BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79177_g1_i1 len=1790 path=[1768:0-1789]

Length=1790
                                                                      Score     E

ref|XP_009621285.1|  PREDICTED: protein ECERIFERUM 1                    488   3e-164   
ref|XP_009786945.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    470   2e-157   
ref|XP_002283781.1|  PREDICTED: protein ECERIFERUM 1                    443   1e-146   Vitis vinifera
ref|XP_007018238.1|  HXXXD-type acyl-transferase family protein, ...    440   2e-145   
emb|CBI19276.3|  unnamed protein product                                441   3e-145   
ref|XP_006366422.1|  PREDICTED: protein ECERIFERUM 1-like               438   1e-144   
ref|XP_004252810.1|  PREDICTED: protein ECERIFERUM 1                    436   6e-144   
gb|KHG00208.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    425   8e-140   
gb|KDP41488.1|  hypothetical protein JCGZ_15895                         418   6e-137   
ref|XP_008352717.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    412   2e-134   
ref|XP_008219248.1|  PREDICTED: protein ECERIFERUM 1                    411   3e-134   
ref|XP_002514050.1|  Anthranilate N-benzoyltransferase protein, p...    409   1e-133   Ricinus communis
ref|XP_008352716.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    407   1e-132   
ref|XP_007222434.1|  hypothetical protein PRUPE_ppa006117mg             403   4e-131   
ref|XP_002264429.1|  PREDICTED: protein ECERIFERUM 26                   402   7e-131   Vitis vinifera
ref|XP_002306532.2|  ECERIFERUM 2 family protein                        402   1e-130   Populus trichocarpa [western balsam poplar]
ref|XP_010277517.1|  PREDICTED: protein ECERIFERUM 1-like               399   1e-129   
ref|XP_008338959.1|  PREDICTED: protein ECERIFERUM 1                    399   1e-129   
ref|XP_011074277.1|  PREDICTED: protein ECERIFERUM 1                    395   6e-128   
ref|XP_010060100.1|  PREDICTED: protein ECERIFERUM 1-like               395   8e-128   
ref|XP_010060103.1|  PREDICTED: protein ECERIFERUM 1-like               392   1e-126   
emb|CDP11510.1|  unnamed protein product                                390   5e-126   
ref|XP_007034236.1|  HXXXD-type acyl-transferase family protein, ...    390   7e-126   
ref|XP_008222816.1|  PREDICTED: protein ECERIFERUM 26-like              386   1e-124   
ref|XP_010243469.1|  PREDICTED: protein ECERIFERUM 26-like              383   3e-123   
ref|XP_010086662.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    384   3e-123   
ref|XP_008466157.1|  PREDICTED: protein ECERIFERUM 1                    382   7e-123   
emb|CBI17286.3|  unnamed protein product                                380   1e-122   
ref|XP_007227614.1|  hypothetical protein PRUPE_ppa022307mg             381   1e-122   
ref|XP_008380478.1|  PREDICTED: protein ECERIFERUM 26-like              381   1e-122   
ref|XP_008348421.1|  PREDICTED: protein ECERIFERUM 26-like              380   5e-122   
emb|CDP11175.1|  unnamed protein product                                377   3e-121   
ref|XP_006472451.1|  PREDICTED: protein ECERIFERUM 1-like               377   9e-121   
ref|XP_006433815.1|  hypothetical protein CICLE_v10001068mg             377   1e-120   
ref|XP_009346997.1|  PREDICTED: protein ECERIFERUM 26-like              375   2e-120   
ref|XP_006421010.1|  hypothetical protein CICLE_v10005028mg             374   9e-120   
ref|XP_006489852.1|  PREDICTED: protein ECERIFERUM 26-like              372   2e-119   
ref|XP_010023659.1|  PREDICTED: protein ECERIFERUM 26-like              369   7e-118   
ref|XP_008802334.1|  PREDICTED: protein ECERIFERUM 26-like              366   1e-116   
ref|XP_011003614.1|  PREDICTED: protein ECERIFERUM 26-like              365   2e-116   
ref|XP_004299741.1|  PREDICTED: vinorine synthase-like                  365   3e-116   
ref|XP_010692384.1|  PREDICTED: protein ECERIFERUM 1                    363   2e-115   
ref|XP_011084205.1|  PREDICTED: protein ECERIFERUM 26-like              358   1e-113   
ref|XP_003602897.1|  Omega-hydroxypalmitate O-feruloyl transferase      359   2e-113   
ref|XP_010910676.1|  PREDICTED: protein ECERIFERUM 26-like              357   2e-113   
ref|XP_004136254.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    357   3e-113   
ref|XP_009785032.1|  PREDICTED: protein ECERIFERUM 26-like              353   1e-111   
ref|XP_009602892.1|  PREDICTED: protein ECERIFERUM 26-like              352   2e-111   
gb|KDP39334.1|  hypothetical protein JCGZ_01091                         351   7e-111   
ref|XP_009408243.1|  PREDICTED: protein ECERIFERUM 26-like              350   3e-110   
ref|XP_003594968.1|  Taxadien-5-alpha-ol O-acetyltransferase            349   4e-110   
ref|XP_009376207.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    348   4e-110   
ref|XP_010673394.1|  PREDICTED: protein ECERIFERUM 26-like              346   9e-109   
ref|XP_006360967.1|  PREDICTED: protein ECERIFERUM 26-like              343   7e-108   
ref|XP_003526552.1|  PREDICTED: protein ECERIFERUM 1-like               342   3e-107   
gb|KEH40827.1|  transferase family protein                              339   4e-106   
ref|XP_009412065.1|  PREDICTED: protein ECERIFERUM 26-like              336   3e-105   
ref|XP_003519204.1|  PREDICTED: protein ECERIFERUM 1-like               336   3e-105   
ref|XP_003531221.1|  PREDICTED: protein ECERIFERUM 26-like              335   1e-104   
ref|NP_001241338.1|  uncharacterized protein LOC100819144               333   5e-104   
ref|XP_004247878.1|  PREDICTED: protein ECERIFERUM 26-like              332   1e-103   
ref|XP_004299742.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    331   6e-103   
gb|KHN12341.1|  Omega-hydroxypalmitate O-feruloyl transferase           330   9e-103   
ref|XP_004501655.1|  PREDICTED: anthranilate N-benzoyltransferase...    328   4e-102   
ref|XP_006852920.1|  hypothetical protein AMTR_s00033p00231280          327   1e-101   
gb|EYU32707.1|  hypothetical protein MIMGU_mgv1a006596mg                325   9e-101   
ref|XP_010544488.1|  PREDICTED: protein ECERIFERUM 1                    323   3e-100   
ref|XP_004297015.1|  PREDICTED: anthranilate N-benzoyltransferase...    317   8e-98    
ref|XP_010448555.1|  PREDICTED: protein ECERIFERUM 1-like               314   8e-97    
ref|XP_007153617.1|  hypothetical protein PHAVU_003G050600g             312   6e-96    
ref|XP_010433760.1|  PREDICTED: protein ECERIFERUM 1-like               311   1e-95    
ref|XP_002869713.1|  hypothetical protein ARALYDRAFT_492392             309   4e-95    
gb|EPS62865.1|  hypothetical protein M569_11925                         309   5e-95    
ref|XP_006286038.1|  hypothetical protein CARUB_v10007574mg             307   2e-94    
ref|XP_007141275.1|  hypothetical protein PHAVU_008G182300g             308   2e-94    
ref|NP_194182.1|  fatty acid elongation machinery component ECERI...    307   4e-94    Arabidopsis thaliana [mouse-ear cress]
gb|EPS62582.1|  hypothetical protein M569_12210                         305   3e-93    
ref|XP_010439020.1|  PREDICTED: protein ECERIFERUM 1-like               304   4e-93    
gb|EPS64444.1|  hypothetical protein M569_10336                         303   1e-92    
ref|XP_008668901.1|  PREDICTED: protein ECERIFERUM 26-like              298   7e-91    
ref|XP_004976772.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    294   5e-89    
dbj|BAJ92272.1|  predicted protein                                      293   2e-88    
gb|KFK39682.1|  hypothetical protein AALP_AA3G275600                    292   2e-88    
ref|XP_002298682.2|  transferase family protein                         284   8e-86    Populus trichocarpa [western balsam poplar]
ref|XP_009102573.1|  PREDICTED: protein ECERIFERUM 26-like              283   4e-85    
emb|CDX77480.1|  BnaA07g06180D                                          283   4e-85    
ref|XP_010240397.1|  PREDICTED: protein ECERIFERUM 26-like              283   8e-85    
ref|XP_006418831.1|  hypothetical protein EUTSA_v10002536mg             281   3e-84    
ref|XP_006413420.1|  hypothetical protein EUTSA_v10025274mg             280   6e-84    
emb|CAA61258.1|  orf                                                    280   8e-84    Zea mays [maize]
gb|KFK39684.1|  hypothetical protein AALP_AA3G275800                    278   5e-83    
ref|NP_001053836.1|  Os04g0611200                                       278   6e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447077.1|  hypothetical protein SORBIDRAFT_06g028160          276   5e-82    Sorghum bicolor [broomcorn]
gb|AAM65391.1|  fatty acid elongase-like protein (cer2-like)            271   1e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527461.1|  PREDICTED: protein ECERIFERUM 26-like              272   2e-80    
ref|XP_009139584.1|  PREDICTED: protein ECERIFERUM 26                   271   2e-80    
ref|XP_009138132.1|  PREDICTED: protein ECERIFERUM 1                    271   3e-80    
ref|XP_010421841.1|  PREDICTED: protein ECERIFERUM 26-like              270   9e-80    
emb|CDY01163.1|  BnaA04g06560D                                          268   3e-79    
ref|NP_566741.1|  HXXXD-type acyl-transferase-like protein              267   5e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008457218.1|  PREDICTED: protein ECERIFERUM 26-like              268   9e-79    
ref|XP_010466747.1|  PREDICTED: protein ECERIFERUM 26-like              266   2e-78    
ref|XP_010532758.1|  PREDICTED: protein ECERIFERUM 26-like              265   4e-78    
ref|XP_006653755.1|  PREDICTED: protein ECERIFERUM 26-like              262   3e-77    
emb|CDY65534.1|  BnaC01g41490D                                          271   3e-77    
emb|CDX85135.1|  BnaC07g07710D                                          262   4e-77    
ref|XP_004139014.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    263   7e-77    
ref|XP_006414850.1|  hypothetical protein EUTSA_v10025273mg             261   2e-76    
gb|KFK36272.1|  hypothetical protein AALP_AA4G100900                    259   5e-76    
ref|XP_006297739.1|  hypothetical protein CARUB_v10013773mg             259   9e-76    
ref|XP_010495840.1|  PREDICTED: protein ECERIFERUM 26                   257   4e-75    
ref|XP_006297755.1|  hypothetical protein CARUB_v10013790mg             256   8e-75    
ref|XP_002862408.1|  hypothetical protein ARALYDRAFT_497463             256   1e-74    
ref|XP_002883466.1|  hypothetical protein ARALYDRAFT_479896             253   2e-73    
ref|XP_010435220.1|  PREDICTED: protein ECERIFERUM 26-like              253   2e-73    
emb|CAN81455.1|  hypothetical protein VITISV_003221                     248   6e-73    Vitis vinifera
ref|XP_006283805.1|  hypothetical protein CARUB_v10004904mg             251   7e-73    
ref|NP_193120.1|  HXXXD-type acyl-transferase-like protein              251   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512967.1|  PREDICTED: protein ECERIFERUM 26-like              249   5e-72    
ref|XP_010450155.1|  PREDICTED: protein ECERIFERUM 26-like              248   1e-71    
ref|NP_001151321.1|  transferase                                        248   4e-71    Zea mays [maize]
ref|XP_002868333.1|  transferase family protein                         246   5e-71    
gb|AFW57004.1|  transferase                                             247   1e-70    
gb|KCW59963.1|  hypothetical protein EUGRSUZ_H026881                    238   1e-69    
ref|XP_004972581.1|  PREDICTED: rosmarinate synthase-like               235   1e-66    
ref|XP_002445215.1|  hypothetical protein SORBIDRAFT_07g006100          234   7e-66    Sorghum bicolor [broomcorn]
gb|ACJ85714.1|  unknown                                                 228   1e-65    Medicago truncatula
ref|XP_002535495.1|  transferase, putative                              223   2e-63    Ricinus communis
ref|XP_010109332.1|  hypothetical protein L484_011074                   219   2e-62    
gb|EYU36447.1|  hypothetical protein MIMGU_mgv1a0065642mg               217   1e-61    
gb|EYU36443.1|  hypothetical protein MIMGU_mgv1a027079mg                216   4e-61    
gb|KDO81199.1|  hypothetical protein CISIN_1g023125mg                   211   2e-59    
ref|XP_004173061.1|  PREDICTED: anthranilate N-benzoyltransferase...    207   7e-58    
ref|XP_010914412.1|  PREDICTED: protein ECERIFERUM 26-like              199   4e-55    
gb|KHN08277.1|  hypothetical protein glysoja_017755                     181   2e-48    
gb|KEH20651.1|  anthranilate N-benzoyltransferase-like protein, p...    172   3e-45    
ref|XP_011069444.1|  PREDICTED: protein ECERIFERUM 26-like              170   7e-45    
gb|EYU36448.1|  hypothetical protein MIMGU_mgv1a0065641mg               150   4e-39    
gb|KDO50656.1|  hypothetical protein CISIN_1g030487mg                   141   2e-35    
emb|CDY64789.1|  BnaCnng44950D                                          144   2e-35    
tpg|DAA36074.1|  TPA: glossy2                                           140   2e-35    
gb|KDO36781.1|  hypothetical protein CISIN_1g037425mg                   138   1e-34    
ref|XP_004517298.1|  PREDICTED: uncharacterized protein LOC101493204    139   3e-34    
emb|CAE05194.3|  OSJNBa0070C17.1                                        137   4e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003629600.1|  hypothetical protein MTR_8g081480                  135   7e-34    
gb|KCW59962.1|  hypothetical protein EUGRSUZ_H026882                    134   3e-33    
ref|XP_006829665.1|  hypothetical protein AMTR_s00122p00127100          140   8e-33    
gb|EMS59951.1|  hypothetical protein TRIUR3_02819                       131   2e-31    
emb|CDY05591.1|  BnaC02g39460D                                          135   5e-31    
ref|XP_010455172.1|  PREDICTED: protein ECERIFERUM 26-like              133   2e-30    
ref|XP_010494090.1|  PREDICTED: protein ECERIFERUM 26-like              132   3e-30    
ref|XP_006286502.1|  hypothetical protein CARUB_v10001016mg             132   6e-30    
ref|XP_006395015.1|  hypothetical protein EUTSA_v10004237mg             132   6e-30    
emb|CAE05195.3|  OSJNBa0070C17.2                                        129   7e-30    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008222902.1|  PREDICTED: protein ECERIFERUM 26-like              126   8e-30    
emb|CDY52503.1|  BnaAnng11500D                                          131   1e-29    
ref|XP_010256176.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   1e-29    
tpg|DAA36076.1|  TPA: glossy2                                           128   2e-29    
ref|XP_010421688.1|  PREDICTED: protein ECERIFERUM 26-like              129   5e-29    
ref|XP_010914319.1|  PREDICTED: protein ECERIFERUM 26-like              120   7e-28    
ref|XP_011026508.1|  PREDICTED: protein ECERIFERUM 26                   125   9e-28    
gb|KHN31456.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    125   1e-27    
ref|XP_006577283.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    125   2e-27    
ref|XP_009129839.1|  PREDICTED: protein ECERIFERUM 26-like              123   7e-27    
ref|XP_011091952.1|  PREDICTED: protein ECERIFERUM 1-like               122   2e-26    
emb|CDY12721.1|  BnaC04g29200D                                          115   2e-26    
ref|XP_006838953.1|  hypothetical protein AMTR_s00002p00270800          121   4e-26    
ref|XP_009139678.1|  PREDICTED: protein ECERIFERUM 26-like              114   8e-26    
ref|XP_008218251.1|  PREDICTED: protein ECERIFERUM 26-like              119   1e-25    
emb|CDP04825.1|  unnamed protein product                                119   1e-25    
ref|XP_010695055.1|  PREDICTED: protein ECERIFERUM 26-like              119   3e-25    
ref|XP_007161246.1|  hypothetical protein PHAVU_001G054300g             118   3e-25    
ref|XP_006604843.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    117   8e-25    
gb|KHN43198.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    117   8e-25    
ref|XP_002282283.1|  PREDICTED: protein ECERIFERUM 26-like              116   1e-24    Vitis vinifera
ref|XP_010917798.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    116   2e-24    
ref|XP_004170167.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    113   2e-24    
ref|XP_011032417.1|  PREDICTED: protein ECERIFERUM 26-like              115   2e-24    
ref|XP_004494691.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    115   4e-24    
ref|XP_011004269.1|  PREDICTED: protein ECERIFERUM 26-like              115   6e-24    
ref|XP_008455878.1|  PREDICTED: protein ECERIFERUM 26                   114   8e-24    
ref|XP_002463889.1|  hypothetical protein SORBIDRAFT_01g008360          114   9e-24    Sorghum bicolor [broomcorn]
ref|XP_003626431.1|  Omega-hydroxypalmitate O-feruloyl transferase      114   1e-23    
gb|KFK26566.1|  hypothetical protein AALP_AA8G265500                    113   1e-23    
ref|XP_006382783.1|  hypothetical protein POPTR_0005s05380g             113   2e-23    
ref|XP_002273086.1|  PREDICTED: protein ECERIFERUM 26-like              113   2e-23    Vitis vinifera
ref|XP_007013792.1|  Transferase, putative                              112   3e-23    
ref|XP_009364516.1|  PREDICTED: protein ECERIFERUM 26-like              112   4e-23    
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    110   1e-22    
ref|XP_008388670.1|  PREDICTED: protein ECERIFERUM 26-like              111   1e-22    
ref|XP_003588700.1|  Taxadien-5-alpha-ol O-acetyltransferase            110   1e-22    
ref|XP_002514352.1|  transferase, putative                              110   1e-22    Ricinus communis
ref|XP_011081909.1|  PREDICTED: protein ECERIFERUM 26-like              110   2e-22    
gb|AFK44549.1|  unknown                                                 103   4e-22    
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    108   7e-22    
gb|EYU30520.1|  hypothetical protein MIMGU_mgv1a006319mg                108   8e-22    
ref|XP_010102303.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    108   9e-22    
emb|CAN80953.1|  hypothetical protein VITISV_032203                     107   1e-21    Vitis vinifera
ref|XP_007147162.1|  hypothetical protein PHAVU_006G101000g             107   2e-21    
ref|XP_010051199.1|  PREDICTED: protein ECERIFERUM 26-like              107   2e-21    
ref|XP_004498644.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    105   6e-21    
gb|ACG37219.1|  transferase                                             105   8e-21    Zea mays [maize]
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    104   1e-20    
ref|XP_010102806.1|  Vinorine synthase                                  104   2e-20    
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    103   2e-20    
ref|NP_001140499.1|  transferase                                        103   3e-20    Zea mays [maize]
ref|XP_004156459.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    103   6e-20    
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   7e-20    
gb|KGN60817.1|  hypothetical protein Csa_2G011500                       102   7e-20    
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   7e-20    
ref|XP_003549253.1|  PREDICTED: protein ECERIFERUM 1-like               102   8e-20    
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   8e-20    
ref|XP_002964139.1|  BAHD family acyltransferase                        102   9e-20    
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    102   9e-20    
ref|XP_010525926.1|  PREDICTED: protein ECERIFERUM 26-like              102   1e-19    
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     102   1e-19    
gb|ADB44897.1|  hydroxycinnamoyl transferase                            101   1e-19    Sinopodophyllum hexandrum [Himalayan mayapple]
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    101   1e-19    Pinus radiata
ref|XP_009393051.1|  PREDICTED: protein ECERIFERUM 26-like              102   1e-19    
ref|XP_002993165.1|  hypothetical protein SELMODRAFT_431276             101   1e-19    
gb|EPS67739.1|  hypothetical protein M569_07035                         101   1e-19    
ref|XP_010670732.1|  PREDICTED: protein ECERIFERUM 26-like              101   1e-19    
gb|AEK80405.1|  HQT                                                     101   1e-19    
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    100   3e-19    
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    100   3e-19    
ref|XP_007223985.1|  hypothetical protein PRUPE_ppa014744mg             100   3e-19    
ref|XP_007099550.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  99.0    4e-19    
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.8    6e-19    
ref|XP_003532115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  99.4    9e-19    
ref|XP_006368492.1|  transferase family protein                       99.0    9e-19    
ref|XP_006432968.1|  hypothetical protein CICLE_v10001131mg           99.4    9e-19    
gb|ABR17170.1|  unknown                                               99.0    9e-19    Picea sitchensis
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g           98.6    1e-18    Populus trichocarpa [western balsam poplar]
ref|XP_008219914.1|  PREDICTED: protein ECERIFERUM 26-like            99.0    1e-18    
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  98.6    1e-18    
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...  98.6    1e-18    
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  98.6    1e-18    
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  98.2    2e-18    
ref|XP_010546595.1|  PREDICTED: protein ECERIFERUM 26-like isofor...  97.8    2e-18    
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.4    3e-18    
ref|XP_002964534.1|  hypothetical protein SELMODRAFT_405848           97.4    3e-18    
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.1    3e-18    
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.1    4e-18    
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                    97.1    5e-18    
gb|KDO79585.1|  hypothetical protein CISIN_1g045312mg                 96.7    5e-18    
ref|XP_006476225.1|  PREDICTED: protein ECERIFERUM 26-like            96.7    5e-18    
ref|XP_008811612.1|  PREDICTED: protein ECERIFERUM 26-like            96.3    6e-18    
ref|XP_006450533.1|  hypothetical protein CICLE_v10008314mg           96.7    6e-18    
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...  96.3    7e-18    Lonicera japonica [Japanese honeysuckle]
ref|XP_008392130.1|  PREDICTED: protein ECERIFERUM 26-like            96.7    7e-18    
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg           96.3    7e-18    
ref|XP_009785033.1|  PREDICTED: protein ECERIFERUM 26-like            92.4    7e-18    
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g           96.3    9e-18    
ref|XP_002984716.1|  BAHD family acyltransferase                      95.9    1e-17    
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.9    1e-17    
ref|XP_002972181.1|  hypothetical protein SELMODRAFT_441723           95.9    1e-17    
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2           95.9    1e-17    
ref|XP_002993129.1|  hypothetical protein SELMODRAFT_431269           95.9    1e-17    
ref|XP_002984713.1|  BAHD family acyltransferase                      95.9    1e-17    
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2            95.1    2e-17    
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.1    2e-17    Vitis vinifera
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  95.1    2e-17    
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  95.1    2e-17    
emb|CAN82918.1|  hypothetical protein VITISV_023290                   95.1    2e-17    Vitis vinifera
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.1    2e-17    
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.7    2e-17    
gb|EAY91836.1|  hypothetical protein OsI_13481                        95.1    2e-17    Oryza sativa Indica Group [Indian rice]
gb|KDP38698.1|  hypothetical protein JCGZ_04051                       94.7    2e-17    
gb|ACF78901.1|  unknown                                               94.0    2e-17    Zea mays [maize]
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  94.7    2e-17    
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg              94.7    2e-17    
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.4    3e-17    
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg          94.7    3e-17    
ref|XP_006304467.1|  hypothetical protein CARUB_v10011142mg           94.4    3e-17    
ref|XP_007030599.1|  HXXXD-type acyl-transferase family protein, ...  94.4    4e-17    
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  93.6    6e-17    
ref|XP_004293014.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  93.6    6e-17    
ref|XP_002977492.1|  hypothetical protein SELMODRAFT_443493           93.6    6e-17    
gb|ABF98834.1|  Transferase family protein, expressed                 93.6    8e-17    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002978802.1|  BAHD family acyltransferase                      93.2    9e-17    
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg           92.8    9e-17    
ref|NP_001051243.1|  Os03g0745200                                     93.2    9e-17    
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase             92.8    1e-16    
emb|CAJ40778.1|  hydroxycinnamoyl transferase                         92.8    1e-16    
gb|EYU24586.1|  hypothetical protein MIMGU_mgv1a0064641mg             90.5    1e-16    
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.4    1e-16    
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.4    1e-16    
emb|CDO98242.1|  unnamed protein product                              92.4    1e-16    
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.4    1e-16    
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora    92.4    1e-16    
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.4    2e-16    
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  92.0    2e-16    
emb|CDY31956.1|  BnaA07g00390D                                        92.0    2e-16    
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1            92.4    2e-16    
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  92.0    2e-16    
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  92.0    2e-16    
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...  92.0    2e-16    
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.0    2e-16    
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.7    2e-16    
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.7    2e-16    
ref|XP_004303231.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.7    2e-16    
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                    91.7    2e-16    
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.7    2e-16    
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  91.7    3e-16    
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...  91.7    3e-16    
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.3    3e-16    
ref|XP_007099551.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  90.5    3e-16    
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.3    3e-16    
ref|XP_002984711.1|  BAHD family acyltransferase                      91.3    4e-16    
ref|XP_003559747.1|  PREDICTED: protein ECERIFERUM 26-like            91.3    4e-16    
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  90.9    4e-16    
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.9    4e-16    
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...  90.9    4e-16    
ref|XP_004302041.1|  PREDICTED: vinorine synthase-like                90.5    4e-16    
ref|NP_567826.1|  HXXXD-type acyl-transferase-like protein            91.3    4e-16    
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.9    4e-16    
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.9    5e-16    
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg           90.9    5e-16    
gb|ABI48360.1|  putative alcohol acyltransferase 1                    90.9    5e-16    
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  90.5    5e-16    
gb|AAM61215.1|  anthranilate N-benzoyltransferase                     90.5    6e-16    
gb|KFK29862.1|  hypothetical protein AALP_AA7G188600                  90.5    6e-16    
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...  90.1    7e-16    
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.5    7e-16    
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase            90.5    7e-16    
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg           90.5    7e-16    
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.5    7e-16    
ref|XP_002978805.1|  BAHD family acyltransferase                      90.5    7e-16    
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  90.1    8e-16    
ref|XP_001785388.1|  predicted protein                                90.1    8e-16    
ref|XP_002515446.1|  transferase, putative                            90.5    8e-16    
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase         90.1    8e-16    
ref|XP_006853006.1|  hypothetical protein AMTR_s00174p00025490        90.1    8e-16    
ref|XP_002993137.1|  BAHD family acyltransferase                      90.1    1e-15    
gb|EYU21934.1|  hypothetical protein MIMGU_mgv1a008485mg              89.0    1e-15    
emb|CBI83579.1|  hydroxycinnamoyl transferase                         89.4    1e-15    
gb|ADG46003.1|  hydroxycinnamoyl transferase                          89.4    1e-15    
gb|KDP41953.1|  hypothetical protein JCGZ_26971                       89.4    1e-15    
emb|CDY05770.1|  BnaC07g00330D                                        89.4    1e-15    
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase               89.4    1e-15    
gb|KDP38692.1|  hypothetical protein JCGZ_04045                       89.4    1e-15    
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.0    2e-15    
ref|XP_002964524.1|  BAHD family acyltransferase                      89.4    2e-15    
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase              89.0    2e-15    
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  88.6    2e-15    
ref|XP_002978800.1|  BAHD family acyltransferase                      89.0    2e-15    
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  89.4    2e-15    
ref|XP_002984719.1|  BAHD family acyltransferase                      89.0    2e-15    
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  88.6    2e-15    
ref|XP_002894568.1|  transferase family protein                       88.6    3e-15    
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  88.6    3e-15    
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase               88.6    3e-15    
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  88.6    3e-15    
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  88.6    3e-15    
ref|XP_007161967.1|  hypothetical protein PHAVU_001G112800g           88.6    3e-15    
ref|XP_002978687.1|  BAHD family acyltransferase                      88.2    3e-15    
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  88.2    3e-15    
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  88.2    3e-15    
dbj|BAK06476.1|  predicted protein                                    88.2    3e-15    
ref|XP_007146248.1|  hypothetical protein PHAVU_006G024700g           88.2    3e-15    
gb|EMS61405.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase     87.8    4e-15    
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                 87.8    4e-15    
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                  87.8    4e-15    
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...  87.8    4e-15    
ref|XP_002990807.1|  BAHD family acyltransferase, clade I             88.2    4e-15    
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.8    4e-15    
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g           87.8    4e-15    
emb|CBI21083.3|  unnamed protein product                              87.8    5e-15    
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg           87.8    5e-15    
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.8    5e-15    
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.4    6e-15    
ref|XP_001754825.1|  predicted protein                                87.4    6e-15    
ref|XP_007205176.1|  hypothetical protein PRUPE_ppa005581mg           87.4    7e-15    
gb|AEJ88365.1|  hydroxycinnamoyltransferase                           87.0    7e-15    
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg           87.0    7e-15    
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.0    7e-15    
ref|XP_011069658.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  87.0    8e-15    
gb|EEE59916.1|  hypothetical protein OsJ_12543                        86.7    8e-15    
ref|XP_004139230.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    9e-15    
ref|XP_004503772.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  86.7    9e-15    
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...  86.7    9e-15    
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.7    9e-15    
emb|CDP21790.1|  unnamed protein product                              85.5    9e-15    
gb|EPS67512.1|  hypothetical protein M569_07262                       86.7    1e-14    
ref|XP_011070203.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.7    1e-14    
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...  86.7    1e-14    
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.7    1e-14    
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg           86.3    1e-14    
dbj|BAF49306.1|  putative acyltransferase                             86.3    1e-14    
gb|AEA36976.1|  rosmarinic acid synthase                              86.7    1e-14    
gb|AAQ62868.1|  At3g48720                                             86.3    1e-14    
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like     86.3    1e-14    
ref|XP_011083578.1|  PREDICTED: uncharacterized protein LOC105166055  85.5    1e-14    
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  86.3    1e-14    
ref|XP_010433114.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    1e-14    
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg           86.3    1e-14    
gb|AAM61611.1|  unknown                                               86.3    2e-14    
ref|XP_009403962.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    2e-14    
gb|KDP38697.1|  hypothetical protein JCGZ_04050                       85.9    2e-14    
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg           85.9    2e-14    
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    2e-14    
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...  85.9    2e-14    
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  85.9    2e-14    
gb|KFK40283.1|  hypothetical protein AALP_AA3G354800                  85.9    2e-14    
gb|AGW27208.1|  rosmarinic acid synthase 3                            85.5    2e-14    
gb|AGW27210.1|  rosmarinic acid synthase 5                            85.9    2e-14    
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.9    2e-14    
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  85.9    2e-14    
ref|XP_010478102.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.9    2e-14    
ref|NP_179497.1|  spermidine hydroxycinnamoyl transferase             85.9    2e-14    
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    2e-14    
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase         85.5    2e-14    
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    2e-14    
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    2e-14    
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like     85.5    2e-14    
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    2e-14    
ref|XP_010556179.1|  PREDICTED: BAHD acyltransferase At5g47980        85.5    3e-14    
dbj|BAF49305.1|  putative acyltransferase                             85.5    3e-14    
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase         85.5    3e-14    
ref|XP_002962462.1|  BAHD family acyltransferase                      85.5    3e-14    
ref|XP_006280408.1|  hypothetical protein CARUB_v10026341mg           85.5    3e-14    
ref|XP_002994620.1|  BAHD family acyltransferase                      85.1    3e-14    
ref|XP_008790004.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.5    3e-14    
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  85.1    3e-14    
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...  85.1    3e-14    
emb|CDY22880.1|  BnaA01g18180D                                        85.1    3e-14    
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g           85.1    3e-14    
gb|KHN36434.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  85.1    3e-14    
gb|KFK34173.1|  hypothetical protein AALP_AA5G109900                  85.1    3e-14    
ref|XP_002993316.1|  BAHD family acyltransferase                      85.1    3e-14    
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.1    3e-14    
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  85.1    4e-14    
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg           84.7    4e-14    
emb|CBI25231.3|  unnamed protein product                              84.7    4e-14    
gb|EYU21930.1|  hypothetical protein MIMGU_mgv1a026668mg              85.1    4e-14    
ref|XP_010942126.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.1    4e-14    
ref|XP_010499244.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.7    4e-14    
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.7    4e-14    
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.7    4e-14    
ref|XP_003550655.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  85.1    4e-14    
emb|CDY27624.1|  BnaA09g27830D                                        84.7    4e-14    
ref|XP_010460517.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.7    4e-14    
emb|CAT00088.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  82.0    5e-14    
gb|KEH21000.1|  omega-hydroxypalmitate O-feruloyl transferase         84.3    5e-14    
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...  84.3    6e-14    
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase       84.3    6e-14    
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.3    6e-14    
gb|ABR16407.1|  unknown                                               84.3    7e-14    
ref|XP_003551903.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  84.3    7e-14    
ref|XP_002884178.1|  transferase family protein                       84.0    7e-14    
gb|KHN30507.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  84.0    8e-14    
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  84.0    8e-14    
ref|NP_190441.1|  HXXXD-type acyl-transferase family protein          84.0    8e-14    
ref|XP_002890739.1|  transferase family protein                       84.0    8e-14    
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.0    8e-14    
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.0    8e-14    
emb|CDP21167.1|  unnamed protein product                              84.0    8e-14    
ref|XP_007011749.1|  HXXXD-type acyl-transferase family protein       84.3    8e-14    
emb|CDX68855.1|  BnaC01g05980D                                        84.0    8e-14    
ref|XP_008220695.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.3    8e-14    
ref|XP_009790148.1|  PREDICTED: vinorine synthase-like                84.0    8e-14    
ref|XP_006296658.1|  hypothetical protein CARUB_v10015907mg           84.0    8e-14    
ref|XP_004301771.1|  PREDICTED: anthranilate N-benzoyltransferase...  84.0    9e-14    
ref|XP_007027325.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  83.2    9e-14    
gb|AGW27209.1|  rosmarinic acid synthase 4                            83.6    9e-14    
ref|XP_002974492.1|  BAHD family acyltransferase, clade I             84.0    1e-13    
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...  83.6    1e-13    
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.6    1e-13    
dbj|BAJ93247.1|  predicted protein                                    83.6    1e-13    
ref|XP_002869444.1|  hypothetical protein ARALYDRAFT_491831           83.6    1e-13    
gb|AGH61997.1|  rosmarinic acid synthase                              83.6    1e-13    
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg              83.6    1e-13    
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.2    1e-13    
gb|ACC68164.1|  unknown                                               83.6    1e-13    
ref|XP_002970021.1|  BAHD family acyltransferase                      83.6    1e-13    
ref|XP_010447873.1|  PREDICTED: rosmarinate synthase-like             83.6    1e-13    
ref|XP_010033687.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  83.6    1e-13    
ref|XP_006414538.1|  hypothetical protein EUTSA_v10025255mg           83.2    1e-13    
ref|XP_007038058.1|  HXXXD-type acyl-transferase family protein i...  83.2    1e-13    
ref|XP_010548604.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  83.2    1e-13    
ref|XP_010489453.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  83.2    1e-13    
gb|ACU23541.1|  unknown                                               80.5    2e-13    
gb|ADA60182.1|  rosmarinic acid synthase                              82.8    2e-13    
ref|XP_001762337.1|  predicted protein                                83.2    2e-13    
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.2    2e-13    
emb|CDP18830.1|  unnamed protein product                              83.2    2e-13    
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg           82.8    2e-13    
gb|AJA31666.1|  rosmarinic acid synthase                              82.8    2e-13    
ref|XP_010467740.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  83.2    2e-13    
dbj|BAJ95750.1|  predicted protein                                    82.8    2e-13    
ref|XP_010677119.1|  PREDICTED: protein ECERIFERUM 26-like            82.0    2e-13    
ref|XP_006409088.1|  hypothetical protein EUTSA_v10022690mg           82.8    2e-13    
ref|XP_007038057.1|  HXXXD-type acyl-transferase family protein, ...  83.2    2e-13    
ref|XP_009363879.1|  PREDICTED: 3'-N-debenzoyl-2'-deoxytaxol N-be...  82.8    2e-13    
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                        82.4    2e-13    
gb|EPS64002.1|  hypothetical protein M569_10778                       82.4    2e-13    
ref|XP_009113746.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  82.4    2e-13    
ref|XP_008222021.1|  PREDICTED: BAHD acyltransferase At5g47980-like   82.4    2e-13    
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g           82.4    2e-13    
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1    82.4    2e-13    



>ref|XP_009621285.1| PREDICTED: protein ECERIFERUM 1 [Nicotiana tomentosiformis]
Length=437

 Score =   488 bits (1256),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 252/439 (57%), Positives = 317/439 (72%), Gaps = 8/439 (2%)
 Frame = +1

Query  109   DVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLK  288
             DVE ++ D + SSVVPA ITG  +V   TN DL MKLHY++G+Y F S+AV+ LN  D K
Sbjct  2     DVEKLISDVKSSSVVPAKITGADKVHEFTNMDLVMKLHYIKGLYFFSSDAVEDLNIYDFK  61

Query  289   SPMFRMLEDFYPAAGRIRTSPEDG-RPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYD  465
              PMF  LE +Y  +GRIR S + G RPF+KCND GVRI+EAK SKTI+EWL M+D S  D
Sbjct  62    KPMFHFLELYYETSGRIRRSEDGGGRPFIKCNDGGVRIIEAKSSKTIEEWLVMNDSSVND  121

Query  466   HLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG  645
              L++ DQVLGP+LGF+PLVFIQ TWFKCGG+SIG+SWAHVLGD FS S+F+N +   MAG
Sbjct  122   QLVY-DQVLGPELGFAPLVFIQFTWFKCGGMSIGLSWAHVLGDVFSASNFINIWAQIMAG  180

Query  646   RRDLPPKHPHMPTADNHN-SPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
             +  LPP+  +    +N   +P   T    PFSL  V PVGDHW++TN+CKM + S+HIT+
Sbjct  181   Q--LPPQSLNNSRTNNKFINPLLSTVDKLPFSLKKVDPVGDHWRITNSCKMISHSFHITE  238

Query  823   KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGL  999
             K+LN  I K+ G KQSAKVKPF+ ISA  WK LAKV+ E +    VTI+           
Sbjct  239   KELNQHISKIFGPKQSAKVKPFDVISATMWKILAKVRGESAEPGIVTIISKDNSCDREIT  298

