLKEKGLLHSDNELYNGTSSTEKLVKKYANNTFVFFKHFAKAMVKMGNIHLLTGSQGEIR  311

Query  330   KNCRKAN  310
              NCRK N
Sbjct  312   TNCRKVN  318



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 238/302 (79%), Gaps = 6/302 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             SSA+L++NFYS +CP +   IK+ + SA+ +E RMGASLLRLHFHDCFV GCD S+LLDD
Sbjct  19    SSAELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDD  78

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF GEKTA  N+ S+RG++VID IK+ +E  C G+VSCADI+A+AARDS V LGGP+W
Sbjct  79    TSSFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSW  138

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              V LGRRDS TASLSAAN+   +P+P  NLS+LISSF N+G ++ ++VALSGS+TIG++R
Sbjct  139   NVLLGRRDSTTASLSAANND--IPAPTLNLSSLISSFSNKGFNSREMVALSGSHTIGQAR  196

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FRDR+YN+TN I +SF    +  CP+    GD+NL+PLD  +P  FDN YYKNL ++
Sbjct  197   CTTFRDRLYNETN-INSSFGTTIKANCPQN--GGDNNLSPLD-TSPTSFDNVYYKNLQSQ  252

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KG+LHSDQ L+NGGSTDS+V  YS N A F + FA AM+KMGN+ PLTG+ G+IRKNCRK
Sbjct  253   KGILHSDQQLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRK  312

Query  315   AN  310
              N
Sbjct  313   IN  314



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 237/302 (78%), Gaps = 6/302 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             SSA+L++NFYS +CP +   IK+ + SA+ +E RMGASLLRLHFHDCFV GCD S+LLDD
Sbjct  19    SSAELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDD  78

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF GEKTA  N+ S+RG++VID IK+ +E  C G+VSCADI+A+AARDS V LGGP+W
Sbjct  79    TSSFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSW  138

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              V LGRRDS TASLSAAN+   +P+P  NLS+LISSF N+G +  ++VALSGS+TIG++R
Sbjct  139   NVLLGRRDSTTASLSAANND--IPAPTLNLSSLISSFSNKGFNAREMVALSGSHTIGQAR  196

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FRDR+YN+TN I +SF    +  CP+    GD+NL+PLD  +P  FDN YYKNL ++
Sbjct  197   CTTFRDRLYNETN-INSSFGTSIKANCPQN--GGDNNLSPLD-TSPTTFDNAYYKNLQSQ  252

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KG+LHSDQ L+NGGSTDS+V  YS N A F + FA AM+KMGN+ PLTG+ G+IRKNCRK
Sbjct  253   KGILHSDQQLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRK  312

Query  315   AN  310
              N
Sbjct  313   NN  314



>ref|XP_009369253.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=318

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 238/307 (78%), Gaps = 7/307 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++  + +A+  E R+GASLLRLHFHDCFV GCD S+
Sbjct  18    FLESN-CKLTKNFYKSKCPKALSIVQEEVIAAIKNETRVGASLLRLHFHDCFVNGCDASV  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTS+F GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AAR+STV LG
Sbjct  77    LLDDTSTFVGEKTAVPNNNSIRGFEVVDRIKAKLEKACPGVVSCADLLALAARESTVYLG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP WKV LGRRDS TAS SAAN+   +P P SN+SALISSF  QGLS  DLVAL+G++TI
Sbjct  137   GPPWKVGLGRRDSTTASRSAANTS--IPPPTSNISALISSFSAQGLSLRDLVALAGAHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYN++ TI A+FAK  QR CPR +GS D+NLA LDL+TP  FDN YYKN
Sbjct  195   GRARCTSFRSRIYNES-TINAAFAKSLQRSCPR-SGS-DNNLASLDLQTPTHFDNLYYKN  251

Query  507   LINKKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             L+ +KGLLHSD  LYNG  ST+ LVKKY+ N  +F  HFA+AM+KMGNI  LTG++GEIR
Sbjct  252   LLKEKGLLHSDNELYNGTSSTEKLVKKYANNTFVFFKHFAKAMVKMGNIHLLTGTQGEIR  311

Query  330   KNCRKAN  310
              NCRK N
Sbjct  312   TNCRKVN  318



>ref|XP_004977590.1| PREDICTED: cationic peroxidase 1-like [Setaria italica]
Length=317

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 229/301 (76%), Gaps = 5/301 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQL+ NFY KSCP    TI++ +KSA+ +E RMGASLLRLHFHDCFV GCDGS+LLDDT
Sbjct  22    SAQLTANFYDKSCPNALYTIQTAVKSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDT  81

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
              +F GEKTA  NNNS+RG++VID IK+ IE +CP +VSCADI+A+AARDS V LGGP W 
Sbjct  82    PTFTGEKTAVPNNNSIRGFDVIDSIKAQIEGICPQVVSCADILAVAARDSVVTLGGPTWV  141

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V LGRRDS TASL AAN+   +P P  +LS L  SF N+GL+ TD++ALSG +TIG++RC
Sbjct  142   VNLGRRDSTTASLDAANND--IPKPTFDLSDLTKSFSNKGLTATDMIALSGGHTIGQARC  199

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
               FR+RIY++ N I  S A   +  CP KT  GD+N++PLD  TP  FDN YYKNL+NKK
Sbjct  200   VNFRNRIYSEAN-IDTSLATSLKSNCPNKT--GDNNISPLDASTPYVFDNFYYKNLLNKK  256

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             G+LHSDQ L+NGGS DS    YS N A F + F+ AM+KMGNI PLTGS G+IRKNCRK 
Sbjct  257   GVLHSDQQLFNGGSADSQTTTYSSNMAKFFTDFSAAMVKMGNISPLTGSSGQIRKNCRKV  316

Query  312   N  310
             N
Sbjct  317   N  317



>gb|KDO41520.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=298

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 231/306 (75%), Gaps = 27/306 (9%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             F   SSAQLSTNFYSK+CP L  T+KS ++SA+ +E+RMGASLLRLHFHDCFV GCDGSI
Sbjct  20    FTGKSSAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSI  79

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKT+  N NS RG+ V+DDIKS                          LG
Sbjct  80    LLDDTSSFTGEKTSGPNINSARGFEVVDDIKSK-------------------------LG  114

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+W VKLGRRDSKTASL+AANS GV+P P S LS LI+ FQ +GLS  D+VALSG++TI
Sbjct  115   GPSWNVKLGRRDSKTASLAAANS-GVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTI  173

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G++RC  FR+RIYN++N I +SFAK R+  CPR TGSGD+NLAPLD ++P  FDN YYK+
Sbjct  174   GQARCVAFRNRIYNESN-IESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYKH  232

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+N+KGLLHSDQ L+NGGSTDSLV  Y+ N   FNS FA AMIKMG+I PLTGS GEIRK
Sbjct  233   LLNQKGLLHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGEIRK  292

Query  327   NCRKAN  310
             NCR+ N
Sbjct  293   NCRRPN  298



>ref|XP_007011215.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY20025.1| Peroxidase superfamily protein isoform 1 [Theobroma cacao]
Length=317