Query  1000  LPCRNGQVISAVKAE-MRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
                 NGQ+IS V+A  ++VSEA+VLELA LI EK VDET +++E ME+ENG + DF VYG
Sbjct  299   QVSNNGQMISIVEANNVKVSEANVLELAKLIAEKGVDETKVVEELMEKENG-TLDFVVYG  357

Query  1177  ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVI  1356
             ANLTFVNLE+  IYGF+++G+KP+FA+Y I  VG+EG VLVL GPENL GKEGGRIVN++
Sbjct  358   ANLTFVNLEKANIYGFELRGKKPLFASYNISEVGEEGVVLVLAGPENLNGKEGGRIVNLV  417

Query  1357  LPEHLLGKLKNEISKELGT  1413
             LPE  +   KNE+ +ELG 
Sbjct  418   LPEDQIEGFKNELREELGV  436



>ref|XP_009786945.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 1-like [Nicotiana 
sylvestris]
Length=430

 Score =   470 bits (1210),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 245/438 (56%), Positives = 311/438 (71%), Gaps = 13/438 (3%)
 Frame = +1

Query  109   DVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLK  288
             DVE ++ D +LSSVVPA ITG  +V   TN DL MKLHY++G+Y F S+AV+GLN  D K
Sbjct  2     DVEKLISDVKLSSVVPAKITGADKVHEFTNMDLVMKLHYIKGLYFFNSDAVEGLNIYDFK  61

Query  289   SPMFRMLEDFYPAAGRIRTSPEDG-RPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYD  465
              PMF  LE +Y A+GRIR S + G R F+KCND GVRI+EAK SKTI++WL M+D S  D
Sbjct  62    KPMFHFLELYYEASGRIRRSEDGGGRSFIKCNDGGVRIIEAKSSKTIEKWLAMNDSSVND  121

Query  466   HLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG  645
              L++ DQVLGP+LGF+PLVFIQ TWFKCGG+SIG+SWAHVLGD FS S F+N +   MAG
Sbjct  122   QLVY-DQVLGPELGFAPLVFIQFTWFKCGGMSIGLSWAHVLGDVFSASKFINIWAQIMAG  180

Query  646   RRDLPPKHPHMPTADNH-NSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
              + LPP+  +    +   N+P   T +  P+S+  V PVGDHW++TNTCKM + S+HIT+
Sbjct  181   HQ-LPPQSLNNSRTNKFINNPLLSTVENLPYSIKRVDPVGDHWRITNTCKMISHSFHITE  239

Query  823   KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLL  1002
             KQLN  I K+ G KQSAKVKPF+ ISA  WK LAKV+       + I++           
Sbjct  240   KQLNQHISKIFGPKQSAKVKPFDVISATMWKILAKVRGNQQSLELXIIRRDNSCDREITQ  299

Query  1003  PCRNGQVISAVKA-EMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGA  1179
                NGQVIS V+A  ++VS+++VLELA LI EK+VDET +++E ME+ENG + DF VYGA
Sbjct  300   VSNNGQVISIVEAINVKVSKSNVLELAKLIAEKSVDETKVVEELMEKENG-TLDFVVYGA  358

Query  1180  NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVIL  1359
             NLTFVNLEE  IYGF+++G+KPIFA+Y I GV   G VLVL GPENL     GRIVN++L
Sbjct  359   NLTFVNLEEANIYGFELRGKKPIFASYNISGV---GVVLVLAGPENL----NGRIVNLVL  411

Query  1360  PEHLLGKLKNEISKELGT  1413
             PE  +   K E+ +ELG 
Sbjct  412   PEDQIEGFKYELREELGV  429



>ref|XP_002283781.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
Length=429

 Score =   443 bits (1139),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 236/445 (53%), Positives = 308/445 (69%), Gaps = 21/445 (5%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M S   E  VY  RLSSVVPAT+TGE +V  L+N DLAMKLHYL+GVY FR EAV+GL  
Sbjct  1     MVSDGGEGSVYGFRLSSVVPATVTGEDKVHGLSNMDLAMKLHYLKGVYFFRREAVEGLTI  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
              DLK PMF  L+ +YP +GRIR S E GRP ++CND GVRIVEA+C K++DEW+ M D  
Sbjct  61    SDLKEPMFEWLKLYYPTSGRIRRS-ESGRPMIRCNDGGVRIVEAQCDKSVDEWMAMEDH-  118

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
             +  + L +DQVLGPDL FSPLVFIQ+TWFKCG +S+G+SWAHVLGD  S SDF+N +G  
Sbjct  119   DIHNCLTYDQVLGPDLAFSPLVFIQLTWFKCGAMSVGLSWAHVLGDVVSASDFINMWGSI  178

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPR-TQKLF--PFSLGSVGPVGDHWKL--TNTCKMAT  801
             MA     PP+        N  SPKP+  QKL   PFSL    P+GDHW L   N  +M T
Sbjct  179   MADHA--PPR----SLGTNPTSPKPQFHQKLSQKPFSLKMTHPIGDHWLLPRANHPRMGT  232

Query  802   QSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFH  981
             + +H+T  QL  L+   SG    A+ +PF+ +SA+ WK+LAK++  S  + VT+ +N + 
Sbjct  233   RYFHVTLDQLKRLLSAHSG--PHAQSQPFQLLSAIMWKTLAKIQGESEPKIVTVCRNSYG  290

Query  982   SRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSAD  1161
              RG+  +  +N  V+S V+A++ V+EADV +LA LI EK V E G+I+ET+  ++GKS D
Sbjct  291   ERGDDEI-LKNAMVVSRVEADIGVAEADVSDLAKLIAEKTVCENGMIEETVGGDDGKS-D  348

Query  1162  FFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGR  1341
             F VYGANLTFVNLEEVK++G +++G KP++A+Y+IGGVGDEGA LVLP P+     +GGR
Sbjct  349   FIVYGANLTFVNLEEVKLFGLEIQGHKPVWASYSIGGVGDEGAFLVLPAPDG----DGGR  404

Query  1342  IVNVILPEHLLGKLKNEISKELGTS  1416
              V  ILPE+ L  L+ E+  E G +
Sbjct  405   TVTAILPENQLAWLRRELKDEWGIA  429



>ref|XP_007018238.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY15463.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=433

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/432 (53%), Positives = 295/432 (68%), Gaps = 12/432 (3%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M S  +E+ V   RLSSVVPA +TG+ +   L++ DLAMKLHY++GVY F+SEAV G++ 
Sbjct  1     MVSAALESPVSGRRLSSVVPAEVTGDNKDFELSSMDLAMKLHYIKGVYFFQSEAVQGVSG  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKC-SKTIDEWLDMSDQ  453
              DLK PMFR LE ++  +GRIR S   GRPF+KCND+GVRIVEA C SKTIDEWL  SD 
Sbjct  61    SDLKEPMFRWLEFYFTTSGRIRRSSGTGRPFIKCNDAGVRIVEAHCDSKTIDEWLATSDH  120

Query  454   SEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP  633
             S  DHLL HDQVLGPDLGFSPLVF+Q TWF+ GG+SIG+SWAHVLGDAFS S F+N +G 
Sbjct  121   S-LDHLLAHDQVLGPDLGFSPLVFLQFTWFRSGGVSIGLSWAHVLGDAFSASAFINLWGQ  179

Query  634   AMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYH  813
              MAG+  +PPK   +   +N   P    +K  PFSL  V PVGD W   N   M T S+H
Sbjct  180   IMAGQ--VPPKSLQVHNPENSELPTSICRK--PFSLKKVDPVGDCWLTANNHNMQTYSFH  235

Query  814   ITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGN  993
             +T+KQL+ ++       Q+  +  FE +S++ W SL+K++E  G   VTI  N    R N
Sbjct  236   VTEKQLHHIVSTTRDPGQTDSISHFEILSSIIWHSLSKLREDMGPRIVTICSNNSLIREN  295

Query  994   GLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVY  1173
              +    NG + S V+A+  VS+ ++ ELA LI EK + E G+++E + +E    +DF VY
Sbjct  296   EM--PTNGMIFSTVEADFCVSKGEITELAKLIAEKRMPENGLVEELLRDE--ARSDFIVY  351

Query  1174  GANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNV  1353
             GANLTFV+LEE  +YG ++KG++P+F NYTI GVGDEG VL+LPGPEN  G   G+IV +
Sbjct  352   GANLTFVDLEEANLYGLELKGKRPMFVNYTINGVGDEGTVLILPGPENEGGS--GKIVTM  409

Query  1354  ILPEHLLGKLKN  1389
              LPE  L KLKN
Sbjct  410   TLPEDQLAKLKN  421



>emb|CBI19276.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   441 bits (1133),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 306/441 (69%), Gaps = 21/441 (5%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M S   E  VY  RLSSVVPAT+TGE +V  L+N DLAMKLHYL+GVY FR EAV+GL  
Sbjct  1     MVSDGGEGSVYGFRLSSVVPATVTGEDKVHGLSNMDLAMKLHYLKGVYFFRREAVEGLTI  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
              DLK PMF  L+ +YP +GRIR S E GRP ++CND GVRIVEA+C K++DEW+ M D  
Sbjct  61    SDLKEPMFEWLKLYYPTSGRIRRS-ESGRPMIRCNDGGVRIVEAQCDKSVDEWMAMEDHD  119

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
              ++  L +DQVLGPDL FSPLVFIQ+TWFKCG +S+G+SWAHVLGD  S SDF+N +G  
Sbjct  120   IHN-CLTYDQVLGPDLAFSPLVFIQLTWFKCGAMSVGLSWAHVLGDVVSASDFINMWGSI  178

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPR-TQKLF--PFSLGSVGPVGDHWKL--TNTCKMAT  801
             MA     PP+        N  SPKP+  QKL   PFSL    P+GDHW L   N  +M T
Sbjct  179   MADHA--PPR----SLGTNPTSPKPQFHQKLSQKPFSLKMTHPIGDHWLLPRANHPRMGT  232

Query  802   QSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFH  981
             + +H+T  QL  L+   SG    A+ +PF+ +SA+ WK+LAK++  S  + VT+ +N + 
Sbjct  233   RYFHVTLDQLKRLLSAHSG--PHAQSQPFQLLSAIMWKTLAKIQGESEPKIVTVCRNSYG  290

Query  982   SRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSAD  1161
              RG+  +  +N  V+S V+A++ V+EADV +LA LI EK V E G+I+ET+  ++GKS D
Sbjct  291   ERGDDEI-LKNAMVVSRVEADIGVAEADVSDLAKLIAEKTVCENGMIEETVGGDDGKS-D  348

Query  1162  FFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGR  1341
             F VYGANLTFVNLEEVK++G +++G KP++A+Y+IGGVGDEGA LVLP P+     +GGR
Sbjct  349   FIVYGANLTFVNLEEVKLFGLEIQGHKPVWASYSIGGVGDEGAFLVLPAPDG----DGGR  404

Query  1342  IVNVILPEHLLGKLKNEISKE  1404
              V  ILPE+ L  L+ E+  E
Sbjct  405   TVTAILPENQLAWLRRELKDE  425



>ref|XP_006366422.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=438

 Score =   438 bits (1126),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 236/446 (53%), Positives = 310/446 (70%), Gaps = 24/446 (5%)
 Frame = +1

Query  112   VENIVYDHRLSSVVPATITGEGRVLN-LTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLK  288
             VE ++ D +LSSVVP  ITG+ ++ +  TN DL MKLHY++ +Y F+++AV+GL+  DLK
Sbjct  4     VEKLISDVKLSSVVPGRITGDDKLQHEFTNMDLIMKLHYIKALYFFKNDAVEGLHIHDLK  63

Query  289   SPMFRMLEDFYPAAGRIR----TSPEDGRPFVKCNDSGVRIVEAKC-SKTIDEWLDMSDQ  453
              PMF +LE +YP +GRIR         GRPF+KCND GVRIVEAKC +KTIDEWL M+D 
Sbjct  64    LPMFNLLELYYPTSGRIRRCDDGDGGGGRPFIKCNDGGVRIVEAKCKNKTIDEWLAMND-  122

Query  454   SEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP  633
             +++D  L +DQ+LGP+LGFSPLVFIQ TWFKCGG+SIG+SWAH+LGD+FS S+FLN +  
Sbjct  123   NDHDEELVYDQLLGPELGFSPLVFIQFTWFKCGGMSIGLSWAHILGDSFSASNFLNMWAK  182

Query  634   AMAGRRDLPPKHPHMPTADN---HNSPKPRT-QKLFPFSLGSVGPVGDHWKLTNTCKMAT  801
              M G+  + P+  H  T  N   +N+P   +     PFSL  V PVGDHWK+T+T KM +
Sbjct  183   IMVGQL-ISPQFLHKSTNTNKLINNNPILLSIVGKLPFSLKRVDPVGDHWKITDTIKMQS  241

Query  802   QSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGF  978
              S+HIT KQLN LI KV G   + KVKPF+ I A  WK LAKV+ E S    +  +  G 
Sbjct  242   HSFHITQKQLNQLISKVCG---TYKVKPFDVICATMWKMLAKVRGEYSSEPAIVTIIRGD  298

Query  979   HSRGNGLLPCRNGQVISAVKA-EMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKS  1155
              +    ++   N  +IS V+A +++VSEAD  EL  LI EK VDET +++E ME+ENG  
Sbjct  299   DNETTEVMSSNNQVIISIVEADDVKVSEADTSELTELIAEKTVDETRVVEELMEKENG-I  357

Query  1156  ADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG  1335
              DF VYGANLTFVNLEE KIY  +++G++PIFA+Y I GVGDEG +LVLP        EG
Sbjct  358   PDFIVYGANLTFVNLEEAKIYDLELRGKQPIFASYNISGVGDEGVILVLPRL------EG  411

Query  1336  GRIVNVILPEHLLGKLKNEISKELGT  1413
             GRIVN++LP+  +  LKN++ +ELG 
Sbjct  412   GRIVNLVLPQKQIEGLKNKMREELGV  437



>ref|XP_004252810.1| PREDICTED: protein ECERIFERUM 1 [Solanum lycopersicum]
Length=445

 Score =   436 bits (1122),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 237/451 (53%), Positives = 306/451 (68%), Gaps = 29/451 (6%)
 Frame = +1

Query  112   VENIVYDHRLSSVVPATITGEGRVLN-LTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLK  288
             VE ++ D +LSSVVP  ITG+ ++ +  TN DL MKLHY++ +Y F+++ V+GL+  DLK
Sbjct  4     VEKLISDVKLSSVVPGRITGDDKLQHEFTNMDLIMKLHYIKALYFFKNDVVEGLHIHDLK  63

Query  289   SPMFRMLEDFYPAAGRIR------TSPEDGRPFVKCNDSGVRIVEAKC-SKTIDEWLDMS  447
              PMF +LE +YP +GRIR           GRPF+KCNDSGVR+VEAKC +KTIDEWL M+
Sbjct  64    LPMFNLLELYYPISGRIRRYDGGDGGGGGGRPFMKCNDSGVRVVEAKCKNKTIDEWLAMN  123

Query  448   DQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKY  627
             D +++D  L +DQ+LGPDLGFSPLVFIQ TWFKCGG+SIG+SWAH+LGD+FS S+FLN +
Sbjct  124   D-NDHDEELVYDQLLGPDLGFSPLVFIQFTWFKCGGMSIGLSWAHILGDSFSASNFLNIW  182

Query  628   GPAMAGRRDLPPKHPHMPTADNH-------NSPKPRTQKLFPFSLGSVGPVGDHWKLTNT  786
                M G++ + P+  H  T  N        N+P   T   FPFSL  V PVGDHWK+TN 
Sbjct  183   AKIMVGQQ-ISPQFLHKSTKTNKLINNNNNNNPILSTITKFPFSLKRVDPVGDHWKITNN  241

Query  787   CKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLE--TVT  960
              KM + S+HIT  QLN L+  V G     KVKPF+ I A  WK LAKV+     E   VT
Sbjct  242   IKMQSHSFHITQNQLNQLVSNVCGTYN--KVKPFDVICATLWKMLAKVRGEYSSEPAIVT  299

Query  961   IVKNGFHSRGNGLLPCRNGQVISAVKA-EMRVSEADVLELANLIGEKAVDETGIIDETME  1137
             I++    S     +   N   IS V+A +++VS+ D  EL  LIGEK VDET I++E M+
Sbjct  300   IIRGDHDSETTEAVSSNNQVTISTVEANDIKVSDVDTSELTELIGEKTVDETRIVEELMK  359

Query  1138  EENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
             +ENG S DF VYGANLTFVNLEE  IY  +++G+KPIFA+Y I GVGDEG +LVLP    
Sbjct  360   KENGVS-DFIVYGANLTFVNLEEAMIYDLEVRGKKPIFASYNISGVGDEGVILVLPRL--  416

Query  1318  LKGKEGGRIVNVILPEHLLGKLKNEISKELG  1410
                 EGGRIVN++LP+  +  LKN++ +ELG
Sbjct  417   ----EGGRIVNLVLPKKQIEGLKNKMREELG  443



>gb|KHG00208.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=429

 Score =   425 bits (1093),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 228/431 (53%), Positives = 291/431 (68%), Gaps = 12/431 (3%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M S  +E  V    LSSVVPA  TG  + L LTN DLAMKLHY++GVY F+ EA  GL+ 
Sbjct  1     MVSGSLECPVRGQMLSSVVPAKATGGNKDLELTNMDLAMKLHYIKGVYFFQPEAAQGLSI  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
              DLK PMF+ LE +Y A+GRIR S E GRPF+KCND GVRIVEA+C K++DEWL M+  +
Sbjct  61    HDLKEPMFQCLELYYAASGRIRRS-ESGRPFIKCNDGGVRIVEAQCDKSVDEWLAMARNN  119

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
               DH+L HDQVLGPDLGFSPLVF+Q T FKCGG+S+G+SWAHVLGDAFS S+FLN +G  
Sbjct  120   --DHMLGHDQVLGPDLGFSPLVFVQFTRFKCGGVSVGLSWAHVLGDAFSASNFLNLWGQI  177

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHI  816
             MAG++   P  P+ P  +    P   ++K  PFSL  V PVGD+W   N  KM T S+ I
Sbjct  178   MAGKQ--VPLQPNSPAHNISQFPTSISRK--PFSLKKVDPVGDYWLTPNNSKMGTHSFRI  233

Query  817   TDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNG  996
             T KQL+  I     +    K+  FE ISA+ W+SL+K +E SG   VTI  N   ++   
Sbjct  234   TAKQLHYYITTYC-IHDPNKISDFEIISAMIWQSLSKAREDSGPNIVTICSNNSANK-MA  291

Query  997   LLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
             +LP  NG  +S V+A+  VS  ++ ELA LI EK +DE+G+I E ++ +  +S DF VYG
Sbjct  292   MLP-SNGMTLSTVEADFCVSRVEIAELAKLIAEKKMDESGLIGELIKGDEVRS-DFIVYG  349

Query  1177  ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVI  1356
             ANLTFVNLE + +YG +MKG KP+ ANY + GVG+EG V+VLP  E   G   G++V + 
Sbjct  350   ANLTFVNLEGMNVYGIEMKGLKPVCANYMVNGVGEEGTVVVLPSNEK-DGGNNGKMVTIT  408

Query  1357  LPEHLLGKLKN  1389
             LP+HLL KL N
Sbjct  409   LPQHLLLKLNN  419



>gb|KDP41488.1| hypothetical protein JCGZ_15895 [Jatropha curcas]
Length=438

 Score =   418 bits (1075),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 223/430 (52%), Positives = 277/430 (64%), Gaps = 9/430 (2%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED  315
             RLSSVVPA +T +     LTN DLA+KLHY+RGVY F +EAV GL   +LK PMF  L  
Sbjct  15    RLSSVVPAEVTSDKEDHKLTNIDLALKLHYIRGVYFFTAEAVQGLTIYELKKPMFPWLAQ  74

Query  316   FYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDH--LLHHDQV  489
             +Y  +GRIR S   GRPF+KCND GVRIVEA C KTI+E +    ++  DH   L HDQV
Sbjct  75    YYTVSGRIRRSENGGRPFIKCNDGGVRIVEAYCDKTIEELMTAIAKNHEDHSRFLVHDQV  134

Query  490   LGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKH  669
             LGPDLGFSPLV+IQ TWFKCGG+S+G+SWAH+LGD FS S+F+N +G  M G +      
Sbjct  135   LGPDLGFSPLVYIQFTWFKCGGMSVGLSWAHLLGDPFSASNFINMWGQFMRGHQ--LSNS  192

Query  670   PHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFK  849
              H+P       P    +K  PFS+  V PVGD W  T+  KM T  +H T KQL+ +   
Sbjct  193   LHVPKTKKPEHPPSPLRK--PFSIKRVDPVGDCWVTTDNYKMETHVFHFTAKQLDNIESS  250

Query  850   VSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVIS  1029
             +S + Q      FE ISA+ WKSL+KV+  SG   VTI     +SR +      N    S
Sbjct  251   ISDVAQPVNFSKFELISAIIWKSLSKVRGDSGPRIVTICAR--NSRNSEREIPSNKMEFS  308

Query  1030  AVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEV  1209
              V+A+   ++ DV ELA LI EK  +E  +I+ETME E+GK  D+  YG+NLTFVNLEE 
Sbjct  309   IVRADFSAAKCDVHELAKLIAEKKEEENSLIEETMESEDGKFHDYIAYGSNLTFVNLEEA  368

Query  1210  KIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE-GGRIVNVILPEHLLGKLK  1386
              IYG ++KG KPIFA Y+I G GDEG VLVLPGPEN   K  GGR V V LPE+ L +LK
Sbjct  369   NIYGLELKGNKPIFAYYSIKGFGDEGTVLVLPGPENGTDKRGGGRTVTVNLPENQLVELK  428

Query  1387  NEISKELGTS  1416
             NE+ +E G +
Sbjct  429   NELVEEWGIA  438



>ref|XP_008352717.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Malus domestica]
 ref|XP_008361578.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Malus domestica]
Length=444

 Score =   412 bits (1059),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 296/440 (67%), Gaps = 31/440 (7%)
 Frame = +1

Query  136   RLSSVVPATITGE-GRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             RLSSVVPAT+T +  +V  LT+ DLAMKLHY++GVYLF+SEAV+GL   DLK P+F++L+
Sbjct  15    RLSSVVPATVTSDRNKVHELTDMDLAMKLHYIKGVYLFKSEAVEGLTIYDLKKPIFQLLQ  74

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMS--DQSEYDHLLHHDQ  486
              ++ A+GRIR S E GRPF++CNDSGVRIVEA C +T+DE L M+  D S ++ L + +Q
Sbjct  75    LYFTASGRIRRS-ETGRPFIRCNDSGVRIVEAHCEETVDELLAMAIEDSSAFNGLAY-NQ  132

Query  487   VLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPK  666
             VLGPDLGFSPLVF+Q TWFKCGG+S+G+SWAHVLGDAFS SDF+N +G  MAG       
Sbjct  133   VLGPDLGFSPLVFVQFTWFKCGGMSVGLSWAHVLGDAFSASDFINMWGKFMAG-------  185

Query  667   HPHMPTADNHNSPKPRTQKL-------FPFSLGSVGPVGDHWKLTNTCKMATQSYHITDK  825
               H P          R  +L        P SL  V  VGDHW  TN+C+  T ++HI+ K
Sbjct  186   --HAPPKSPRPPEPGRRSQLQTLSIPGTPCSLKRVDSVGDHWLTTNSCQTKTHTFHISAK  243

Query  826   QLNALIFKVSG-LKQSAKVKPFEAISALFWKSLAKVKEGSG--LETVTIVKNGFHSRGNG  996
             +L+ L+  +S    QSAK   FE +SA+ WKSL+K K+ +   ++ VTI     +SR   
Sbjct  244   KLDHLLSSISCPPSQSAKFSAFEVLSAVIWKSLSKTKKENSEKIQIVTICAK--NSRERE  301

Query  997   LLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
             L    N  V S V+A+  V++ADV +LA LI  K  +E GII E +  +NG S DF  YG
Sbjct  302   LELPSNDMVFSTVEADFSVAKADVSKLAELIVNKRAEENGIIREVVRRDNGNS-DFIAYG  360

Query  1177  ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLP-GPENLKGK---EGGRI  1344
             A LTFVNLEE +IYG ++KGQKP++ANYTI GVGDEG VLVLP GP+  K K     G +
Sbjct  361   AKLTFVNLEEAEIYGLELKGQKPVYANYTIDGVGDEGGVLVLPAGPKYGKDKARANEGHL  420

Query  1345  VNVILPEHLLGKLKNEISKE  1404
             V  ILPE+ L +L+NE+  E
Sbjct  421   VTAILPENQLAQLRNELETE  440



>ref|XP_008219248.1| PREDICTED: protein ECERIFERUM 1 [Prunus mume]
Length=426

 Score =   411 bits (1056),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 226/436 (52%), Positives = 291/436 (67%), Gaps = 25/436 (6%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLN-LTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             RLSSVVPAT+T E  +++ LT+ DLAMKLHY+ G+Y F+S+AV+GL   DLK PMF +L+
Sbjct  7     RLSSVVPATVTAEQNMVHELTDMDLAMKLHYIEGLYFFKSDAVEGLTIYDLKKPMFHLLQ  66

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMS--DQSEYDHLLHHDQ  486
               + A+GRIR S E GRPF+KCNDSGVRIVEA   + +D+WL M+  D S +D L + +Q
Sbjct  67    LQFTASGRIRRS-ETGRPFIKCNDSGVRIVEAYSEEAMDQWLAMAMEDSSRFDGLTY-NQ  124

Query  487   VLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPK  666
              LGPDLGFSPLVF+Q TWFKCGG+S+G+SWA+VLGDAFS S F+N  G  MAG   LP K
Sbjct  125   ALGPDLGFSPLVFLQFTWFKCGGMSVGLSWANVLGDAFSASAFINMLGKIMAGH--LPLK  182

Query  667   HPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIF  846
               H+P       P P T      SL  V  VGD+W   N CKM   ++H++ K+L+ L+ 
Sbjct  183   PLHVPVPGKPEFPAPSTPNT-SSSLKRVDSVGDYWVTPNNCKMRKHTFHVSAKKLDHLLS  241

Query  847   KVSGLKQSAKVKPFEAISALFWKSLAKVKEGSG-LETVTIVKNGFHSRGNGLLPCRNGQV  1023
                   QS K   FE +SA+ WKSL+K+KE S     VTI  N  H R   +    N  V
Sbjct  242   -----NQSTKFSAFEVLSAIIWKSLSKIKENSAQTRRVTICTNS-HEREYEI--PSNNMV  293

Query  1024  ISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLE  1203
             +S V+A+  V+EADV EL  LI  +  +E GI++E    E+G S+DF  YGANL FVNLE
Sbjct  294   LSTVEADFLVTEADVSELVELILNRRAEEKGIVEEMKGLESG-SSDFIAYGANLAFVNLE  352

Query  1204  EVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE-----GGRIVNVILPEH  1368
             E +IYG ++KGQKP++ANY I GVGDEG VLVLPGP    GKE     GGR+V V+LPE+
Sbjct  353   EAEIYGLELKGQKPVYANYCINGVGDEGVVLVLPGPN--YGKEEANIRGGRLVTVVLPEN  410

Query  1369  LLGKLKNEISKELGTS  1416
              + +LK E+ +E  T+
Sbjct  411   EVAQLKTELQREWSTA  426



>ref|XP_002514050.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF48633.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=436

 Score =   409 bits (1052),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 230/445 (52%), Positives = 290/445 (65%), Gaps = 18/445 (4%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEG-RVLNLTNADLAMKLHYLRGVYLFRSEAVDGLN  273
             M  P     V   RLS+VVPA +TGE  +   LTN DLA+KLHY++GVY F +EAV GL 
Sbjct  1     MAPPTPSTPVSGVRLSTVVPAEVTGESNQDYKLTNMDLALKLHYIKGVYFFAAEAVQGLT  60

Query  274   TGDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQ  453
             T DLK PMF  L  +Y A+GRIR S E GRPF+KCNDSGVRIVEA C +TI+EW+  +D 
Sbjct  61    TSDLKRPMFPCLSLYYTASGRIRRS-ETGRPFIKCNDSGVRIVEAFCDRTIEEWM-ATDN  118

Query  454   SEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP  633
                  LL HDQVLGPDLGF+PLV+IQ TWFKCGGLS+G+SWAHVLGD FS S+F+N +  
Sbjct  119   DLDSFLLAHDQVLGPDLGFTPLVYIQFTWFKCGGLSVGLSWAHVLGDPFSASNFINNWAQ  178

Query  634   AMAGRRDLPPKHPHMPTADNHNSPK-PRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSY  810
                G   +P K  H+P   N N P+ P +    PFSL  V PVGD+W  TN CKM T S+
Sbjct  179   FTQGH--VPCKSLHVP---NTNEPECPPSIPREPFSLKRVDPVGDYWLTTNNCKMETYSF  233

Query  811   HITDKQLNALIFK--VSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHS  984
               T KQL+ ++ +  +S L QS+K+  FE ISA+ WK L+K++E SG    TI      +
Sbjct  234   VFTAKQLDTILSESAISDLFQSSKISHFEVISAIIWKLLSKIREDSGPRIATICTRKSRN  293

Query  985   RGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENG-KSAD  1161
               N +    N  V S V+A+  V++  V ELA LI EK   E   I+  ME + G   ++
Sbjct  294   HENEV--SSNKMVFSTVRADFSVAKGGVDELAALIAEKQEGENRWIEGIMECDKGDDQSN  351

Query  1162  FFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLP-GPENLKGKEGG  1338
             +  YGANLTFVN+EE  IYG ++K  KP++ANYTI GVGDEGAV+VLP GP+  KG  G 
Sbjct  352   YIAYGANLTFVNMEEANIYGLELKEHKPVYANYTINGVGDEGAVIVLPAGPD--KGSNGR  409

Query  1339  RIVNVILPEHLLGKLKNEISKELGT  1413
             R V +ILPE  L +LK  + +E GT
Sbjct  410   R-VTLILPEDQLKELKYMVREEWGT  433



>ref|XP_008352716.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Malus domestica]
 ref|XP_008361577.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Malus domestica]
Length=445

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 229/441 (52%), Positives = 296/441 (67%), Gaps = 32/441 (7%)
 Frame = +1

Query  136   RLSSVVPATITGE-GRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             RLSSVVPAT+T +  +V  LT+ DLAMKLHY++GVYLF+SEAV+GL   DLK P+F++L+
Sbjct  15    RLSSVVPATVTSDRNKVHELTDMDLAMKLHYIKGVYLFKSEAVEGLTIYDLKKPIFQLLQ  74

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMS--DQSEYDHLLHHDQ  486
              ++ A+GRIR S E GRPF++CNDSGVRIVEA C +T+DE L M+  D S ++ L + +Q
Sbjct  75    LYFTASGRIRRS-ETGRPFIRCNDSGVRIVEAHCEETVDELLAMAIEDSSAFNGLAY-NQ  132

Query  487   VLGPDLGFSPLVFIQ-ITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             VLGPDLGFSPLVF+Q  TWFKCGG+S+G+SWAHVLGDAFS SDF+N +G  MAG      
Sbjct  133   VLGPDLGFSPLVFVQQFTWFKCGGMSVGLSWAHVLGDAFSASDFINMWGKFMAG------  186

Query  664   KHPHMPTADNHNSPKPRTQKL-------FPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
                H P          R  +L        P SL  V  VGDHW  TN+C+  T ++HI+ 
Sbjct  187   ---HAPPKSPRPPEPGRRSQLQTLSIPGTPCSLKRVDSVGDHWLTTNSCQTKTHTFHISA  243

Query  823   KQLNALIFKVSGL-KQSAKVKPFEAISALFWKSLAKVKEGSG--LETVTIVKNGFHSRGN  993
             K+L+ L+  +S    QSAK   FE +SA+ WKSL+K K+ +   ++ VTI     +SR  
Sbjct  244   KKLDHLLSSISCPPSQSAKFSAFEVLSAVIWKSLSKTKKENSEKIQIVTICAK--NSRER  301

Query  994   GLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVY  1173
              L    N  V S V+A+  V++ADV +LA LI  K  +E GII E +  +NG S DF  Y
Sbjct  302   ELELPSNDMVFSTVEADFSVAKADVSKLAELIVNKRAEENGIIREVVRRDNGNS-DFIAY  360

Query  1174  GANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLP-GPENLKGK---EGGR  1341
             GA LTFVNLEE +IYG ++KGQKP++ANYTI GVGDEG VLVLP GP+  K K     G 
Sbjct  361   GAKLTFVNLEEAEIYGLELKGQKPVYANYTIDGVGDEGGVLVLPAGPKYGKDKARANEGH  420

Query  1342  IVNVILPEHLLGKLKNEISKE  1404
             +V  ILPE+ L +L+NE+  E
Sbjct  421   LVTAILPENQLAQLRNELETE  441



>ref|XP_007222434.1| hypothetical protein PRUPE_ppa006117mg [Prunus persica]
 gb|EMJ23633.1| hypothetical protein PRUPE_ppa006117mg [Prunus persica]
Length=426

 Score =   403 bits (1035),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 220/441 (50%), Positives = 289/441 (66%), Gaps = 35/441 (8%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLN-LTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             RLS+VVPAT T E  +++ LT+ DLAMKLHY+ G+Y F+S+AV+GL   DLK P F +L+
Sbjct  7     RLSTVVPATATAEQNMVHELTDMDLAMKLHYIEGLYFFKSDAVEGLTIYDLKKPTFHLLQ  66

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMS-DQSEYDHLLHHDQV  489
              ++ A+GRIR S E GRPF+KCNDSGVRIVEA   + +D+WL M+ + S   + L ++Q 
Sbjct  67    LYFTASGRIRRS-ETGRPFIKCNDSGVRIVEAYSEEAMDQWLAMAMEDSSLFNGLTYNQA  125

Query  490   LGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKH  669
             LGPDLGFSPLVF+Q TWFKCGG+S+G+SWA VLGDAFS S F+N +G  MAG   L P H
Sbjct  126   LGPDLGFSPLVFLQFTWFKCGGMSVGLSWASVLGDAFSASAFINMWGKIMAGHLPLKPLH  185

Query  670   ------PHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
                   P  P     N+           SL  V  VGD+W   N CKM   ++H++ K+L
Sbjct  186   VPVPGKPEFPALSTPNTSS---------SLKRVDSVGDYWVTPNNCKMRKHTFHVSAKKL  236

Query  832   NALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGS-GLETVTIVKNGFHSRGNGLLPC  1008
             + L+       QS K   FE +SA+ WKSL+K+KE S     VTI  N  H R   +   
Sbjct  237   DHLLS-----NQSTKFSAFEVLSAIIWKSLSKIKENSEQTRRVTICTNS-HERKYEI--P  288

Query  1009  RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLT  1188
              N  V+  V+A+  V+EADV EL  LI  +  +E GI++E    E+G S+DF  YGANLT
Sbjct  289   SNNIVLCTVEADFLVTEADVSELVELILNRRAEEKGIVEEMKGLESG-SSDFIAYGANLT  347

Query  1189  FVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE-----GGRIVNV  1353
             FVNLEE +IYG ++KGQKP++ANY+I GVGDEG VLVLPGP+   GKE     GGR+V V
Sbjct  348   FVNLEEAEIYGLELKGQKPVYANYSINGVGDEGVVLVLPGPK--YGKEEANIHGGRLVTV  405

Query  1354  ILPEHLLGKLKNEISKELGTS  1416
             +LPE+ + +LK E+ +E  T+
Sbjct  406   VLPENEVAQLKTELQREWSTA  426



>ref|XP_002264429.1| PREDICTED: protein ECERIFERUM 26 [Vitis vinifera]
Length=435

 Score =   402 bits (1034),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 225/442 (51%), Positives = 286/442 (65%), Gaps = 17/442 (4%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M S D  N+VYD +LSSV P  +TG   V   +N DLAMKLHYLRGVY F SEAV GL  
Sbjct  1     MVSSDHLNLVYDIKLSSVGPGHVTGSDVVHEPSNMDLAMKLHYLRGVYFFSSEAVQGLTV  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
               +K PMF  L  +Y   GR R S   GRP +KCND GVRI+EAKC KTIDEWL+M D S
Sbjct  61    YRIKEPMFTWLNHYYWTCGRFRRS-NSGRPLIKCNDCGVRIIEAKCDKTIDEWLEMKDSS  119

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
                 LL  + ++GP+L FSPLVF+Q+T FKCGG+S+G+SWAHVLGDAFS SDF+N +G A
Sbjct  120   -LTKLLVSNHIVGPELPFSPLVFLQVTSFKCGGMSLGLSWAHVLGDAFSASDFINMWGQA  178

Query  637   MAGRRDLPPKHP-HMPTADNH-NSPKPRTQ-KLFPFSLGSVGPVGDHWKLTNTCKMATQS  807
             MA +    P+HP  +P +      P  R+Q    P S+  V PVGD+W   N CKM   S
Sbjct  179   MANQL---PQHPVDLPKSSFMLVKPANRSQLATDPLSIKRVDPVGDNWITVNNCKMEPFS  235

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
             +HIT  QL  L  K+SG K +    PFE +  +FW+S+A+V      E VT+ KN   SR
Sbjct  236   FHITATQLTQLQAKISGHKATP---PFECLCTIFWQSIARVCSRHEPEIVTVCKNERGSR  292

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFF  1167
               G L   + Q+IS VKA+  V EA   ++A L+ E AVDE G+I+  +E + G S DF 
Sbjct  293   RTGTLS-NSAQIISTVKADFSVKEAKPKDVAALLVEHAVDERGLIEAAVERDGGVS-DFI  350

Query  1168  VYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVL-PGPENLKGKEG--G  1338
             +YGANLTFVNLEE   YG ++ GQKP+  +Y I G+GDEG VLV  PGP++  GK+   G
Sbjct  351   IYGANLTFVNLEEASFYGLELNGQKPVHVSYLIDGIGDEGVVLVAPPGPKD-SGKDSNEG  409

Query  1339  RIVNVILPEHLLGKLKNEISKE  1404
             +IV VILPE  + +LK+E+ +E
Sbjct  410   KIVTVILPEDQVMELKSELKRE  431



>ref|XP_002306532.2| ECERIFERUM 2 family protein [Populus trichocarpa]
 gb|EEE93528.2| ECERIFERUM 2 family protein [Populus trichocarpa]
Length=436

 Score =   402 bits (1032),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 223/428 (52%), Positives = 281/428 (66%), Gaps = 10/428 (2%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED  315
             +LSSVVPA +TG+     LTN DLA KLHY+RGV  F +E V GL   DLK PMF +L  
Sbjct  14    KLSSVVPAEVTGDNEDRKLTNMDLAFKLHYVRGVSFFSNETVQGLTIYDLKEPMFSLLAL  73

Query  316   FYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLG  495
             +  A+GRIR S E GRPF+KCND GVRIVEA C KTI+EWL M+D    D  L +DQVLG
Sbjct  74    YPTASGRIRKS-ESGRPFIKCNDGGVRIVEAHCDKTIEEWLKMNDHQPLDDYLVYDQVLG  132

Query  496   PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPH  675
             PDLGFSPLVF+Q TWFKCGG+S+G+SWAHVLGD FS S F+N +G  M G   +P + PH
Sbjct  133   PDLGFSPLVFVQFTWFKCGGMSVGLSWAHVLGDPFSASTFINTWGKIMQGH--VPSRSPH  190

Query  676   MPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIF-KV  852
             +P       P   T++  PFSL  V PVGD W  TN CKM T S H+T +QL+ ++   +
Sbjct  191   VPNTKKSKYPLSTTRRK-PFSLKRVDPVGDSWLSTNNCKMETHSLHVTAEQLDDILSDNI  249

Query  853   SGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISA  1032
              G KQ  ++  F+ +SA+ WKSL+KV+E SG   VTI     +SR N      N  V S 
Sbjct  250   RGQKQPTELSHFQVLSAIIWKSLSKVREDSGPRIVTICTG--NSRVNDPEVPSNNLVFSI  307

Query  1033  VKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVK  1212
             ++A+  V+E ++ ELA LI EK  +E  +I++ +E +  +  D   YG NLTFV+LEE  
Sbjct  308   IQADFSVAEGEIYELAELIAEKQEEENSLIEDIVESDEVE-FDRIAYGTNLTFVDLEEAN  366

Query  1213  IYGFDMKGQKPIFANYTIGGVGDEGAVLVLP-GPENLKGK-EGGRIVNVILPEHLLGKLK  1386
             IYG ++KGQKPIFANY+I GVG+ G VLVLP GP N  GK   GR V V LPE+ L +L 
Sbjct  367   IYGLELKGQKPIFANYSIKGVGEGGVVLVLPAGPGNGSGKVSSGRTVTVTLPENQLSRLM  426

Query  1387  NEISKELG  1410
             NE+    G
Sbjct  427   NELKLHWG  434



>ref|XP_010277517.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=433

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 212/448 (47%), Positives = 292/448 (65%), Gaps = 24/448 (5%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M   +VE+ VYD +LSSVVPA+ITGE RV   ++ DLA+KLHYLRG+Y F+S  V GL  
Sbjct  1     MAPAEVEDPVYDIKLSSVVPASITGEDRVHEFSSMDLALKLHYLRGLYFFKSNMVQGLTI  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
              D K  +F+ LE     +GRIR S E GRP +KCND GVR++EA+CS T+D+WL+M+D S
Sbjct  61    YDYKKHLFKWLEINGVLSGRIRRS-ESGRPSIKCNDGGVRVIEAQCSNTLDQWLEMNDYS  119

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
              +  L   +QVLGPDLGFSPL+ +Q TWFKCGG+S+G+SWAHVLGD FS S  +N +   
Sbjct  120   LHRRLFP-NQVLGPDLGFSPLILVQFTWFKCGGVSVGLSWAHVLGDPFSASRLINIWAQM  178

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKL------FPFSLGSVGPVGDHWKLTNTCKMA  798
             ++ R  LPPK  ++P A+    PKP+  +        P S+  V PVG+HW + N C+M 
Sbjct  179   LSDR--LPPKSFNLPKAE----PKPQMPETPVHDGSEPVSVKQVEPVGEHWLVANNCQME  232

Query  799   TQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGF  978
             T S+ +T  +L  L  K+    Q+ K   FE++SA+ W+SLA+V+      TVT+ + G 
Sbjct  233   TFSFQLTSAELTNLHSKMR--NQTGKTPTFESLSAIIWQSLARVRGKPEPRTVTVYRKGR  290

Query  979   HSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSA  1158
             H    G     N Q +S VKA+  +++A   ELA ++  ++V+E   I++ +E + G + 
Sbjct  291   HDGELG-----NNQAVSVVKADFSIADASASELAQMLVGRSVEENSKIEKAVERDQGLT-  344

Query  1159  DFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE--NLKGKE  1332
             DF   G NLTFVNLEEV++YG + +GQKPI+AN  I GVGDEG VLVLPGPE  ++    
Sbjct  345   DFIALGVNLTFVNLEEVELYGLEFRGQKPIYANCLIDGVGDEGVVLVLPGPESGSIAEGR  404

Query  1333  GGRIVNVILPEHLLGKLKNEISKELGTS  1416
             GGR V V LPE+ + +LKNE+ +E   S
Sbjct  405   GGRTVTVTLPENQVAQLKNELQREWCIS  432



>ref|XP_008338959.1| PREDICTED: protein ECERIFERUM 1 [Malus domestica]
Length=432

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 219/431 (51%), Positives = 287/431 (67%), Gaps = 20/431 (5%)
 Frame = +1

Query  136   RLSSVVPATITG-EGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             RLSSVVPAT+TG E +V  LTN DLAMKLHY++GVY F+SEAV+GL   DLK PMF +L+
Sbjct  8     RLSSVVPATMTGDENKVHELTNMDLAMKLHYIKGVYFFKSEAVEGLTIYDLKKPMFELLQ  67

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLD--MSDQSEYDHLLHHDQ  486
                 A+GRIR + E GRPF+KCND GVRIVEA   +T+DEW    + D S +D L + +Q
Sbjct  68    LHITASGRIRIT-ETGRPFIKCNDGGVRIVEAHSEETVDEWFARAVEDSSLFDGLAY-NQ  125

Query  487   VLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPK  666
              LGPDLG+SPLVF+Q TWFKCGG+++G+SWA+VLGDAFS SDF+N +G  MAG   +P K
Sbjct  126   SLGPDLGYSPLVFLQFTWFKCGGMAVGLSWANVLGDAFSASDFMNMWGKIMAGH--VPRK  183

Query  667   HPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIF  846
               H+P    H  P   +    PFSL  V PVGD+W   N  KM    +H++ ++L+ L+ 
Sbjct  184   LLHVPPPGKHEFPSLSSVPKTPFSLKRVDPVGDYWVTPNNYKMRKHIFHVSAEKLDHLVS  243

Query  847   KVSG--LKQSAKV-KPFEAISALFWKSLAKVKEGS-GLETVTIVKNGFHSRGNGLLPCR-  1011
              +S     QSAKV   FE +SA+ WK+L+K+KE S  +  VTI     H    G    R 
Sbjct  244   NISCPPSNQSAKVSSAFEVLSAIIWKTLSKIKESSEQIRRVTICTKNAH---KGEFEIRT  300

Query  1012  NGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDE-TMEEENGKSADFFVYGANLT  1188
             N  V S V+A   V+EA+V +L  L+  K  +E G I+E T  EE G ++DF  YGA LT
Sbjct  301   NDMVWSTVEANFLVAEAEVSDLVELMMNKRAEENGAIEEMTGREEGGINSDFIAYGAKLT  360

Query  1189  FVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEH  1368
             F+NLEE +IY  ++KGQKP++ANY + GVGDEG VLVLP   N      GR+V+V+LPE+
Sbjct  361   FMNLEEAEIYRLELKGQKPVYANYGVSGVGDEGLVLVLPASTN----NVGRLVSVVLPEN  416

Query  1369  LLGKLKNEISK  1401
              L +LK+E+ +
Sbjct  417   QLAQLKSELQR  427



>ref|XP_011074277.1| PREDICTED: protein ECERIFERUM 1 [Sesamum indicum]
Length=435

 Score =   395 bits (1015),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 218/443 (49%), Positives = 288/443 (65%), Gaps = 30/443 (7%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN++YD +LS+VVPA+IT EG+   LTN DLAMKLHY+  V+ F  +A +GL+  DLK+P
Sbjct  10    ENVIYDIKLSTVVPASITAEGKTRQLTNMDLAMKLHYITTVHFFGRDAAEGLSIQDLKNP  69

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             MF+ L+ +YP  GRIR     GRPF+KCNDSGVRIVEAKC+KT+DEWL+  +  ++  LL
Sbjct  70    MFQWLQPYYPICGRIRRHDGGGRPFIKCNDSGVRIVEAKCAKTVDEWLETVNGGDHHRLL  129

Query  475   HHDQVLGPD-LGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRR  651
              + Q L  D  GF+PLVF+Q T FKCGGL +G+SWAH+LGDAFS ++ +N +G  MA R 
Sbjct  130   VYKQPLVADNFGFTPLVFLQFTEFKCGGLCVGMSWAHILGDAFSATECINMWGKFMANRT  189

Query  652   ------DLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYH  813
                     PP   H+  A +              SL  + P+GD+W   N  KM   ++H
Sbjct  190   PAPHILSTPPIIHHLEMASSCR------------SLKLLDPLGDNWLTPNNLKMQMDTFH  237

Query  814   ITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNG--FHSR  987
             +T+KQL+    ++SG  ++ KVKPFE ISA+ WKSLAK+++   +  VT+ K G    + 
Sbjct  238   LTEKQLSD---QLSGGNKNYKVKPFELISAIVWKSLAKIRDSCSM-IVTVCKKGEFVQTS  293

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETME--EENGKSAD  1161
                 LP    QVI  V+AEM  +  D LELA LI  K VDET +I++ ME    NG  AD
Sbjct  294   MENELPGNMHQVIGIVEAEM--TGTDPLELAELIAGKLVDETSMIEKRMEGGSVNGHPAD  351

Query  1162  FFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGR  1341
             + +YGANLTFVNLE+V + G  ++GQ P+FAN +IGGVGDEGAV+V+P      G  GGR
Sbjct  352   YILYGANLTFVNLEDVNLCGLKLRGQGPVFANLSIGGVGDEGAVVVVPYSGQGNGS-GGR  410

Query  1342  IVNVILPEHLLGKLKNEISKELG  1410
              VNVILPE  L +LKNE+  E G
Sbjct  411   TVNVILPEPQLLQLKNELRVEWG  433



>ref|XP_010060100.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW66641.1| hypothetical protein EUGRSUZ_F00422 [Eucalyptus grandis]
Length=458

 Score =   395 bits (1016),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 213/446 (48%), Positives = 288/446 (65%), Gaps = 13/446 (3%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M + DV+++V++ +LSSVVP  +T    V  LT+ DLAMKLHYLRG+Y FRS+A  GL  
Sbjct  1     MVASDVKSLVHNVKLSSVVPGKVTPNNTVHELTSMDLAMKLHYLRGLYFFRSDAAQGLTN  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
              DLK PM   LE +  A+GRIR S E  RP +KCNDSG+RIVEA+C +++DEWL  + + 
Sbjct  61    FDLKKPMAYWLELYPTASGRIRWS-ETERPVIKCNDSGIRIVEAQCDRSLDEWLAATKED  119

Query  457   ---EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKY  627
                E   LL H +VLGP LGFSP++++Q TWF CGG+ +G++WAHVLGDAF+ S F+N +
Sbjct  120   GGWELQDLLVHSEVLGPALGFSPMIYVQFTWFACGGICVGLNWAHVLGDAFAASSFINVW  179

Query  628   GPAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS  807
             G  MAG    PPK  H    +    P        P ++  V PVGD W + N CK+AT S
Sbjct  180   GQMMAGHA--PPKPLHTLVPERPAYPADSGLGTAPSTIKRVNPVGDCWLVVNNCKLATYS  237

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
              HIT +QL+ ++ K  GL   +K   FE +SAL WKSL+K++  +G + VT+ +      
Sbjct  238   IHITMQQLDHIMGKY-GLFGESKTSHFELLSALIWKSLSKIRGDNGPKVVTVCEKNVRRE  296

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFF  1167
              N L    NG  +S  +     +EA+V +LA LI E AV+E G I+E +E+++GK  D+ 
Sbjct  297   LNPL--PSNGMGLSRAEVNFLAAEAEVSDLARLIAE-AVNENGSIEEMVEKDDGK-LDYI  352

Query  1168  VYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GR  1341
              YGANLTFVNLE   +YG ++KG+KPIFANYTI GVGDEG VLVLPGP N   K G  GR
Sbjct  353   AYGANLTFVNLEGADVYGLELKGRKPIFANYTISGVGDEGVVLVLPGPGNGNEKGGGFGR  412

Query  1342  IVNVILPEHLLGKLKNEISKELGTSP  1419
              V ++LP   + +++ EI++  G  P
Sbjct  413   TVTMVLPHAQMAQIRKEINETWGLLP  438



>ref|XP_010060103.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW66643.1| hypothetical protein EUGRSUZ_F00425 [Eucalyptus grandis]
Length=439

 Score =   392 bits (1006),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 211/447 (47%), Positives = 281/447 (63%), Gaps = 14/447 (3%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M + DV++ V+  +LSS+VP  +TG      L + DLAMKLHYLRG+Y FRS+AV GL  
Sbjct  1     MVASDVKSPVHSVKLSSMVPPKVTGNNTEHKLRSMDLAMKLHYLRGLYFFRSDAVQGLTI  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
              DLK  M +  E +  A+GRIR S E  RP +KCNDSGVRIVEA+C +++DEWL  + + 
Sbjct  61    FDLKKAMGQTQELYPSASGRIRQS-ESERPVIKCNDSGVRIVEARCDRSLDEWLVATKEE  119

Query  457   ----EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNK  624
                 E   LL H QVLGPDLGFSPL+++Q TWF CGG+ + + WAHVLGDAF+ S F+N 
Sbjct  120   DGGWELQDLLVHSQVLGPDLGFSPLIYVQFTWFACGGICVSLGWAHVLGDAFAASSFINM  179

Query  625   YGPAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQ  804
             +G  MAG    PPK  H P  +    P        P ++  V PVGD W + N+C M T 
Sbjct  180   FGTIMAGHA--PPKSLHAPIPERPKFPAESRLDTAPSTVKRVDPVGDCWLVINSCNMETY  237

Query  805   SYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHS  984
             S H+T +QLN +  K  GL   +K   FE +SAL WKSL+K++   G + VT+ +N    
Sbjct  238   SIHVTSQQLNHITGKY-GLLGESKTSHFELLSALIWKSLSKIRGDGGPKVVTVCENNVRR  296

Query  985   RGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADF  1164
               N L    NG  +S  +     +EA+V +LA  I E AV+E G+I+E +  ++GK  DF
Sbjct  297   ELNPL--PSNGMDLSRAEVNFSAAEAEVSDLARQITE-AVNENGLIEEMVGRDDGK-LDF  352

Query  1165  FVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--G  1338
               YGANLTFVNLE   +YG ++KGQKPIFA+Y + GVGDEG VL+LPGP N   K G  G
Sbjct  353   IAYGANLTFVNLEGADVYGLELKGQKPIFASYAMSGVGDEGVVLILPGPGNGNEKSGGFG  412

Query  1339  RIVNVILPEHLLGKLKNEISKELGTSP  1419
             R V ++LP+  + +L+ EI++  G  P
Sbjct  413   RTVTMVLPQAQMAELRKEINETWGLLP  439



>emb|CDP11510.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   390 bits (1002),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 221/447 (49%), Positives = 288/447 (64%), Gaps = 38/447 (9%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             VYD RLSSVVPA+ITGE +V  L+N DL +KLHY++G+Y FRS A  GL   DLK PMF 
Sbjct  11    VYDVRLSSVVPASITGEDKVHELSNMDLMLKLHYVKGIYFFRSGAARGLTINDLKKPMFE  70

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
              L  +   +GRIR S EDGRPF+KCNDSGVRI EAKCSKT+DEWL  +D S  D L+ + 
Sbjct  71    CLALYSTLSGRIRKS-EDGRPFIKCNDSGVRIAEAKCSKTLDEWLAFNDDSLNDQLI-YS  128

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q L PD  F+PLVF+Q TWFKCGG+SIG+SWAH++GDAFS S F+N +G  + G+  +PP
Sbjct  129   QFLAPDAEFTPLVFVQFTWFKCGGISIGLSWAHIVGDAFSASHFINMWGQILTGQ--VPP  186

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPV----------GDHWKLTNTCKMATQSYH  813
              H      D HN   P+ +K FP  L  V P+          G HW + N  KM   S+H
Sbjct  187   HH-----LDTHN---PKNRKKFPSPLAKV-PLSVQRVLLESDGGHWLIPNHRKMRAHSFH  237

Query  814   ITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGN  993
             +T KQLN L       +++   KPFE ISA+ WKSLAK    +    V  + +    + N
Sbjct  238   VTPKQLNRLT------EEAKLAKPFEVISAVIWKSLAKTSGKAEEPKVVTLISSTWDKEN  291

Query  994   GLLPCRNGQVISAV-KAEMRVSEADVLELANLIGEKAVDETGIIDETMEE---ENGKSAD  1161
             G LP  +  +IS +  AE   ++AD+ +LA LI  K  DET +++  M +   ++G+S D
Sbjct  292   G-LPSNSRVIISTIEAAEAPPAQADLADLARLIARKQEDETHLVERVMYQKGSDDGESRD  350

Query  1162  FFVYGANLTFVNLEEVKIYGFDMKG-QKPIFANYTIGGVGDEGAVLVLPGPE--NLKGK-  1329
             F +YGA LTFVNLE++ IYG  M G  +P+FA+Y++ GVGDEGAVLVLPGP      GK 
Sbjct  351   FILYGARLTFVNLEKMNIYGLKMSGHHQPVFASYSVSGVGDEGAVLVLPGPPPGTESGKD  410

Query  1330  EGGRIVNVILPEHLLGKLKNEISKELG  1410
             EGGR++N+ILPE+ L +LK  +  E G
Sbjct  411   EGGRVINLILPENQLDELKYRLGSEWG  437



>ref|XP_007034236.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY05162.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=440

 Score =   390 bits (1001),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 205/436 (47%), Positives = 279/436 (64%), Gaps = 7/436 (2%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M  P+ + +VY+ RLSSV P  +TG   V  L+  DLAMKLHYL+GVY F S+AV+GL  
Sbjct  1     MVPPEQDRLVYNIRLSSVGPGRVTGTDVVHELSGLDLAMKLHYLKGVYFFGSQAVEGLTI  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
               +K  MF  L D+Y  +GRI+ S E GRP++KCND GVR VE  C KTIDEWL+M D S
Sbjct  61    TRMKEIMFFSLNDYYITSGRIKRS-ESGRPYIKCNDCGVRFVEGLCDKTIDEWLEMGDDS  119

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
               D+LL + + +GP+L FSP V++Q+TWFKCGG+S+G+SWAH+LGDAFS SDF+N +G  
Sbjct  120   -LDNLLVYHRAIGPELSFSPSVYLQVTWFKCGGISVGMSWAHILGDAFSASDFINSWGQY  178

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHI  816
             MAG +   P       A       P      P S   V PVGD W   N CKM T S+ +
Sbjct  179   MAGLKLNGPLTLSKSVAKIEKPDDPTQLAKEPLSAKQVNPVGDLWVTANNCKMETFSFFL  238

Query  817   TDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNG  996
             +  QL  L  K+ G     ++ PFE++ A+ W+ +A+VKE    + VT+ +   +   N 
Sbjct  239   SKLQLLTLHVKICGEDGGKRISPFESVCAVIWQCIARVKEAYEPQIVTVCRKDPYHDIN-  297

Query  997   LLPCRNGQVISAVKAEMRVSEADVLELANLIGE-KAVDETGIIDETMEEENGKSADFFVY  1173
              +P  N Q+ISAVKA   V+EAD+ +LA L+ E + +DE   I+  +E+ENG + D+ +Y
Sbjct  298   -VP-SNSQIISAVKANFSVTEADLNKLAMLLAEDQGLDERNKIEAAVEKENGVT-DYIMY  354

Query  1174  GANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNV  1353
             G NLTFVNLE+  +Y  ++KG KP+FA Y+I GVGDEGAVL LPGP + +     R+V +
Sbjct  355   GTNLTFVNLEDAGLYELELKGHKPMFAYYSIQGVGDEGAVLFLPGPPSTESDGKERLVTI  414

Query  1354  ILPEHLLGKLKNEISK  1401
              LPE  L KLK+E+ +
Sbjct  415   TLPEDQLLKLKSELKR  430



>ref|XP_008222816.1| PREDICTED: protein ECERIFERUM 26-like [Prunus mume]
Length=436

 Score =   386 bits (992),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 209/434 (48%), Positives = 278/434 (64%), Gaps = 19/434 (4%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN+VY  +LSSV P  ITG   V + +  DLAMKLHYLRGV+ F S+A  GL    +K  
Sbjct  7     ENLVYGIKLSSVGPGRITGSDVVHDPSGMDLAMKLHYLRGVFFFSSQAAQGLTIVRMKEA  66

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
              F  L   Y   GR R S E GRP++KCND GVR +EA+C KTI+EWL+M     +  LL
Sbjct  67    TFTWLNVHYRTCGRFRRS-ESGRPYLKCNDCGVRFLEAQCDKTIEEWLEMD--LSHQKLL  123

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               +QV+GP+L FSPLV  Q+T F+CGG+S+G+SWAHVLGDAF+ SDF+N  G  M+    
Sbjct  124   ASNQVIGPELFFSPLVLFQVTHFRCGGISLGLSWAHVLGDAFAASDFINGLGQIMSALE-  182

Query  655   LPPKHPHMPTADNH----NSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
              P + P+  T++       +P P      P S+  V PVGD+W     CKM T S  IT 
Sbjct  183   -PNRLPNYATSNTKFQTLENPPP------PLSIKQVNPVGDNWITPINCKMETLSIPITA  235

Query  823   KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLL  1002
              QLN L FK+ G  Q  ++  FE ISA+ W+ +AKV+EGS  + VTI +N    R  G  
Sbjct  236   TQLNNLQFKILGQNQIDQIPVFELISAIIWQCVAKVREGSEPKLVTICRNDPKERTRG--  293

Query  1003  PCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
              C N Q+IS VKA+  +++AD  +LA L+ ++A +E   I+E ME +NG  ADF VYGAN
Sbjct  294   ECSNSQIISTVKADFSITDADPKKLATLLVKQAGNERSQIEEAMENDNG-VADFVVYGAN  352

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENL-KGKEGGRIVNVIL  1359
             LTFVN E+   YG ++ G KP++ +Y I GVGDEGAVL+LPGP++  +G+  GR+VN+IL
Sbjct  353   LTFVNWEDADFYGLEVNGHKPVYVHYNIQGVGDEGAVLLLPGPKDFGEGRGEGRVVNIIL  412

Query  1360  PEHLLGKLKNEISK  1401
             PE  +  LK+E+ K
Sbjct  413   PEKEVFGLKSELRK  426



>ref|XP_010243469.1| PREDICTED: protein ECERIFERUM 26-like [Nelumbo nucifera]
Length=434

 Score =   383 bits (983),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 207/441 (47%), Positives = 285/441 (65%), Gaps = 16/441 (4%)
 Frame = +1

Query  97    MESPDV-ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLN  273
             M SPDV E+++   RLSSV PA +T    +   +N DLAMKLHYLRGVY F S +V+G  
Sbjct  1     MVSPDVVESLISGVRLSSVGPAAVTPPDLIYEPSNMDLAMKLHYLRGVYFFSSSSVEGFT  60

Query  274   TGDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQ  453
                +K  MF+ LE +Y A+GR R S E GRPF+KCND GVR +EAKCS+T+DEWL++ D 
Sbjct  61    IPKIKETMFQWLELYYHASGRFRRS-ESGRPFIKCNDCGVRFIEAKCSQTLDEWLEIKDF  119

Query  454   SEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP  633
             S +   +  +QV+GP+L FSPLV +QITWFKCGG+++G+SWAHVLGDAFS S+F+N +G 
Sbjct  120   STHCRFVS-NQVIGPELPFSPLVLLQITWFKCGGMAVGVSWAHVLGDAFSASNFINMWGQ  178

Query  634   AMAGRR-DLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSY  810
              +AG + +LPP    +       S KP +    P S+  V PVGD+W +   CKM   S+
Sbjct  179   VLAGNKPELPPYVSRL-----EKSEKPPSLAQEPLSVKRVDPVGDNWVVPGNCKMEMLSF  233

Query  811   HITDKQLNALIFKVSGLKQSAKVKP-FEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
              +   QL+ L  +VSG KQ     P FE I A+ W+SLAK++EG     VTI +   H+R
Sbjct  234   RLAATQLDGLQSRVSGQKQKNDQAPLFECICAVIWQSLAKIREGPEPRIVTICRKEPHNR  293

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFF  1167
             G   L   N Q+IS  KA+  V EA   +L  LI + +V+E   I++ ++++ G   DF 
Sbjct  294   GR--LTLSNNQMISVAKADFSVVEAKPKDLVELIAKPSVNENTQIEKLVKKDQG-LMDFV  350

Query  1168  VYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE--GGR  1341
              YGANLTFV+L    +YG ++   KP+F NYT+ GVGDEG + VLP  + + G++  GG+
Sbjct  351   FYGANLTFVDLGGSDLYGLELNKTKPVFVNYTVDGVGDEGVIFVLPEAK-VAGEDGRGGQ  409

Query  1342  IVNVILPEHLLGKLKNEISKE  1404
              V +ILPE+ L KLK+E+ +E
Sbjct  410   TVTLILPENQLMKLKDELKRE  430



>ref|XP_010086662.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB22549.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=456

 Score =   384 bits (985),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 300/460 (65%), Gaps = 38/460 (8%)
 Frame = +1

Query  97    MESPD-VENIVYDHRLSSVVPATITGEGRVLN-LTNADLAMKLHYLRGVYLFRSEAVDG-  267
             M SPD V   +   R+S+VVP  + G+    + LTN DLA+KLHY++GVY F+S +    
Sbjct  1     MVSPDNVGTPITGVRISTVVPGRVRGDASEDHELTNMDLALKLHYIKGVYFFKSTSSADH  60

Query  268   ----LNTGDLKSPMFRMLEDFYPAAGRIRTSP-EDGRPFVKCNDSGVRIVEAKCSKTIDE  432
                 L+  ++K PMF +L+ F+  AGRIR S    GRP++KCND+GVRIVEA C KTIDE
Sbjct  61    DQLVLSVAEMKKPMFPLLDQFFVTAGRIRRSDGAAGRPYIKCNDAGVRIVEAFCEKTIDE  120

Query  433   WLDMSDQ--------SEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVL  588
             WL M+D+          ++  L +D VLGPDLGFSPLV+ Q TWFKCGGLS+G+SWAH+L
Sbjct  121   WLAMADEFGTTSNNCKNFNQGLCYDHVLGPDLGFSPLVYFQFTWFKCGGLSVGLSWAHLL  180

Query  589   GDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADN-HNSPKPR---TQKLFPFSLGSVGP  756
             GD  S S F+N +   MAG   +P K+ H+P+       P PR   ++K  PFSL  +  
Sbjct  181   GDVLSASAFINTWAKIMAGH--VPQKNIHVPSCGKLPKDPPPRLAISKK--PFSLKELDL  236

Query  757   VGDHWKLT-NTCK-MATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKV  930
             VG+HW +T N C+ M T S+ +T KQL+ L+    G K++A    FE +SA+ W+SL+++
Sbjct  237   VGNHWSVTANNCQSMRTHSFRVTSKQLDLLMSNTCG-KKAANFSQFEILSAVIWRSLSRI  295

Query  931   KEGSGLETVTIVKNGFHSRGNGL---LPCRNGQVISAVKAEMRVSEADVLELANLIGEKA  1101
             +E  G + VTI    + SR  G+   +P   G V+S V+A++   EAD+ ELA LI EK 
Sbjct  296   RESKGPKIVTIC--CYDSRRRGVENEIPSNKGMVLSTVEADL---EADISELAFLISEKR  350

Query  1102  VDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGD  1281
               E   I+E +++EN K  DFFVYGANLTFVNLEEV IYG ++KGQKP FA+YTI GVGD
Sbjct  351   TIENDAIEEMVKKENNK-FDFFVYGANLTFVNLEEVDIYGLEVKGQKPTFASYTIDGVGD  409

Query  1282  EGAVLVLP-GPENLKGKEG-GRIVNVILPEHLLGKLKNEI  1395
             EG VLVLP GP+  +  +  GR V V+LP+  + +L+NE+
Sbjct  410   EGLVLVLPAGPKYSEEDDANGRTVTVVLPKDHIARLENEL  449



>ref|XP_008466157.1| PREDICTED: protein ECERIFERUM 1 [Cucumis melo]
Length=444

 Score =   382 bits (981),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 277/441 (63%), Gaps = 20/441 (5%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMF  300
             + D + SSVVPA  TGE  V  LT  DLAMKLHY+RGVY FR SE V  L   DLK P+F
Sbjct  10    ISDLKFSSVVPAKATGEDEVKELTAMDLAMKLHYIRGVYFFRASEEVKNLTIYDLKKPLF  69

Query  301   RMLEDFYPAAGRIR---TSPEDG-RPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSE---  459
              +LE +Y  +GRIR       DG R F+KCNDSGVRIVEA C KTI+EWL + D  +   
Sbjct  70    LLLEKYYVVSGRIRRRIIGDNDGDRAFIKCNDSGVRIVEADCEKTIEEWLSIEDDDDDKI  129

Query  460   --YDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP  633
                D  L H Q +GPDLGFSPL FIQ+T FKCGGLS+G+SW HVLGD FS S F+N +G 
Sbjct  130   LNRDGCLVHSQAIGPDLGFSPLAFIQLTRFKCGGLSVGLSWTHVLGDIFSASTFINVWGH  189

Query  634   AMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYH  813
              M  R    P H   P    H  P   ++ +    L  + P GD W  +  CKMAT+S+ 
Sbjct  190   IMNNR----PLHQLRPAPATHIPPSTSSRLISTPPLKRLDPTGDLWIGSTDCKMATRSFR  245

Query  814   ITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRG  990
             IT +QL+  I  V G  +S     FE+I+A+FWKSL+K++ E SG  T++I    F +R 
Sbjct  246   ITSEQLDR-ITSVVGRNRSVNFSTFESITAVFWKSLSKIRLEDSGSRTISIYSTKFPNR-  303

Query  991   NGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFV  1170
              G +P  NG  +S V+A+  V+ A   ELA +I +K +DE G I+E +E +   S DF  
Sbjct  304   EGEIPS-NGMEMSGVEADFPVAGAAEGELAEVIVKKKIDEGGEIEELVETKMNDS-DFIA  361

Query  1171  YGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE-GGRIV  1347
             YGA LTFV+LEE  IYGF+++GQK +  NY IGGVG+ G VLVLPGP    G++ GGR V
Sbjct  362   YGARLTFVDLEEADIYGFELEGQKAVHVNYEIGGVGENGVVLVLPGPPRSDGRDGGGRTV  421

Query  1348  NVILPEHLLGKLKNEISKELG  1410
              VILPE  L +L +E+ K+ G
Sbjct  422   TVILPEKELPELIDEMEKQWG  442



>emb|CBI17286.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   380 bits (976),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 207/407 (51%), Positives = 263/407 (65%), Gaps = 17/407 (4%)
 Frame = +1

Query  202   DLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCN  381
             DLAMKLHYLRGVY F SEAV GL    +K PMF  L  +Y   GR R S   GRP +KCN
Sbjct  2     DLAMKLHYLRGVYFFSSEAVQGLTVYRIKEPMFTWLNHYYWTCGRFRRS-NSGRPLIKCN  60

Query  382   DSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLS  561
             D GVRI+EAKC KTIDEWL+M D S    LL  + ++GP+L FSPLVF+Q+T FKCGG+S
Sbjct  61    DCGVRIIEAKCDKTIDEWLEMKDSS-LTKLLVSNHIVGPELPFSPLVFLQVTSFKCGGMS  119

Query  562   IGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLF---P  732
             +G+SWAHVLGDAFS SDF+N +G AMA +    P+HP      +    KP  +      P
Sbjct  120   LGLSWAHVLGDAFSASDFINMWGQAMANQL---PQHPVDLPKSSFMLVKPANRSQLATDP  176

Query  733   FSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFW  912
              S+  V PVGD+W   N CKM   S+HIT  QL  L  K+SG K +    PFE +  +FW
Sbjct  177   LSIKRVDPVGDNWITVNNCKMEPFSFHITATQLTQLQAKISGHKATP---PFECLCTIFW  233

Query  913   KSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIG  1092
             +S+A+V      E VT+ KN   SR  G L   + Q+IS VKA+  V EA   ++A L+ 
Sbjct  234   QSIARVCSRHEPEIVTVCKNERGSRRTGTLS-NSAQIISTVKADFSVKEAKPKDVAALLV  292

Query  1093  EKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGG  1272
             E AVDE G+I+  +E + G S DF +YGANLTFVNLEE   YG ++ GQKP+  +Y I G
Sbjct  293   EHAVDERGLIEAAVERDGGVS-DFIIYGANLTFVNLEEASFYGLELNGQKPVHVSYLIDG  351

Query  1273  VGDEGAVLVL-PGPENLKGKEG--GRIVNVILPEHLLGKLKNEISKE  1404
             +GDEG VLV  PGP++  GK+   G+IV VILPE  + +LK+E+ +E
Sbjct  352   IGDEGVVLVAPPGPKD-SGKDSNEGKIVTVILPEDQVMELKSELKRE  397



>ref|XP_007227614.1| hypothetical protein PRUPE_ppa022307mg [Prunus persica]
 gb|EMJ28813.1| hypothetical protein PRUPE_ppa022307mg [Prunus persica]
Length=435

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 212/434 (49%), Positives = 276/434 (64%), Gaps = 20/434 (5%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN+VY  +LSSV P  ITG   V + +  DLAMKLHYLRGVY F S+A  GL    +K  
Sbjct  7     ENLVYGIKLSSVGPGRITGSDVVHDPSGMDLAMKLHYLRGVYFFSSQAAQGLTIVRMKEA  66

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
              F  L   Y A GR R S E GRP++KCND GVR +EAKC KTI+EWL+M     +  LL
Sbjct  67    TFTWLNVHYRACGRFRRS-ESGRPYLKCNDCGVRFLEAKCDKTIEEWLEMD--LSHQKLL  123

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               +QV+GP+L FSPLV  Q+T F+CGG+S+G+SWAHVLGDAF+ SDF+N  G  M+    
Sbjct  124   ASNQVIGPELFFSPLVLFQVTHFRCGGISLGLSWAHVLGDAFAASDFVNGLGQIMSALE-  182

Query  655   LPPKHPHMPTADNH----NSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
              P + P+  T++       +P P      P S+  V PVGDHW     CKM T S+ IT 
Sbjct  183   -PNRLPNYTTSNKKFQKLENPPP------PLSIKQVNPVGDHWITPINCKMETLSFPITA  235

Query  823   KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLL  1002
              QLN L FK+ G  Q  ++  FE ISA+ W+ +AKV+ GS  + VTI KN    R  G  
Sbjct  236   TQLNNLQFKILGQNQIHQIPIFELISAIIWQCVAKVR-GSEPKLVTICKNDPKERARG--  292

Query  1003  PCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
                N Q+IS VKA+  +++AD  +LA L+ ++A +E   I+E ME +NG  ADF VYGAN
Sbjct  293   EGSNSQIISTVKADFSITDADPKKLATLLVKQAGNERSQIEEAMENDNG-VADFVVYGAN  351

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLK-GKEGGRIVNVIL  1359
             LTFVN E+   YG ++KG KP++  Y I GVGDEG VL+LPGP++   G+  GR+VN+IL
Sbjct  352   LTFVNWEDADFYGLEVKGHKPVYVLYNIQGVGDEGTVLLLPGPKDFGVGRGEGRVVNIIL  411

Query  1360  PEHLLGKLKNEISK  1401
             PE  +  LK+E+ K
Sbjct  412   PEKEVFGLKSELRK  425



>ref|XP_008380478.1| PREDICTED: protein ECERIFERUM 26-like [Malus domestica]
Length=435

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 275/439 (63%), Gaps = 30/439 (7%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN+VY  +LSSV PA +TG   V N +  DLAMKLHYLRGVY F S+A  GL T  +K  
Sbjct  7     ENLVYGIKLSSVGPARVTGSDVVHNPSGMDLAMKLHYLRGVYFFDSQAAQGLTTNRIKEA  66

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             MF  L   Y   GR R S E GRP++KCND G R +EA+C KTIDEWL M        LL
Sbjct  67    MFTWLCVSYQTCGRFRRS-ESGRPYLKCNDCGARYLEAQCDKTIDEWLGMD--CSLQKLL  123

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               +Q++GP+L FSP+V  Q+T+FKCGG+S+G+SW+HVLGDAF+ SDF+N  G  M+G   
Sbjct  124   ASNQIIGPELFFSPVVLFQVTYFKCGGMSLGLSWSHVLGDAFAASDFINGLGQVMSGLE-  182

Query  655   LPPKHPHMPTADNHNSPKPRT---QKLF------PFSLGSVGPVGDHWKLTNTCKMATQS  807
              P + P        N  KP T   QKL       P S+  V  VGD+W   N CKM T S
Sbjct  183   -PSRLP--------NYAKPNTNVQQKLAKNPSPPPLSIRHVDSVGDYWISPNKCKMETFS  233

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
             + +T  QLN L  K+ G  QS ++  FE I AL WK +A V+EG   + VTI KN  ++R
Sbjct  234   FTVTATQLNNLQVKILGPIQSDQIPIFELICALIWKCVATVREGPQPKLVTICKNDTNNR  293

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKA-VDETGIIDETMEEENGKSADF  1164
               G     N Q IS V+A+ RVS+ D  ELANL+ ++A  +E   I+E +E ENG  ADF
Sbjct  294   TEG-----NSQTISTVEADFRVSDMDXKELANLLAKQAGQNEKTRIEEAIEXENG-VADF  347

Query  1165  FVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRI  1344
              VYGANLTFVN E+V  YG ++KG KP+  +Y I GVGDEGAVL+LP      G +GGR+
Sbjct  348   VVYGANLTFVNWEDVDFYGLEVKGHKPVCVHYNIQGVGDEGAVLLLPAGAKEXG-DGGRV  406