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 234/300 (78%), Gaps = 7/300 (2%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
             +LS N+YS +CP +   +K  ++ A+ +E RMGASLLRLHFHDCFV GCDGS+LLDDT++
Sbjct  24    KLSPNYYSSTCPEVLSIVKERVRVAIKKEARMGASLLRLHFHDCFVNGCDGSLLLDDTAT  83

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F GEKTA  NNNSVRG+ V+DDIK+ +EK CPG+VSCADI+AIAARDST +LGGP+W+VK
Sbjct  84    FIGEKTAAPNNNSVRGFYVVDDIKAKVEKACPGVVSCADILAIAARDSTAMLGGPSWEVK  143

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             LGRRDS TAS +AAN+   +P+P  N+S L+ SF  QGLS  DLVALSGS+TIG +RCT 
Sbjct  144   LGRRDSTTASRAAANNS--IPAPTFNISGLLLSFAAQGLSLEDLVALSGSHTIGLARCTS  201

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNL-APLDLETPAFFDNNYYKNLINKKG  490
             FR  IYND+N I ASFAK  QRKCP+   SG DN+  PLD +TP  FDN YY NL+  KG
Sbjct  202   FRTHIYNDSN-IDASFAKSLQRKCPK---SGKDNVHQPLDFQTPTSFDNLYYHNLLKMKG  257

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LLHSDQ L+NG S D LV++Y+ + + F   FA++MIKMG+I+PLTGS GEIR NCRK N
Sbjct  258   LLHSDQELFNGASADCLVEEYAADTSAFFKAFAKSMIKMGDIKPLTGSSGEIRTNCRKVN  317



>ref|XP_009132056.1| PREDICTED: peroxidase 68-like [Brassica rapa]
Length=324

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/302 (62%), Positives = 231/302 (76%), Gaps = 1/302 (0%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             S AQLS++FY +SCP LF  ++  ++ A+  E+RM ASLLRL FHDCFV GCDGSILLDD
Sbjct  24    SHAQLSSDFYKESCPSLFYAVRREVQRAVTRERRMAASLLRLFFHDCFVNGCDGSILLDD  83

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSS  GEKTA  NNNSVRG++V+D IKS +E++CPG+VSCADI+AI ARDS +LL GP W
Sbjct  84    TSSSMGEKTAGPNNNSVRGFDVVDKIKSRVERLCPGVVSCADILAIIARDSVLLLDGPGW  143

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              VKLGRRDS TAS + ANS GV+P P S L  LI+ F+ QGLS+ D+VALSG++TIG++R
Sbjct  144   SVKLGRRDSTTASFTTANS-GVIPPPTSTLDNLINRFRAQGLSSRDMVALSGAHTIGQAR  202

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             C  FRDRIYN++N I  SFA  RQR C   +GS D+N A LD+ +P  FD NYY+ L+N 
Sbjct  203   CVTFRDRIYNESNNIELSFALSRQRSCSAASGSSDNNEATLDIHSPGRFDLNYYRQLLNH  262

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             +GLL SDQ LY+GGSTDSLV  YS++   F   F R M+KMG+I+PLTGS GEIR NCR+
Sbjct  263   RGLLTSDQVLYSGGSTDSLVVSYSRSLNAFYRDFVRGMVKMGDIKPLTGSSGEIRNNCRR  322

Query  315   AN  310
              N
Sbjct  323   PN  324



>gb|KHN48387.1| Peroxidase 52 [Glycine soja]
Length=265

 Score =   388 bits (997),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/268 (71%), Positives = 221/268 (82%), Gaps = 3/268 (1%)
 Frame = -2

Query  1113  MGASLLRLHFHDCFVQGCDGSILLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVC  934
             MGASLLRL FHDCFV GCDGSILLDDTSSF GEK A  N NS RGY VID+IKSA+EK C
Sbjct  1     MGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRNSARGYEVIDNIKSAVEKAC  60

Query  933   PGIVSCADIVAIAARDSTVLLGGPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALI  754
             PG+VSCADI+AIAARDS  +LGGP+W VK+GRRD++TAS SAAN+   +P P SNL+ LI
Sbjct  61    PGVVSCADILAIAARDSVQILGGPSWNVKVGRRDARTASQSAANNG--IPPPTSNLNQLI  118

Query  753   SSFQNQGLSTTDLVALSGSYTIGESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSG  574
             S F   GLST DLVALSG +TIG++RCT FR RIYN++N I  +FA+ RQ+ CPR +GSG
Sbjct  119   SRFSALGLSTKDLVALSGGHTIGQARCTNFRARIYNESN-IDTAFARTRQQSCPRTSGSG  177

Query  573   DDNLAPLDLETPAFFDNNYYKNLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHF  394
             D+NLAPLDL+TP  FDN Y+KNL+ KKGLLHSDQ L+NGGSTDS+V+ YS NP+ F+S F
Sbjct  178   DNNLAPLDLQTPTEFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPSSFSSDF  237

Query  393   ARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             A AMIKMG+I PLTGS GEIRKNCR+ N
Sbjct  238   AAAMIKMGDISPLTGSNGEIRKNCRRIN  265



>ref|XP_003519284.1| PREDICTED: peroxidase 4 [Glycine max]
 gb|KHN46096.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 234/307 (76%), Gaps = 7/307 (2%)
 Frame = -2

Query  1224  LDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSIL  1045
             + SSSAQLS NFY   CP +F  +KSV++SAL +E R GAS++RL FHDCFV GCDGS+L
Sbjct  23    IGSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVL  82

Query  1044  LDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGG  865
             LD  SS   EKTA  NNNS+RGY VID IKS +E VCPG+VSCADIV IAARDS  +LGG
Sbjct  83    LDGPSS---EKTAPPNNNSLRGYEVIDAIKSKVETVCPGVVSCADIVTIAARDSVAILGG  139

Query  864   PNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIG  685
             P WKVKLGRRDS T   + A+S GVLP P S+LS LI  F +QGLST D+VALSG++TIG
Sbjct  140   PYWKVKLGRRDSTTGFFNLASS-GVLPGPGSSLSDLIKRFDDQGLSTKDMVALSGAHTIG  198

Query  684   ESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGS--GDDNLAPLDLETPAFFDNNYYK  511
             ++RC  +R RIYN+ N I + FAK RQ+ CP+ +     D+N+APLD +TP  FDN Y+K
Sbjct  199   KARCASYRGRIYNENN-IDSLFAKARQKNCPKGSNGTPKDNNVAPLDFKTPNHFDNEYFK  257

Query  510   NLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             NLINKKGLLHSDQ L+NGGSTDSLV+ YS N   F + F  AMIKMGNI+PLTGS G+IR
Sbjct  258   NLINKKGLLHSDQELFNGGSTDSLVRAYSNNQKAFEADFVTAMIKMGNIKPLTGSNGQIR  317

Query  330   KNCRKAN  310
             K CR+ N
Sbjct  318   KQCRRPN  324



>gb|EPS58134.1| anionic peroxidase swpb3, partial [Genlisea aurea]
Length=315

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 190/304 (63%), Positives = 236/304 (78%), Gaps = 4/304 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             SSSAQLS ++Y  SCP LF T++SV++SA+  E R+GAS+LRL FHDCFV GCDGSILLD
Sbjct  15    SSSAQLSYDYYWDSCPDLFPTVRSVVRSAIQAEPRIGASILRLFFHDCFVNGCDGSILLD  74

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             D  +F GEK A  N NS RG+ V+D IK+A+E VCPG+VSCADI+A+A+RDS  +LGGP 
Sbjct  75    DGPNFVGEKGATPNRNSARGFEVVDRIKAAVEYVCPGVVSCADILAVASRDSVEILGGPG  134

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRD+KTASL+AANS   +P P SNL+AL++SF + GLS  DLV LSGS+TIG++
Sbjct  135   WDVKLGRRDAKTASLAAANSN--IPPPRSNLTALVTSFASHGLSVRDLVVLSGSHTIGQA  192

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYN+TN I    A+ R+  CP   G+GD+NLAPLD +TP  FDN Y++NL++
Sbjct  193   RCTSFRPRIYNETN-IEPYLARIRKYNCPEINGTGDNNLAPLDPQTPTRFDNFYFRNLVD  251

Query  498   KKGLLHSDQALYN-GGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNC  322
             K GLLHSDQ L+N GGSTD LV+ Y++NP  F   F  AMI+MG+I+PLTG  GEIR NC
Sbjct  252   KAGLLHSDQELFNGGGSTDWLVRYYAENPYAFLRDFPTAMIRMGDIKPLTGFAGEIRANC  311

Query  321   RKAN  310
             RK N
Sbjct  312   RKVN  315



>ref|XP_009408894.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=318

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 190/299 (64%), Positives = 229/299 (77%), Gaps = 5/299 (2%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
             QLS  FY  +CP L   ++S ++ A+++E RMGAS+LRL FHDCFV GCDGSILLDDTSS
Sbjct  25    QLSPTFYGSTCPNLQSIVRSAMRQAVNKEPRMGASILRLFFHDCFVNGCDGSILLDDTSS  84

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F GEK+A  N NS RG+ VID IKS +E  C   VSCADI+A+AARD  VLLGGP W V+
Sbjct  85    FTGEKSAGPNANSARGFEVIDTIKSNVEAACKATVSCADILALAARDGVVLLGGPTWTVQ  144

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             LGRRD+ TAS SAANS   LP P S+LS LISSF  +GLS  D+ ALSG++TIG++RCT 
Sbjct  145   LGRRDATTASQSAANSN--LPGPGSSLSQLISSFAAKGLSARDMTALSGAHTIGQARCTS  202

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGL  487
             FR  IYND N + ASFA  R++ CP  +  GD NLAPLDL+TP  FDN YY+NL+ +KGL
Sbjct  203   FRSHIYNDAN-VNASFAALRKQNCP--SSGGDGNLAPLDLQTPTTFDNKYYQNLVVRKGL  259

Query  486   LHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LHSDQ L+NGGS DSLV++YS NPA+FN  F  AM+KMGNI PLTG++G+IR NCRKAN
Sbjct  260   LHSDQELFNGGSQDSLVQQYSTNPAVFNGDFTAAMVKMGNISPLTGTKGQIRLNCRKAN  318



>ref|XP_004240055.1| PREDICTED: cationic peroxidase 1-like [Solanum lycopersicum]
Length=317

 Score =   390 bits (1001),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/302 (64%), Positives = 240/302 (79%), Gaps = 5/302 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             SSAQL++NFY+ SCP +   IK+ + SA+ +E RMGASLLRLHFHDCFV GCD S+LLDD
Sbjct  21    SSAQLTSNFYNSSCPNVLSIIKTAVNSAIAKESRMGASLLRLHFHDCFVNGCDASVLLDD  80

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             TSSF GEKTA  N+ S+RG++VID IK+ IE  C G+VSCADI+A+AARDS V LGGP+W
Sbjct  81    TSSFTGEKTANPNSGSLRGFDVIDTIKTQIESSCAGVVSCADILAVAARDSVVKLGGPSW  140

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              V LGRRDS TASLS ANS   +P+P  NLS+LISSF N+G +T ++VALSGS+TIG++R
Sbjct  141   TVLLGRRDSTTASLSNANSD--IPAPTLNLSSLISSFSNKGFNTREMVALSGSHTIGQAR  198

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FRDR++N+T+ I ASFA   + KCP ++GS D+N++PLD  +P  FDN YYKNL  +
Sbjct  199   CTTFRDRLHNETD-INASFATSIKSKCP-QSGS-DNNVSPLDTTSPTTFDNIYYKNLRIQ  255

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L +GGSTDS+V  YS N A F + FA+AM+KMGN+ PLTG+ G+IRKNCRK
Sbjct  256   KGLLHSDQQLSSGGSTDSIVNTYSSNSATFLADFAKAMVKMGNLSPLTGTNGQIRKNCRK  315

Query  315   AN  310
              N
Sbjct  316   TN  317



>ref|XP_006387938.1| hypothetical protein POPTR_0466s00210g [Populus trichocarpa]
 gb|ERP46852.1| hypothetical protein POPTR_0466s00210g [Populus trichocarpa]
Length=316

 Score =   390 bits (1001),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 231/300 (77%), Gaps = 5/300 (2%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             A+LS+ FY KSCP     I++ I++A+  E+RM ASL+RLHFHDCFVQGCD SILLD+TS
Sbjct  22    AKLSSAFYDKSCPKAESAIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETS  81

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             S + EKTA  NNNSVRGY VID  KS +EK+CPG+VSCADI+A+AARD++  +GGP+W V
Sbjct  82    SIQSEKTAGGNNNSVRGYEVIDKAKSKVEKICPGVVSCADIIAVAARDASAYVGGPSWAV  141

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             K GRRDS TAS + AN+   LP+ F  L  LIS FQ +GL+  D+VALSGS+T+G+++C 
Sbjct  142   KFGRRDSTTASRTLANAE--LPAFFDRLDRLISRFQKKGLTARDMVALSGSHTLGQAQCF  199

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FRDRIYN +N I A FA  R+R+CPR    G  NLAPLDL TP  FDNNY+KNL+  KG
Sbjct  200   TFRDRIYNASN-IDAGFASTRKRRCPR--AGGQANLAPLDLVTPNSFDNNYFKNLMRNKG  256

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LL SDQ L+NGGSTDS+V +YS+NPA F+S FA AMIKMG+IRPLTGS G+IR+ C   N
Sbjct  257   LLQSDQVLFNGGSTDSIVSEYSRNPAKFSSDFASAMIKMGDIRPLTGSAGQIRRICSAVN  316



>pdb|1SCH|A Chain A, Peanut Peroxidase
 pdb|1SCH|B Chain B, Peanut Peroxidase
Length=294

 Score =   389 bits (998),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 228/298 (77%), Gaps = 5/298 (2%)
 Frame = -2

Query  1203  LSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF  1024
             LS+NFY+  CP    TIKS + SA+ +E RMGASLLRLHFHDCFVQGCD S+LLDDTS+F
Sbjct  2     LSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSNF  61

Query  1023  KGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVKL  844
              GEKTA  N NS+RG+ VID IKS +E +CPG+VSCADI+A+AARDS V LGG +W V L
Sbjct  62    TGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLL  121