Query  1345  VNVILPEHLLGKLKNEISK  1401
             V VILPE  +  +K+E+ K
Sbjct  407   VXVILPEKEVFGVKSELRK  425



>ref|XP_008348421.1| PREDICTED: protein ECERIFERUM 26-like [Malus domestica]
Length=438

 Score =   380 bits (975),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 210/437 (48%), Positives = 274/437 (63%), Gaps = 23/437 (5%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN+VY  +LSSV PA +TG   V N +  DLAMKLHYLRGVY F S+A  G+ T  +K  
Sbjct  7     ENLVYGIKLSSVGPARVTGSDVVHNPSGMDLAMKLHYLRGVYFFDSQAAQGMTTNRIKEA  66

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             MF  L   Y   GR R S E GRP++KCND GVR +EA+C KT+DEWL +        LL
Sbjct  67    MFTWLCVSYRTCGRFRRS-ESGRPYLKCNDCGVRYLEAQCDKTLDEWLGLD--CSLQKLL  123

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               +Q++GP+L FSP+V  Q+T+FKCGG+S+G+SW+HVLGDAF+ SDF+N  G  M+G   
Sbjct  124   ASNQIIGPELFFSPVVLFQVTYFKCGGISLGLSWSHVLGDAFAASDFINGLGQVMSGL--  181

Query  655   LPPKHPHMPTADNHNSPKPRTQKLF-------PFSLGSVGPVGDHWKLTNTCKMATQSYH  813
                    +    N+ +P    Q+         P S+  V  VGD+W   N CKM T S+ 
Sbjct  182   ------EISKLPNYANPNTNVQQKLAKNPSPPPLSIRHVDSVGDYWISPNNCKMETFSFP  235

Query  814   ITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGN  993
             +T  QLN L  K+ G  QS ++  FE I AL WK +A V+EG   + VTI KN  + R  
Sbjct  236   VTATQLNNLQVKILGPIQSDQIPIFELICALIWKCIATVREGPQPKLVTICKNDTNRRTE  295

Query  994   GLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKA-VDETGIIDETMEEENGKSADFFV  1170
             G   C N Q IS V+A+ RVS+ D  ELANL+ ++A  +E   I+E +E ENG  ADF V
Sbjct  296   G--ECSNSQTISTVEADFRVSDMDPKELANLLAKQAGQNEKTRIEEAIENENG-VADFVV  352

Query  1171  YGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVN  1350
             YGANLTFVN E+V  YG ++KG KP+  +Y I GVGDEGAVL+LP      G +GGR+V+
Sbjct  353   YGANLTFVNWEDVDFYGLEVKGHKPVCVHYNIQGVGDEGAVLLLPAGAKEFG-DGGRVVS  411

Query  1351  VILPEHLLGKLKNEISK  1401
             VILPE  +  +K+E+ K
Sbjct  412   VILPEKEVFGVKSELRK  428



>emb|CDP11175.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   377 bits (969),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 198/427 (46%), Positives = 271/427 (63%), Gaps = 8/427 (2%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF  300
             ++Y+ +LSSV P   TG+  V    + DLAMKLHYL+GVY F S+A DGL    +K P+F
Sbjct  12    LIYNMKLSSVGPGRYTGQDIVHEPNDMDLAMKLHYLKGVYYFPSQAFDGLTIRKIKEPLF  71

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS-EYDHLLH  477
                  FY   GR R S E GRP +KCND G R +EA+C KT+DEWL+M       + LL 
Sbjct  72    IWFNHFYITCGRFRRSEESGRPVIKCNDCGARFIEAQCDKTLDEWLEMKKHDPALEKLLV  131

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDL  657
              D+++GP+LGFSPLVF+Q T FKCGG+++G+SW HVLGDAFS ++F+N  G  +AG    
Sbjct  132   SDKIVGPELGFSPLVFLQYTKFKCGGMAVGLSWTHVLGDAFSAAEFMNVLGRVLAGEEPQ  191

Query  658   PPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNA  837
                +       N ++  P++    P S+  VGPV D W   NTC M T S+H+T  +L+ 
Sbjct  192   RLLNTAQSLNKNQDAGSPKSVMEDPLSVKRVGPVEDKWITVNTCNMGTFSFHVTPTELSD  251

Query  838   LIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNG  1017
             +  K+SG K   K+ PFE++ A+ WK +AK++ G+  + VTI K    ++G+G L   N 
Sbjct  252   IQSKISG-KYGPKIAPFESLCAVIWKCVAKIRHGNEPKVVTICKKDSRNKGDGRL--SNS  308

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
             Q+IS VKA+  +++A   ELA +I  +A+DE   I+E ME + G  ADF VYGANLTFVN
Sbjct  309   QMISVVKADFAIAKASHEELAAMIKNQAIDERKKIEEAMERDQG-LADFEVYGANLTFVN  367

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLG  1377
              E+   +GF+  G K +  +Y I GVGDEGAVLVLPGP +      GRIV VILPE+ + 
Sbjct  368   YEDANFHGFEYNGTKQVGVSYWIDGVGDEGAVLVLPGPND---GGFGRIVRVILPENEIV  424

Query  1378  KLKNEIS  1398
             +L+ E S
Sbjct  425   ELRREWS  431



>ref|XP_006472451.1| PREDICTED: protein ECERIFERUM 1-like [Citrus sinensis]
Length=437

 Score =   377 bits (967),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 218/451 (48%), Positives = 282/451 (63%), Gaps = 33/451 (7%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M S + EN V   +LSSVVPA  TG  +   L N DLAMKLHY++GVY F  EAV GL  
Sbjct  1     MVSSNPENRVSGIKLSSVVPAKATG-NQDYELKNIDLAMKLHYIKGVYFFNREAVRGLTI  59

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPED---GRPFVKCNDSGVRIVEAKCS-KTIDEWLDM  444
              DLK PMF++L+ FY A+GRIR  PE    GRPF+KCND GVRIVEA C  +TI EWL M
Sbjct  60    FDLKRPMFQLLDIFYTASGRIR-RPETAGAGRPFIKCNDGGVRIVEAFCDDQTIAEWLAM  118

Query  445   SDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNK  624
              D    D  L +   LGPDL FSPLVF+Q T FKCGG+S+G+SWAHVLGD FS S F++ 
Sbjct  119   -DHESRDDCLAYGSELGPDLAFSPLVFVQFTSFKCGGMSLGLSWAHVLGDPFSASAFVSM  177

Query  625   YGPAMAGRRDLPPKHPHMP------TADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNT  786
             +   MAGR  +PPK  H P      T     + +     L+P  +  V PVGDHW+  N 
Sbjct  178   WAQIMAGR--VPPKSLHEPEPKKSETETQTRASESVAGNLYP--IKRVDPVGDHWQFPNN  233

Query  787   CKMATQSYHITDKQLNALI--FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVT  960
             C M T ++  T KQL+ +    +  G++++A V  FE ISA  WK LAK  E SG   VT
Sbjct  234   CNMKTHTFQFTKKQLDQMASNLRYRGIREAAAVSHFEVISATIWKLLAKASEDSGPGVVT  293

Query  961   IVK-NGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETME  1137
             I + NG   R N      N  V+S  + +  VS++DV EL+ LI +K  D    +DE + 
Sbjct  294   ICRYNG--QRENET--ASNDMVLSTAEVDFDVSKSDVWELSTLIADKRKD----VDEKVL  345

Query  1138  EENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE-  1314
              E   S+DF +YGANLTFV++EE  +YG  ++GQKP+  NY+I GVG++G VLVL GPE 
Sbjct  346   SE---SSDFIMYGANLTFVDMEEADVYGLKLQGQKPVDVNYSINGVGEQGVVLVLAGPEE  402

Query  1315  -NLKGKEGGRIVNVILPEHLLGKLKNEISKE  1404
              + +G++ G  V V+LPE+ L KL NE+++E
Sbjct  403   DSGRGRDRGSTVTVVLPENQLEKLMNELNQE  433



>ref|XP_006433815.1| hypothetical protein CICLE_v10001068mg [Citrus clementina]
 gb|ESR47055.1| hypothetical protein CICLE_v10001068mg [Citrus clementina]
Length=466

 Score =   377 bits (969),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 217/455 (48%), Positives = 283/455 (62%), Gaps = 37/455 (8%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M SP+ EN V   +LSSVVPA  TG  +   L N DLAMKLHY++GVY F  EAV GL  
Sbjct  26    MVSPNPENRVSGIKLSSVVPAKATG-NQDYELKNIDLAMKLHYIKGVYFFNREAVRGLTI  84

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPED---GRPFVKCNDSGVRIVEAKCS-KTIDEWLDM  444
              DLK PMF++L+ FY A+GRIR  PE    GRPF+KCND GVRIVEA C  +TI EWL M
Sbjct  85    FDLKRPMFQLLDIFYTASGRIR-RPETAGAGRPFIKCNDGGVRIVEAFCDDQTIAEWLAM  143

Query  445   SDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNK  624
              D    D  L +   LGPDL FSPLVF+Q T FKCGG+S+G+SWAHVLGD FS S F++ 
Sbjct  144   -DHESRDDCLAYGSALGPDLAFSPLVFVQFTSFKCGGMSLGLSWAHVLGDPFSASAFVSM  202

Query  625   YGPAMAGRRDLPPKHPHM----------PTADNHNSPKPRTQKLFPFSLGSVGPVGDHWK  774
             +   MAGR  +PPK  H            T     + +     L+P  +  V PVGDHW+
Sbjct  203   WAQIMAGR--VPPKSLHEPEPEPEPEKSETETQTRASESVAGNLYP--IKRVDPVGDHWQ  258

Query  775   LTNTCKMATQSYHITDKQLNALI--FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGL  948
               N C + T ++  T KQL+ +    +  G++++A V  FE ISA  WK LAK  E SG 
Sbjct  259   FPNNCNIKTHTFQFTKKQLDQMASNLRYRGIREAAAVSHFEVISATIWKLLAKASEDSGP  318

Query  949   ETVTIVK-NGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIID  1125
               VTI + NG   R N      N  V+S  + +  VS++DV EL+ LI +K  D    +D
Sbjct  319   GVVTICRYNG--QRENE--TASNDMVLSTAEVDFDVSKSDVWELSTLIADKRKD----VD  370

Query  1126  ETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLP  1305
             E +  E   S+DF +YGANLTFV++EE  +YG  ++GQKP++ NY+I GVG++G VLVL 
Sbjct  371   EKVLSE---SSDFIMYGANLTFVDMEEADVYGLKLQGQKPVYVNYSINGVGEQGVVLVLA  427

Query  1306  GPE--NLKGKEGGRIVNVILPEHLLGKLKNEISKE  1404
             GPE  + +G++ G  V V+LPE+ L KL NE+++E
Sbjct  428   GPEEDSGRGRDRGSTVTVVLPENQLEKLMNELNQE  462



>ref|XP_009346997.1| PREDICTED: protein ECERIFERUM 26-like [Pyrus x bretschneideri]
Length=438

 Score =   375 bits (964),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 216/439 (49%), Positives = 273/439 (62%), Gaps = 27/439 (6%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN+VY  +LSSV PA +TG   V N +  DLAMKLHYLRGVY F S+A  GL T  +K  
Sbjct  7     ENLVYGIKLSSVGPARVTGSDVVHNPSGIDLAMKLHYLRGVYFFDSQAAQGLTTNRIKEA  66

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             MF  L   Y   GR R S E GRP++KCND GVR +EA+C KTIDEWL +        LL
Sbjct  67    MFTWLCVSYQTCGRFRRS-ESGRPYLKCNDCGVRYIEAQCDKTIDEWLGLD--CSLQKLL  123

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               +Q++GP+L FSP+V  Q+T+FKCGG+SIG+SW+H LGDAF+ SDF+N  G  M+G   
Sbjct  124   ASNQIIGPELFFSPVVLFQVTYFKCGGMSIGLSWSHALGDAFAASDFINGLGQVMSGLE-  182

Query  655   LPPKHPHMPTADNHNSPKPRT---QKLF------PFSLGSVGPVGDHWKLTNTCKMATQS  807
              P + P        N  KP T   QKL       P S+  V  VGD+W   N CKM T S
Sbjct  183   -PSRLP--------NYAKPNTNVQQKLAKNPSPPPLSIRHVDSVGDYWISPNKCKMETFS  233

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
             + +T  QLN L  K+ G  QS ++  FE I AL WK +A V+EG   + VTI KN  + R
Sbjct  234   FPVTATQLNNLQVKILGPIQSDQIPIFELICALIWKCIATVREGPQPKLVTICKNDTNKR  293

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVD-ETGIIDETMEEENGKSADF  1164
               G     N Q IS V+A+ RVS+ D  EL NL+ ++A + E   I+E ME ENG  ADF
Sbjct  294   TKGEY--GNSQTISTVEADFRVSDMDPKELVNLLAKQASENEKTRIEEAMENENG-VADF  350

Query  1165  FVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRI  1344
              VYGANLTFVN E+V  YG ++KG KP+  +Y I GVGDEGAVL+L       G +GGR+
Sbjct  351   VVYGANLTFVNWEDVDFYGLEVKGHKPVCVHYNIQGVGDEGAVLLLAAGAKEFG-DGGRV  409

Query  1345  VNVILPEHLLGKLKNEISK  1401
             V+VILPE  +  +K+E+ K
Sbjct  410   VSVILPEKEVFGVKSELRK  428



>ref|XP_006421010.1| hypothetical protein CICLE_v10005028mg [Citrus clementina]
 gb|ESR34250.1| hypothetical protein CICLE_v10005028mg [Citrus clementina]
Length=426

 Score =   374 bits (959),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 197/435 (45%), Positives = 276/435 (63%), Gaps = 30/435 (7%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF  300
             +++  RLSSV P   TG   V  L+  DLAMKLHYL+G Y+FRS AV GL+   +K   F
Sbjct  6     LIHSIRLSSVGPGKATGSDVVHELSGMDLAMKLHYLKGFYIFRSHAVQGLSIKLIKESTF  65

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
              +  ++Y   GR+R S + GRP++KCND G R VEA+C KT+DE L+M D S + +LL +
Sbjct  66    YLFNNYYWTCGRLRRS-DSGRPYLKCNDCGARFVEAQCDKTVDELLEMGDYSSFPNLLVY  124

Query  481   DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKY----------G  630
              Q +GPDL FSP +++Q+TWFKCGG+S+G+SWAH++GDAFS  +F+N            G
Sbjct  125   HQPIGPDLAFSPPIYLQVTWFKCGGMSLGMSWAHIVGDAFSACEFINTMGQILTAIKANG  184

Query  631   PAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSY  810
             P    +   P K   +  + +   PK       P S+  V PVGDHW   N CKM T S+
Sbjct  185   PPTCAKSISPGKIVKLEMSSSFFKPKD------PISITWVDPVGDHWVTANNCKMDTFSF  238

Query  811   HITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRG  990
             H+TD +++ L    S  +   ++  FE++ A+ W+ +AK+++G G   VTI + G H R 
Sbjct  239   HLTDSRISHL---QSNFRNHHQIPVFESLCAIIWQYVAKIRDGFGPNNVTICRKGSHIRE  295

Query  991   NGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFV  1170
             NG L   NGQ+ISA +A+  V EAD+ +LA ++ +   DE  +I+ETME+ NG  AD+  
Sbjct  296   NGNL--SNGQIISAFQADFSVMEADLEKLARVLCDAVEDERSLIEETMEKGNG-VADYIF  352

Query  1171  YGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVN  1350
             YGANLTFVN E+  +YG ++ G+K  FA+++I GVGDEGAVLVLPG     GK  GRI+ 
Sbjct  353   YGANLTFVNWEDADVYGLELNGEKADFASFSIQGVGDEGAVLVLPG-----GK--GRILM  405

Query  1351  VILPEHLLGKLKNEI  1395
             +ILPE  + KLK E+
Sbjct  406   IILPEDQILKLKTEL  420



>ref|XP_006489852.1| PREDICTED: protein ECERIFERUM 26-like [Citrus sinensis]
Length=427

 Score =   372 bits (956),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 203/439 (46%), Positives = 278/439 (63%), Gaps = 37/439 (8%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF  300
             +++  RLSSV P   TG   V  L+  DLAMKLHYL+G Y+FRS AV GL+   +K   F
Sbjct  6     LIHSIRLSSVGPGKATGSDVVHELSGMDLAMKLHYLKGFYIFRSHAVQGLSVKLIKESTF  65

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
              +  ++Y    R+R S + GRP++KCND G R VEA+C KT+DE L+M D S + +LL +
Sbjct  66    YLFNNYYWTCARLRRS-DSGRPYLKCNDCGARFVEAQCDKTVDELLEMGDYSSFPNLLVY  124

Query  481   DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLP  660
              Q +GPDL FSP +++Q+TWFKCGG+S+G+SWAH+LGDAFS  +F+NK G  +   +   
Sbjct  125   HQPIGPDLAFSPPIYLQVTWFKCGGMSLGMSWAHILGDAFSACEFINKMGQVLTAIKANG  184

Query  661   PKHPHMPTADNHNSP-------------KPRTQKLFPFSLGSVGPVGDHWKLTNTCKMAT  801
             P     PT     SP             KP+     P S+  V PVGDHW   N  KM T
Sbjct  185   P-----PTCAKSISPGKIVKLEMSSSFFKPKD----PISIKWVDPVGDHWVTANNSKMDT  235

Query  802   QSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFH  981
              S+H+TD +++ L    S  +   ++  FE++ A+ W+ +AK+++G G   VTI K G H
Sbjct  236   FSFHLTDSRISHL---QSNFRNHHQIPVFESLCAIIWQCVAKIRDGFGPNNVTICKKGSH  292

Query  982   SRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAV-DETGIIDETMEEENGKSA  1158
              R NG L   NGQ+ISA +A+  V EAD+ +LA ++  +AV DE   I+ETME+ NG  A
Sbjct  293   IRENGNL--SNGQIISAFQADFSVMEADLEKLAKVLCYEAVEDERSRIEETMEKGNG-VA  349

Query  1159  DFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGG  1338
             D+ VYGANLTFVN E+  +YG ++ G+K  FA+++I GVGDEGAVLVLPG     GK  G
Sbjct  350   DYIVYGANLTFVNWEDADVYGLELNGEKADFASFSIQGVGDEGAVLVLPG-----GK--G  402

Query  1339  RIVNVILPEHLLGKLKNEI  1395
             RI+ +ILPE  + KLK E+
Sbjct  403   RILKIILPEDQILKLKTEL  421



>ref|XP_010023659.1| PREDICTED: protein ECERIFERUM 26-like [Eucalyptus grandis]
Length=437

 Score =   369 bits (947),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 197/431 (46%), Positives = 265/431 (61%), Gaps = 6/431 (1%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             E +VY  +LSSV PA +TG   V     ADLAMKLHYLRGVY F   AV+GL    +K  
Sbjct  7     EKLVYGLKLSSVGPARVTGADAVHEPAAADLAMKLHYLRGVYFFAGPAVEGLTVPRIKES  66

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             MF    D+Y   GR R S + GRP++KCND GVR VEA+C  T+DEWL+          L
Sbjct  67    MFSWCTDYYAVCGRFRRS-DSGRPYIKCNDCGVRFVEAECDSTVDEWLEADGHGSLLGPL  125

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
                QV+GP+  FSP   +Q+T FKCGG+S+G+SWAHVLGD FS SD  N  G +++G   
Sbjct  126   VSHQVVGPEPFFSPTCLVQVTRFKCGGMSLGLSWAHVLGDPFSASDCFNMLGRSLSGLLA  185

Query  655   LPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN  834
               PK P   +     +  P   +  P S+  V PVGDHW +   C M T ++H++  QL 
Sbjct  186   DGPKGPRALSGPRRLADPPELARE-PASIKRVSPVGDHWVVDGNCNMGTFTFHLSPDQLA  244

Query  835   ALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRN  1014
              L  KV G     K  PFE++ A+ W+ +AKV+ G+   TVT++KN    R NG+L   N
Sbjct  245   HLKSKVGGEGHGEKFPPFESLCAILWQLIAKVRAGNEPSTVTLIKNDPSKRENGIL--SN  302

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFV  1194
                I +VKA+  V++AD  E+  L+ ++A +E+ +I+E +E + G  AD+ VYGANL+FV
Sbjct  303   SLKICSVKADFSVADADPGEILRLLIDRAENESNLIEEAVERDGG-VADYVVYGANLSFV  361

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG-GRIVNVILPEHL  1371
               EEV +YG  + G +PIFA+Y I GV DEGAV VLPGP +     G GR+V VILPE+ 
Sbjct  362   EWEEVSMYGLQLNGNRPIFASYVIEGVADEGAVFVLPGPPSSGKDSGQGRVVTVILPEYQ  421

Query  1372  LGKLKNEISKE  1404
             L +LK+E+ K+
Sbjct  422   LLQLKSELVKQ  432



>ref|XP_008802334.1| PREDICTED: protein ECERIFERUM 26-like [Phoenix dactylifera]
Length=433

 Score =   366 bits (939),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 195/439 (44%), Positives = 281/439 (64%), Gaps = 23/439 (5%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS-EAVDGLNTGDLKSPMF  300
             ++  +LS+VVP ++TGE  V  L N DL MKLHYLR VY F++ E +D L    LK PMF
Sbjct  10    IHGRKLSTVVPGSVTGEAAVYELANIDLVMKLHYLRTVYYFKADEIIDSLTIKALKEPMF  69

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
               L+ +YP AGRIR + E GRPFVKCND GVRIVE KC +T++EWL++ D S +  L+  
Sbjct  70    PWLDVYYPVAGRIRRT-EAGRPFVKCNDCGVRIVETKCGQTLEEWLEIKDSSRWRQLVP-  127

Query  481   DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLP  660
             ++VLGPDL FSP VFIQ T FKCGG++IG SW+H+LGDA + ++F+N +   ++     P
Sbjct  128   EKVLGPDLHFSPFVFIQFTRFKCGGMAIGFSWSHILGDAITATNFINLWAQLLSNS---P  184

Query  661   PK---HPHMPTADNHNSP--KPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDK  825
             PK   H   P      +P   P + +L P  +  V  VGD W   N  KMAT S+ IT++
Sbjct  185   PKCQQHLLSPETKTEKTPIKLPASMELLP--VKQVEHVGDSWLSLNNSKMATHSFQITEE  242

Query  826   QLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP  1005
             ++  L       K+S ++  FE ISAL W+ L+K+++  G ++VTI +N   ++ +GLL 
Sbjct  243   KIKQL-----QAKESGQISSFEIISALIWQCLSKIRKDKGPKSVTICRNDTSAKRSGLL-  296

Query  1006  CRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANL  1185
               N Q IS V ++   S+  + ELA++I ++ V ET +I++ ++ ++G + DF VYGANL
Sbjct  297   -SNEQKISTVVSDFVPSKVAISELASMIAKQEVAETKMIEDLVDSQSG-TPDFIVYGANL  354

Query  1186  TFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGK--EGGRIVNVIL  1359
             TF+++E V +Y  ++KGQKPI   Y+I GVGDEGAVLVL  P+   G    GG++V +IL
Sbjct  355   TFIDMEGVPLYELELKGQKPIHVEYSIDGVGDEGAVLVLQCPQQTYGSGGNGGKMVMLIL  414

Query  1360  PEHLLGKLKNEISKELGTS  1416
             PE  +  L+ E+    G +
Sbjct  415   PEDQIPPLQEELQSAWGVA  433



>ref|XP_011003614.1| PREDICTED: protein ECERIFERUM 26-like [Populus euphratica]
Length=443

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 203/440 (46%), Positives = 286/440 (65%), Gaps = 12/440 (3%)
 Frame = +1

Query  94    IMESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLN  273
             ++   D +N+VYD +LSS VP   TG   +  L+  DLAMKL YL+GVY F S+A  GL 
Sbjct  1     MVSCKDDQNLVYDIKLSSAVPGRPTGSDVIHELSGMDLAMKLPYLKGVYFFSSQACQGLT  60

Query  274   TGDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQ  453
                +K  MF  L D+Y   GR + + E GRP++KC+DSGVRIVEA+CSKT+DEWL+  D 
Sbjct  61    IMQIKGSMFYWLNDYYTVCGRFQRT-EAGRPYMKCSDSGVRIVEARCSKTVDEWLETRDC  119

Query  454   SEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP  633
             S  D+LL +   +GP+L FSP +++Q+T FKCGG+S+GISWAHV+GD FS S+ LN +G 
Sbjct  120   S-LDNLLIYHSPIGPELFFSPSLYMQVTKFKCGGMSLGISWAHVIGDVFSASECLNSWGQ  178

Query  634   AMAGRRDLPP-KHPHMPTA-DNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS  807
              +AG +   P K    PT  +   SP   T++  P SL  V PVGD W   N  KM T S
Sbjct  179   FLAGVKSYGPLKLTKSPTGLERSKSPSVGTKE--PVSLKQVDPVGDLWVTANNRKMETFS  236

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
             +H++  Q++ L  ++ G    AK+  FE++ A+ W+ +AK K+G   + VT+ K   ++ 
Sbjct  237   FHLSASQVSQLHSRIWGRSGLAKIPFFESLCAIMWQCIAKGKDGLEPQVVTLCKKDPNNP  296

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFF  1167
              +G+L   N Q+IS+VKA+  V +AD+ ELA L+ ++A +E   I+E +E++NG   D+ 
Sbjct  297   KDGIL--SNSQIISSVKADSSVVDADLKELATLLVDQATEENSQIEEAVEKDNG-VIDYV  353

Query  1168  VYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GR  1341
             VYGANLTFV+LEE   YG +  G KP   +Y+I GVGDEGAV+VLP P++  G +G  GR
Sbjct  354   VYGANLTFVDLEETNFYGLEWNGHKPEAVHYSIQGVGDEGAVMVLPWPKD-SGTDGNIGR  412

Query  1342  IVNVILPEHLLGKLKNEISK  1401
             IV V LPE+ + KL+ E+ K
Sbjct  413   IVVVTLPENEVVKLRFELRK  432



>ref|XP_004299741.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=442

 Score =   365 bits (936),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 210/433 (48%), Positives = 281/433 (65%), Gaps = 22/433 (5%)
 Frame = +1

Query  136   RLSSVVPATITG-EGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             RLSSVVPAT+TG E +V  LTN DLAMKLHY++GVY F+S+AV+GL   DLK PMF++L+
Sbjct  16    RLSSVVPATVTGQEHKVHELTNMDLAMKLHYIKGVYFFKSDAVEGLTAKDLKKPMFQLLQ  75

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLD--MSDQSEYDHLLHHDQ  486
              ++  +GRIR S   GRPF+KCNDSGVR VEA+C  T+DEWL   + D S +D L ++  
Sbjct  76    RYFAVSGRIRRSVT-GRPFIKCNDSGVRTVEARCEDTVDEWLARAVEDDSVFDGLAYNQA  134

Query  487   VLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPK  666
             +  PDLGFSPLVF+Q TWFKCGG+S+G+ WA+VLGD FS S F+N +G AMAG +    K
Sbjct  135   LGDPDLGFSPLVFVQFTWFKCGGMSVGLGWANVLGDVFSASTFINLWGKAMAGHKQ--QK  192

Query  667   HPHMPTADNHNSPKPRTQKLF-PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
               H+P +     P      +  P ++  V  VGD W   N  KM T +++I  +++N  +
Sbjct  193   SLHVPDSAKSEFPVSVLPNIVSPNAVKRVDLVGDLWLTPNNSKMKTHTFYIHGEKINHFL  252

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQV  1023
                    Q++KV  FE +SA+ WKSL+K+KE +    +  +   F  R     P  N  V
Sbjct  253   -----SDQNSKVSAFEVLSAIIWKSLSKIKENAKETRMVTLCQKFGER-KFEFP-SNEMV  305

Query  1024  ISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETM--EEENGKSADFFVYGANLTFVN  1197
              S V+A+  V+EA+V EL  LI +K  DE G+I++ M   E   + +DF  YGANLTFVN
Sbjct  306   WSTVEADFWVAEAEVSELVELILKKKGDENGMIEKIMGNHESGERCSDFITYGANLTFVN  365

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE-----GGRIVNVILP  1362
             LEE++IY  ++KGQKP++ANY+I GVGDEG VLVLP      GK+     G R V V+LP
Sbjct  366   LEEIEIYELELKGQKPVYANYSINGVGDEGVVLVLPARPKC-GKDGDDVKGDRTVTVVLP  424

Query  1363  EHLLGKLKNEISK  1401
             E+ L +LK EI K
Sbjct  425   ENQLAQLKVEIQK  437



>ref|XP_010692384.1| PREDICTED: protein ECERIFERUM 1 [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   363 bits (932),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/442 (45%), Positives = 278/442 (63%), Gaps = 22/442 (5%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTG----D  282
             EN+V+D ++SSVVP  ITGE +   L   DLAMKLHYL+G+Y F +  +    +     +
Sbjct  9     ENLVFDIKISSVVPGKITGENKTHELKGIDLAMKLHYLKGLYFFTNNGLSSSISVLSIHE  68

Query  283   LKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSD-QSE  459
              K  MF  L  ++ A GRIR S    RP +K ND+GVR+VEAK SKT+DEWL M D  S 
Sbjct  69    AKKSMFDCLIPYFMACGRIRMSDTSDRPTIKLNDAGVRVVEAKSSKTVDEWLAMEDFLSL  128

Query  460   YDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAM  639
              DHL++ + VLGPDL FSPLV +Q TWF+CGG+S+G+SWAH+LGDAFS S+F+N +   +
Sbjct  129   QDHLVY-NHVLGPDLPFSPLVCLQFTWFRCGGVSVGLSWAHILGDAFSASEFMNTFSQYI  187

Query  640   AGRRDLPP----KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS  807
                   P     ++ H PT   H  P P  Q   P S+  VGPVG+HW L    K+   +
Sbjct  188   QNNHQQPKTISLQNTHQPT---HPHPNPTRQ---PISVKRVGPVGNHWVLPANYKIGIHT  241

Query  808   YHITDKQLNALIFKVSGLK--QSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFH  981
              H+  KQL+ L  KV G K   +   K FE I+A+ W+S+AK+++    + VTI ++   
Sbjct  242   LHLQLKQLHQLHSKVYGSKINDNGPTKYFEVITAIIWRSIAKIRKDKETDIVTICRSKTS  301

Query  982   SRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSAD  1161
              R   ++P  NGQV+S V A   VS  D L L   I E  V+ET +++E + +E   S D
Sbjct  302   QR-QQMMP-YNGQVLSTVGANCSVSSVDPLLLVKFIAENLVEETEMVEELVNKELSTS-D  358

Query  1162  FFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLK-GKEGG  1338
             F VYG NLTFV++EEV IY F +KG+ P+FA+YT+GG+GD+G V+VLPGP + K G++ G
Sbjct  359   FIVYGRNLTFVDMEEVDIYNFKLKGKCPVFASYTVGGIGDKGVVMVLPGPRDGKDGEDDG  418

Query  1339  RIVNVILPEHLLGKLKNEISKE  1404
             +++ ++LPE  +  LK+E   E
Sbjct  419   KVIVLLLPEDEIECLKSEFKNE  440



>ref|XP_011084205.1| PREDICTED: protein ECERIFERUM 26-like [Sesamum indicum]
Length=434

 Score =   358 bits (918),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 203/446 (46%), Positives = 280/446 (63%), Gaps = 26/446 (6%)
 Frame = +1

Query  94    IMESPDV--ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDG  267
             ++ SP +  + +VY+ ++SSV PA +TG   +       LAMKLHY+RG+Y F S+A +G
Sbjct  2     VVSSPAMAADGLVYNIKISSVGPANVTGSDLIYEPETMGLAMKLHYIRGIYYFGSQAFEG  61

Query  268   LNTGDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMS  447
             L+T  +K PMF  L  +    GR R + E GR ++KCND GVR VEAKC KT+DEWL+M 
Sbjct  62    LSTLVIKEPMFTWLNKYPQVCGRFRRT-ETGRAYLKCNDCGVRFVEAKCDKTLDEWLEMK  120

Query  448   DQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKY  627
             D +  + LL  DQ LGP+LGFSPLV+IQ+T FKCGG ++G+SW+HVLGDAFS ++F+N  
Sbjct  121   DAT-LEKLLVRDQALGPELGFSPLVYIQLTKFKCGGTAVGLSWSHVLGDAFSAAEFMNML  179

Query  628   GPAMAGRRDLPPKHPHMPTADNHNSPK------PRTQKLFPFSLGSVGPVGDHWKLTNTC  789
             G A+AG  DL       PT+  H+  K      P      P S+  VGPVGDHW     C
Sbjct  180   GRAVAG-YDL-----GQPTSLAHSRTKVTTPNGPEKVGDDPLSIKRVGPVGDHWVNVTKC  233

Query  790   KMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVK  969
             KM   S+++T  QL+ L  K+S      +   FEA+SA+ W+ +AK++E      VTI K
Sbjct  234   KMEAFSFNVTPTQLSHLQSKLS--PNGTQFGAFEALSAVIWQCIAKIREWDS-NVVTICK  290

Query  970   NGFHSRG-NGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEEN  1146
                 S+  +G L   N QV+S V A  ++ +++  ELA L+   A+DE   I+E ME + 
Sbjct  291   GSEESKTCDGTL--SNSQVVSVVNANFQILDSNPSELALLVQNGALDEREKIEEAMERDG  348

Query  1147  GKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKG  1326
             G   DF VYGA LTFVNLE+ + Y F+ +GQ+P+  +Y I GVG+EG +LVLPGP   KG
Sbjct  349   GL-PDFIVYGAKLTFVNLEDARFYAFEYRGQRPVNISYRIEGVGEEGTILVLPGP---KG  404

Query  1327  KEGGRIVNVILPEHLLGKLKNEISKE  1404
              +GGR V  ILPE+ + +LK E+ +E
Sbjct  405   DDGGRSVMAILPENEIEELKLELKRE  430



>ref|XP_003602897.1| Omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
 gb|AES73148.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=480

 Score =   359 bits (922),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 272/443 (61%), Gaps = 16/443 (4%)
 Frame = +1

Query  106   PDVENIVYDHRLSSVVPATITGE-GRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGD  282
             P++E      R+S+VVPAT  GE     NL   DL MKLHY+R +YLF S+AV  L+  D
Sbjct  5     PNLETPPQISRISTVVPATPRGEENSAYNLNYMDLLMKLHYIRSIYLFNSKAVQNLSISD  64

Query  283   LKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEY  462
             LK+PMF++L+ +   +GR+R S E GRPF+KCND+GVRI E+ C KT+ EWLD  + S  
Sbjct  65    LKAPMFQLLDSYSHVSGRVRIS-ESGRPFIKCNDAGVRIAESHCEKTLREWLDEKEYS-V  122

Query  463   DHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMA  642
             D L++ D VLGPDL FSPLVF++ T+FKCGGLS+G+SWAH+LGDAFS  +F+ K+   +A
Sbjct  123   DELVY-DHVLGPDLAFSPLVFVKFTFFKCGGLSVGLSWAHILGDAFSARNFITKWSHTLA  181

Query  643   GRRDLPPKHPHMPTADNHNSPKPRTQKLF--PFSLGSVGPVGDHWKLTNTCKMATQSYHI  816
             G+   PPK  HMP   N   P+  +  ++  P S+     + ++W       +AT ++HI
Sbjct  182   GQA--PPKSLHMP---NLTKPQFLSNSVYDNPISIKRATTIEEYWLAATDSYVATHTFHI  236

Query  817   TDKQLNALIFKVSG--LKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRG  990
             T KQL+ L+   +   +  + K K FE ISA+ WK + +++   G   VTI      +R 
Sbjct  237   TSKQLHHLLTTSTSTNININTKTKYFEIISAMIWKCIGQIRGNFGPRVVTICTTNISNRA  296

Query  991   NGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFV  1170
                 P  NG V+S ++  +   E+++ EL  LI EK ++E   +++ MEE  GK  DF V
Sbjct  297   ENEFPT-NGSVLSKIETSLSPGESEISELVKLIAEKKMNENHGLEKMMEEGEGKD-DFIV  354

Query  1171  YGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVN  1350
             YGA LTFV+LEE   YG  + GQKPI AN    GVGD+G VLVL GPE+  G   GR+V 
Sbjct  355   YGAKLTFVDLEEGNFYGVKINGQKPILANCDFRGVGDQGVVLVLSGPEDYNGN-NGRMVT  413

Query  1351  VILPEHLLGKLKNEISKELGTSP  1419
             + LP   L +LK ++S      P
Sbjct  414   ISLPGKELDQLKCKLSFSCKLQP  436



>ref|XP_010910676.1| PREDICTED: protein ECERIFERUM 26-like [Elaeis guineensis]
Length=432

 Score =   357 bits (917),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 192/435 (44%), Positives = 277/435 (64%), Gaps = 16/435 (4%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS-EAVDGLNTGDLKSPMF  300
             VY H+LS+VVP ++TGE  V  L N DL MKLHYLR VY F++ E +D L   DLK PMF
Sbjct  10    VYGHKLSTVVPGSVTGETIVYELANIDLVMKLHYLRSVYYFKANEIIDNLTIQDLKGPMF  69

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
               L+ +YP +GRIR + ++GRP+VKCND GVRIVE KC  T++EWL++ D S +  L+  
Sbjct  70    PWLDVYYPVSGRIRRT-DNGRPYVKCNDCGVRIVETKCGVTLEEWLEIKDSSRWRQLVP-  127

Query  481   DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMA-GRRDL  657
             ++VLGPDL FSPLVF+Q T FKCGG++IG SW+HVLGDA + ++F++ +   ++ G    
Sbjct  128   EKVLGPDLQFSPLVFVQFTRFKCGGMAIGFSWSHVLGDAITAANFIHLWAQLLSGGSPKC  187

Query  658   PPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNA  837
              P H H    +      P + +L   S+  V  VGD W   N  KMAT S+ IT+ ++  
Sbjct  188   QPIHKHETKTEKTLIKSPTSLEL--LSVKQVELVGDSWLSLNNSKMATYSFQITEAKIRQ  245

Query  838   LIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNG  1017
             +       K+S+KV  FE ISAL W+ LAK+++      VTI KN    + +GL    N 
Sbjct  246   I-----QAKESSKVSSFEIISALIWQCLAKIRKDKEPTLVTICKNDPSVKRSGLF--SNV  298

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
             Q I  V ++   S+  + +LA++I ++ V ET II++ +E+E+G + DF +YGANLTF++
Sbjct  299   QKIGTVVSDFFPSKVAISKLASMIAKQQVIETKIIEDLVEKESG-TPDFIIYGANLTFID  357

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENL--KGKEGGRIVNVILPEHL  1371
             +E V +Y  ++K QKPI  +++I GVGDEGAVLVL  P+     G+ GG++V +ILPE  
Sbjct  358   MEGVPLYELELKDQKPIHVDFSIDGVGDEGAVLVLQCPQKTYGNGESGGKMVMLILPEDQ  417

Query  1372  LGKLKNEISKELGTS  1416
             +  L+  +    G +
Sbjct  418   ISPLREALESASGIA  432



>ref|XP_004136254.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN60263.1| hypothetical protein Csa_3G892170 [Cucumis sativus]
Length=441

 Score =   357 bits (917),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 214/439 (49%), Positives = 273/439 (62%), Gaps = 19/439 (4%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMF  300
             V D R SSVVPA  TGE  V  LT  DLAMKLHY+RGVY FR SE V  L   DLK P+F
Sbjct  10    VSDLRFSSVVPAKATGEDEVKELTAMDLAMKLHYIRGVYFFRASEEVRNLTVYDLKKPLF  69

Query  301   RMLEDFYPAAGRIRTS--PEDG-RPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEY---  462
              +LE +Y  +GRIR     +DG R F+KCNDSGVRIVEA C KTI+EWL + D  +    
Sbjct  70    LLLEKYYVVSGRIRRRIVGDDGDRAFIKCNDSGVRIVEADCEKTIEEWLSIEDGDKILNR  129

Query  463   DHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMA  642
             D  L H Q +GPDLGFSPL FIQ+T FKCGGLS+G+SW HVLGD FS S F+N +G  M 
Sbjct  130   DGCLVHSQAIGPDLGFSPLAFIQLTRFKCGGLSVGLSWTHVLGDIFSASTFINVWGHIMN  189

Query  643   GRRDLPPKHPHMPTADNHNSPKPRTQKLFPF-SLGSVGPVGDHWKLTNTCKMATQSYHIT  819
              R    P H   P    H  P  R+ +L     L  + P GD W  +  CKMAT+S+ IT
Sbjct  190   NR----PLHQLRPAPATH-IPTSRSSRLISTPPLKRLDPTGDLWIGSTDCKMATRSFRIT  244

Query  820   DKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNG  996
               QL+  I  V G  +S     FE+I+A+FW SL+K++ E S   T++I      +R   
Sbjct  245   SAQLDR-ITSVVGRNRSMNFSTFESITAVFWNSLSKIRLEDSDSRTISIYSTKCPNR-ES  302

Query  997   LLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
              +P  NG  +S V+A+  V+ A   ELA +I +K +DE G ++E +E +   S DF  YG
Sbjct  303   EIPS-NGMEMSGVEADFPVAGAAEGELAEVIVKKRIDEGGEVEELVETKMDDS-DFIAYG  360

Query  1177  ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE-GGRIVNV  1353
             A LTFV+LEE  +YGF+++GQK +  NY IGGVG+ G V+VLPGP    G++ GGR V V
Sbjct  361   ARLTFVDLEEADVYGFELEGQKAVHVNYEIGGVGENGVVMVLPGPPRSDGRDGGGRTVTV  420

Query  1354  ILPEHLLGKLKNEISKELG  1410
             ILPE  +  L +E+ K+ G
Sbjct  421   ILPEKEVPDLIDEMEKQWG  439



>ref|XP_009785032.1| PREDICTED: protein ECERIFERUM 26-like [Nicotiana sylvestris]
Length=431

 Score =   353 bits (905),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 195/434 (45%), Positives = 269/434 (62%), Gaps = 22/434 (5%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF  300
             ++Y+ + SSV PA +TG+  V   +N D+AMKLHYLRG+Y F S+A   +    +K P+F
Sbjct  10    LIYNIKFSSVGPANVTGQDVVYEPSNIDVAMKLHYLRGIYYFNSQAFQDVTIYQVKEPIF  69

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
                  FY  AGR R + E GRP++KCND G R +EA+C KT++EWL+M D S  + LL  
Sbjct  70    LCFNHFYMTAGRFRRA-ESGRPYIKCNDCGARFIEAQCDKTLEEWLEMKDAS-LEKLLVS  127

Query  481   DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLP  660
             +QVLGP+L FSP + IQ T FKCGG+S+G+SWAHVLGD FS ++F+N  G  + G +   
Sbjct  128   NQVLGPELAFSPPILIQQTKFKCGGVSLGLSWAHVLGDVFSATEFINFLGKVVVGYQPAR  187

Query  661   PKH-PHMPTADNHNSPKPRTQKLF--PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
             P +  H  T  N        QK+   P S+  VGPV DHW   N+CKM + S  +T  +L
Sbjct  188   PNNLAHSLTKANSTQ---TLQKIVEDPLSIKRVGPVEDHWIANNSCKMESFSIQVTASKL  244

Query  832   NALIFKVSGLKQSAKVK-PFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC  1008
                    S ++   ++K PFE++ A+ W+S++K+++G   + VTI K     +  GL+  
Sbjct  245   -------SQIQSRTEIKGPFESLCAIIWQSISKIRDGPEPKVVTICKKS-EEKKEGLV--  294

Query  1009  RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLT  1188
              N QVI  VK +  + EA+  ELA LI    +DE   IDE++E ++G S D  VYGANLT
Sbjct  295   GNNQVIGVVKVDHSIREANPSELARLIKNDIIDERLKIDESIENDHGVS-DVVVYGANLT  353

Query  1189  FVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GRIVNVILP  1362
             FVN+E   +YGFD KG KP+  +Y I GVGD G V+VLP   N   K+G  GRIV + LP
Sbjct  354   FVNMEGADLYGFDWKGHKPMNVSYLIDGVGDAGTVVVLPAGPNDSSKDGDEGRIVTMTLP  413

Query  1363  EHLLGKLKNEISKE  1404
             E  + KLK E++KE
Sbjct  414   EDEIMKLKFELNKE  427



>ref|XP_009602892.1| PREDICTED: protein ECERIFERUM 26-like [Nicotiana tomentosiformis]
Length=431

 Score =   352 bits (903),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 268/433 (62%), Gaps = 20/433 (5%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF  300
             ++Y+ + SSV PA +TG+  V   +N DLAMKLHYLRG+Y F S+A   +    +K P+F
Sbjct  10    LIYNIKFSSVGPANVTGQDVVYEPSNIDLAMKLHYLRGIYYFNSQAFQDVTIYKVKEPIF  69

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
                  FY  AGR R + E GRP++KCND G R +EA+C KT++EWL+M D S  + LL  
Sbjct  70    SWFSHFYMTAGRFRRA-ESGRPYIKCNDCGARFIEAQCDKTLEEWLEMKDAS-LEKLLVS  127

Query  481   DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLP  660
             +QVLGP+L FSP + IQ T FKCGG+++G+SWAHVLGD FS ++F+N  G  + G +   
Sbjct  128   NQVLGPELTFSPPILIQHTKFKCGGIALGLSWAHVLGDVFSATEFINFLGKVVGGFQPAR  187

Query  661   PKH-PHMPTADNHNSPKPRTQKLF--PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
             P +  H+ T  N   P    QK+   P S+  VGPV DHW   N+CKM + S++IT  +L
Sbjct  188   PNNLAHLLTKAN---PTQTLQKIVEDPLSIKRVGPVEDHWIANNSCKMESFSFYITASKL  244

Query  832   NALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCR  1011
               L        ++    PFE++ A+ W+S++++++G   + VTI K     +     P  
Sbjct  245   GHL------QSRTEIQGPFESLCAIIWQSISRIRDGPEPKVVTICKKSEEKKEG---PVG  295

Query  1012  NGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTF  1191
             N Q I  VK +  + EA+  ELA LI  + +DE   IDE +E+++G S D  VYGANLTF
Sbjct  296   NNQFIGVVKVDHSIREANPSELARLIKNEIIDERLKIDEAIEKDHGVS-DVVVYGANLTF  354

Query  1192  VNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GRIVNVILPE  1365
             VN+E   +YGFD +G KP   +Y + GVGD GAV+VLP   N   K+G  GR+V + LPE
Sbjct  355   VNVEGADLYGFDWEGHKPTNVSYLVDGVGDAGAVVVLPAGPNDSSKDGDEGRVVTMTLPE  414

Query  1366  HLLGKLKNEISKE  1404
               + KLK E++KE
Sbjct  415   DEIMKLKYELNKE  427



>gb|KDP39334.1| hypothetical protein JCGZ_01091 [Jatropha curcas]
Length=438

 Score =   351 bits (900),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 191/436 (44%), Positives = 265/436 (61%), Gaps = 9/436 (2%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M S + + +VY+ ++SSV P   T    V    + DLAMKLHYL+ VY F SEA  GL  
Sbjct  1     MVSSNAQTLVYNLKISSVGPGWATDSEAVHEPNSIDLAMKLHYLKSVYFFCSEACQGLTI  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
               LK  MF  L D+Y   GR R + + GRP++KCND G+R++EA+C  ++DEWL++ D S
Sbjct  61    SCLKESMFYWLNDYYITCGRFRRN-DAGRPYLKCNDCGIRMIEAECDTSLDEWLELKDSS  119

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
               D L++H  + GP+L FSP V+ Q T FKCGGLS G+SWAH+LGD FS S ++N   P 
Sbjct  120   LNDMLVYHLPI-GPELSFSPPVYFQATKFKCGGLSFGLSWAHILGDPFSASYYMNMLSPF  178

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHI  816
             +AG R      P   T       K    K  P SL  V PVGDHW   N CKM T S ++
Sbjct  179   LAGVRS---NRPVKVTKQPKTLGKSENIKAPPLSLKRVDPVGDHWVTANNCKMQTFSLYL  235

Query  817   TDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNG  996
             T  Q++ L+  + G   + +   FE++ A+ W+ +AKV+EG   + VTI K    +  N 
Sbjct  236   TASQVSHLLSNMWGQSPNKETPLFESLCAIIWQCIAKVREGHDPKIVTICKKDPTNPENE  295

Query  997   LLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
             +L   N Q+IS+ KA+  + ++++ +LA L+ + A+DE   IDET+E  +G S D+ VYG
Sbjct  296   IL--SNNQIISSAKADFSIIDSNLKKLAMLLVDGAIDERDQIDETVENNDG-SLDYIVYG  352

Query  1177  ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENL-KGKEGGRIVNV  1353
             ANLTF+NLE    Y  ++ G KP F  +TI GVGDEGAVL+ P PE   K  + GR+V +
Sbjct  353   ANLTFINLENANSYELELNGFKPKFVYHTIQGVGDEGAVLLFPWPEYCDKYDDKGRVVTI  412

Query  1354  ILPEHLLGKLKNEISK  1401
             I PE  + KLK+E+ K
Sbjct  413   ISPEKEVIKLKSELKK  428



>ref|XP_009408243.1| PREDICTED: protein ECERIFERUM 26-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 197/445 (44%), Positives = 274/445 (62%), Gaps = 27/445 (6%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLF-RSEAVDGLNTGDLKS  291
             + ++YDHR+S+VVPAT+TG   +  LTN DL MKLHYLR VY F +SE  DG+   DLK+
Sbjct  7     KTVIYDHRISTVVPATVTGNAVLHELTNMDLIMKLHYLRAVYYFNQSEITDGITIADLKN  66

Query  292   PMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYD-H  468
             PMF  L   YP AGRIR + E GRP +KCND G+RI+EA+C +T+ EWLD+   S     
Sbjct  67    PMFLWLNICYPMAGRIRRA-ESGRPLIKCNDCGLRIIEARCRRTLGEWLDVESSSSSRWR  125

Query  469   LLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGR  648
             LL  D+VLGPDL FSP+V++Q T FKCGG++IG SWAHVLGD  S ++ +N +G   +G 
Sbjct  126   LLVPDKVLGPDLQFSPMVYMQFTRFKCGGMAIGYSWAHVLGDPMSATNCINLWGELFSG-  184

Query  649   RDLPPKHPHM-------PTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS  807
              + PPK   +        +A  H    P+     P  +  V  +GD W   NT KMAT S
Sbjct  185   -NPPPKTLQLNNHQKKAESAATHVKVSPK-----PIPVNQVELIGDGWLAPNTRKMATNS  238

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
             + IT+ +L  +  +   LKQ   V  F  ISA+ WK LAK+++    +  TI +    ++
Sbjct  239   FRITETKLKKM--QPEQLKQ---VPTFVIISAMIWKCLAKIRKSRESKMATICRYLTLAK  293

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFF  1167
              + +L   N    S V+ +   +   +LELA LI ++  DE+  ++E ++ ENGK  DF 
Sbjct  294   CSKIL--NNMLKTSTVRLDSSAANFGLLELATLICKQEADESKSVEELVDIENGK-PDFV  350

Query  1168  VYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE--NLKGKEGGR  1341
             +YGANLTFV++E + +YG ++KGQKP+  +Y+I GVGDEGAVLVL GP+  N       R
Sbjct  351   LYGANLTFVDMEGINLYGLELKGQKPVQVDYSIDGVGDEGAVLVLQGPQRTNETSSNQER  410

Query  1342  IVNVILPEHLLGKLKNEISKELGTS  1416
             +V VILPE  + +L   +S E G +
Sbjct  411   LVMVILPEDEIQQLCELLSSEFGIA  435



>ref|XP_003594968.1| Taxadien-5-alpha-ol O-acetyltransferase [Medicago truncatula]
 gb|AES65219.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=442

 Score =   349 bits (896),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 196/431 (45%), Positives = 275/431 (64%), Gaps = 19/431 (4%)
 Frame = +1

Query  136   RLSSVVPATITGEGR-VLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             R+S+VVPAT   E +   NL   DL MKLHY+R +Y F SEAV GL   DLK+PMF +L+
Sbjct  16    RISTVVPATPRCEEKGEHNLNYMDLLMKLHYVRSIYFFDSEAVQGLTISDLKTPMFPLLD  75

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVL  492
              +   AGR+R + + GRPF+KCND+GVRI E++C KT+ EWLD ++ S  D L+H D VL
Sbjct  76    LYSHVAGRVRIA-KSGRPFIKCNDAGVRIAESQCDKTLREWLDENEYS-VDELVH-DHVL  132

Query  493   GPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP  672
             GPDL FSPLVF++ T FKCGGLS+G+SWAH+LGDAFS  +F+ K+   +AG+    PK  
Sbjct  133   GPDLAFSPLVFVKFTSFKCGGLSVGLSWAHILGDAFSAFNFITKWSHILAGQSQ--PKSL  190

Query  673   HMPTADNHNSPKPRTQKLF----PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
             H+P     N  KP+    F    P S+ +   VG++W   N C + + ++HIT  QL+ L
Sbjct  191   HIP-----NLVKPQFLSNFVFDNPISIKNENVVGEYWLAANDCYVPSHTFHITSSQLHHL  245

Query  841   IFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIV-KNGFHSRGNGLLPCRNG  1017
             + K +    +   K FE ISA  WK +A+++   G + VTI  KN   S+        N 
Sbjct  246   V-KTTKSITNTDTKYFEIISATIWKCIAQIRGDIGPKVVTICSKNKNTSKCAENEFPTND  304

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
              ++S ++  +R  E ++L+L NLIGEK ++E   +++ +E+ +GK  DFFVYGA LTFV+
Sbjct  305   ILLSKIETNLRPEEYNILDLMNLIGEKKINENYALEKLVEKGDGKD-DFFVYGAKLTFVD  363

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLG  1377
             LEE  +YG  + G+KPI AN  + GVGD+G VLV PGPE+  G   GR++ V LP   L 
Sbjct  364   LEEADLYGVKLNGKKPIRANCDLRGVGDQGVVLVFPGPEDDDGN-NGRMIKVSLPGKELD  422

Query  1378  KLKNEISKELG  1410
             +LK ++ +E G
Sbjct  423   QLKYKLEREWG  433



>ref|XP_009376207.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 1 [Pyrus x 
bretschneideri]
Length=416

 Score =   348 bits (893),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 272/429 (63%), Gaps = 32/429 (7%)
 Frame = +1

Query  136   RLSSVVPATITG-EGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             RLS+VVPAT  G E RV  +TN DLAMKLHY++GVY F +EAV+GL   DLK  MF++L+
Sbjct  8     RLSTVVPATRIGDENRVHEVTNIDLAMKLHYIKGVYFFNNEAVEGLTIYDLKKRMFQLLQ  67

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEW--LDMSDQSEYDHLLHHDQ  486
              ++ A+GR R S E GRPF+KCNDSGVRIVEA   +T+DEW    M D S +D L  ++Q
Sbjct  68    LYFTASGRFRRS-ETGRPFIKCNDSGVRIVEAHYEETVDEWSARAMDDSSLFDGL-AYNQ  125

Query  487   VLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPK  666
              LGPDLG+SPLVF+     KCGG+++G+SWA+VL DAFS S F+N +G  +AG+  +P K
Sbjct  126   ALGPDLGYSPLVFLHSLGLKCGGMAVGLSWANVLRDAFSASAFMNMWGKIIAGQ--VPWK  183

Query  667   HPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIF  846
               H+P      SP   +    PFS+  V PVGD W   N  +M    +H+  ++L+ L+ 
Sbjct  184   LLHVPLPGKPESPSLSSVPEIPFSVKRVDPVGDFWVTPNKXRMRKHIFHVFAEKLDHLVS  243

Query  847   KVSG--LKQSAKVK-PFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNG  1017
              +S    KQSAKV   FE +SA+            G  T  + K  F     G+L   N 
Sbjct  244   NISCPPSKQSAKVSSAFEVLSAII----------XGFGTKNVHKGEF-----GVL--SND  286

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETME-EENGKSADFFVYGANLTFV  1194
              V S V A+  V+EA+V +L  LI +K  +E G I+ET   EE G ++DF  YGA LTFV
Sbjct  287   IVWSTVAADFLVAEAEVSDLVELIVKKGAEENGAIEETARREEGGSNSDFIAYGAKLTFV  346

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLL  1374
             NLEE +IYG ++KGQKP++A+Y I GVGDEG VLVLP   N      GR+++V+ PE+ L
Sbjct  347   NLEEAEIYGLELKGQKPVYASYGISGVGDEGLVLVLPASTN----NVGRLLSVVRPENQL  402

Query  1375  GKLKNEISK  1401
              +LK+E+ +
Sbjct  403   TQLKSELQR  411



>ref|XP_010673394.1| PREDICTED: protein ECERIFERUM 26-like [Beta vulgaris subsp. vulgaris]
Length=453

 Score =   346 bits (887),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 266/443 (60%), Gaps = 17/443 (4%)
 Frame = +1

Query  118   NIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPM  297
             ++VY HRLSSV  AT+TG+  V    N DLAMKLHYLR VY   SEA++GL    LK  +
Sbjct  17    SLVYGHRLSSVGSATVTGD-LVYEPNNMDLAMKLHYLRVVYFLDSEAIEGLIPVKLKEGI  75

Query  298   FRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
             F  L  +Y   GR R S   G+P++KCND GVR VEAK SKT++EWL + D      LL 
Sbjct  76    FAWLCYYYETCGRFRRSENGGKPYIKCNDCGVRFVEAKSSKTLEEWLQIKDTFS-QRLLV  134

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDL  657
              D V+GP+L FSPLVF+Q+T  KCGG+S+G+SWAHVLGDAFS+S+F+N     + G +  
Sbjct  135   ADNVIGPELTFSPLVFLQVTLLKCGGISLGVSWAHVLGDAFSVSNFMNTLSQFLRGMKPT  194

Query  658   PPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNA  837
              P + +     N    KP T +  P SL  V PVGD W +   C+M T S+ +   QL  
Sbjct  195   YPPNINKSPPQNQKPIKPMTSE--PLSLKQVSPVGDKWIMPLPCEMDTFSFQVKPTQLAQ  252

Query  838   LIFKVSGLKQS-AKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRN  1014
             L   +     + + ++PFE +SA+ W+++A++K G  L  VTI+K    S     +  RN
Sbjct  253   LQVNLFENDSTLSPIQPFELLSAVIWRAIARIKNGPELNAVTIMKKSATSPITDEMHLRN  312

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFV  1194
                + +VKA+  V EA +  +A LI + A DE   I+E +  +  +S DF +YG+NLTFV
Sbjct  313   NLFVGSVKADFSVVEAHLEVIATLIHDMAKDERAQIEEIVGRDPERS-DFIIYGSNLTFV  371

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE---------NLKGKEGGRIV  1347
             NLE+   YGF++KG  P F N  + G+G EG VLVLP P+          LK +E GR+V
Sbjct  372   NLEDAGFYGFELKGLSPRFVNCFVDGIGGEGVVLVLPSPKDNNNDKNNGTLKCEE-GRVV  430

Query  1348  NVILPEHLLGKLKNEISKELGTS  1416
               ILP + + KLK E+ KE G S
Sbjct  431   TFILPNYYMVKLKEEL-KECGLS  452



>ref|XP_006360967.1| PREDICTED: protein ECERIFERUM 26-like [Solanum tuberosum]
Length=426

 Score =   343 bits (879),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 195/440 (44%), Positives = 274/440 (62%), Gaps = 22/440 (5%)
 Frame = +1

Query  97    MESPDVEN-IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLN  273
             M S  +E+ ++Y+ +LSSV PA +TG+  V   +N DLAMKLHYLRG+Y F S+    + 
Sbjct  1     MVSSKLEDGLIYNIKLSSVGPARVTGQDVVYEPSNMDLAMKLHYLRGIYYFDSQTFQDVT  60

Query  274   TGDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQ  453
                +K P+F     FY   GR R + E GRP++KCND G R +EA+C KT++EWL+M D 
Sbjct  61    IYKIKEPIFIWFNYFYMTNGRFRRA-ESGRPYIKCNDCGARFIEAQCDKTLEEWLEMKDA  119

Query  454   SEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP  633
             S  + LL  +QVLGP+L FSP V IQ T FKCGG+S+G+SWAHVLGD FS ++F N  G 
Sbjct  120   S-LEKLLVSNQVLGPELAFSPPVLIQHTKFKCGGISLGLSWAHVLGDVFSATEFWNFLGK  178

Query  634   AMAGRRDLPPKHPHMPTADNHNSPKPRTQKLF--PFSLGSVGPVGDHWKLTNTCKMATQS  807
              + G +  PP+  ++  +    +     QK+   P S+  V PV DHW    +CK+ + S
Sbjct  179   VVGGYQ--PPRPLNLAHSLTKANSTQTLQKIVEDPLSIKRVDPVEDHWIANASCKLESFS  236

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
              H++  +L  +  ++ G++      PFE++ A+ W+S++++++G G + VTI K     +
Sbjct  237   IHVSASKLGHIQSRI-GIQ-----GPFESLCAIIWQSISRIRDGPGPKVVTICKKS-EEK  289

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFF  1167
               GL+   N QVI  VK +  + EA+  ELA LI  + +DE   IDE +E+E+G S DF 
Sbjct  290   KEGLIG--NTQVIGVVKVDDSIREANPSELARLIKNEIIDERLKIDEAIEKEHGVS-DFI  346

Query  1168  VYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLP-GPENLKGKEGGRI  1344
             VYGANLTFV+LE   +YGFD KG KP   NY I GVGD G VLVL  GP + +    GRI
Sbjct  347   VYGANLTFVSLEGADLYGFDWKGHKPKNVNYFIDGVGDAGTVLVLSDGPNDSE----GRI  402

Query  1345  VNVILPEHLLGKLKNEISKE  1404
             V + LPE  + KLKNE++ E
Sbjct  403   VTMTLPEDEIMKLKNELNNE  422



>ref|XP_003526552.1| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
 gb|KHN08987.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=444

 Score =   342 bits (877),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 192/438 (44%), Positives = 264/438 (60%), Gaps = 24/438 (5%)
 Frame = +1

Query  136   RLSSVVPAT-ITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             R+S+VVPAT    E     L   DL +KLHY+R V+ F SEAV GL+  DLK PMF +L+
Sbjct  16    RISTVVPATPREDENGAFQLNYMDLLVKLHYIRPVFFFTSEAVQGLSISDLKKPMFPLLD  75

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVL  492
              +Y  +GR+R S E GRPF+KCND+GVRI E+ C +T++EW   +     + L+H D VL
Sbjct  76    PYYHVSGRVRRS-ESGRPFIKCNDAGVRIAESHCDRTLEEWFRENGNGAVEGLVH-DHVL  133

Query  493   GPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP  672
             GPDL FSPLVF++ TWFKCGGLS+G+SWAHVLGDAFS  +FL+K+   +AG+   PPK  
Sbjct  134   GPDLAFSPLVFVKFTWFKCGGLSVGLSWAHVLGDAFSAFNFLSKWSQILAGQA--PPKSL  191

Query  673   HMPTADNHNSPKPRTQKLF-----PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNA  837
             H+ +      P+P+          P S+     +G++W  TN   +AT S+HIT KQL+ 
Sbjct  192   HVSSF-----PEPKISHNSIVDDPPVSIKKTNILGEYWLATNYHDVATHSFHITSKQLHH  246

Query  838   LIFKV-----SGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGL  999
             L+            ++     FE ISAL WK +A ++ +  G   VTI  +   +R    
Sbjct  247   LVTATFNQTNDNTNKAKTTTYFEIISALLWKCIANIRGQKIGPNVVTICTSE-SNRAENE  305

Query  1000  LPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGA  1179
              P     V+S ++A+    + ++ EL  LI E  + E  ++++ +E + GK  DF VYG 
Sbjct  306   FPTNGFLVLSKIEADFSTGKYEISELVKLIAENKMVENHVMEKLVEADEGKE-DFIVYGV  364

Query  1180  NLTFVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVI  1356
             NLTFVNLEE  IY G ++ GQKPI AN T  GV D+G VLVLP PE+ +    GRIV V 
Sbjct  365   NLTFVNLEEANIYDGMNLNGQKPIMANCTFRGVSDKGVVLVLPAPEDDEDGGNGRIVTVS  424

Query  1357  LPEHLLGKLKNEISKELG  1410
             LP   L +LK+++  E G
Sbjct  425   LPREELYQLKDKLGGEWG  442



>gb|KEH40827.1| transferase family protein [Medicago truncatula]
Length=439

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 189/442 (43%), Positives = 264/442 (60%), Gaps = 21/442 (5%)
 Frame = +1

Query  106   PDVENIVYDHRLSSVVPATITGEGRVL---NLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             P +E      R+++VVP T T +G  +   NL   DL MKLHY+R +Y+F SE +  L+ 
Sbjct  5     PSLETPHQSSRITTVVPLTPTLQGDEIVAYNLNYMDLLMKLHYIRSIYVFNSEVMQNLSL  64

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
              DLK+P++ +LE     +GRIR   E GRPF+KCND+GVR+ E +C KT+ EW D  + S
Sbjct  65    SDLKTPIYALLESCSHVSGRIRIL-ESGRPFIKCNDAGVRVAETRCDKTLHEWFDEKEYS  123

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
                 +   D VLGPDL FSPLVF++ T FKCGGLS+G+SWAH+LGDAFS  +F++K+   
Sbjct  124   VEGFV--PDHVLGPDLAFSPLVFVKFTHFKCGGLSVGMSWAHILGDAFSAFNFISKWSQI  181

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPR----TQKLFPFSLGSVGPVGDHWKLTNTCKMATQ  804
             +AG+   PPK  H       N  KP+    +    P S+     V ++W  TN   +AT 
Sbjct  182   LAGQA--PPKSLH-----KQNLTKPQFSLNSVSDNPISIKRATCVEEYWLATNHSDVATH  234

Query  805   SYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHS  984
             ++HIT  QL+ L+   S    + K K FE ISA+ WK +A+++   G   VTI      +
Sbjct  235   TFHITSNQLHHLV-TPSTTSNNIKTKYFEIISAMIWKCIAQIRGDFGQTVVTICTTNISN  293

Query  985   RGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADF  1164
             R     P  NG V+S ++      +A++L+LANLI EK ++E  ++++ +E+  GK   F
Sbjct  294   RAENEFP-TNGSVLSKIETNFPPDQANILDLANLITEKKMNENHVLEKIVEDGEGKE-HF  351

Query  1165  FVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRI  1344
              VYGA LTFV+LEE   Y   + GQKPI  N    GV DEG VLVLPGPE+  G   GR+
Sbjct  352   IVYGAKLTFVDLEEADFYEIKINGQKPIMVNCDFRGVHDEGVVLVLPGPEDTDGN-NGRM  410

Query  1345  VNVILPEHLLGKLKNEISKELG  1410
             + V LP   L +LK +++ ELG
Sbjct  411   ITVSLPGKELDQLKCKLAGELG  432



>ref|XP_009412065.1| PREDICTED: protein ECERIFERUM 26-like [Musa acuminata subsp. 
malaccensis]
Length=433

 Score =   336 bits (862),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 191/436 (44%), Positives = 261/436 (60%), Gaps = 23/436 (5%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLF-RSEAVDGLNTGDLKSPMF  300
             VY H+LS+VVP +++GE  V  L + DL MKLHY+R VY F + E +DGL   D+K PMF
Sbjct  10    VYGHKLSTVVPGSVSGEAVVHELADVDLVMKLHYVRTVYYFEQHETIDGLTIVDIKKPMF  69

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
               L  ++P  GRIR + E GRP +KCND GVRIVEAKC +T++EWL +   + +  L+  
Sbjct  70    PWLNSYFPVTGRIRRT-EAGRPLIKCNDCGVRIVEAKCCRTLEEWLRVPHSARWRPLVP-  127

Query  481   DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLP  660
             D+VLGP+L FSP+V++Q T FKCGG +IG SW+HVLGD  + ++ +N +G  + G    P
Sbjct  128   DKVLGPELHFSPMVYVQFTKFKCGGTAIGYSWSHVLGDPVTGTNCINLWGRLLGGN---P  184

Query  661   PKHPHMPTADNHNSPKPRTQ---KLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
             P    +P +    + +P  Q      P S+  V PVGD W +TN CKMAT S  IT+ +L
Sbjct  185   PPKSLLPHSARTPTGRPARQAPASATPLSVKQVEPVGDFWLVTNACKMATDSITITESRL  244

Query  832   NALIFKVSGLKQSAK---VKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLL  1002
               L        QS K   V  FE ISALFW+ LA V+ G G E   +       R     
Sbjct  245   ERL--------QSEKLNGVPAFEMISALFWRCLASVRRG-GREPRVVTICRHKPRAKRCA  295

Query  1003  PCRNGQVISAVKAEMRVS-EADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGA  1179
                N Q+IS V        + D+ ELA L+ ++ VDET +++E+++ + GK  DF VYGA
Sbjct  296   QLSNEQMISTVSTSAASPVDLDLAELAQLVSKQQVDETKLVEESIDGDGGK-PDFVVYGA  354

Query  1180  NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVIL  1359
             NLTFV++E V + G D+KG+KP+  +  I GVGDEGAVLV P   +  G   G    +IL
Sbjct  355   NLTFVDMEGVDLSGLDIKGEKPVQVDCVIDGVGDEGAVLVFPRGADAGGGSKGGAAVLIL  414

Query  1360  PEHLLGKLKNEISKEL  1407
             PE  + KLK  + +E 
Sbjct  415   PEDQIMKLKEVLKREF  430



>ref|XP_003519204.1| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
 gb|KHN26142.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=443

 Score =   336 bits (862),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 197/435 (45%), Positives = 264/435 (61%), Gaps = 20/435 (5%)
 Frame = +1

Query  136   RLSSVVPATITG-EGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             ++S+VVPAT  G E    +L+N DL MKLHY+R VY F ++A  GL+  DLK PMF +L+
Sbjct  13    KISTVVPATPRGDEDGAYHLSNMDLLMKLHYIRAVYFFINDAAQGLSIYDLKKPMFPLLD  72

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVL  492
                  +GRIR S E GRPF+KCND+GVRI E     T+ EW   +  S     L HD VL
Sbjct  73    QVVQLSGRIRVS-ESGRPFLKCNDAGVRIAEYHHDHTLGEWFQKNGCSLQG--LVHDHVL  129

Query  493   GPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPK-H  669
             GPDLGFSPLVF++ TWFKCGGLS+G+SW+HVLGDAFS   F+ K+   +AG    PPK  
Sbjct  130   GPDLGFSPLVFVKFTWFKCGGLSLGLSWSHVLGDAFSAFSFITKWSQILAGHA--PPKIL  187

Query  670   PHMPTADNHNSPKPRTQKLFP----FSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNA  837
             P  PT     +P             FS+ +   + + W  TN  KM T ++H+T KQLN 
Sbjct  188   PMSPTLKEIQTPHNNNSVNANNGNHFSVKTATTIEELWLATNGIKMVTHTFHVTAKQLNR  247

Query  838   LI---FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC  1008
             L+   F      ++ K   FE +SAL WK +A ++E +  + VTI   G     N   P 
Sbjct  248   LVSSTFFSCDQNKATKTSYFEILSALVWKHIAGMREDTEPKVVTICTRGM---ANIEFPT  304

Query  1009  RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLT  1188
              NG V+S V+A + V ++DV +LA LIGE+   E  ++++ +EE  GK  DF VYGANLT
Sbjct  305   -NGLVLSVVEANVAVGQSDVSDLAKLIGEEKRVENVVVEKLVEESQGK-GDFVVYGANLT  362

Query  1189  FVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLK-GKEGGRIVNVILPE  1365
             FV+LEE  +Y   + G KP+  N +I GVGD+G VLVLPG E+ + G+  GR+V V LPE
Sbjct  363   FVDLEEGDMYEVVLNGHKPVVTNCSIHGVGDQGVVLVLPGLEDEENGRNIGRMVTVSLPE  422

Query  1366  HLLGKLKNEISKELG  1410
               + +LK ++  E G
Sbjct  423   KEVDQLKEKLRGEWG  437



>ref|XP_003531221.1| PREDICTED: protein ECERIFERUM 26-like [Glycine max]
Length=434

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 187/432 (43%), Positives = 260/432 (60%), Gaps = 17/432 (4%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             E++V+D RLSSV P   TG     N    DLAMKLHYLR VY F SEA   L    +K  
Sbjct  5     ESVVHDVRLSSVGPGRATGSDVFHNPGGLDLAMKLHYLRVVYFFDSEAAQDLTIMKIKDG  64

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             MF +   ++   GR R S + GRP +KCND G R +EAKC+KT+DEWL M D   Y  L+
Sbjct  65    MFTLFNHYFITCGRFRRS-DSGRPLIKCNDCGARFIEAKCNKTLDEWLAMKDWPLYKLLV  123

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAM--AGR  648
              H QV+GP+L FSP V  Q+T FKCGG+S+G+SWAHVLGD  S S+F+N +G  +   G 
Sbjct  124   SH-QVIGPELSFSPPVLFQVTKFKCGGISLGLSWAHVLGDPLSASEFINSWGLILKNMGL  182

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
             + L      +PT      P P      P S   + PVGDHW   N  KM T S+H+T  Q
Sbjct  183   KMLFNIPRSIPTP---GQPGPEKD---PVSAKRIDPVGDHWIPANNKKMETFSFHLTSSQ  236

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC  1008
             LN L  ++ G     +  PFE++ A+ W+ +A+++ GS  +TVT+ ++  + RGN ++  
Sbjct  237   LNYLQAQIWGTSLD-QTPPFESLCAMIWRCMARIRPGSEPKTVTVCRSNPYKRGNHII--  293

Query  1009  RNGQVISAVKA--EMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
              N QVI  V A  E  + + D+  LA+++ ++ VDE   I+E +E + G S DFFVYG N
Sbjct  294   GNNQVICKVDAASESSILDTDLTVLASMLVDQGVDERKQIEEAVERDQGVS-DFFVYGVN  352

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE-NLKGKEGGRIVNVIL  1359
             LTF++L+E  +Y   +KG  P F  YT+ GVGDEG VLV P P+ +++    G+ + +I 
Sbjct  353   LTFLDLQETNVYDLQLKGHTPKFVYYTLQGVGDEGVVLVYPLPKGSMENGVDGKFLTMIF  412

Query  1360  PEHLLGKLKNEI  1395
             PE  + KLK+E+
Sbjct  413   PEDEMVKLKSEL  424



>ref|NP_001241338.1| uncharacterized protein LOC100819144 [Glycine max]
 gb|ACU18001.1| unknown [Glycine max]
Length=434

 Score =   333 bits (854),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 191/434 (44%), Positives = 262/434 (60%), Gaps = 21/434 (5%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             E +V+D RLSSV P   T      +    DLAMKLHYLR VY F SEA   L    +K  
Sbjct  5     ECVVHDVRLSSVGPGRATRSEVFHSPGGLDLAMKLHYLRVVYFFASEAAQDLTIMKIKEA  64

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             MF +L  ++   GR R S + GRP +KCND GVR +EAKCSKT+DEWL M D   Y  L+
Sbjct  65    MFTLLNHYFITCGRFRRS-DSGRPLIKCNDCGVRFIEAKCSKTLDEWLAMKDWPLYKLLV  123

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAM--AGR  648
              H QV+GP+L FSP V +Q+T FKCGG+S+G+SWAHVLGD  S S+F+N +G  +   G 
Sbjct  124   SH-QVIGPELSFSPPVLLQVTKFKCGGISLGLSWAHVLGDPLSASEFINSWGLILKNMGL  182

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
             + L      +PT      P P      P S   V PVGDHW   N  KM T S+H+T  Q
Sbjct  183   QQLFNIPRSIPTP---RQPGPEKD---PVSAKRVDPVGDHWIPANNKKMDTFSFHLTSSQ  236

Query  829   LNALIFKVSG--LKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLL  1002
             LN L  ++ G  L Q+     FE++ A+ W+ +A+V+ GS  +TVT+ +   + R N ++
Sbjct  237   LNYLQAQIWGPSLDQTPL---FESLCAMIWRCMARVRSGSEPKTVTVCRTDPYKRSNDII  293

Query  1003  PCRNGQVISAVKAEMRVS--EADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
                N QVI  V+ E   S  + D+  LA+++ ++ VDE   I+E +E++ G S DFFVYG
Sbjct  294   --GNNQVICKVEVESECSIVDTDLTILASMLVDQGVDERKQIEEAIEKDQGVS-DFFVYG  350