Query  843   GRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTIF  664
             GRRDS TASLS+ANS   LP+PF NLS LIS+F N+G +T +LV LSG++TIG+++CT F
Sbjct  122   GRRDSTTASLSSANSD--LPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAF  179

Query  663   RDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGLL  484
             R RIYN++N I  ++AK  Q  CP  +  GD NL+P D+ TP  FDN YY NL NKKGLL
Sbjct  180   RTRIYNESN-IDPTYAKSLQANCP--SVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGLL  236

Query  483   HSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             HSDQ L+NG STDS V  YS N A FN+ F  AMIKMGN+ PLTG+ G+IR NCRK N
Sbjct  237   HSDQQLFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  294



>ref|NP_001169614.1| uncharacterized protein LOC100383495 precursor [Zea mays]
 gb|ACN34270.1| unknown [Zea mays]
Length=332

 Score =   390 bits (1002),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 235/306 (77%), Gaps = 6/306 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSAQLST FYS SCP +   ++SV+++A+  E+RMGAS+LRL FHDCFVQGCD S+LLD
Sbjct  30    TSSAQLSTGFYSHSCPGVHDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLLLD  89

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT SF+GEK A  NN SVRG+ VID IKSA++K CPG+VSCADI+AIAARDS V LGGPN
Sbjct  90    DTPSFQGEKMAKPNNGSVRGFEVIDAIKSAVDKACPGVVSCADILAIAARDSVVTLGGPN  149

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W VKLGRRDS+TAS S AN+   +P P S L+ L S F  QGLS  D+VALSG++TIG++
Sbjct  150   WDVKLGRRDSRTASFSGANNN--IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  207

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGS---GDDNLAPLDLETPAFFDNNYYKN  508
             RCT FR  +YNDTN I  +FA+ R+  CP    S   GD+NLAPLDL+TP  F+N+YY+N
Sbjct  208   RCTNFRAHVYNDTN-IDGAFARARRSVCPAAASSGSGGDNNLAPLDLQTPTVFENDYYRN  266

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             L+ +KGLLHSDQ L+NG +TD+ V+ Y  + + F + F   M+KMG+I PLTGS GEIRK
Sbjct  267   LVCRKGLLHSDQELFNGAATDAQVQAYVSSQSAFFADFVAGMVKMGDISPLTGSSGEIRK  326

Query  327   NCRKAN  310
             NCR+ N
Sbjct  327   NCRRIN  332



>ref|XP_010664359.1| PREDICTED: cationic peroxidase 1 isoform X3 [Vitis vinifera]
Length=316

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 234/306 (76%), Gaps = 6/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              L  + AQLS+NFY+ SCP    TI++ + +A+ +E+RMGASLLRLHFHDCFV GCD SI
Sbjct  16    LLGMAHAQLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASI  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT++F GEKTA  NNNSVRGY+VID IKS +E +CPG+VSCADIVA+AARDS V LG
Sbjct  76    LLDDTANFTGEKTAGPNNNSVRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W V+LGRRDS TAS S ANS   LP+P S+L ALIS F N+G +T ++V LSG++TI
Sbjct  136   GPTWTVQLGRRDSTTASFSTANSD--LPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G+++C+ FRDRIYN+TN I A+FA  +Q  CP  +  GD+NL+ LD ET   FDN Y+ N
Sbjct  194   GKAQCSKFRDRIYNETN-IDATFATSKQAICP--SSGGDENLSDLD-ETTTVFDNVYFTN  249

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI KKGLLHSDQ LYNG STDS+V+ YS +   F +  A AM+KMGN+ PLTG+ GEIR 
Sbjct  250   LIEKKGLLHSDQQLYNGNSTDSMVETYSNDSTTFFTDVASAMVKMGNLSPLTGTDGEIRT  309

Query  327   NCRKAN  310
             NCR  N
Sbjct  310   NCRAIN  315



>ref|XP_004302590.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=317

 Score =   389 bits (1000),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 183/302 (61%), Positives = 237/302 (78%), Gaps = 5/302 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLS+ FYS SCP    TIKS + SA+  E RMGASLLRLHFHDCFV GCD S+LLDD
Sbjct  21    ASAQLSSTFYSSSCPKALATIKSAVDSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDD  80

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T++F GEKTA AN NS+RG++V+D IKS +E +CPG+ SC+DI+A+AARDS V LGGP+W
Sbjct  81    TANFTGEKTAGANANSLRGFDVVDTIKSQLESLCPGVFSCSDILAVAARDSVVALGGPSW  140

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              V+LGRRDS TASLSAAN+   +P+P  NLSAL++SF N+G +  +LVALSGS+TIG++R
Sbjct  141   TVQLGRRDSTTASLSAANTN--IPAPTLNLSALLTSFSNKGFNAKELVALSGSHTIGQAR  198

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CT FR R+YN+ N I +SFA   +  CP  +  GD NL+PLD+ TP  FDN Y+KNL+++
Sbjct  199   CTTFRARLYNEAN-IDSSFATSLKANCP--SSGGDANLSPLDVTTPNKFDNAYFKNLVSQ  255

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             KGLLHSDQ L++GGST++ V  Y  NP  F++ FA+AM+KMGN+ PLTG+ G+IR +C+K
Sbjct  256   KGLLHSDQQLFSGGSTNAQVNAYVSNPGTFSTDFAKAMVKMGNLSPLTGTNGQIRTDCKK  315

Query  315   AN  310
              N
Sbjct  316   VN  317



>ref|XP_010261061.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=317

 Score =   389 bits (1000),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 232/302 (77%), Gaps = 5/302 (2%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +SAQLS NFY+ SCP     I+S +  A+  E+RMGASLLRLHFHDCFV GCD SILLDD
Sbjct  21    ASAQLSPNFYASSCPRALSIIRSAVSIAVARERRMGASLLRLHFHDCFVNGCDASILLDD  80

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
              S+F GEKTA  N NSVRG++V+D IKS +E  CPG+VSCADI+A+AARDS V LGG +W
Sbjct  81    NSTFTGEKTAAPNANSVRGFDVVDTIKSQLESACPGVVSCADILAVAARDSVVALGGSSW  140

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              V+LGRRDS TASL+AAN+   LPSPFS+LSAL+S+F N+G +  +LVALSGS+TIG++R
Sbjct  141   TVQLGRRDSTTASLNAANNN--LPSPFSDLSALLSAFSNKGFTAKELVALSGSHTIGQAR  198

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINK  496
             CTIFR RIYN+TN I +++A   +  CP  +  GD+NLA LD  T   FDN Y+ NL+N 
Sbjct  199   CTIFRSRIYNETN-INSAYATSLKANCP--SSGGDNNLAGLDASTSTVFDNAYFTNLLNN  255

Query  495   KGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             +GLLHSDQ L++GGSTD+ V+ YS N A F S F  AMIKMGN+ PLTG+ G+IR NCRK
Sbjct  256   RGLLHSDQQLFSGGSTDAQVRAYSSNSATFLSDFGNAMIKMGNLSPLTGTSGQIRNNCRK  315