Query  1177  ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE-NLKGKEGGRIVNV  1353
              NLTF++LE+  +Y   +KG  P F  YT+ GVGDEG VLV P P+ +++    G+ V +
Sbjct  351   VNLTFLDLEDTNVYDLQLKGHTPKFVYYTLQGVGDEGIVLVYPWPKGSIENGVDGKFVTM  410

Query  1354  ILPEHLLGKLKNEI  1395
             I+PE  + KLK+E+
Sbjct  411   IIPEDEMVKLKSEL  424



>ref|XP_004247878.1| PREDICTED: protein ECERIFERUM 26-like [Solanum lycopersicum]
Length=427

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 270/433 (62%), Gaps = 20/433 (5%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             + ++Y+ +LSSV PA +TG+  V   +N DLAMKLHYLRG+Y F S+A  G+    +K P
Sbjct  8     DGLIYNIKLSSVGPARVTGQDVVYEPSNMDLAMKLHYLRGIYYFDSQAFQGVTIYKIKEP  67

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +F     FY   GR R + E GRP++KCND G R +EA+C KT+DEWL+M D S  + LL
Sbjct  68    IFIWFNYFYMTNGRFRRA-ESGRPYIKCNDCGARFIEAQCDKTLDEWLEMKDTS-LEKLL  125

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               +QVLGP+L FSP V IQ T FKCGG+S+G+SWAHVLGD FS ++F N  G  + G + 
Sbjct  126   VSNQVLGPELAFSPPVLIQHTKFKCGGISLGLSWAHVLGDIFSATEFWNFLGKVVGGYQ-  184

Query  655   LPPKHPHMPTADNHNSPKPRTQKLF--PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
              PP+  ++  +    +     QK+   P S+  V PV DHW    + K+ + S H++  +
Sbjct  185   -PPRPINLAHSLTKANSTETLQKIVEDPLSIKRVDPVEDHWVANASYKLESFSIHVSASK  243

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC  1008
             L  L  ++ G++      PFE++ ++ W+S++++++G G + VTI K G   +  GL+  
Sbjct  244   LGQLQSRI-GIQ-----GPFESLCSIIWQSISRIRDGPGPKVVTICKKGEEKKEGGLI--  295

Query  1009  RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLT  1188
              N Q+I  VK +  + +A+  ELA LI  + +DE   IDE +E+E+G S D  VYGANLT
Sbjct  296   GNTQLIGVVKVDDSIRDANPSELARLIKNEIIDERLKIDEAIEKEHGVS-DVIVYGANLT  354

Query  1189  FVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLP-GPENLKGKEGGRIVNVILPE  1365
             FV+LE V +Y FD KG KP   +Y I GVGD G VLVLP GP   +    GRIV + LP 
Sbjct  355   FVSLEGVDLYEFDWKGHKPKNVSYFIDGVGDAGTVLVLPDGPNYAE----GRIVTMTLPV  410

Query  1366  HLLGKLKNEISKE  1404
               + KLKNE++ E
Sbjct  411   DEIMKLKNELNNE  423



>ref|XP_004299742.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=446

 Score =   331 bits (848),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 214/437 (49%), Positives = 286/437 (65%), Gaps = 28/437 (6%)
 Frame = +1

Query  136   RLSSVVPATITGEG-RVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             R+SSVVPAT+T E  +V  LT  DLA+KLHY++GVY F    V+G+   DLK PMF++L+
Sbjct  18    RMSSVVPATVTAEEHKVHELTKMDLALKLHYIKGVYFFGR--VEGVTIYDLKKPMFQLLQ  75

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDH---LLHHD  483
              ++PAAGRIR S E+GRPF+KCNDSGVRIVEA+C +T+DEWL M+   ++D    +L ++
Sbjct  76    LYFPAAGRIRRS-ENGRPFIKCNDSGVRIVEARCDETVDEWLAMALGDDHDSSFDVLAYN  134

Query  484   QVLG-PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLP  660
             Q LG PDL  SPLVF+Q T FKCGG+S+GISWA+VLGDAFS S F+N +   MA    +P
Sbjct  135   QALGDPDLDLSPLVFLQFTRFKCGGMSVGISWANVLGDAFSASTFINLWKKIMAD--PVP  192

Query  661   PKHPHMPTADNHNSPKPRTQK---LFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
              K  H+P  D+  S  P +     + P  L  V  VGD W   N CKM T ++H+  +++
Sbjct  193   HKSLHIP-PDSAKSKLPLSVHPILITPSFLKRVDSVGDLWLTPNNCKMKTHTFHVDAEKI  251

Query  832   NALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSG-LETVTIVKNGFHSRGNGLLPC  1008
             N  +   SG  Q  KV  FE +SA+ WKSL+K+KE +     V++ KN    R   L   
Sbjct  252   NHFL---SG--QKPKVSAFEVLSAIIWKSLSKIKENAEETRIVSLCKNKSGERQ--LEFP  304

Query  1009  RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENG---KSADFFVYGA  1179
              N  V S V+A+  V+EA+V EL  LI  K   E  +I+E M  +N    +S+DF  YGA
Sbjct  305   SNEMVWSTVEADFWVAEAEVSELVELIFNKRKYENDMIEEMMGHDNESGEESSDFIAYGA  364

Query  1180  NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGK---EGGRIVN  1350
              LTFVNLEE++IY  ++KGQKP++ANY I GVG EG VLVLPGP+  K +   +G +IV 
Sbjct  365   KLTFVNLEEIEIYELELKGQKPVYANYAITGVGVEGVVLVLPGPKCGKERNDVDGDKIVT  424

Query  1351  VILPEHLLGKLKNEISK  1401
             V+LPE+ L +LK E+ K
Sbjct  425   VVLPENQLAQLKVELQK  441



>gb|KHN12341.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=434

 Score =   330 bits (845),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 185/432 (43%), Positives = 259/432 (60%), Gaps = 17/432 (4%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             E++V+D RLSSV P   T      +    DLAMKLHYLR VY F SEA   L    +K  
Sbjct  5     ESVVHDVRLSSVGPGRATRSEVFHSPGGLDLAMKLHYLRVVYFFASEAAQDLTIMKIKDG  64

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             MF +   ++   GR R S + GRP +KCND G R +EAKC+KT+DEWL M D   Y  L+
Sbjct  65    MFTLFNHYFITCGRFRRS-DSGRPLIKCNDCGARFIEAKCNKTLDEWLAMKDWPLYKLLV  123

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAM--AGR  648
              H QV+GP+L FSP V  Q+T FKCGG+S+G+SWAHVLGD  S S+F+N +G  +   G 
Sbjct  124   SH-QVIGPELSFSPPVLFQVTKFKCGGISLGLSWAHVLGDPLSASEFINSWGLILKNMGL  182

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
             + L      +PT      P P      P S   + PVGDHW   N  KM T S+H+T  Q
Sbjct  183   KMLFNIPRSIPTP---GQPGPEKD---PVSAKRIDPVGDHWIPANNKKMETFSFHLTSSQ  236

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC  1008
             LN L  ++ G     +  PFE++ A+ W+ +A+++ GS  +TVT+ ++  + RGN ++  
Sbjct  237   LNYLQAQIWG-PSLDQTPPFESLCAMIWRCMARIRPGSEPKTVTVCRSNPYKRGNDII--  293

Query  1009  RNGQVISAVKA--EMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
              N QVI  V A  E  + + D+  LA+++ ++ VDE   I+E +E + G S DFFVYG N
Sbjct  294   GNNQVICKVDAASESSILDTDLTVLASMLVDQGVDERKQIEEAVERDQGVS-DFFVYGVN  352

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE-NLKGKEGGRIVNVIL  1359
             LTF++L+E  +Y   +KG  P F  YT+ GVGDEG VLV P P+ +++    G+ + +I 
Sbjct  353   LTFLDLQETNVYDLQLKGHTPKFVYYTLQGVGDEGVVLVYPLPKGSMENGVDGKFLTMIF  412

Query  1360  PEHLLGKLKNEI  1395
             PE  + KLK+E+
Sbjct  413   PEDEMVKLKSEL  424



>ref|XP_004501655.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Cicer 
arietinum]
Length=424

 Score =   328 bits (840),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 184/439 (42%), Positives = 266/439 (61%), Gaps = 25/439 (6%)
 Frame = +1

Query  106   PDVENIVYDHRLSSVVPATI-TGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGD  282
             P++E    ++RLS+VVPAT  T E    NL   DL MKLHY+R +Y+F SEAV GL    
Sbjct  5     PNLETPPLNYRLSTVVPATQRTEENSEYNLNYMDLLMKLHYIRSIYIFESEAVQGLTIPQ  64

Query  283   LKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEY  462
             LK+PMF +L  ++  +GR        R F+KCND+GVRIVE++C KT+ EWLD   +  +
Sbjct  65    LKAPMFPLLNLYWHVSGRXXXX----RAFIKCNDAGVRIVESQCDKTVREWLD-EKKFCF  119

Query  463   DHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMA  642
             D  L HD VLGPDL FSPLVF++ T+FKCGGLSIG+SWAH+LGDAFS  +F++ +   +A
Sbjct  120   DEELVHDHVLGPDLAFSPLVFVKFTYFKCGGLSIGLSWAHILGDAFSAFNFISNWSHLLA  179

Query  643   GRRDLPPKHPHMPTADNHNSPK--PRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHI  816
             G+    PK+ HMP   NH+ P+  P +    P S+     VG++W  +N   +AT ++HI
Sbjct  180   GQA--LPKNLHMP---NHSKPQFLPNSVSDNPISIKRATNVGEYWLASNESNLATHTFHI  234

Query  817   TDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNG  996
             T KQL  L+   +   +    K FE ISA+ WK +++++   G   VTI      +R   
Sbjct  235   TYKQLQHLV-TTTTSTKYTNTKYFEIISAMIWKCISQIRGDFGSNVVTICTTNISNRDEN  293

Query  997   LLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
                  N  +IS ++  + + + D+ +L  LIG+K ++E  ++ E  EEE         YG
Sbjct  294   DF-ATNYLMISKIETNLPLEQCDISQLVKLIGDKKMNENHVL-EKFEEEG--------YG  343

Query  1177  ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE-NLKGKEGGRIVNV  1353
             A LTFV+LEE + YG  + G+KPI  N    GVGD+G VLVLP P+ +      GR++ V
Sbjct  344   AKLTFVDLEESEFYGVKLNGKKPIMTNCDFRGVGDQGVVLVLPAPQDDDDDGNNGRMITV  403

Query  1354  ILPEHLLGKLKNEISKELG  1410
              LP + L ++K+++++E G
Sbjct  404   SLPGNELNQMKSKLAREWG  422



>ref|XP_006852920.1| hypothetical protein AMTR_s00033p00231280 [Amborella trichopoda]
 gb|ERN14387.1| hypothetical protein AMTR_s00033p00231280 [Amborella trichopoda]
Length=424

 Score =   327 bits (837),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 180/430 (42%), Positives = 265/430 (62%), Gaps = 24/430 (6%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED  315
             ++S+V+PA +T +G V  L+N DLAMKLHYLR VY +  +A + L+   +K  MF +L+ 
Sbjct  14    KVSTVLPAAVTADGTVHELSNMDLAMKLHYLRAVYYYNKQAAESLSIYKVKESMFVLLQR  73

Query  316   FYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLG  495
                 AGR+R S E GRP +KCNDSGVRI+EA+C+KTI+EWL++ +    + L+  +QVLG
Sbjct  74    HVAVAGRVRKS-ESGRPHIKCNDSGVRILEAQCNKTIEEWLELKELIHGEELIS-NQVLG  131

Query  496   PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPH  675
             PDL FSPL+++Q T FKCGG+SI ++W+H+LGDAF+ S+F+  +G  +A      P  P 
Sbjct  132   PDLRFSPLLYLQFTKFKCGGMSIAMNWSHILGDAFTASNFIKAWGNLIADN----PAEPP  187

Query  676   MPTADNHNSPKPRTQK---LFPFSLGS-VGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             +PT       KP  Q+   + P S+   V P GD+W +TNT  M T S+HI+   +N L+
Sbjct  188   LPTVTLTPPLKPEVQEKKPMKPLSVSKPVEPAGDYWTVTNTTPMETTSFHISGSHVNQLL  247

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQV  1023
               +S    + K   FEA+SA  W++LAK++  +    +T++K     +  G+L   N Q 
Sbjct  248   SNISS--PNCKTSSFEAVSAFIWQTLAKIRGPNEPNVLTLIK-----KPKGIL--SNQQA  298

Query  1024  ISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLE  1203
             IS V     VSEA + ELA  I + A DET  I E +E +   + D  VYG NLTFV+LE
Sbjct  299   ISTVSVGFSVSEARLEELAVEILKGAKDETKEICEYIEADIVNN-DAIVYGGNLTFVDLE  357

Query  1204  EVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKL  1383
              ++ Y   +  ++P++A+Y++  VGD G V VLPG     G  G R+V V LP+  + +L
Sbjct  358   GLECYELKLAKERPVYASYSVEQVGDAGVVFVLPG----AGSNGERVVTVTLPKEEVSEL  413

Query  1384  KNEISKELGT  1413
             K+ ++K   T
Sbjct  414   KSHLNKAWNT  423



>gb|EYU32707.1| hypothetical protein MIMGU_mgv1a006596mg [Erythranthe guttata]
Length=437

 Score =   325 bits (832),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 187/434 (43%), Positives = 255/434 (59%), Gaps = 18/434 (4%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF  300
             +VYD +LSSV P  +TG+  +    N DLAMKLHY+R VY F S A +GL T  +K P+F
Sbjct  10    LVYDIKLSSVGPGNVTGQDSIFEARNMDLAMKLHYIRCVYYFGSRAFEGLTTLAIKEPIF  69

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQ-SEYDHLLH  477
               L  F   AGR R   E GRP++KCND GVR +EAKC  ++DEW +MSD  +  +  L 
Sbjct  70    VWLNRFPMTAGRFRRD-ESGRPYIKCNDCGVRFIEAKCRTSLDEWFEMSDDIAMREKFLC  128

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDL  657
              + ++GP+L FSPL++IQ+T FKCGG+++G+SWAHVLGD FS ++++N +     G    
Sbjct  129   SNSIIGPELSFSPLIYIQLTKFKCGGMAVGLSWAHVLGDVFSAAEYMNNWSRVATG---F  185

Query  658   PPKHPHMPTADNHNSPKPRTQKLF----PFSLGSVGPVGDHWKLTNTCKMATQSYHITDK  825
                 P    AD    PK    ++     P S+  V  VGD+W      K A  S+ +T  
Sbjct  186   GLNRPINKMADGPTKPKYFNGRVKVSEDPLSVKRVDSVGDNWVFAAKRKTAAFSFDVTPT  245

Query  826   QLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEG-SGLETVTIVKNGFHSRGNGLL  1002
             QL+ L  K+S  +       FEAISA+ W+ +A ++ G S    VTI K    +    +L
Sbjct  246   QLSHLRSKLS--RNGIDSPAFEAISAVIWRCIAGIRGGESEPRIVTICKRSEDNEKFRVL  303

Query  1003  PCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
               RN QV+  VKAE  V EA+  +LA L+    +DE   I+E +E ++G   DF VYGAN
Sbjct  304   --RNNQVVLVVKAESPVMEANPSDLAALMKNGGIDERAGIEEAVERDHGLP-DFIVYGAN  360

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILP  1362
             LTFVNLE    Y F+  GQKP+  +  I GVG+ GAVLVLP  E   G  GGR V  ILP
Sbjct  361   LTFVNLEGADFYDFEYSGQKPVRVSCRIDGVGENGAVLVLPAAE---GGGGGRSVMAILP  417

Query  1363  EHLLGKLKNEISKE  1404
             E+ +  +K+E+ +E
Sbjct  418   ENEVAAVKSELKRE  431



>ref|XP_010544488.1| PREDICTED: protein ECERIFERUM 1 [Tarenaya hassleriana]
Length=427

 Score =   323 bits (828),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 192/432 (44%), Positives = 266/432 (62%), Gaps = 29/432 (7%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLE  312
             +LSSVVPAT+TG  +   LT+ DLA+KLHY+R VY F+ S +V  +   + K P FR+L+
Sbjct  10    KLSSVVPATVTGNNKTRELTSMDLAVKLHYVRSVYFFKPSPSVRSITIDNFKGPFFRLLQ  69

Query  313   DFYPA-AGRIRTSPED---GRPFVKCNDSGVRIVEAKCSK-TIDEWLDMSDQS-EYDHLL  474
                P+ +GRIR S  D    RPFV+CNDSGVRIVEA     T++EWL   D++ +Y++L+
Sbjct  70    ISDPSVSGRIRRSESDNPTSRPFVRCNDSGVRIVEATVEGFTVEEWLSAGDRTIDYEYLV  129

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
             + DQVLGPDL FSPLV  Q+T FKCGG+SIG+ WAHVLGDAFS S F+N     +AG ++
Sbjct  130   Y-DQVLGPDLDFSPLVVFQMTRFKCGGISIGLDWAHVLGDAFSASAFMNALSLVLAG-QE  187

Query  655   LPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN  834
             +P   P  P    H  P         FS+  + PVG+HW  TN CKM  Q++ +  KQ+ 
Sbjct  188   IP--KPLYPEKIGHKYPVHEKA----FSIKKIEPVGNHWLHTNACKMGIQTFCLGSKQIQ  241

Query  835   ALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC-R  1011
              L+ +   L ++  V   E + A+ W+S+  V +GS  + ++I +      G     C  
Sbjct  242   NLMARYPALGKTLSV--VEILYAVVWRSMLNVHKGSNPKIISICE------GRRTETCSN  293

Query  1012  NGQVISAVKAEMRVSEAD--VLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANL  1185
             NG VIS V       E D  VLELA LI EK + E G I E+M + +G  +D+ +YGA L
Sbjct  294   NGMVISTVDIGGLPKEGDSSVLELATLIAEKKIVENGAI-ESMIDRDGGVSDYILYGAKL  352

Query  1186  TFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPE  1365
             TFVNL E  +Y F++ G+KP + NY I  VGDEG V+VL G ++ KGK   ++V +++PE
Sbjct  353   TFVNLGEADVYRFELDGEKPEYVNYMIHSVGDEGVVMVLQGNQD-KGKL-AKVVIMVIPE  410

Query  1366  HLLGKLKNEISK  1401
               L KL+ E+ K
Sbjct  411   EQLAKLEGELKK  422



>ref|XP_004297015.1| PREDICTED: anthranilate N-benzoyltransferase protein 2-like [Fragaria 
vesca subsp. vesca]
Length=428

 Score =   317 bits (811),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 188/432 (44%), Positives = 248/432 (57%), Gaps = 22/432 (5%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             +++VY  +LSSV    IT    V   +  DLAMKLHYLRGVY F SEA +GL+   +K  
Sbjct  7     DSLVYGFKLSSVGSGKITPADTVHVPSGMDLAMKLHYLRGVYFFSSEAAEGLSVLKIKET  66

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +F  L + +   GR R S   GRPFVKCND G R +EA+  KT++EWL M   S    LL
Sbjct  67    IFVWLIEHWRVLGRFRRSESSGRPFVKCNDCGARFIEAQSDKTLEEWLGM--DSSIHKLL  124

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSD-FLNKYGPAMAGRR  651
               +Q++GP+L FSP V  Q T FKCGG+SIG+SW+H+LGDA + S+ F N     M G+ 
Sbjct  125   ASNQIIGPELFFSPPVLFQWTRFKCGGVSIGLSWSHILGDAMAASEYFFNGLSRTMTGKE  184

Query  652   DLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
               P  +P     + H    P      P +L  V  VGDHW   N  KM T S  +T  QL
Sbjct  185   --PSPYPETSKPNIHQLKHPS-----PLALKKVDSVGDHWITPNNHKMETFSLVLTPTQL  237

Query  832   NALIFKVSGL--KQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP  1005
             N+L  K+ G     + ++  FE I  + W+ +AK+++GS  + VTI   G       +  
Sbjct  238   NSLELKLLGQNPNPAEEIPTFELICGVIWQCVAKMRQGSEPKLVTICTKGTKP---AVAE  294

Query  1006  CRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANL  1185
             C N Q+IS V+A   V++ D   LA ++ ++   E   I E +E ENG S D+ VYGANL
Sbjct  295   CGNNQIISTVEA-ADVADMDPKSLAAMLAKRESYEETQIGELVESENGAS-DYIVYGANL  352

Query  1186  TFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPE  1365
             TFVN E    YGF+ +G KP+  NY+I GVGDEGAVLV PGP        GR+VNVI PE
Sbjct  353   TFVNWEGSDFYGFEAEGHKPVCVNYSIQGVGDEGAVLVQPGPNG-----EGRLVNVIFPE  407

Query  1366  HLLGKLKNEISK  1401
               +  LK E+ K
Sbjct  408   KEVVGLKAELRK  419



>ref|XP_010448555.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=417

 Score =   314 bits (804),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 187/445 (42%), Positives = 256/445 (58%), Gaps = 43/445 (10%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             ME+  V  I    RLSSVVPA++ GE +   LT  DLAMKLHY+R VY  + +       
Sbjct  1     MEASPVTGI----RLSSVVPASVVGENKPRALTPMDLAMKLHYVRAVYFLKGKR--DFTV  54

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPED------GRPFVKCNDSGVRIVEAKCSK-TIDEW  435
              DLKS MF +L+  Y  +GRIR    D        P+++CNDSG+RIVEA   + T+++W
Sbjct  55    SDLKSTMFTLLQSNYHVSGRIRMPENDNDPSGLALPYIRCNDSGIRIVEANVEEFTVEKW  114

Query  436   LDMSDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDF  615
             LD+ D+S     L +D VLGPDL FSPLVF+QIT FKCGG SIG+SW HVLGD FS S F
Sbjct  115   LDLEDRSIDHRFLVYDHVLGPDLFFSPLVFLQITQFKCGGFSIGMSWTHVLGDVFSASTF  174

Query  616   LNKYGPAMAGRRDLP----PKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTN  783
             +   G  M+G  DLP    PK P + TA +HN            S+  +  VG+ W L N
Sbjct  175   MKTLGQLMSG-HDLPKLVYPKTPEV-TAHDHNGE--------AISIKKIESVGNCWSLAN  224

Query  784   TCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTI  963
              CKM    ++++  QL+ L+ K +   Q   +   + + AL WKSL  ++  +    +TI
Sbjct  225   KCKMGRYIFNLSLNQLDRLMAKYT--TQDQPLSESDILYALIWKSLLNIRGETETNVITI  282

Query  964   VKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEE  1143
                   +       C N  ++ +V  E +     + ELA LI     +E G+I  T+EE+
Sbjct  283   CDRKRST------TCWNDDLVISV-VERKDERIGISELAALIAGGKREENGVIKRTIEED  335

Query  1144  NGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLK  1323
              G S+DF  YGANLTFVNL+   +Y F++KG KP F NYTI GVGD+G VLV P      
Sbjct  336   RG-SSDFITYGANLTFVNLDMSDMYEFEIKGGKPDFVNYTIHGVGDKGVVLVFP------  388

Query  1324  GKEGGRIVNVILPEHLLGKLKNEIS  1398
              ++  RIV+V++P+  L KLK+E++
Sbjct  389   KEKSARIVSVVMPDEDLAKLKDEVA  413



>ref|XP_007153617.1| hypothetical protein PHAVU_003G050600g [Phaseolus vulgaris]
 gb|ESW25611.1| hypothetical protein PHAVU_003G050600g [Phaseolus vulgaris]
Length=434

 Score =   312 bits (800),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 184/442 (42%), Positives = 253/442 (57%), Gaps = 37/442 (8%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNA-DLAMKLHYLRGVYLFRSEAVDGLNTGDLKS  291
             E +V+D RLSSV P   T E  V +   A DLAMKLHYLR V+ F SEA   L    +K 
Sbjct  5     ETLVHDLRLSSVGPGQAT-ESDVFHYPAAMDLAMKLHYLRVVFFFHSEAAQDLTIMKIKD  63

Query  292   PMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHL  471
              MF     ++   GR R S + GRPF+KCND G R +EA CSKT+DEWL   D S  + L
Sbjct  64    AMFTWFNYYFITCGRFRRS-DSGRPFIKCNDCGARFIEANCSKTLDEWLATKDCS-LNKL  121

Query  472   LHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGR-  648
             L  +QV+GP+L FSP V +QI  FKCGG+S+G+SWAH+LGD F  S+F+N +G  M    
Sbjct  122   LSSNQVIGPELSFSPPVLLQIVKFKCGGISLGLSWAHILGDIFIASEFINSWGQIMNNLG  181

Query  649   --------RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQ  804
                     R +P      P  D             P S   + PVGDHW + N  KM T 
Sbjct  182   LKMVSNIPRSVPEPGQSGPEKD-------------PISAKPIDPVGDHWIVPNNKKMDTF  228

Query  805   SYHITDKQLNALIFKVSG--LKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGF  978
             S+H+T  QLN L  ++ G  L Q+     FE++ A+ W+ +A+V+     +TVT+ +   
Sbjct  229   SFHLTSSQLNYLQAQIWGPSLDQTPA---FESLCAMIWRCVARVRAKPEPKTVTVCRFDP  285

Query  979   HSRGNGLLPCRNGQVISAVK--AEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGK  1152
             + +   ++   N QVI  V+  +E  + + D+  LA+++  + VDE   I+E +E + G 
Sbjct  286   NKKNKDII--GNNQVICKVEGGSESCIVDMDLRVLASMLENEGVDERQQIEEAIERDQGV  343

Query  1153  SADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE-NLKGK  1329
             S DF+VYGANLTFV+LE+   Y   +KG  P F   TI GVGDEGA+LV P P+ + K  
Sbjct  344   S-DFYVYGANLTFVDLEKTNFYDLQLKGHTPTFVYLTIQGVGDEGAILVYPWPQSSTKNG  402

Query  1330  EGGRIVNVILPEHLLGKLKNEI  1395
               G+ V +ILPE  +  LK+E+
Sbjct  403   VDGKFVTMILPEEEMSDLKSEL  424



>ref|XP_010433760.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=418

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 180/433 (42%), Positives = 251/433 (58%), Gaps = 40/433 (9%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED  315
             RLSSVVPA++ GE +   LT  DLAMKLHY+R VY  + +        DLK+ MF +L+ 
Sbjct  10    RLSSVVPASVVGENKPRPLTPMDLAMKLHYVRAVYFLKGKR--DFTVSDLKTTMFTLLQS  67

Query  316   FYPAAGRIRTSPED-------GRPFVKCNDSGVRIVEAKCSK-TIDEWLDMSDQSEYDHL  471
             ++  +GRIR    D         P+++CNDSG+RIVEA   + T+++WLD+ D+S     
Sbjct  68    YHHVSGRIRMPENDNDPSSGLALPYIRCNDSGIRIVEANVEEFTVEKWLDLEDRSIDHRF  127

Query  472   LHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRR  651
             L +D VLGPDL FSPLVF+QIT FKCGG SIG+SW HVLGD FS S F+   G  M+G  
Sbjct  128   LVYDHVLGPDLFFSPLVFLQITQFKCGGFSIGLSWTHVLGDVFSASTFMKTLGQLMSG-H  186

Query  652   DLP----PKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT  819
              LP    PK P M T+ +HN            S+  +  VG+ W L N CKM    ++ +
Sbjct  187   GLPELVYPKTPEM-TSHDHNDE--------AISIKKIESVGNCWLLANKCKMGRYVFNFS  237

Query  820   DKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGL  999
               QL+ LI K +   Q   +   + + AL WKSL  ++  +    +TI  +   +     
Sbjct  238   LNQLDRLIAKYT--TQDQPLSEIDILYALIWKSLLNIRGETNTNVITICDSKRST-----  290

Query  1000  LPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGA  1179
               C N  ++ +V  E +     + ELA LI     +E G+I + ++E+ G S+DF  YGA
Sbjct  291   -TCWNDDLVISV-VERKDEMIGISELAALIAGGKREENGVIKQMIKEDRG-SSDFITYGA  347

Query  1180  NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVIL  1359
             NLTFVNL+   +Y F++KG KP F NYTI GVGD+G VLV P       ++  RIV+V++
Sbjct  348   NLTFVNLDMADMYEFEIKGGKPDFVNYTIHGVGDKGVVLVFP------KEKSARIVSVVM  401

Query  1360  PEHLLGKLKNEIS  1398
             PE  L KLK+E++
Sbjct  402   PEEDLAKLKDEVT  414



>ref|XP_002869713.1| hypothetical protein ARALYDRAFT_492392 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45972.1| hypothetical protein ARALYDRAFT_492392 [Arabidopsis lyrata subsp. 
lyrata]
Length=415

 Score =   309 bits (792),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 179/431 (42%), Positives = 246/431 (57%), Gaps = 39/431 (9%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED  315
             RLSSVVPA++ GE +    T  DLAMKLHY+R VY F+   +      DLK+ MF +L+ 
Sbjct  10    RLSSVVPASVVGENKPRLFTPMDLAMKLHYVRAVYFFK--GIRDFTVADLKNTMFTILQS  67

Query  316   FYPAAGRIRTSPED----GRPFVKCNDSGVRIVEAKCSK-TIDEWLDMSDQSEYDHLLHH  480
             ++  +GRIR S  D      P+++CNDSG+RIVEA   + T+++WLD+ D+S     L +
Sbjct  68    YHHVSGRIRMSDNDPSAPAIPYIRCNDSGMRIVEANVEEFTVEKWLDLDDRSIDHRFLVY  127

Query  481   DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLP  660
             D VLGPDL FSPLVF+QIT FKCGGLSIG+SWAHVLGD FS + F+   G  M+G     
Sbjct  128   DHVLGPDLTFSPLVFVQITQFKCGGLSIGLSWAHVLGDLFSAATFMKTLGQLMSGHGPTK  187

Query  661   PKHPHMP--TADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN  834
               +P  P  T+  HN            S+  +  VG +W LTN CKM    ++ +  Q++
Sbjct  188   LVYPETPELTSHAHNGE--------AISIEKIESVGQYWLLTNKCKMGRYIFNFSLNQID  239

Query  835   ALIFKVSGLKQSAKVKPFEAIS---ALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP  1005
              L+ K +   Q     PF  +    AL WK+L  ++  +    +TI      S       
Sbjct  240   RLMAKYTTRDQ-----PFSEVDILYALIWKALLNIRGKTNTNVITICDRNKSS------T  288

Query  1006  CRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANL  1185
             C N  ++ +V  E       + ELA LI     +E G+I   +EE+ G S+DF  YGANL
Sbjct  289   CWNDDLVISV-VEKNDEMIGISELAALIAGGKREENGVIKRMIEEDKG-SSDFITYGANL  346

Query  1186  TFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPE  1365
             TFVNL+ + +Y  ++KG KP F NYTI GVGD+G VLV P       +   RIV+V++PE
Sbjct  347   TFVNLDMIDMYEIEIKGGKPDFVNYTIHGVGDKGVVLVYP------KQNFARIVSVVMPE  400

Query  1366  HLLGKLKNEIS  1398
               L KLK E++
Sbjct  401   EDLAKLKEEVT  411



>gb|EPS62865.1| hypothetical protein M569_11925, partial [Genlisea aurea]
Length=417

 Score =   309 bits (792),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 184/443 (42%), Positives = 250/443 (56%), Gaps = 48/443 (11%)
 Frame = +1

Query  118   NIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPM  297
             +I+   RLS+VVPA++ GEG   + TN DLA KLHYL  ++LF  EA   L   DLK PM
Sbjct  3     DIISGIRLSTVVPASVAGEGISHHFTNTDLAFKLHYLSTLHLFTGEAAKDLTIADLKEPM  62

Query  298   FRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
             F+ L  +Y   GRIR    DGR F+KCNDSGVRIVEA CSKT+ EW+D  D      L++
Sbjct  63    FQWLRVYYGICGRIRRDDSDGRLFLKCNDSGVRIVEAICSKTVAEWIDGGDYQR--GLVY  120

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG----  645
             H   LG +  F+PLVF+Q+T FKCGGL +G+ WAH++GD F   D +  +G  +AG    
Sbjct  121   HQPFLGDNFEFTPLVFLQLTRFKCGGLGVGMRWAHIIGDGFKALDSIKAWGKILAGEMPK  180

Query  646   -----------RRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCK  792
                        RR++    P  P+A    S KP TQ L           G  W   N  K
Sbjct  181   PPPPPLTTPTSRRNVDSAEP--PSASPCRSLKPLTQSL-----------GGTWLTPNNVK  227

Query  793   MATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKN  972
             + T ++H ++K L  L+        +  +  FE ISAL WK LA++K  +  +TVT+VK 
Sbjct  228   LQTHTFHFSEKHLAGLMAAADRRYGNHGISSFEIISALIWKYLAEIKT-AATDTVTLVKK  286

Query  973   ---GFHSR--GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETME  1137
                 F  R  GNG L      ++     E   +++D LE+A  I ++ VDET +I+ET +
Sbjct  287   RKGDFDGRILGNGGLEI---GIVDFAFQEKITTDSDPLEIAKAITDRFVDETKLIEETAK  343

Query  1138  EENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
              +     DF +YG+NLTFV+L +  +YG  +KG+   FAN ++GGVGDEGAV+V+PG E+
Sbjct  344   WD----LDFLIYGSNLTFVDLIDADLYGLKLKGEDAAFANLSVGGVGDEGAVVVVPGREH  399

Query  1318  LKGKEGGRIVNVILPEHLLGKLK  1386
                  G   VN ILPE     LK
Sbjct  400   -----GIATVNAILPEDQTVHLK  417



>ref|XP_006286038.1| hypothetical protein CARUB_v10007574mg [Capsella rubella]
 gb|EOA18936.1| hypothetical protein CARUB_v10007574mg [Capsella rubella]
Length=417

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 176/430 (41%), Positives = 245/430 (57%), Gaps = 35/430 (8%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED  315
             RLSSVVPA++ GE +   LT  DLAMKLHY+R VY F+          DLK+ MF +L+ 
Sbjct  10    RLSSVVPASVVGENKPRKLTPMDLAMKLHYVRAVYFFKGRR--DFTVSDLKTTMFTLLQS  67

Query  316   FYPAAGRIRTSPED------GRPFVKCNDSGVRIVEAKCSK-TIDEWLDMSDQSEYDHLL  474
             ++  +GRIR    D        P+++CNDSG+RIVEA     T+++WLD+ D+S     L
Sbjct  68    YHHVSGRIRMPENDDDPSALALPYIRCNDSGIRIVEANVEDFTVEKWLDLDDRSIDHRFL  127

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGR--  648
              +D VLGPDL FSPLVF+QIT FKCGG SIG+SW HVLGD FS S F+   G  M+G   
Sbjct  128   VYDHVLGPDLIFSPLVFLQITQFKCGGFSIGLSWTHVLGDVFSASTFMKTLGQLMSGHGL  187

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
              +L    P   T+  HN            S+  +  VG +W LTN CKM    ++ +  Q
Sbjct  188   PELVYPEPLELTSHAHNGE--------AISMKKIESVGKYWLLTNKCKMGRYIFNFSLSQ  239

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC  1008
             ++ L+ K +   Q   +   + + AL WK+L  ++  +    +TI              C
Sbjct  240   IDRLMAKYTA--QDQPLSEIDILYALIWKALLNIRGDTATNVITICDR------KKTTTC  291

Query  1009  RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLT  1188
              N  ++ +V  E +     + ELA LI     +E G+I + M EE+G S+DF  YGANLT
Sbjct  292   WNDDLVISV-VERKDEPIGISELAKLIAGGKREENGVI-KRMIEEDGGSSDFITYGANLT  349

Query  1189  FVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEH  1368
             FVNL+   +Y F++KG KP F NYTI GVG++G VLV P  ++       RIV+V++PE 
Sbjct  350   FVNLDMADMYEFEIKGGKPDFVNYTIQGVGEKGVVLVFPKEKH------ARIVSVVMPEE  403

Query  1369  LLGKLKNEIS  1398
              L KLK+E++
Sbjct  404   ELAKLKDEVA  413



>ref|XP_007141275.1| hypothetical protein PHAVU_008G182300g [Phaseolus vulgaris]
 gb|ESW13269.1| hypothetical protein PHAVU_008G182300g [Phaseolus vulgaris]
Length=437

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 195/430 (45%), Positives = 265/430 (62%), Gaps = 15/430 (3%)
 Frame = +1

Query  136   RLSSVVPATITGE-GRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             R+S+VVPAT  GE  R  +L++ DL +KLHY+R +Y F + A  GL+  DLK PMF +L+
Sbjct  11    RISTVVPATPRGEEHREWHLSSMDLLLKLHYIRALYFFVNHAAQGLSVYDLKKPMFPLLD  70

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVL  492
                  +GRIR S E GRPF+KCND+GVRI E+ C  T+ EWL  +  S + H L  D VL
Sbjct  71    HVTHLSGRIRIS-ESGRPFIKCNDAGVRIAESHCHLTLREWLHQNGSSLH-HALLPDHVL  128

Query  493   GPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP  672
             GPDLGFSPLVF++ TWFKCGG+S+G+SW+HVLGDAFS  +F+ K+   +AG    PPK  
Sbjct  129   GPDLGFSPLVFVKFTWFKCGGISVGLSWSHVLGDAFSAFNFIAKWSRMLAGHA--PPKTL  186

Query  673   HMPTADNHNSPKPRTQKL-FPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFK  849
             H+ +     SP    +    P S+     V D W  TN  KM T ++H++  QLN L+  
Sbjct  187   HVTSHKQTQSPPHNNENDGSPISVKMATTVEDLWLATNQTKMVTHTFHVSPNQLNHLVTS  246

Query  850   V--SGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQV  1023
             +      Q+ K   FE +SAL WK +A+++     + VTI+  G  S G       N  V
Sbjct  247   MFTCDQNQATKTSYFEILSALVWKHVARIRHLEP-KIVTILTRGSDSDGFS----SNNVV  301

Query  1024  ISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLE  1203
             IS V+A + V ++DV +LA LIGE+   E  +++E +E + GK  +  VYGA LTFV+LE
Sbjct  302   ISVVEANVAVGKSDVADLAKLIGEEKRVENNVVEELVEGKEGKE-NLVVYGARLTFVDLE  360

Query  1204  EVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE-NLKGKEGGRIVNVILPEHLLGK  1380
             E  IY   + GQKP+  N  IGGVGD+G VLVLPG +    G  GGR+V V LPE  + +
Sbjct  361   EDDIYEVLLNGQKPMVVNCGIGGVGDDGVVLVLPGSQGEEDGGRGGRMVTVTLPEKEVEQ  420