Query  315   AN  310
              N
Sbjct  316   VN  317



>ref|XP_008374568.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   389 bits (999),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 233/307 (76%), Gaps = 7/307 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
             FL+S+  +L+ NFY   CP     ++  + +A+  E R+GASLLRLHFHDCFV GCD S+
Sbjct  18    FLESN-CKLTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASV  76

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDTSSF GEKTA  NNNS+RG+ V+D IK+ +EK CPG+VSCAD++A+AARDSTV LG
Sbjct  77    LLDDTSSFVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLG  136

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP+WKV LGRRDS TAS SAAN+   +P P SN+SALISSF  QGLS  DLVALSGS+TI
Sbjct  137   GPSWKVGLGRRDSTTASRSAANTS--IPPPTSNISALISSFSAQGLSIRDLVALSGSHTI  194

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RCT FR RIYND+  I A+FA+  Q  CPR     D+NLA LDL+TP  FDN YYKN
Sbjct  195   GLARCTSFRSRIYNDS-AIDATFAQSLQGICPRS--GNDNNLASLDLQTPTHFDNKYYKN  251

Query  507   LINKKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIR  331
             L+ +KGLLHSDQ L+NG  STD LV+ Y+ N   F  HFA AM+KMGNI PLTGS+GEIR
Sbjct  252   LLKEKGLLHSDQELFNGTTSTDKLVQIYANNTLTFFKHFAVAMVKMGNIDPLTGSQGEIR  311

Query  330   KNCRKAN  310
              NCRK N
Sbjct  312   TNCRKVN  318



>ref|NP_001130666.1| uncharacterized protein LOC100191769 precursor [Zea mays]
 gb|ACF78975.1| unknown [Zea mays]
 gb|AFW65995.1| hypothetical protein ZEAMMB73_708588 [Zea mays]
Length=324

 Score =   389 bits (998),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/299 (63%), Positives = 232/299 (78%), Gaps = 3/299 (1%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
             QLS++FY+ +CP L   +++ + +AL  E+RMGASL+RL FHDCFVQGCDGSILLDD  S
Sbjct  27    QLSSSFYAATCPTLELIVRTTMLTALLAERRMGASLVRLFFHDCFVQGCDGSILLDDVGS  86

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F GEK A  N NS+RG++VID IK+ +E +CPG+VSCADIVA+AARD T LLGGP+W V 
Sbjct  87    FVGEKGAGPNVNSLRGFDVIDQIKANVELICPGVVSCADIVALAARDGTFLLGGPSWAVP  146

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             LGRRDS TASL+ ANS   LPSP S L+AL+++F N+GL   DL ALSG++TIG S+C  
Sbjct  147   LGRRDSTTASLALANSD--LPSPVSGLAALLAAFGNKGLGPGDLTALSGAHTIGFSQCQN  204

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGL  487
             FR  IYNDT+ I  +FA  RQR CP   G+GD +LAPLD++T   FDN YY+NL+ K+GL
Sbjct  205   FRAHIYNDTD-IDPAFASLRQRTCPAAPGTGDSSLAPLDVQTQLVFDNAYYRNLLAKRGL  263

Query  486   LHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             L SDQAL+NGGS D+LV++YS NPALF S FA AMIKMGNI PLTG+ G+IR NCR  N
Sbjct  264   LRSDQALFNGGSQDALVRQYSANPALFASDFANAMIKMGNISPLTGTAGQIRANCRVVN  322



>ref|XP_006378808.1| hypothetical protein POPTR_0010s24340g [Populus trichocarpa]
 ref|XP_006387937.1| Peroxidase 5 precursor family protein [Populus trichocarpa]
 gb|ERP46851.1| Peroxidase 5 precursor family protein [Populus trichocarpa]
 gb|ERP56605.1| hypothetical protein POPTR_0010s24340g [Populus trichocarpa]
 gb|AHL39167.1| class III peroxidase [Populus trichocarpa]
Length=317

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 232/300 (77%), Gaps = 5/300 (2%)
 Frame = -2

Query  1209  AQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  1030
             A+LS+ FY KSCP     I++ I++A+  E+RM ASL+RLHFHDCFVQGCD SILLD+TS
Sbjct  23    AKLSSAFYHKSCPKAESAIRTAIRTAIARERRMAASLIRLHFHDCFVQGCDASILLDETS  82

Query  1029  SFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKV  850
             S + EKTA  NNNSVRGY VID  KS +EK+CPG+VSCADI+A+AARD++  +GGP+W V
Sbjct  83    SIQSEKTAGGNNNSVRGYEVIDKAKSKVEKICPGVVSCADIIAVAARDASAYVGGPSWAV  142

Query  849   KLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCT  670
             KLGRRDS TAS + A +   LP+ F +L  LIS FQ +GL+  D+VALSGS+T+G+++C 
Sbjct  143   KLGRRDSTTASPALAITE--LPAFFDDLGRLISRFQQKGLTARDMVALSGSHTLGQAQCF  200

Query  669   IFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKG  490
              FRDRIYN +N I A FA  R+R+CPR    G  NLAPLDL TP  FDNNY+KNL+  KG
Sbjct  201   TFRDRIYNASN-IDAGFASTRKRRCPR--AGGQANLAPLDLVTPNSFDNNYFKNLMRNKG  257

Query  489   LLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LL SDQ L+NGGSTDS+V +YS+NPA F+S FA AMIKMG+IRPLTGS G+IR+ C   N
Sbjct  258   LLQSDQVLFNGGSTDSIVSEYSRNPAKFSSDFASAMIKMGDIRPLTGSAGQIRRICSAVN  317



>ref|XP_008463814.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=325

 Score =   389 bits (998),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/303 (63%), Positives = 228/303 (75%), Gaps = 5/303 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +SSA LS NFY KSCP L   +++ ++SA+ +E RMGASLLRLHFHDCFV GCDGSILLD
Sbjct  28    ASSAHLSPNFYHKSCPKLLSVVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSILLD  87

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT +F GE+TA  NN SVRG+NVI  IK  IEK+CP +VSCADI+ ++ARDS V LGGP+
Sbjct  88    DTPTFLGEQTAAPNNRSVRGFNVIASIKEKIEKICPDVVSCADILTLSARDSVVALGGPS  147

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             WKVKLGRRDSKTAS S  +  G +P P S L  LI+ F  +GLS  DLVALSG++TIG+ 
Sbjct  148   WKVKLGRRDSKTASFSDVS--GAIPPPTSTLPTLINRFSTKGLSPKDLVALSGAHTIGKP  205

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC  F++RIYN+TN I  SFAK+RQR CPR    GD+N +P D  TP  FDNNYYKNL+ 
Sbjct  206   RCLFFKNRIYNETN-IDKSFAKERQRNCPR--NGGDENRSPFDFRTPNLFDNNYYKNLVE  262

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KK LL SDQ L++GGSTDSLV+ YS + A F S F  AMIKMG+I PL G +GEIRK C 
Sbjct  263   KKALLRSDQVLHDGGSTDSLVELYSHDSAAFESDFVAAMIKMGDIEPLIGLQGEIRKVCS  322