Query  1381  LKNEISKELG  1410
             LK ++ +E G
Sbjct  421   LKEKLREEWG  430



>ref|NP_194182.1| fatty acid elongation machinery component ECERIFERUM2 [Arabidopsis 
thaliana]
 sp|Q39048.1|CER2_ARATH RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]
 emb|CAA63618.1| cer2 [Arabidopsis thaliana]
 gb|AAB17946.1| CER2 [Arabidopsis thaliana]
 emb|CAA23012.1| CER2 [Arabidopsis thaliana]
 emb|CAB79361.1| CER2 [Arabidopsis thaliana]
 gb|AAM64817.1| CER2 [Arabidopsis thaliana]
 gb|ABH04588.1| At4g24510 [Arabidopsis thaliana]
 gb|AEE84918.1| fatty acid elongation machinery component ECERIFERUM2 [Arabidopsis 
thaliana]
Length=421

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 174/434 (40%), Positives = 246/434 (57%), Gaps = 39/434 (9%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF---RM  306
             RLSSVVPA++ GE +   LT  DLAMKLHY+R VY F+          D+K+ MF    +
Sbjct  10    RLSSVVPASVVGENKPRQLTPMDLAMKLHYVRAVYFFK--GARDFTVADVKNTMFTLQSL  67

Query  307   LEDFYPAAGRIRTSPEDGR------PFVKCNDSGVRIVEAKCSK-TIDEWLDMSDQSEYD  465
             L+ ++  +GRIR S  D        P+++CNDSG+R+VEA   + T+++WL++ D+S   
Sbjct  68    LQSYHHVSGRIRMSDNDNDTSAAAIPYIRCNDSGIRVVEANVEEFTVEKWLELDDRSIDH  127

Query  466   HLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG  645
               L +D VLGPDL FSPLVF+QIT FKCGGL IG+SWAH+LGD FS S F+   G  ++G
Sbjct  128   RFLVYDHVLGPDLTFSPLVFLQITQFKCGGLCIGLSWAHILGDVFSASTFMKTLGQLVSG  187

Query  646   RRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDK  825
                  P +P  P   +H             S+  +  VG++W LTN CKM    ++ +  
Sbjct  188   HAPTKPVYPKTPELTSHARNDGEA-----ISIEKIDSVGEYWLLTNKCKMGRHIFNFSLN  242

Query  826   QLNALIFKVSGLKQSAKVKPFEAIS---ALFWKSLAKVKEGSGLETVTIVKNGFHSRGNG  996
              +++L+ K +   Q     PF  +    AL WKSL  ++  +    +TI      S    
Sbjct  243   HIDSLMAKYTTRDQ-----PFSEVDILYALIWKSLLNIRGETNTNVITICDRKKSS----  293

Query  997   LLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
                C N  ++ +V  E       + ELA LI  +  +E G I   +E++ G S+DFF YG
Sbjct  294   --TCWNEDLVISV-VEKNDEMVGISELAALIAGEKREENGAIKRMIEQDKG-SSDFFTYG  349

Query  1177  ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVI  1356
             ANLTFVNL+E+ +Y  ++ G KP F NYTI GVGD+G VLV P       +   RIV+V+
Sbjct  350   ANLTFVNLDEIDMYELEINGGKPDFVNYTIHGVGDKGVVLVFP------KQNFARIVSVV  403

Query  1357  LPEHLLGKLKNEIS  1398
             +PE  L KLK E++
Sbjct  404   MPEEDLAKLKEEVT  417



>gb|EPS62582.1| hypothetical protein M569_12210, partial [Genlisea aurea]
Length=429

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 183/438 (42%), Positives = 251/438 (57%), Gaps = 26/438 (6%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             E +VYD +LSSV P  ++G    ++  NADLAMKLHY++GVY F  EA +G+   D+K P
Sbjct  6     EQLVYDVKLSSVGPGKVSGFNTSVSPENADLAMKLHYVKGVYYFGREAFEGVTVQDIKDP  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
              F  L  +    GR R      RP++KCND GVR VEA C KT+ EW +M      + LL
Sbjct  66    TFVWLNKYPVHCGRFRRDHPSERPYIKCNDCGVRFVEATCGKTLQEWFEMEGD---ERLL  122

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
                Q+LGP+L FSPLV+IQ+T FKCG +++G+SWAHVLGD FS  DF+N +G  +AG + 
Sbjct  123   SSGQILGPELKFSPLVYIQLTKFKCGSVAVGLSWAHVLGDLFSAVDFMNDWGRTVAGLQ-  181

Query  655   LPPKHPHMPTADNHNSPKPR-----TQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT  819
                     P    + S KP+     T    P S+  V PVGD+W  +  C+M   S+ I 
Sbjct  182   -----IGQPVDFINQSAKPKLSNASTSFKDPLSIKRVDPVGDNWIHSPNCRMRVVSFRIP  236

Query  820   DKQLNALIFKVSGLKQSAKVKP-FEAISALFWKSLAKVKEGSGLETVTIV--KNGFHSRG  990
               QL       S L+   +VK  FE+++A+ WK +A+++     + V  V  KN      
Sbjct  237   PAQL-------SLLRAKLQVKATFESVAAVIWKCIARIRGREKEQRVVTVCKKNDDRDGD  289

Query  991   NGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFV  1170
                    N Q++S  +A+  V +A+  EL +L+ E  VDE   I E +E   G  ADF V
Sbjct  290   RRKRILNNTQIVSVARADFPVIDAECGELVSLLMEDLVDERVKIGEAVERSYG-LADFVV  348

Query  1171  YGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVN  1350
             YGANL+FVNLE+  +YGF+  GQK I A+Y I GV + GA++V P   +  G  GGR V 
Sbjct  349   YGANLSFVNLEDTNLYGFEYNGQKSIRASYHIDGVSENGAIVVHP-ESSSGGGGGGRTVV  407

Query  1351  VILPEHLLGKLKNEISKE  1404
              ILPE+   +LK E+ KE
Sbjct  408   AILPENEAIELKLEMKKE  425



>ref|XP_010439020.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=418

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 175/432 (41%), Positives = 250/432 (58%), Gaps = 38/432 (9%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED  315
             RLSSVVPA++ GE +   LT  DLAMKLHY+R VY  + +        DLK+ MF +L+ 
Sbjct  10    RLSSVVPASVVGENKPRPLTPMDLAMKLHYVRAVYFLKGKR--DFTVSDLKTTMFTLLQS  67

Query  316   FYPAAGRIRTSPED------GRPFVKCNDSGVRIVEAKCSK-TIDEWLDMSDQSEYDHLL  474
             ++  +GRIR    D        P+++CNDSG+RIVEA   + T+++WLD+ D++     L
Sbjct  68    YHHVSGRIRMPENDNDPSGLALPYIRCNDSGIRIVEANVEEFTVEKWLDLEDRTIDHRFL  127

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
              +D VLGPDL FSPLVF+QIT FKCGG SIG+SW HVLGD FS S F+   G  M+G   
Sbjct  128   VYDHVLGPDLFFSPLVFLQITQFKCGGFSIGLSWTHVLGDVFSASTFMKTLGQLMSG-HG  186

Query  655   LP----PKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
             LP    PK P + T+ +HN      +K        +  VG+ W L N C M   +++I+ 
Sbjct  187   LPELVYPKTPEL-TSHDHNGEAIAIKK--------IESVGNCWLLANKCNMGRYNFNISL  237

Query  823   KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLL  1002
              QL+ L+ K +  +    +   + + AL W SL  ++  +    +TI      +      
Sbjct  238   NQLDRLMAKYTT-QVDQPLSEIDILYALIWNSLLNIRGETDTNVITICDRKKST------  290

Query  1003  PCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
              C N  ++ +V  E +     + ELA LI     +E G+I   +EE+ G S+DF  YGAN
Sbjct  291   SCWNDDLVISV-VERKDERIGISELAALIACGKREENGVIKRMIEEDRG-SSDFITYGAN  348

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILP  1362
             LTFVNL+   +Y F++KG+KP F NYTI GVGD+G VLV P       ++  RIV+V++P
Sbjct  349   LTFVNLDMADMYEFEIKGEKPDFVNYTIHGVGDKGVVLVFP------KEKSARIVSVVMP  402

Query  1363  EHLLGKLKNEIS  1398
             E  L K+K+E++
Sbjct  403   EEDLAKIKDEVT  414



>gb|EPS64444.1| hypothetical protein M569_10336, partial [Genlisea aurea]
Length=424

 Score =   303 bits (776),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 175/434 (40%), Positives = 253/434 (58%), Gaps = 28/434 (6%)
 Frame = +1

Query  136   RLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED  315
             +LSSV P  ++G    +     DLAMKLHYLRGVY F  +A DG    ++K PMF  L  
Sbjct  5     KLSSVGPGNVSGFNAAVEPAGIDLAMKLHYLRGVYYFERKAFDGATVQEVKDPMFEWLNR  64

Query  316   FYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEY---DHLLHHDQ  486
             +    GR R      RP++KCND GVR +EA   +T+DEWL+++D       + LL   Q
Sbjct  65    YPVQCGRFRREEASERPYIKCNDCGVRFIEAAAGETLDEWLELNDDDGLMLREKLLFSGQ  124

Query  487   VLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPK  666
             ++GP+L FSPLV+IQ+T F+CGG+++G+SWAH+LGD FS   F+N +    +G R   P 
Sbjct  125   IIGPELTFSPLVYIQLTKFRCGGVAVGLSWAHILGDLFSAIKFMNDWARTASGLRIDQPI  184

Query  667   HPHMPTADNHNSPKPRTQKLF--PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
                  +A++  + +P+ +K F  P S+  V PVGD+W  + +C M   S+ I   QL   
Sbjct  185   FKAQDSANSKLTIEPK-KKAFEDPLSIKRVDPVGDNWIYSPSCAMQAVSFEIASAQL---  240

Query  841   IFKVSGLKQSAKVKP-FEAISALFWKSLAKVKEGSGLET----VTIVKNGFHSR-GNGLL  1002
                 S L+   +VK  FE ISA+ WK +A+++   G ET    VT+ K       G+G +
Sbjct  241   ----SLLRAKLQVKSTFEPISAVIWKCIARIR---GRETEPRVVTVFKKSDRDEVGDGSI  293

Query  1003  PCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
               +N Q +   K+E  V++++  +L  L+ E  V+E   I+E ME  +G   DF VYGAN
Sbjct  294   -LKNTQRVIVAKSEFSVADSNFRDLVYLLLENYVEERFEIEEAMERSDGLD-DFVVYGAN  351

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILP  1362
             L+FVNLE+ ++YGF    Q P+  +Y + GVG+ GA+L+LP    + G   GR V  ILP
Sbjct  352   LSFVNLEDARLYGFVYNRQIPVRVSYRLDGVGENGAILILP----VSGGGDGRSVVAILP  407

Query  1363  EHLLGKLKNEISKE  1404
             E+   KLK E+ KE
Sbjct  408   ENEAVKLKAELKKE  421



>ref|XP_008668901.1| PREDICTED: protein ECERIFERUM 26-like [Zea mays]
 tpg|DAA36075.1| TPA: glossy2 [Zea mays]
Length=426

 Score =   298 bits (764),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 178/436 (41%), Positives = 255/436 (58%), Gaps = 36/436 (8%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+ HRLS+VVP+++TGE     L +ADLA KLHYLRGVY +RS   DGL T  LK PMF 
Sbjct  16    VHGHRLSTVVPSSVTGEVD-YALADADLAFKLHYLRGVYYYRSG--DGLATKVLKDPMFP  72

Query  304   MLEDFYPAAGRIRTSPEDG-----RPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDH  468
              L+D +P AGR+R +  +G     RP++KCND GVRIVEA+C + + EW+  +       
Sbjct  73    WLDDHFPVAGRVRRAEAEGDGAPRRPYIKCNDCGVRIVEARCDRDMAEWIRDAAPGRIRQ  132

Query  469   LLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGR  648
             L + D+VLGP+L FSPL+++QIT FKCGGL++G SWAH++GD  S +   NK+   ++G 
Sbjct  133   LCY-DKVLGPELFFSPLLYVQITNFKCGGLALGFSWAHLIGDIPSAATCFNKWAQILSG-  190

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
                  K P        N P        P S+  VGP+ D W +     MA  S+H++D  
Sbjct  191   -----KKPEATVLTPPNQPLQGQSPAAPRSVKQVGPMEDLWLVPAGRDMACYSFHVSDAV  245

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP-  1005
             L  L  + +G +Q A    FE +SAL W+++AK++    ++TVT+V+    +R    L  
Sbjct  246   LKKLHQQQNG-RQDAAAGTFELVSALVWQAVAKIR--GDVDTVTVVRADAAARSGKSLAN  302

Query  1006  -CRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVY-GA  1179
               + G V SA  +    ++ DV ELA L+ +  VDET  +            D  VY GA
Sbjct  303   EMKVGYVESAGSSP---AKTDVAELAALLAKNVVDETAAV-------AAFQGDVLVYGGA  352

Query  1180  NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVIL  1359
             NLT V++E+V +YG ++KGQ+P++  Y + GVGDEGAVLV P   +  G+  GR+V V+L
Sbjct  353   NLTLVDMEQVDLYGLEIKGQRPVYVEYGMDGVGDEGAVLVQP---DADGR--GRLVTVVL  407

Query  1360  PEHLLGKLKNEISKEL  1407
             P   +  L+  +   L
Sbjct  408   PGDEIDSLRAALGSAL  423



>ref|XP_004976772.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=427

 Score =   294 bits (752),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 172/438 (39%), Positives = 258/438 (59%), Gaps = 37/438 (8%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS-EAVDGLNTGDLKSPMF  300
             V+ HRLS+VVP+++TGE     L +ADLA KLHYLRGVY + + +   G+ T  LK PMF
Sbjct  14    VHGHRLSTVVPSSVTGEVD-YALADADLAFKLHYLRGVYYYPAGDVARGITTKVLKDPMF  72

Query  301   RMLEDFYPAAGRIRTSPEDG---RPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHL  471
               L+D++P AGR+R + +D    RP++KCND GVRIVEAKC + + +WL   D  +    
Sbjct  73    PWLDDYFPVAGRVRRADDDAAGRRPYIKCNDCGVRIVEAKCDRDMADWL-RDDAPDRLRQ  131

Query  472   LHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRR  651
             L +D+VLGP+L FSPL+++QIT FKCGGL++G SWAH++GD  S +   NK+   ++G++
Sbjct  132   LCYDKVLGPELFFSPLLYVQITNFKCGGLALGFSWAHLIGDVQSAATCFNKWAQILSGKK  191

Query  652   D----LPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT  819
                  L P++  +       +  PR+ K        VGP+ DHW +     MA  S+H+T
Sbjct  192   PEATVLTPENKPLQGQSPAGAAAPRSVK-------QVGPIEDHWLVPAGRDMACYSFHVT  244

Query  820   DKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGL  999
             +  L  L  +    + +A    FE +SAL W+++A+++ G+  +TVT+VK    +R    
Sbjct  245   EATLKKLEQQQG--RHAAAAGTFELVSALLWQAVARIRGGT--QTVTVVKTDAAARSGRA  300

Query  1000  LPCRNGQVISAVKAE-MRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVY-  1173
             L   N   +  V+A     ++ DV ELA L+ +  VDET  +            D  VY 
Sbjct  301   LA--NEMKVGYVEASGSSPAKTDVAELAALLAKGVVDETAAV-------AAFPGDVLVYG  351

Query  1174  GANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNV  1353
             GA+LT V++E V +YG ++KGQ+P+   Y + GVG+EGAVLV P   +  G+  GR+V  
Sbjct  352   GAHLTLVDMERVDVYGLEIKGQRPVHVEYGMDGVGEEGAVLVQP---DADGR--GRLVTA  406

Query  1354  ILPEHLLGKLKNEISKEL  1407
             +LP+  +  L+  I   L
Sbjct  407   VLPKDEIESLRAAIGSAL  424



>dbj|BAJ92272.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 171/434 (39%), Positives = 250/434 (58%), Gaps = 44/434 (10%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS-EAVDGLNTGDLKSPMF  300
             V+ HRLS+VVP+++T E     L +ADLA +LHYLRGVY + + E V G+ T  LK PMF
Sbjct  11    VHGHRLSTVVPSSVT-EVEGYELGDADLAFRLHYLRGVYYYAAGEVVRGVTTKVLKDPMF  69

Query  301   RMLEDFYPAAGRI----------------RTSPEDGRPFVKCNDSGVRIVEAKCSKTIDE  432
               L+ +YP AGR+                +      RP+VKCND GVRIVEA+C + +D+
Sbjct  70    PWLDAYYPVAGRVRRPADDAAPAAAEQQQQRGEASRRPYVKCNDCGVRIVEARCERALDD  129

Query  433   WLDMSDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSD  612
             WL      +   LL +D+VLGP+L FSPL+++Q+T FKCG +++G SWAH++GD  + + 
Sbjct  130   WL-RDGAVDRVRLLCYDKVLGPELFFSPLLYVQVTNFKCGAMALGFSWAHLIGDVATATT  188

Query  613   FLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKPR--TQKLFPFSLGSVGPVGDHWKLTNT  786
               N +   + G      K P   T +  N P+ R       P S+  VGP+ D+W +   
Sbjct  189   CFNHWAKILGG------KTPDAVTVNPRNEPQDRAPADAAVPRSVKPVGPIEDYWFVPAG  242

Query  787   CKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIV  966
               MA  S+HIT+  L  L  +    + +A    FE ISAL W+++AK++ G  ++TVT+V
Sbjct  243   VDMAGYSFHITEPMLTRLQQQQQ-QEPAAAGGAFELISALLWQTVAKIRAGKEVKTVTVV  301

Query  967   KNGFHSR-GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEE  1143
             +N   +R GN L    N Q +  V+A    ++ DV ELA L+ +  VDET  +       
Sbjct  302   RNDMSARSGNSLA---NEQRVGYVEAGSPPAKTDVPELAALLAKDVVDETAAV-------  351

Query  1144  NGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLK  1323
                  D  +YGANLTFV++E+V +YG ++KGQ+P    Y + GVG+EGAV V P   +  
Sbjct  352   VAFPGDVVIYGANLTFVDMEQVDLYGLEIKGQRPAHVEYGLDGVGEEGAVPVQP---DAD  408

Query  1324  GKEGGRIVNVILPE  1365
             G+  GR+V  +LP+
Sbjct  409   GR--GRVVTAVLPK  420



>gb|KFK39682.1| hypothetical protein AALP_AA3G275600 [Arabis alpina]
Length=422

 Score =   292 bits (748),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/429 (40%), Positives = 250/429 (58%), Gaps = 32/429 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+   LS+V  +  T        T  DLAMKLHYL+ VY++ +E    L    +K P+F 
Sbjct  12    VHGFELSTVTASRPTETSTTHEPTGLDLAMKLHYLKAVYIYSAETARDLTVMHVKGPLFA  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + E  +   GR R   + GRP++KCND G+R VE++C  T++EWL + D+S  + L++H 
Sbjct  72    VFEQIHWIIGRFRRH-DSGRPYIKCNDCGMRFVESQCDLTVEEWLRVPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP L FSPL++IQ+T  KCGGL++G+SWAHV+GD FSLS F N +  A +G +   P
Sbjct  130   QPVGPVLAFSPLIYIQMTRLKCGGLALGLSWAHVMGDPFSLSHFFNLWTRAFSGEKIYCP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             K     T++   +P    ++  P S+  V PVGDHW + +  KM T S++IT  ++ +  
Sbjct  190   K-----TSNGFQNPNSTGKE--PDSIKRVDPVGDHWVVPSNNKMETYSFNITVHEVRSH-  241

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVK---NGFHSRGNGLLPCRN  1014
             F V+G         FE +SA+ WK +AKV+  S  + VTI++   NG  SR        N
Sbjct  242   FPVNG-------DEFEILSAIIWKCIAKVRGESESQPVTIIRSDPNGLKSRS-----VSN  289

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFV  1194
              QVIS+V  +  V++AD+ E+   IGE A DE   IDE +E ++G S DF VYGA LTFV
Sbjct  290   SQVISSVHVDFSVADADLKEIVKWIGE-ATDENFGIDEIVESDDGVS-DFIVYGAKLTFV  347

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLL  1374
             ++ EV  Y   +  + P      + G+GDEG V+VLP       +E  R+V V LPE  +
Sbjct  348   DMSEVDFYEAKVNEKLPKSVYCNVQGIGDEGVVVVLP-----TAREEERVVTVTLPEEEM  402

Query  1375  GKLKNEISK  1401
              K+K E+ K
Sbjct  403   EKVKWELKK  411



>ref|XP_002298682.2| transferase family protein [Populus trichocarpa]
 gb|EEE83487.2| transferase family protein [Populus trichocarpa]
Length=392

 Score =   284 bits (727),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 217/340 (64%), Gaps = 8/340 (2%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             +N+VYD +LSS  P  ITG   +      DLAMKL YL+GVY F S+A  GL    +K  
Sbjct  8     QNLVYDIKLSSAGPGRITGSDVIHEPNGMDLAMKLPYLKGVYFFNSQACQGLTIMQIKGS  67

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             MF  L D+Y   GR + + E GRP++KCND GVRIVEA+CSKT+DEWL+  D S  D+LL
Sbjct  68    MFYWLNDYYTVCGRFQRT-EAGRPYMKCNDCGVRIVEARCSKTVDEWLETRDCS-LDNLL  125

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
              +   +GP+L FSP +++Q+T FKCGG+S+GISWAH++GD +S S+ LN +G  +AG + 
Sbjct  126   IYHSPIGPELFFSPSLYMQVTKFKCGGMSLGISWAHIIGDVYSASECLNSWGQFLAGLKS  185

Query  655   LPP-KHPHMPTA-DNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
               P K    PT  ++  SP   TQ+  P SL  V PVGD W   N CKM T S+H++  Q
Sbjct  186   YGPLKLTKSPTGLEDSKSPSVGTQE--PVSLKQVDPVGDLWVTANNCKMETFSFHLSASQ  243

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC  1008
             ++ L  ++ G    AK+  FE++ A+ W+ +AK K+G   + VT+ K   ++  +G+L  
Sbjct  244   VSQLHSRIWGPSGIAKIPFFESLCAIMWQCIAKAKDGLEPKVVTLCKKDPNNPKDGIL--  301

Query  1009  RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDE  1128
              N Q+IS+VKA+  V +AD+ ELA L+ ++A +E   I+E
Sbjct  302   SNSQIISSVKADSSVVDADLQELATLLVDQATEENSQIEE  341



>ref|XP_009102573.1| PREDICTED: protein ECERIFERUM 26-like [Brassica rapa]
Length=426

 Score =   283 bits (725),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 170/430 (40%), Positives = 244/430 (57%), Gaps = 31/430 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+   +S+V  A  T  G V   T  DLAMKLHY++ VY++ +E    L    +K   F 
Sbjct  12    VHGFWMSTVGSARPTETGTVHQPTGLDLAMKLHYIKAVYIYLAEMTRDLTVMHVKETFFT  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR+R   + GRPF+KCND G R+VE++C  T+DEWL + D+S  + L++H 
Sbjct  72    VFDQISWITGRLRRR-DSGRPFIKCNDCGTRVVESQCDLTVDEWLCVPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L +SPL++IQ+T +KCGGL++G+SWAH++GD FSLS   + +  A+AG     P
Sbjct  130   QPVGPELAYSPLIYIQMTRYKCGGLALGLSWAHIMGDPFSLSHIFSLWTRALAGEVIYCP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT--DKQLNA  837
             +     +      PKP +    P S+  V PVGD W   N  KMAT S+ +T  D + N 
Sbjct  190   QT----SGSRRGFPKPNSTGKEPNSIKQVDPVGDLWVAPNKTKMATYSFKVTVNDIKTN-  244

Query  838   LIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CR  1011
               F   G +       FE +S + WK +AK +  S   T+TIV+    S  N L P   R
Sbjct  245   --FPAKGFE-------FEILSGIVWKCIAKARGDSEPVTITIVR----SDPNELKPRAVR  291

Query  1012  NGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTF  1191
             N Q+IS+V  +  V+E ++ E+   IGE A DE   IDE  E ++G   D  VYGA LTF
Sbjct  292   NCQMISSVHVDFSVAEVNLEEIVKSIGE-ATDERFWIDEIGERDDG-VLDLVVYGAELTF  349

Query  1192  VNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHL  1371
             V+L +V  Y   ++   P+     + G+GDEGAV++LP       KEG R+V V LPE  
Sbjct  350   VDLTQVDFYEAKIRETSPVSVYCNVQGIGDEGAVVILPA-----AKEGERVVTVTLPEAE  404

Query  1372  LGKLKNEISK  1401
             + K+K E+ K
Sbjct  405   MDKVKCELKK  414



>emb|CDX77480.1| BnaA07g06180D [Brassica napus]
Length=426

 Score =   283 bits (725),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 169/430 (39%), Positives = 244/430 (57%), Gaps = 31/430 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+   +S+V  A  T  G V   T  DLAMKLHY++ VY++ +E    L    +K  +F 
Sbjct  12    VHGFWMSTVGSARPTETGTVHQPTGLDLAMKLHYIKAVYIYSAEMTRDLTVMHVKETLFT  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR+R   + GRPF+KCND G R+VE++C  T+DEWL + D+S  + L++H 
Sbjct  72    VFDQISWITGRLRRR-DSGRPFIKCNDCGTRVVESQCDLTVDEWLCVPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L +SPL++IQ+T +KCGGL++G+SWAH++GD FSLS   + +  A+AG     P
Sbjct  130   QPVGPELAYSPLIYIQMTRYKCGGLALGLSWAHIMGDPFSLSHIFSLWTRALAGEVIYCP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT--DKQLNA  837
             +     +      PKP +    P S+  V PVGD W   N  KM T S+ +T  D + N 
Sbjct  190   QT----SGSRRGFPKPNSTGKEPNSIKQVDPVGDLWVAPNKTKMTTYSFKVTVNDIKTN-  244

Query  838   LIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CR  1011
               F   G +       FE +S + WK +AK +  S   T+TIV+    S  N L P   R
Sbjct  245   --FPAKGFE-------FEILSGIVWKCIAKARGDSEPVTITIVR----SDPNELKPRAVR  291

Query  1012  NGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTF  1191
             N Q+IS+V  +  V+E ++ E+   IGE A DE   IDE  E ++G   D  VYGA LTF
Sbjct  292   NCQMISSVHVDFSVAEVNLEEIVKSIGE-ATDERFWIDEIGERDDG-VLDLVVYGAELTF  349

Query  1192  VNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHL  1371
             V+L +V  Y   ++   P+     + G+GDEGAV++LP       KEG R+V V LPE  
Sbjct  350   VDLTQVDFYEAKIRETSPVSVYCNVQGIGDEGAVVILPA-----AKEGERVVTVTLPEAE  404

Query  1372  LGKLKNEISK  1401
             + K+K E+ K
Sbjct  405   MDKVKCELKK  414



>ref|XP_010240397.1| PREDICTED: protein ECERIFERUM 26-like [Brachypodium distachyon]
Length=430

 Score =   283 bits (723),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 173/452 (38%), Positives = 261/452 (58%), Gaps = 44/452 (10%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             +E  + +  V+ HRLS+VVP+++T E     L +AD+A +LHYLRG Y +   AV G+ T
Sbjct  3     LEEAEEKKAVHGHRLSTVVPSSVT-EVENYALGDADMAFRLHYLRGAYYY--GAVRGVTT  59

Query  277   GDLKSPMFRMLEDFYPAAGRIR--------TSPEDGRPFVKCNDSGVRIVEAKCSKTIDE  432
               LK PMF  L+ +YP AGR+R         +    RP+VKCND GVRIVEA+C + +++
Sbjct  60    KVLKDPMFPWLDAYYPVAGRVRRPDADADAAAAAADRPYVKCNDCGVRIVEAQCDRALED  119

Query  433   WLDMSDQSEYDHL--LHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSL  606
             WL   D +  D +  + +D+VLGP+L FSPL++IQIT FKCGG+++G SWAH++GD  S 
Sbjct  120   WLRDDDDAAVDRVRQMCYDKVLGPELFFSPLLYIQITKFKCGGMALGFSWAHLIGDVASA  179

Query  607   SDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKPRTQ--KLFPFSLGSVGPVGDHWKLT  780
             +   N +   +AG      ++P     +  N P+ R       P S+  VGPV D+W + 
Sbjct  180   TTCFNHWAKILAG------ENPGDVVVNPKNEPQHRAPPGTPAPRSVKPVGPVEDYWLVP  233

Query  781   NTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVT  960
             +   MA  S+H+T+  L  L       ++    +PFE ISAL W+++AK++    ++TVT
Sbjct  234   SGADMACYSFHVTEAALEKL-----QQEEDPTGRPFELISALLWQTVAKIRVTKEVKTVT  288

Query  961   IVKNGFHSR-GNGLLPCRNGQVISAVKAE-MRVSEADVLELANLIGEKAVDETGIIDETM  1134
             +V+    +R GN L    N Q +  V A     ++AD+ +LA L+ +  VDET  +    
Sbjct  289   VVRTDVAARSGNSLA---NEQKVGYVDATGYSPAKADMSDLAALLADSVVDETAAV----  341

Query  1135  EEENGKSADFFVY-GANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGP  1311
                     D  VY GANLTFV++E+V +YG ++ G++P    Y + GVG+EGAVLV P  
Sbjct  342   ---AAFPGDVVVYGGANLTFVDMEQVDLYGLELNGRRPAHVEYGMDGVGEEGAVLVQP--  396

Query  1312  ENLKGKEGGRIVNVILPEHLLGKLKNEISKEL  1407
              +  G+  GR+V  +LP   +G L+  +   L
Sbjct  397   -DAGGQ--GRVVTAVLPRDEVGALRAALGASL  425



>ref|XP_006418831.1| hypothetical protein EUTSA_v10002536mg [Eutrema salsugineum]
 gb|ESQ37267.1| hypothetical protein EUTSA_v10002536mg [Eutrema salsugineum]
Length=429

 Score =   281 bits (720),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 170/427 (40%), Positives = 244/427 (57%), Gaps = 25/427 (6%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  T       LT  DLA+KLHYL+ VY++ +E    L    +K P+F 
Sbjct  12    VHGFRLSTVSASRPTETDTTQELTGLDLALKLHYLKAVYIYSAETARDLTVTHVKGPLFT  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR R   + GRPF+KCND G R VE+ C  T++EWL + ++S  + L++H 
Sbjct  72    VFDQIPWITGRFRRH-DSGRPFIKCNDCGTRFVESHCDLTVEEWLRVPNRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L +SPLV+IQ+T FKCGGL+ G+SWAH++GD FSLS F N +  A+AG     P
Sbjct  130   QPVGPELAYSPLVYIQMTRFKCGGLAFGLSWAHIMGDPFSLSHFFNLWTRALAGEEIYSP  189

Query  664   KHPHMPTAD-NHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
             K     T+D       P +    P S+  V PVGD W   +  KM T S+++T  ++   
Sbjct  190   K-----TSDLERGFLNPNSTGKEPDSIKRVDPVGDLWVAPSNNKMTTYSFNVTVHEIQPH  244

Query  841   IFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRN  1014
              F  +G KQ   + PFE +S + WK +AK +  S   T+TI++    S  NGL P   RN
Sbjct  245   -FPANGDKQ---IPPFEILSGIIWKCIAKARRESEPVTITIIR----SDPNGLKPRAVRN  296

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFV  1194
              Q+IS+V+    V++A++ E+   IGE A DE   ID   E ++G S D  VYGA LTFV
Sbjct  297   SQMISSVRVGFSVADANLEEIVKSIGE-ATDERSEIDAIGESDDGVS-DLIVYGAKLTFV  354

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLL  1374
             +L EV  Y   ++   P      + G+GD GAV+VLP  E  +     R+V V LP+  +
Sbjct  355   DLSEVDFYEAKVREASPESVYCNVQGIGDGGAVVVLPAAEVEE-----RVVTVTLPDEEM  409

Query  1375  GKLKNEI  1395
              K+K E+
Sbjct  410   EKVKWEL  416



>ref|XP_006413420.1| hypothetical protein EUTSA_v10025274mg [Eutrema salsugineum]
 gb|ESQ54873.1| hypothetical protein EUTSA_v10025274mg [Eutrema salsugineum]
Length=427

 Score =   280 bits (717),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 247/441 (56%), Gaps = 39/441 (9%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V D ++SSVVPA++TGE +  +LT  DLAMKLHY+R VY F+          DLK  MF 
Sbjct  6     VTDVKVSSVVPASVTGENKPRHLTAMDLAMKLHYVRAVYFFK--GTRDFTLTDLKDNMFP  63

Query  304   MLE--DFYPAAGRIRTSPEDGR----PFVKCNDSGVRIVEAKCSK-TIDEWLDMSDQSEY  462
             +L+   +   AGRIR    D      PF++CNDSG R+VEAK    T++EWLD+ D+S  
Sbjct  64    LLQLQCYGHVAGRIRMPDNDSSAPALPFIRCNDSGTRVVEAKVDGFTVEEWLDLEDRSID  123

Query  463   DHLLHHDQVLG-PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAM  639
                L +D VLG PDL FSPLVF+QIT FKCGG SIG+SWAHVLGD  S S F+   G  +
Sbjct  124   HQYLVYDHVLGDPDLIFSPLVFLQITQFKCGGFSIGLSWAHVLGDVLSASTFMKTMGQLL  183

Query  640   AGRRDLPPK--HPHMPTADNH--NSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS  807
             +     PPK  +P      +H               S+  +  VG++W  TN   M    
Sbjct  184   SSYG--PPKLVYPTKSVLTSHAIGQGHDDNDDDEAISIKKIESVGEYWLPTNKWNMRRFV  241

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPF---EAISALFWKSLAKVKEGSGLETVTIVKNGF  978
             ++ +  Q + L+ K +G  Q     PF   + + AL WKSL  ++       +TI     
Sbjct  242   FNFSHDQTDRLMAKYAGPNQ-----PFSEVDVLYALMWKSLLNIRGDKETNVITICDRKM  296

Query  979   HSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSA  1158
              S       C N  ++ +V  E +    ++ ELA LI  K ++E G+I   +E++ G S+
Sbjct  297   SS------TCWNDDLVISV-VERKDEAVEISELAALIAGKKIEENGVIKRMIEQDKG-SS  348

Query  1159  DFFVYGANLTFVNLEEVKI-YGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG  1335
             DF  YGANLTFVNL+ V + + F++KG KP F NYTI GVGD+G VLV P     KGK  
Sbjct  349   DFITYGANLTFVNLDMVDMCHDFEIKGAKPDFVNYTIHGVGDKGVVLVFP-----KGKL-  402

Query  1336  GRIVNVILPEHLLGKLKNEIS  1398
              RIV+V++ E  L KLK E++
Sbjct  403   ARIVSVVMLEEDLAKLKVEVN  423



>emb|CAA61258.1| orf [Zea mays]
Length=426

 Score =   280 bits (716),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 175/436 (40%), Positives = 251/436 (58%), Gaps = 36/436 (8%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+ HRLS+VVP+++TGE     L +ADLA KLHYLRGVY +RS   DGL T  LK PM  
Sbjct  16    VHGHRLSTVVPSSVTGEVD-YALADADLAFKLHYLRGVYYYRSG--DGLATKVLKDPMLP  72

Query  304   MLEDFYPAAGRIRTSPEDG-----RPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDH  468
              L+D +P AGR+R +  +G     RP++KCND GVRIVEA+C + + EW+  +       
Sbjct  73    WLDDHFPVAGRVRRAETEGDGAPRRPYIKCNDCGVRIVEARCDRDMAEWIRDAAPGRIRQ  132

Query  469   LLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGR  648
             L + D+VLGP+L FSPL+++QIT FKCGGL++G SWAH++GD  S +   NK+   ++G 
Sbjct  133   LCY-DKVLGPELFFSPLLYVQITNFKCGGLALGFSWAHLIGDIPSAATCFNKWAQILSG-  190

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
                  K P        N P        P S+  VGP+ D W +     MA  S+H++D  
Sbjct  191   -----KKPEATVLTPPNQPLQGQSPAAPRSVKQVGPIEDLWLVPAGRDMACYSFHVSDAV  245

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP-  1005
             L  L  + +G +Q A    FE +SAL W+++AK++    ++TVT+V+     R    L  
Sbjct  246   LKKLHQQQNG-RQDAAAGTFELVSALVWQAVAKIR--GDVDTVTVVRADAAGRSGKSLAN  302

Query  1006  -CRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVY-GA  1179
               + G V SA  +    ++ D+ ELA L+ +  VDET  +            D  VY GA
Sbjct  303   EMKVGYVESAGSSP---AKTDLAELAALLAKNLVDETAAV-------AAFQGDVLVYGGA  352

Query  1180  NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVIL  1359
             NLT V++E+V +YG ++KGQ+P+   Y + GVGDEGAVLV P   +  G+  GR+V  +L
Sbjct  353   NLTLVDMEQVDLYGLEIKGQRPVHVEYGMDGVGDEGAVLVQP---DADGR--GRLVTAVL  407

Query  1360  PEHLLGKLKNEISKEL  1407
             P   +  L+  +   L
Sbjct  408   PGDEIDSLRAALGSAL  423



>gb|KFK39684.1| hypothetical protein AALP_AA3G275800 [Arabis alpina]
Length=412

 Score =   278 bits (710),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 164/429 (38%), Positives = 244/429 (57%), Gaps = 39/429 (9%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  T  G     T  DLAMKLHYL+ VY++ +E    L    +K+P F 
Sbjct  12    VHGFRLSTVSSSWPTETGTTHEPTGLDLAMKLHYLKAVYIYSAETARDLTVTHVKNPFFP  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + + +    GR     +  RP++KCND G R VE+ C+ T+DEWL + D+S  + L++H 
Sbjct  72    VFDQYPWTTGRFARH-DSRRPYIKCNDCGTRFVESHCNLTVDEWLLLPDRSIDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             + +GP+L FSPL++IQ+T FKCGGL++G+SWAHV+GD FSLS F N +  A+AG +   P
Sbjct  130   KPIGPELIFSPLIYIQMTRFKCGGLALGLSWAHVMGDPFSLSHFFNLWARALAGEKIYCP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             K     T++   +P        P S+  V PVGDHW + +  KM T S+H+T  ++ +  
Sbjct  190   K-----TSNGFQNPGKE-----PDSIKRVDPVGDHWVVPSNKKMETYSFHVTIHEIRSHF  239