Query  318   KAN  310
             + N
Sbjct  323   RPN  325



>gb|ABK23423.1| unknown [Picea sitchensis]
Length=318

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/299 (65%), Positives = 232/299 (78%), Gaps = 5/299 (2%)
 Frame = -2

Query  1206  QLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  1027
             QL++ FYS+SCP     +++ ++ A+ +E+RMGASLLRLHFHDCFV GCDGSILLDD S+
Sbjct  25    QLTSTFYSESCPRALSIVQAAVEQAVAKERRMGASLLRLHFHDCFVNGCDGSILLDDNST  84

Query  1026  FKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWKVK  847
             F GEKTA  NNNSVRGY+VID IK+ +E  C G+VSCADIVAIAARDS V LGGP W V 
Sbjct  85    FTGEKTATPNNNSVRGYDVIDTIKTQVEAACSGVVSCADIVAIAARDSVVALGGPTWTVL  144

Query  846   LGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRCTI  667
             LGRRDS TAS +AANS   +PSP SNLS LISSF++  LS  DLVALSG++TIG++RCT 
Sbjct  145   LGRRDSTTASFNAANSS--IPSPASNLSTLISSFRSHNLSPKDLVALSGAHTIGQARCTS  202

Query  666   FRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKKGL  487
             FR RIYN++N I  S A   + KCPR TG GD+ L+PLDL TP  FD +YY NL +KKGL
Sbjct  203   FRARIYNESN-IDTSLATAVKPKCPR-TG-GDNTLSPLDLATPITFDKHYYCNLRSKKGL  259

Query  486   LHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKAN  310
             LHSDQ L+NGGSTDS V  YS N   F + FA AM+ MGNI+PLTG+ G+IR+NCRK+N
Sbjct  260   LHSDQQLFNGGSTDSQVTTYSTNQNNFFTDFAAAMVNMGNIKPLTGTSGQIRRNCRKSN  318



>ref|XP_010256951.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=318

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 236/304 (78%), Gaps = 8/304 (3%)
 Frame = -2

Query  1215  SSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDD  1036
             +  +LS+N YS +CP     + + + +A+ +E R+GASLLRLHFHDCFV GCDGSILLDD
Sbjct  21    AQCKLSSNHYSSTCPEALSIVNNAVIAAIKKETRIGASLLRLHFHDCFVNGCDGSILLDD  80

Query  1035  TSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNW  856
             T+SF GEKTA  NNNSVRG++V+DDIKS +EK CPG+VSCADI+A+AARDS V LGGP+W
Sbjct  81    TASFTGEKTAVPNNNSVRGFDVVDDIKSRLEKKCPGVVSCADILALAARDSVVYLGGPSW  140

Query  855   KVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESR  676
              V+LGRRDS TA+L+AANS   +P+P SNLS L + F  +GLS  D+VALSGS+TIG +R
Sbjct  141   TVELGRRDSITANLTAANSD--IPAPTSNLSVLETRFAAKGLSVKDMVALSGSHTIGLAR  198

Query  675   CTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDN-LAPLDLETPAFFDNNYYKNLIN  499
             CT FR RIYND+N I  + A   QRKCPR   SG+DN LA LD +TP +FDN YYKNL+ 
Sbjct  199   CTTFRSRIYNDSN-IDGTLAMSLQRKCPR---SGNDNKLAGLDAQTPTYFDNYYYKNLLK  254

Query  498   KKGLLHSDQALYNG-GSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNC  322
              KGLLH+DQ L+NG  STDSLVKKY  NP+ F   FA+AM+KMGNI PLTGS GEIR NC
Sbjct  255   GKGLLHTDQELFNGSSSTDSLVKKYVGNPSKFFKDFAKAMVKMGNISPLTGSEGEIRFNC  314

Query  321   RKAN  310
             R+ N
Sbjct  315   RELN  318



>gb|AAD43561.1|AF155124_1 bacterial-induced peroxidase precursor [Gossypium hirsutum]
Length=316

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/303 (61%), Positives = 233/303 (77%), Gaps = 5/303 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +++AQLS NFY+ SCP L   +++ +  A++ E R+GAS+LRL FHDCFV GCDGSILLD
Sbjct  19    AANAQLSPNFYASSCPNLQTIVRNAMSRAVNRETRIGASILRLFFHDCFVNGCDGSILLD  78

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT++F GEK A  N NS RG+ VID IK+ +E  C   VSCADI+A+AARD   LLGGP 
Sbjct  79    DTATFTGEKNAVPNRNSARGFEVIDTIKTNVEAACSATVSCADILALAARDGVALLGGPT  138

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W+V LGRRD++TAS SAAN+   +PSPF+NL+ L SSF  +GLST DL ALSG +TIG +
Sbjct  139   WQVPLGRRDARTASQSAANNQ--IPSPFANLATLTSSFAAKGLSTRDLTALSGGHTIGLA  196

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR RIYNDTN I A+FA  R+  CP     GD+NLAPLD++TP  FDN+Y++NL+ 
Sbjct  197   RCTTFRGRIYNDTN-IDANFAATRRANCP--ASGGDNNLAPLDIQTPTRFDNDYFRNLVA  253

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             ++GLLHSDQ L+NGGS D+LV+ YS NPA F++ FA AM+KMGNI PLTG++GEIR+NCR
Sbjct  254   RRGLLHSDQELFNGGSQDALVRTYSNNPATFSADFAAAMVKMGNISPLTGTQGEIRRNCR  313

Query  318   KAN  310
               N
Sbjct  314   VVN  316



>gb|AAB02554.1| cationic peroxidase [Stylosanthes humilis]
Length=320

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 229/302 (76%), Gaps = 6/302 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             S QLS+NFY+  CP    TIKS + SA+ +E R+GASLLRLHFHDCFVQGCD S+LLDDT
Sbjct  24    SGQLSSNFYATKCPNALSTIKSAVNSAVSKEARLGASLLRLHFHDCFVQGCDASVLLDDT  83

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             S+F GEKTAF N NS RG++VID IKS +E +CPG+VSCADI+A+AARDS V LGGP+W 
Sbjct  84    STFTGEKTAFPNVNSARGFDVIDTIKSQVESLCPGVVSCADILALAARDSVVALGGPSWN  143

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V+LGRRDS TASL++ANS   LP P  NLS LIS+F  +G +  +LV LSG++TIG++RC
Sbjct  144   VQLGRRDSTTASLNSANSD--LPGPSFNLSGLISAFSKKGFTAKELVTLSGAHTIGQARC  201

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             T FR RIYN++N I  S+AK  Q  CP     GD NL+P D+ TP  FDN YY NL NKK
Sbjct  202   TTFRTRIYNESN-IDPSYAKSLQGNCPSV--GGDSNLSPFDVTTPNKFDNAYYINLKNKK  258

Query  492   GLLHSDQALYN-GGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRK  316
             GLLH+DQ L+N GGSTDS V  YS N A FN+ F  AMIKMGN+ PLTG+ G+IR NCRK
Sbjct  259   GLLHADQQLFNGGGSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRK  318

Query  315   AN  310
              N
Sbjct  319   TN  320



>ref|XP_007142064.1| hypothetical protein PHAVU_008G249500g [Phaseolus vulgaris]
 gb|AAD37428.1|AF149278_1 peroxidase 3 precursor [Phaseolus vulgaris]
 gb|ESW14058.1| hypothetical protein PHAVU_008G249500g [Phaseolus vulgaris]
Length=324

 Score =   388 bits (997),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 195/308 (63%), Positives = 236/308 (77%), Gaps = 7/308 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              + SSSAQLS NFY+K CP +   +KSV++SA+ +E RMGASLLRL FHDCFV GCDGS+
Sbjct  22    LIGSSSAQLSENFYAKKCPKVLYAVKSVVQSAVAKEPRMGASLLRLFFHDCFVNGCDGSV  81

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLD  SS   EKTA  N+ S+RGY VID IKS +E +CPGIVSCADIVAIAARDS  +LG
Sbjct  82    LLDGPSS---EKTAPPNDKSLRGYEVIDAIKSKVEALCPGIVSCADIVAIAARDSVNILG  138

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP WKVKLGRRDS T     A+S G LPSP S+L  LISSF++QGLS  D+VALSG++TI
Sbjct  139   GPFWKVKLGRRDSSTGFFQLASS-GALPSPASSLDTLISSFKDQGLSAKDMVALSGAHTI  197

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSG--DDNLAPLDLETPAFFDNNYY  514
             G++RC ++  RIYN+ N I + FAK RQ+ CPR +     D+N+APL+ +TP  FDNNYY
Sbjct  198   GKARCAVYGSRIYNEKN-IESLFAKARQKNCPRNSNGTPKDNNVAPLEFKTPNHFDNNYY  256

Query  513   KNLINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEI  334
             KNLINKKGLLHSDQ L++GGSTDSLV+ YS +   F S F  AMIKMGNI+PLTGS G+I
Sbjct  257   KNLINKKGLLHSDQVLFDGGSTDSLVRAYSNDQRAFESDFVTAMIKMGNIKPLTGSNGQI  316

Query  333   RKNCRKAN  310
             R+ C + N
Sbjct  317   RRLCGRPN  324



>gb|ABR18139.1| unknown [Picea sitchensis]
Length=327

 Score =   388 bits (997),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 233/303 (77%), Gaps = 5/303 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             S   QL  +FY KSCP +   + SV+  A+ +EKRMGASLLRLHFHDCFV GCDGSILLD
Sbjct  30    SVYGQLCPDFYDKSCPNVLSIVNSVVMQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLD  89

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DTS+F GEKTA  NNNSVRG++VID IK+ +E  C G+VSCADIVAIAARDS V LGGP 
Sbjct  90    DTSTFTGEKTANPNNNSVRGFDVIDTIKTQVEATCSGVVSCADIVAIAARDSVVQLGGPT  149

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W V LGRRDS +AS SAAN+   +P P SNLSALIS FQ QGL+T D+VALSGS+TIG++
Sbjct  150   WTVMLGRRDSTSASKSAANNN--IPPPTSNLSALISFFQAQGLTTEDMVALSGSHTIGQA  207

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT FR+RIYN++N IA  FA  R+  CP  TG GD+NLAPLDL TP  FDN+YY NL  
Sbjct  208   RCTNFRNRIYNESN-IALLFAGLRKANCP-VTG-GDNNLAPLDLFTPTAFDNSYYNNLQF  264

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             + GLLHSDQ L+ GGSTD+ V  Y+ +P  F + FA AM+KMGNI+PLT + GEIRKNCR
Sbjct  265   QNGLLHSDQQLFKGGSTDNRVSFYAVHPDAFFNDFAAAMVKMGNIKPLTVNNGEIRKNCR  324

Query  318   KAN  310
             K N
Sbjct  325   KIN  327



>ref|XP_006664869.1| PREDICTED: cationic peroxidase 1-like [Oryza brachyantha]
Length=317

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 232/301 (77%), Gaps = 5/301 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SAQLS NFY KSCP    TI++ ++SA+ +E RMGASLLRLHFHDCFV+GCDGS+LLDDT
Sbjct  22    SAQLSANFYDKSCPNALSTIRTAVRSAITKENRMGASLLRLHFHDCFVKGCDGSVLLDDT  81

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
              +F GEKTA  NNNS+RG++VID+IK+ IE +CP +VSCADI+A+AARDS V LGGP W 
Sbjct  82    PTFTGEKTAAPNNNSLRGFDVIDNIKAQIEGICPQVVSCADILAVAARDSVVALGGPTWV  141

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V+LGRRDS TASL AAN+   +P+P  +L  L  SF N+GLS TD++ALSG++TIG++RC
Sbjct  142   VQLGRRDSTTASLDAANND--IPAPTLDLGDLNKSFSNKGLSATDMIALSGAHTIGQARC  199

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
               FR+RIY++TN I +S A   +  CP  T  GD+N++PLD  TP  FDN YYKNL+ KK
Sbjct  200   VNFRNRIYSETN-IDSSLATSLKSNCPNTT--GDNNISPLDASTPYVFDNFYYKNLLKKK  256

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             G+LHSDQ L+NGGS DS    YS N A F + F+ AM+KM NI PLTGS G+IRKNCRK 
Sbjct  257   GVLHSDQQLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMSNITPLTGSSGQIRKNCRKV  316

Query  312   N  310
             N
Sbjct  317   N  317



>ref|XP_010041648.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 236/303 (78%), Gaps = 5/303 (2%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             ++SA+LS+ FY  SCP    TIKS + SA+  E RMGASLLRLHFHDCFV GCD SILLD
Sbjct  22    TASARLSSTFYFTSCPSALHTIKSGVNSAVSSEARMGASLLRLHFHDCFVNGCDASILLD  81

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             DT++F GEKTA AN+NS+RGY VID IKS +E  CPG+VSCADI+A+AARDS V LGGP+
Sbjct  82    DTTNFTGEKTAGANDNSIRGYEVIDTIKSQLESSCPGVVSCADILAVAARDSIVALGGPS  141

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W+V LGRRDS TASLSAANS   +P+P  +LS LI++F N+G +  ++VALSGS+TIG++
Sbjct  142   WRVLLGRRDSTTASLSAANSD--IPAPTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQA  199

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RCT F+ R+YN+++ I ++FA   +  CP  +  GD+NL+PLD  +P +FDN Y+KNL  
Sbjct  200   RCTTFQTRLYNESD-INSTFATSLKENCP--SSGGDNNLSPLDTTSPTYFDNAYFKNLQT  256

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             +KGLLHSDQ L++GGSTD+ V  YS N A F + FA AM+KMGN+ PLTGS G+IRKNCR
Sbjct  257   QKGLLHSDQQLFSGGSTDAQVNTYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCR  316

Query  318   KAN  310
             K N
Sbjct  317   KLN  319



>ref|XP_004242492.1| PREDICTED: cationic peroxidase 1 [Solanum lycopersicum]
Length=314

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/301 (61%), Positives = 236/301 (78%), Gaps = 5/301 (2%)
 Frame = -2

Query  1212  SAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLDDT  1033
             SA LS+++Y KSCP    TIK+ + +A+  E+RMGASLLRLHFHDCFV GCD S+LLDDT
Sbjct  19    SADLSSDYYEKSCPKAMYTIKNAVANAVTNERRMGASLLRLHFHDCFVNGCDASVLLDDT  78

Query  1032  SSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPNWK  853
             + F GEK+A  N+NS+RG++VID IKS IEK+CPGIVSCADI+A+AARDS VLLGGP+W 
Sbjct  79    TDFTGEKSAKPNSNSIRGFDVIDKIKSQIEKLCPGIVSCADIIAVAARDSVVLLGGPSWT  138

Query  852   VKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGESRC  673
             V+LGRRDS TASL  ANS   +PSP  +L+ LI++F N+G +  ++VALSG +TIG+++C
Sbjct  139   VELGRRDSTTASLDTANSD--IPSPSLDLNDLITNFANKGFTAKEMVALSGGHTIGKAQC  196

Query  672   TIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLINKK  493
             T FR R+YN+TN I +S A   +  CP  TG GDD L+ LD  TP  FDN++YKNL+N K
Sbjct  197   TTFRARVYNETN-IDSSLATSLKSNCP-STG-GDDTLSSLDATTPVLFDNHFYKNLVNNK  253

Query  492   GLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCRKA  313
             G+LHSDQ LY+GGSTDS VK YS NP  F++ FA+AM+K+GN+ PLTG+ G+IR NCRK 
Sbjct  254   GILHSDQQLYSGGSTDSQVKSYSTNPIAFDADFAKAMVKLGNLSPLTGTNGQIRTNCRKI  313

Query  312   N  310
             N
Sbjct  314   N  314



>ref|XP_002284007.1| PREDICTED: cationic peroxidase 1 isoform X2 [Vitis vinifera]
Length=316

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 233/306 (76%), Gaps = 6/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              L  + AQLS+++YS SCP    TI++ + +A+ +E RMGASLLRLHFHDCFV GCD SI
Sbjct  16    LLGMAHAQLSSDYYSSSCPSALSTIQTAVNNAVADESRMGASLLRLHFHDCFVLGCDASI  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT++F GEKTA  NNNSVRGY+VID IKS +E +CPG+VSCADIVA+AARDS V LG
Sbjct  76    LLDDTANFTGEKTAGPNNNSVRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             GP W V+LGRRDS TAS S ANS   LP+P S+L ALIS F N+G +T ++V LSG++TI
Sbjct  136   GPTWTVQLGRRDSTTASFSTANSD--LPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G+++C+ FRDRIYN+TN I A+FA  +Q  CP  +  GD+NL+ LD ET   FDN Y+ N
Sbjct  194   GKAQCSKFRDRIYNETN-IDATFATSKQAICP--SSGGDENLSDLD-ETTTVFDNVYFTN  249

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LI KKGLLHSDQ LYNG STDS+V+ YS +   F +  A AM+KMGN+ PLTG+ GEIR 
Sbjct  250   LIEKKGLLHSDQQLYNGNSTDSMVETYSNDSTTFFTDVASAMVKMGNLSPLTGTDGEIRT  309

Query  327   NCRKAN  310
             NCR  N
Sbjct  310   NCRAIN  315



>emb|CAL25300.1| properoxidase [Picea abies]
Length=310

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/303 (62%), Positives = 230/303 (76%), Gaps = 3/303 (1%)
 Frame = -2

Query  1218  SSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSILLD  1039
             +++ QLS+ FY++SCP     +K+ ++ A+  EKRMGASLLRLHFHDCFV GCDGS+LLD
Sbjct  11    TANGQLSSTFYAQSCPTALSVVKAAVRQAVANEKRMGASLLRLHFHDCFVNGCDGSVLLD  70

Query  1038  DTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLGGPN  859
             D+S+  GEKTA  N NS RG++VID IKS +EK C G+VSCADI+AI+ARDS V LGGP+
Sbjct  71    DSSTITGEKTANPNANSARGFDVIDTIKSNVEKACSGVVSCADILAISARDSVVELGGPS  130

Query  858   WKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTIGES  679
             W V LGRRDS TAS + AN+   +P P S+LS LIS FQ QGLST ++VALSG +TIG++
Sbjct  131   WTVMLGRRDSTTASKNGANNN--IPPPTSSLSNLISLFQAQGLSTKEMVALSGGHTIGQA  188

Query  678   RCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKNLIN  499
             RC  FR  IYN+TN I ++++   Q KCP   GSGD NL+PLD  TP  FD NYY NL +
Sbjct  189   RCVNFRAHIYNETN-IDSTYSTSLQSKCPSTAGSGDSNLSPLDYVTPTAFDKNYYSNLKS  247

Query  498   KKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRKNCR  319
             KKGLLHSDQ L+NGGSTDS V  Y+ N   F S FA AM+KMGNI+PLTG+ G+IRKNCR
Sbjct  248   KKGLLHSDQELFNGGSTDSQVTTYASNQNSFFSDFAAAMVKMGNIKPLTGTSGQIRKNCR  307

Query  318   KAN  310
             K N
Sbjct  308   KPN  310



>dbj|BAM28607.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   387 bits (995),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 236/306 (77%), Gaps = 5/306 (2%)
 Frame = -2

Query  1227  FLDSSSAQLSTNFYSKSCPMLFGTIKSVIKSALDEEKRMGASLLRLHFHDCFVQGCDGSI  1048
              L ++SAQLS+ +Y  SCP    TI+S + SA+ +E RMGASLLRLHFHDCFV GCDGS+
Sbjct  16    LLGAASAQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSV  75

Query  1047  LLDDTSSFKGEKTAFANNNSVRGYNVIDDIKSAIEKVCPGIVSCADIVAIAARDSTVLLG  868
             LLDDT++F GEKTA  N NS+RG++VID IK+++E VCPG+VSCADI+A+ ARDS V LG
Sbjct  76    LLDDTANFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLG  135

Query  867   GPNWKVKLGRRDSKTASLSAANSPGVLPSPFSNLSALISSFQNQGLSTTDLVALSGSYTI  688
             G +W V LGRRDS TASLSAAN+   +P+P  NLS LISSF N+GL+  ++VALSG++TI
Sbjct  136   GQSWTVLLGRRDSTTASLSAANAN--IPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTI  193

Query  687   GESRCTIFRDRIYNDTNTIAASFAKKRQRKCPRKTGSGDDNLAPLDLETPAFFDNNYYKN  508
             G +RC  FR RIYN+TN I +S+A   ++ CP  T  G +N APLD+ TP  FDN Y+K+
Sbjct  194   GLARCVTFRSRIYNETN-IKSSYAASLKKNCP--TNDGGNNTAPLDITTPFIFDNAYFKD  250

Query  507   LINKKGLLHSDQALYNGGSTDSLVKKYSKNPALFNSHFARAMIKMGNIRPLTGSRGEIRK  328
             LIN +GLLHSDQ LYN GS DS V KYS +P+ F++ FA A++KMGN+ PLTG+ G+IR 
Sbjct  251   LINLEGLLHSDQQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNLSPLTGTEGQIRT  310

Query  327   NCRKAN  310
             NCRK N
Sbjct  311   NCRKVN  316



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3338119460130