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVK---NGFHSRGNGLLPCRN  1014
                      AK   FE +  + WK +AKV+  S  + VTI++   NG  SR        N
Sbjct  240   --------PAKGDEFEILCGVIWKCIAKVRGESESQPVTIIRSDPNGLKSRS-----VSN  286

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFV  1194
              QVIS+V  +  V++A++ E+   I E A D+   IDE      G++ DF VYGA LTFV
Sbjct  287   SQVISSVHVDFSVADAELEEIVKSIVE-ATDQRFCIDEI-----GETDDFIVYGAKLTFV  340

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLL  1374
             ++ +V  Y   +  + P      + G+GD+GAV+VLP       K+  R+V V LPE  +
Sbjct  341   DMSQVDFYEAKVNEKSPKSVYCNVHGIGDDGAVVVLPA-----AKKEERVVTVTLPEDEM  395

Query  1375  GKLKNEISK  1401
              ++K E++K
Sbjct  396   ERVKWELNK  404



>ref|NP_001053836.1| Os04g0611200 [Oryza sativa Japonica Group]
 emb|CAE03571.2| OSJNBa0085I10.16 [Oryza sativa Japonica Group]
 dbj|BAF15750.1| Os04g0611200 [Oryza sativa Japonica Group]
 emb|CAH67002.1| OSIGBa0152L12.11 [Oryza sativa Indica Group]
 gb|EEC77977.1| hypothetical protein OsI_17350 [Oryza sativa Indica Group]
 gb|EEE61662.1| hypothetical protein OsJ_16121 [Oryza sativa Japonica Group]
Length=437

 Score =   278 bits (711),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 167/442 (38%), Positives = 247/442 (56%), Gaps = 38/442 (9%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS-EAVDGLNTGDLKSPMF  300
             V+ HRLS+VVP+++TGE    +L +ADLA KLHYLRG Y + + +AV G+    LK PMF
Sbjct  14    VHGHRLSTVVPSSVTGEAN-YDLADADLAYKLHYLRGAYYYPAGDAVRGITIKSLKDPMF  72

Query  301   RMLEDFYPAAGRIRTSP-------EDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSE  459
               L+ ++P AGRIR +           RP++KCND GVRIVEA+C + +D+WL       
Sbjct  73    PWLDAYFPVAGRIRRAEGDDADAAAARRPYIKCNDCGVRIVEARCDRALDDWLRDESPDR  132

Query  460   YDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAM  639
               HL + D+VLGP+L FSPL++IQ+T FKCGG+++G SWAH++GD  S +   N +   +
Sbjct  133   LRHLCY-DKVLGPELFFSPLLYIQVTSFKCGGMALGFSWAHLIGDVASATACFNTWAQIL  191

Query  640   AGRRDLPPKHPHMPTADNHNSPKPRTQKLFPF----SLGSVGPVGDHWKLTNTCKMATQS  807
             +G      K P     +  N P  R           S+  VGP+ DHW +     MA  S
Sbjct  192   SG------KKPAGTVLEPANKPLDRAPAAAAAAPPRSVKPVGPIEDHWLVPAGRAMAWYS  245

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
             + +T+  L  L  + +  + +A    FE +SAL W+++AK++  +  E  T+        
Sbjct  246   FRVTEPALKKL--QSAAGRHAAGT--FELVSALLWQAVAKIRAAASKEVTTVTVVRTDMA  301

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLI-GEKAVDETGIIDETMEEENGKSADF  1164
                     N Q +  V+A    ++ DV ELA ++ G+K VDETG +            D 
Sbjct  302   ARSGKSLANEQRVGYVEAASSPAKTDVAELAAMLAGDKVVDETGAV-------AAFPGDV  354

Query  1165  FVY-GANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGR  1341
              VY GANLTFV++E+V  Y  ++KGQ+P+   Y + GVG+EGAVLV P   +  G+  GR
Sbjct  355   VVYGGANLTFVDMEQVAPYELELKGQRPVHVEYGLDGVGEEGAVLVQP---DAGGR--GR  409

Query  1342  IVNVILPEHLLGKLKNEISKEL  1407
             +V V++P   +  L+  +   L
Sbjct  410   VVTVVIPRDEVDSLRAALGSTL  431



>ref|XP_002447077.1| hypothetical protein SORBIDRAFT_06g028160 [Sorghum bicolor]
 gb|EES11405.1| hypothetical protein SORBIDRAFT_06g028160 [Sorghum bicolor]
Length=438

 Score =   276 bits (705),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 173/447 (39%), Positives = 253/447 (57%), Gaps = 45/447 (10%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMF  300
             V+ HRLS+VVP+++TGE     L +ADLA KLHYLRGVY +   +   GL T  LK PMF
Sbjct  15    VHGHRLSTVVPSSVTGEVD-YALADADLAFKLHYLRGVYYYPPGDVARGLATKVLKDPMF  73

Query  301   RMLEDFYPAAGRIRTSPEDGRP----------FVKCNDSGVRIVEAKCSKTIDEWLDMSD  450
               L+D++P AGR+R + +              ++KCND GVRIVEAKC + +D+WL   D
Sbjct  74    PWLDDYFPVAGRVRRAEQQEPEAAAAGAPRRPYIKCNDCGVRIVEAKCDRDMDDWL-RDD  132

Query  451   QSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG  630
               +    L +D+VLGP+L FSPL+++QIT FKCGGL++G SWAH++GD  S     NK+ 
Sbjct  133   APDRLRQLCYDKVLGPELFFSPLLYVQITNFKCGGLALGFSWAHLIGDVPSAVTCFNKWA  192

Query  631   PAMAGRRD-----LPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKM  795
               ++G++       PP  P +       +  PR+ K        VGP+ DHW +     M
Sbjct  193   QILSGKKPEATVLTPPNKP-LQAQSPAAAAAPRSVK-------QVGPIEDHWLVPAGRDM  244

Query  796   ATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNG  975
             A  S+H++D  L  L  + SG + +A    FE +SAL W+++AK++ G  ++TVT+V+  
Sbjct  245   ACYSFHVSDAVLKKLQ-QQSG-RHAAAAGTFELVSALVWQAVAKIR-GGDVDTVTVVRTD  301

Query  976   FHSRGNGLLP--CRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENG  1149
               +R    L      G V SA  +    ++ DV ELA L+ +  VDET  +         
Sbjct  302   AAARSGKSLANEMTVGYVASAGSSP---AKTDVAELAALLAKSVVDETAAV-----AAFA  353

Query  1150  KSADFFVY-GANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKG  1326
                D  VY GANLT V++E+V +Y  ++KG +P+   Y + GVG+EGAVLV P   +  G
Sbjct  354   FQGDVLVYGGANLTLVDMEQVDVYALEIKGLRPVHVEYGMDGVGEEGAVLVQP---DADG  410

Query  1327  KEGGRIVNVILPEHLLGKLKNEISKEL  1407
             +  GR+V  +LP   +  L+  +   L
Sbjct  411   R--GRLVTAVLPRDEIDSLRAALGSAL  435



>gb|AAM65391.1| fatty acid elongase-like protein (cer2-like) [Arabidopsis thaliana]
Length=420

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 159/397 (40%), Positives = 229/397 (58%), Gaps = 24/397 (6%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  +  G     T  DLAMKLHYL+ VY++ +E    L   D+K P+F 
Sbjct  12    VHGFRLSTVSASLPSETGTTHEPTGLDLAMKLHYLKTVYIYSAETARDLTVMDVKGPLFS  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR R   E GRP++KCND G R VE  C  T++EWL + D+S  + L++H 
Sbjct  72    VFDQNPCIIGRFRRH-ESGRPYLKCNDCGTRFVERHCDLTVEEWLRVPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GPDL FSPL++IQ+T F CGGL++G+SWAH++GD FSLS F N +  A AG     P
Sbjct  130   QPVGPDLAFSPLLYIQMTRFSCGGLALGLSWAHIMGDPFSLSHFFNLWAQAFAGENIYSP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             K   +     +    P +    P S+  V PVGD W   N  KM T S+++T   L +  
Sbjct  190   KTSDLQRVFQN----PTSTVKQPDSIKRVDPVGDLWVAPNNSKMTTFSFNLTVNDLKS-N  244

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRNG  1017
             F V+G  +      FE ++ + WK +A V+  S   T+T+++    S    L P   RNG
Sbjct  245   FPVNGDGE------FEILTGIIWKCVATVRGESAPVTITVIR----SDPKKLKPRAVRNG  294

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
             Q+IS++  +  V+EA + E+   IGE A DE  +IDE +++     +DF VYGANLTFV+
Sbjct  295   QMISSIHVDFSVAEASLEEIVKSIGE-AKDERVVIDEIVDD----VSDFIVYGANLTFVD  349

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPG  1308
             + EV  Y   + G+ P      + G+GD+GAV+VLPG
Sbjct  350   MSEVDFYEAKVMGKSPESVYCNVQGIGDDGAVVVLPG  386



>ref|XP_010527461.1| PREDICTED: protein ECERIFERUM 26-like [Tarenaya hassleriana]
Length=437

 Score =   272 bits (695),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 166/430 (39%), Positives = 239/430 (56%), Gaps = 19/430 (4%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  R S+V     T  G     T  DLAMKLHYL+  Y+F +E    ++   +K  MF 
Sbjct  12    VHGFRFSTVGSPRPTAPGTTHEPTGLDLAMKLHYLKVAYVFSAETASEIDVKKVKEGMFV  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + E      GR R     GRP++KCND G R VE  C  T++EWL   D+S+ + L++H 
Sbjct  72    LFEQISWTTGRFRRH-VSGRPYIKCNDCGTRFVEGNCDFTVEEWLRKPDRSDDELLVYHK  130

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
              V GP+L FSPL+++Q+T FKCGGLS+G+SWAH+LGD FSLS   N++  A+AG++   P
Sbjct  131   PV-GPELSFSPLIYVQMTRFKCGGLSLGLSWAHILGDPFSLSYSFNQWAHALAGKKVSIP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
              +   P +     PKP  +   P  +  V PVGD W   N  KMA+ ++ +T  Q++   
Sbjct  190   SNRLSPNSGPGPDPKPVRKD--PVFIKRVDPVGDLWVTPNNKKMASFTFILTVSQISTFF  247

Query  844   -FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGS-GLETVTIVKNGFHSRGNGLLP--CR  1011
               K+S      ++  FE +  +  K +AKV+E S  + T+T+V+        GL P    
Sbjct  248   PEKISIANDGDQIPVFETLCGIVLKCVAKVREESEPVTTITVVRKD----AKGLKPRSVS  303

Query  1012  NGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTF  1191
             N Q+I +V+ +  V++A + EL   I E   D    IDE +E ++G   DF VYGA LTF
Sbjct  304   NDQMICSVQVDFPVADAALQELVRRIVE-GTDVRSEIDEIVESDDG-VLDFVVYGARLTF  361

Query  1192  VNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHL  1371
             V+L EV  +G  + G  P      I GVGD GAV+VLP          GR+V V LPE  
Sbjct  362   VDLSEVDFHGVRLMGNPPKSVYCGIQGVGDAGAVVVLPA-----ATAEGRVVTVTLPEEE  416

Query  1372  LGKLKNEISK  1401
             + ++K+E++K
Sbjct  417   VERVKSELNK  426



>ref|XP_009139584.1| PREDICTED: protein ECERIFERUM 26 [Brassica rapa]
Length=426

 Score =   271 bits (694),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 161/429 (38%), Positives = 243/429 (57%), Gaps = 23/429 (5%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             +Y+ RLS+V     T  G +   T  DLAMKLHYL+  Y++  E    L+   +K  MF+
Sbjct  12    IYNMRLSTVGATRATETGAIHEPTGLDLAMKLHYLKAAYIYSPELASDLSVTHVKEAMFK  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR+    + GRP++KCND G R VE +C+ T++EWL   D+S  + L++H 
Sbjct  72    LFDQIAWTTGRLWRR-DSGRPYIKCNDCGARFVEGECNFTVEEWLSKPDRSVDEFLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L FSPL+++Q+T FKC GL++G+SWA+++GD+FSL    N +   ++G +   P
Sbjct  130   QPVGPELPFSPLIYVQMTRFKCRGLALGMSWANIMGDSFSLFYAFNLWVKVLSGEKIYAP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             +   +       +P P  +   P S+  V PVGD W   N  KMA+  +++T     +  
Sbjct  190   ETSIIDR--RFQNPNPTVKD--PESIKQVDPVGDLWITPNNKKMASCCFNLTAADQMSPH  245

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP---CRN  1014
             F  +G  Q   +  FEA++A+ WKS+AKV+E     TVTI++       N L P    RN
Sbjct  246   FPANGDDQ---IPVFEALAAIIWKSIAKVREDPEPLTVTIIRKD----PNDLKPIRSIRN  298

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFV  1194
              Q+IS+V  +  V+EA V EL   + E+A DE   IDE  E  +G S DF VYGA LTF+
Sbjct  299   SQMISSVHVDFPVAEATVEELVRCM-ERATDERCGIDEIGESCDG-SLDFIVYGAKLTFM  356

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLL  1374
             +L EV +Y   + G+ P    Y + G+G+EG V+V         K   R+V + LPE  +
Sbjct  357   DLSEVDLYEAKVMGKSPESVYYNVEGIGEEGLVVVYAA-----AKSEERVVTMTLPEEEM  411

Query  1375  GKLKNEISK  1401
              ++K+E  K
Sbjct  412   ERVKSEFKK  420



>ref|XP_009138132.1| PREDICTED: protein ECERIFERUM 1 [Brassica rapa]
Length=417

 Score =   271 bits (692),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 170/433 (39%), Positives = 244/433 (56%), Gaps = 33/433 (8%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V D ++SSVVPA++TGE +  +LT  DLA+KLHY+R VY F+          +LK+  F 
Sbjct  6     VTDVKISSVVPASMTGENKPRHLTAMDLAVKLHYVRAVYFFK--GTRDFTIVELKNITFP  63

Query  304   ML--EDFYPAAGRIRT-----SPEDGRPFVKCNDSGVRIVEAKCSK-TIDEWLDMSDQSE  459
             +L  + +    GRIR            P+++CNDSG+RIVEAK    T+ EWLD+ D+S 
Sbjct  64    LLDLQCYDHVTGRIRILNNNDPSAQAIPYIRCNDSGMRIVEAKVEGFTVQEWLDLDDRSI  123

Query  460   YDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAM  639
                 L +D VLGPDL +SPLV++QIT FKCGGLS+G+SWAHVLGD  S S F+   G  M
Sbjct  124   DHRFLVYDHVLGPDLFYSPLVYLQITQFKCGGLSLGLSWAHVLGDVVSASTFMKTMGQLM  183

Query  640   AGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT  819
             + R    P +P  P  + H +           S+  V  VG +W L+N CKM   ++  +
Sbjct  184   STRGPSKPVYPKKPELNPHANGHVDDDGE-AISIKKVESVGKYWLLSNKCKMGRFNFKFS  242

Query  820   DKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGL  999
              +Q++ L+ K     QSA     + + AL W S+  ++       +TI      S     
Sbjct  243   LEQIDRLMAKY----QSA--SEVDILYALIWSSILNIRGEKDTNVITICDRKTSS-----  291

Query  1000  LPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGA  1179
               C N  ++ +V  E +    +V ELA +I  +  +E G+I   ++++ G S+DF  YGA
Sbjct  292   -TCWNDDLVISV-VERKDEMTEVSELAAIIANERREENGVIKGMIDKDRG-SSDFITYGA  348

Query  1180  NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVIL  1359
             NLTFVNL+       ++KG+KP F N+TI GVGD+G VL  P     KGK   R+V+V++
Sbjct  349   NLTFVNLDMCD--ELEIKGEKPDFVNFTIHGVGDKGVVLAFP-----KGK-FVRVVSVVM  400

Query  1360  PEHLLGKLKNEIS  1398
             PE  L KLK E++
Sbjct  401   PEEELAKLKIEVN  413



>ref|XP_010421841.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=428

 Score =   270 bits (689),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 166/428 (39%), Positives = 246/428 (57%), Gaps = 26/428 (6%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  T  G    LT  DLAMKLHYL+ VY++ +EA   L   ++K+P+F 
Sbjct  12    VHGFRLSTVSSSRPTETGTTHELTGLDLAMKLHYLKVVYIYSAEAASDLTVMNVKAPLFP  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR+R   E  RP++KCND G R VE+ C  T+DEWL + D+S  + L++H 
Sbjct  72    VFDQISWITGRLRRH-ESRRPYIKCNDCGTRFVESHCDLTVDEWLRIPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP++ FSPL++IQ+T F CGGL++G+SWAH++GD  SLS F N +  A  G +   P
Sbjct  130   QPVGPEMAFSPLIYIQMTRFSCGGLALGLSWAHIMGDPLSLSHFFNLWARAYVGEKIHSP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             K   +     +    P +    P S+  V PVGD W   +  KM T S+++T  ++ +  
Sbjct  190   KTSELERVFQN----PNSTGKEPESIKRVDPVGDLWVAPSNRKMTTFSFNLTVSEIKSH-  244

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRNG  1017
             F  +G  +      FE +S + WK +AK +  S   T+T++K    S  NGL P   RN 
Sbjct  245   FPATGDDE------FEILSGIIWKCIAKARGESAPVTITVIK----SDPNGLKPRAVRNS  294

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
             Q+IS+V  +  V+EA + E+   IGE   DE   IDET+++      DF VYGANLTFV+
Sbjct  295   QMISSVHVDFSVAEASLEEIVKSIGETN-DERFGIDETVDD----VTDFIVYGANLTFVD  349

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLG  1377
             L  V  Y   + G+ P      + G+GD GAV+V+PG   ++ +E    V V LP+  + 
Sbjct  350   LSGVDFYEAKVMGKSPESVYCNVQGIGDGGAVVVMPG--GVEEEERVVTVTVTLPDDEIE  407

Query  1378  KLKNEISK  1401
             K+K E++K
Sbjct  408   KVKCEMNK  415



>emb|CDY01163.1| BnaA04g06560D [Brassica napus]
Length=430

 Score =   268 bits (686),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 161/431 (37%), Positives = 241/431 (56%), Gaps = 25/431 (6%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             +Y+ RLS+V     T  G     T  DLAMKLHYL+  Y++  E    L+   +K  MF+
Sbjct  14    IYNMRLSTVGATRATETGATHEPTGLDLAMKLHYLKAAYIYSPELASDLSVTHVKEAMFK  73

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR+    + GRP++KCND G R VE +C+ T++EWL   D+S +D  L + 
Sbjct  74    LFDQIAWTTGRLWRR-DSGRPYIKCNDCGARFVEGECNFTVEEWLSKPDRSVHDEFLVYH  132

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L FSPL+++Q+T FKC GL++G+SWA+++GD+FSL    N +   ++G +   P
Sbjct  133   QPVGPELPFSPLIYVQMTRFKCRGLALGMSWANIMGDSFSLFYAFNLWVKVLSGEKIYAP  192

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT--DKQLNA  837
             +   +       +P P  +   P S+  V PVGD W   N  KMA+  +++T    Q++ 
Sbjct  193   ETSIIDR--RFQNPNPTVKD--PESIKQVDPVGDLWITPNNKKMASYCFNLTVAADQMSP  248

Query  838   LIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP---C  1008
               F  SG  Q   +  FE ++A+ WKS+AKV+E     TVTI++       N L P    
Sbjct  249   H-FPASGNYQ---IPVFEVLAAIIWKSIAKVREDPEPLTVTIIRKD----TNDLKPIRSI  300

Query  1009  RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLT  1188
             RN Q+IS+V  +  V+EA V EL   + E A DE   +DE  E  +G S DF VYGA LT
Sbjct  301   RNSQMISSVHVDFPVAEATVEELVRCM-ESATDERCGVDEIGESCDG-SLDFIVYGAKLT  358

Query  1189  FVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEH  1368
             F++L EV +Y   + G+ P    Y + G+G+EG V+V         K   R+V + LPE 
Sbjct  359   FMDLSEVDLYEAKVMGKSPESVYYNVEGIGEEGLVVVYAA-----AKSEERVVTMTLPEE  413

Query  1369  LLGKLKNEISK  1401
              + ++K+E  K
Sbjct  414   EMERVKSEFKK  424



>ref|NP_566741.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 sp|Q9LIS1.1|CR26L_ARATH RecName: Full=Protein ECERIFERUM 26-like; Short=CER26-like; AltName: 
Full=CER2-like protein 2; Short=CER2-like2 [Arabidopsis 
thaliana]
 dbj|BAB03002.1| fatty acid elongase-like protein [Arabidopsis thaliana]
 gb|ABH04587.1| At3g23840 [Arabidopsis thaliana]
 gb|AEE76821.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=420

 Score =   267 bits (683),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 159/397 (40%), Positives = 230/397 (58%), Gaps = 24/397 (6%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  +  G     T  DLAMKLHYL+ VY++ +     L   D+K+P+F 
Sbjct  12    VHGFRLSTVSASLPSETGTTHEPTGLDLAMKLHYLKAVYIYSAGTARDLTVMDVKAPLFS  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             +        GR R   E GRP++KCND G R VE+ C  T++EWL + D+S  + L++H 
Sbjct  72    VFYQIPCIIGRFRRH-ESGRPYLKCNDCGTRFVESHCDLTVEEWLRVPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GPDL FSPL++IQ+T F CGGL++G+SWAH++GD FSLS F N +  A AG +   P
Sbjct  130   QPVGPDLAFSPLLYIQMTRFSCGGLALGLSWAHIMGDPFSLSHFFNLWAQAFAGGKIYCP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             K     T  +  +P    +K  P S+  V  VGD W   N  KM T S+++T   L    
Sbjct  190   KTS--VTERDFQNPTSTFKK--PDSVKQVDLVGDLWVAPNNSKMTTFSFNLTVNDLKTH-  244

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRNG  1017
             F V+G  +      FE ++ + WK +A V+  S   T+T+++    S    L P   RNG
Sbjct  245   FPVNGDGE------FEILTGIIWKCVATVRGESAPVTITVIR----SDPKKLKPRAVRNG  294

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
             Q+IS++  +  V+EA + E+   IGE A DE  +IDE +++     +DF VYGANLTFV+
Sbjct  295   QMISSIHVDFSVAEASLEEIVKSIGE-AKDERVVIDEIVDD----VSDFIVYGANLTFVD  349

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPG  1308
             + EV  Y   + G+ P      + G+GD+GAV+VLPG
Sbjct  350   MSEVDFYEAKVMGKSPESVYCNVQGIGDDGAVVVLPG  386



>ref|XP_008457218.1| PREDICTED: protein ECERIFERUM 26-like [Cucumis melo]
Length=450

 Score =   268 bits (684),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 179/447 (40%), Positives = 253/447 (57%), Gaps = 36/447 (8%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             +++V+  R+SSV P    G     +LT  DLAMKLHY+ G+Y F SEA   +    +K+ 
Sbjct  8     QSLVHSFRISSVGPGQTLGCDSSYHLTGLDLAMKLHYINGIYFFDSEASQRVTLPQIKAA  67

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDM-SDQSEYDHL  471
              F +  D+    GR+R   + GRPF+KCND G R VEA+C  T+ EWL+M  D      L
Sbjct  68    TFVIFNDYNFTCGRLRRE-DSGRPFIKCNDCGARFVEAECDSTVSEWLEMIGDDWSSMKL  126

Query  472   LHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRR  651
             L   +V+GP+L FSP +++Q+T FKC G+SIG++WAHVL DAFS + F+N     + G  
Sbjct  127   LVSQKVIGPELHFSPPIYMQVTRFKCKGMSIGLTWAHVLSDAFSPAAFMNSLTNMLFGAP  186

Query  652   D--LPPKHPHMPTADNHN--------SPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMAT  801
                  P  P + T             S KP      P SL  V PVGDHW  TN  KM +
Sbjct  187   TALTSPPLPSLATITTTPPPKPPVSASAKP------PLSLRRVDPVGDHWIPTNKYKMES  240

Query  802   QSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVK-NGF  978
              S+ +   QL  L       +   +  PFE+ISA  W S+AK++ GS   TVT+ K +  
Sbjct  241   FSFKLNPTQLANL-----QTQMPHQTPPFESISAALWHSIAKLRRGSEPTTVTLCKLDSV  295

Query  979   HSRGNGLLPCRNGQVISAVKAE-MRVSEADVLELANLIGEKAV-DETGIIDETMEEENGK  1152
               +G  +    N Q +S V++    VS+ D  +LA L+ + A  DE  +I+E ++ ++G 
Sbjct  296   KQQGKVI---GNTQKVSTVRSSAAAVSDVDQRDLAALLVDSAAKDEGELIEEAVDRDDGV  352

Query  1153  SADFFVYGANLTFVNLEEVKIYG---FDMKGQKPIFANYTIGGVGDEGAVLVLPGP--EN  1317
             S DF VYGANLTFV  +E  +YG    ++  +KP F  YT+ GVGD GAV+V+PGP  + 
Sbjct  353   S-DFIVYGANLTFVKWDEANLYGDGIMELDHEKPKFVYYTLHGVGDGGAVVVIPGPVDDG  411

Query  1318  LKGKEG-GRIVNVILPEHLLGKLKNEI  1395
             + G++  GR V VILPE+ +  LK E+
Sbjct  412   ISGRDDRGRFVTVILPENEVVGLKAEL  438



>ref|XP_010466747.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=425

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 157/398 (39%), Positives = 231/398 (58%), Gaps = 26/398 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  T  G    LT  DLAMKLHYL+ VY++ +E    L   ++K+P+F 
Sbjct  12    VHGFRLSTVSSSRPTETGTTHELTGLDLAMKLHYLKVVYIYSAETARDLTVMNVKAPLFP  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR+R   E GRP++KCND G R+VE+ C  T+DEWL + D+S  + L++H 
Sbjct  72    VFDQISWITGRLRRD-ESGRPYIKCNDCGTRLVESHCDLTVDEWLRVPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP++ FSPL++IQ+T F CGGL++G+SWAH++GD  SLS   N +  A  G +   P
Sbjct  130   QPVGPEMAFSPLIYIQMTRFSCGGLALGLSWAHIMGDPLSLSHVFNLWARASVGEKIHCP  189

Query  664   KHPHMPTA-DNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
             K   +     N NS   +     P S+  V PVGD W   +  KM T S+++T  ++ + 
Sbjct  190   KTSELERVFQNPNSTDKK-----PDSIKPVDPVGDLWVAPSNRKMTTFSFNLTVNEIKSH  244

Query  841   IFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRN  1014
              F  +G  +      F+ +S + WK +AK +  S   T+T++K    S  NGL P   RN
Sbjct  245   -FPATGENE------FDILSGIIWKCIAKARGESAPVTITVIK----SDPNGLKPRAVRN  293

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFV  1194
             GQ+IS+V  +  V+EA + E+   I E   DE   IDET+++     +DF VYGANLTFV
Sbjct  294   GQMISSVHVDFSVAEASLEEIVKSIRETN-DERFGIDETVDD----VSDFIVYGANLTFV  348

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPG  1308
             +L  V  Y   + G+ P      + G+GD GAV+V+PG
Sbjct  349   DLSGVDFYEAKVMGKSPESVYCNVQGIGDGGAVVVMPG  386



>ref|XP_010532758.1| PREDICTED: protein ECERIFERUM 26-like [Tarenaya hassleriana]
Length=440

 Score =   265 bits (678),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 163/412 (40%), Positives = 228/412 (55%), Gaps = 26/412 (6%)
 Frame = +1

Query  193   TNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFV  372
             T  DLAMKLHYL+  Y+F +E    ++   +K  MF + E      GR R     GRP++
Sbjct  35    TGLDLAMKLHYLKVAYIFSAETAGEIDVTSVKEGMFVLFEQISWTTGRFRRH-LSGRPYI  93

Query  373   KCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCG  552
             KCND G R VEA C  T++EWL   D+S+ + L+ H  V GP+L FSPL+++Q+T FKCG
Sbjct  94    KCNDCGARFVEAHCDFTVEEWLSEPDRSDDELLVFHKPV-GPELAFSPLIYVQMTRFKCG  152

Query  553   GLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFP  732
             GLS+G+SWAHVLGD FSLS  +N++     G +       H+P   N  +P      + P
Sbjct  153   GLSLGLSWAHVLGDPFSLSYTINQWAQTFVGDKI------HIPIPSNRLTPNAGPDPIKP  206

Query  733   ----FSLG---SVGPVGDHWKLTNTCKMATQSYHITDKQLNALIF-KVSGLKQSAKVKPF  888
                   LG    V PVGD W L N  KMAT S+ +T  Q++     K S   +  +V  F
Sbjct  207   GLDREELGFVKRVDPVGDLWVLPNNKKMATFSFKLTVAQISPFFLAKPSAENEGDRVPVF  266

Query  889   EAISALFWKSLAKVKEGSGL-ETVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEAD  1065
             EA+ A+ WK + KV+E S L  T+T+++   +  G       N Q IS+ +    V++AD
Sbjct  267   EALCAIIWKCVGKVRENSELVTTITVMRK--NPNGEKPRSVNNDQTISSAQVGYPVADAD  324

Query  1066  VLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKP  1245
             + EL   I E A D    I+E  E ++G   D  VYGA LTFV+L +   YG  +KG  P
Sbjct  325   LWELVRSIRE-ATDVRSEIEEIGESDDG-VLDLVVYGARLTFVDLSKAGFYGVKLKGNPP  382

Query  1246  IFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISK  1401
                 + I GVGD+GAV+VLP           R++ V LPE  + ++K+E+ K
Sbjct  383   ESVYFGIQGVGDDGAVVVLP-----TAVAEERVMTVTLPEEEVERVKSELKK  429



>ref|XP_006653755.1| PREDICTED: protein ECERIFERUM 26-like [Oryza brachyantha]
Length=409

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 164/432 (38%), Positives = 241/432 (56%), Gaps = 44/432 (10%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS-EAVDGLNTGDLKSPMF  300
             V+ HRLS+VVP+++TGE    +L +ADLA KLHYLRGVY + + +AV GL    LK PMF
Sbjct  14    VHGHRLSTVVPSSVTGETN-YDLADADLAFKLHYLRGVYYYPAGDAVRGLTIKALKDPMF  72

Query  301   RMLEDFYPAAGRIRTS-PEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
               L+ ++P AGRIR +  +D RP++KCND GVRIVE +C + +D+WL          L +
Sbjct  73    PWLDAYFPVAGRIRRADADDRRPYIKCNDCGVRIVEVRCDRDLDDWLRDDAPDRLRQLCY  132

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDL  657
              D+VLGP+L FSPL+++Q+T FKCGG+S+G SWAH++GD  S +   N +   ++G    
Sbjct  133   -DKVLGPELFFSPLLYVQVTSFKCGGMSLGFSWAHLIGDVASATSCFNAWAQILSG----  187

Query  658   PPKHPHMPTADNHNSPKPRTQ--KLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
               K P   T +  N P  R       P  +  VGP+ D+W +   C MA  S+H+ +  L
Sbjct  188   --KKPEGSTLEPANRPDERAPAGAAPPRCVKPVGPIEDNWLVPAGCAMACYSFHVAEPAL  245

Query  832   NALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCR  1011
               L  +  G         FE ISAL W++++K++    + TVT+V+    +R    L   
Sbjct  246   KRLQQQEEGRHAGT----FELISALLWQTVSKIRVSKEVTTVTVVRTDMSARSGKSL---  298

Query  1012  NGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTF  1191
                           +E  V  LA  + +  VDET  +            D  +YGANLTF
Sbjct  299   -------------ANEQRVAGLAARLAKSQVDETDAV-------AAFPGDVVIYGANLTF  338

Query  1192  VNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHL  1371
             V++E+V  Y  ++KGQ+P+   Y + GVG+EGAVLV P   +  G+  GR+V  +LP+  
Sbjct  339   VDMEQVAPYELELKGQRPVHVEYGMDGVGEEGAVLVQP---DAGGR--GRVVTAVLPKDE  393

Query  1372  LGKLKNEISKEL  1407
             +  L+  +   L
Sbjct  394   VESLRAVLGSTL  405



>emb|CDY65534.1| BnaC01g41490D [Brassica napus]
Length=762

 Score =   271 bits (694),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 176/434 (41%), Positives = 246/434 (57%), Gaps = 35/434 (8%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V D ++SSVVPA++TGE +  +LT  DLA+KLHY+R VY F+          DLK+  F 
Sbjct  351   VTDMKISSVVPASMTGENKPRHLTAMDLAVKLHYVRAVYFFK--GTRDFTIVDLKNITFP  408

Query  304   MLE--DFYPAAGRIR-----TSPEDGRPFVKCNDSGVRIVEAKCSK-TIDEWLDMSDQSE  459
             +L+   +    GRIR            P+++CNDSG+RIVEAK    T+ EWLD+ D+S 
Sbjct  409   LLDLPCYDHVTGRIRLLDNKNPSAQAIPYIRCNDSGMRIVEAKVEGFTVQEWLDLDDRSI  468

Query  460   YDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAM  639
                 L +D VLGPDL +SPLV++QIT FKCGGLS+G+SWAHVLGD  S S F+   G  M
Sbjct  469   DHRFLVYDHVLGPDLLYSPLVYLQITQFKCGGLSVGLSWAHVLGDVVSASTFMKTMGQLM  528

Query  640   AGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT  819
             + R    P +P  P    H + +         S+  V  VG++W L+N CKM   +   +
Sbjct  529   STRGPSKPVYPKKPELTPHANGQVDDDGQ-AISIKKVESVGEYWLLSNKCKMGRFNIKFS  587

Query  820   DKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGL  999
              +Q++ L+ K    + S++V   + + AL W S+  ++       +TI      S     
Sbjct  588   LEQIDRLMAK---YQSSSEV---DILYALIWSSILNIRGEKDTNVITICDRKTSST----  637

Query  1000  LPCRNGQ-VISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
               C N   VIS V+ +  ++E    ELA LI  +  +E G+I   +E++ G S DF  YG
Sbjct  638   --CWNDDLVISVVERKDEMTEGS--ELAGLIANERKEENGVIKGMIEKDRGYS-DFITYG  692

Query  1177  ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVI  1356
             ANLTFVNL+       ++KG+KP F NYTI GVGD+G VLV P     KGK   R V+V+
Sbjct  693   ANLTFVNLDMCD--ELEIKGEKPDFVNYTIHGVGDKGVVLVFP-----KGK-FARAVSVV  744

Query  1357  LPEHLLGKLKNEIS  1398
             +PE  L KLK E++
Sbjct  745   MPEEELAKLKIELN  758



>emb|CDX85135.1| BnaC07g07710D [Brassica napus]
Length=407

 Score =   262 bits (669),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 161/428 (38%), Positives = 231/428 (54%), Gaps = 45/428 (11%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+   +S+V  A  T  G V   T  DLAMKLHY++ VY++ +E    L    +K   F 
Sbjct  12    VHGFWMSTVGSARPTETGTVHQPTGLDLAMKLHYIKSVYIYSAETTRDLTVMHVKETFFT  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             +L+      GR+R   + GRPF+KCND G R+VE++C  T+DEWL   D+S  + L++H 
Sbjct  72    VLDQISWITGRLRRR-DSGRPFIKCNDCGTRVVESQCDLTVDEWLCAPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L +SPL++IQ+T FKCGGL+IG SWAH++GD  SLS F N +  A+AG +   P
Sbjct  130   QPIGPELAYSPLIYIQMTRFKCGGLAIGFSWAHIIGDPHSLSHFFNLWTRALAGEQIYFP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             K   +     +    P +    P S+  V PVGD W   +  KM T S++I         
Sbjct  190   KTSDLERCFQN----PNSTDKEPVSIKRVDPVGDLWVAPSNSKMTTYSFNI---------  236

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRNG  1017
                              +S + WK +AK +      T+TI++    S  NGL P   RN 
Sbjct  237   -----------------LSGIIWKCIAKSRGEPEPVTITIIR----SDPNGLKPRAVRNS  275

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
             Q+IS+V  +  V+EA + E+   IG KA DE   I++  E ++G + DF VYGA LTFV+
Sbjct  276   QMISSVHVDFSVAEAKLEEIVKAIG-KATDERSEINKIGESDDG-ALDFVVYGAKLTFVD  333

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLG  1377
             + EV  Y   +K   P      + G+GD+G V+VLP        E   +V V LPE  + 
Sbjct  334   MSEVGFYDAKVKDTSPRSVYCNVQGIGDDGEVVVLPA-----AVEEEMVVTVTLPEDEIE  388

Query  1378  KLKNEISK  1401
             K+K E+ K
Sbjct  389   KVKWELKK  396



>ref|XP_004139014.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN61496.1| hypothetical protein Csa_2G147920 [Cucumis sativus]
Length=450

 Score =   263 bits (671),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 175/448 (39%), Positives = 246/448 (55%), Gaps = 38/448 (8%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             +++V+  R+SSV P    G     +LT  DLAMKLHY+  +Y F SEA   +    +K+ 
Sbjct  8     QSLVHSFRISSVGPGQTLGSDISYHLTGLDLAMKLHYINAIYFFDSEASHRVTLPQIKTA  67

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDM-SDQSEYDHL  471
              F +  D+Y   GR+R   + GRPF+KCND G R +EA+C  T+ EWL+M  D      L
Sbjct  68    TFVLFNDYYLTCGRLRRE-DSGRPFIKCNDCGARFIEAECDTTVSEWLEMIGDDCSPMKL  126

Query  472   LHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRR  651
             L   +V+GP+L FSP ++IQ+T FKC G+SIG++WAHVLGDAFS + F+N     + G  
Sbjct  127   LVSQKVIGPELNFSPPIYIQVTRFKCKGMSIGLTWAHVLGDAFSPAAFMNSITNMLFGAA  186

Query  652   DLPPKHPHMPTADNHN-----------SPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMA  798
                   P +P+                S KP      P SL  V PVGDHW  TN  KM 
Sbjct  187   T-ALTSPPLPSLGTITTTPPPKPPVSASAKP------PLSLRRVDPVGDHWIPTNKYKME  239

Query  799   TQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVK-NG  975
             + S+ +   QL  L       +   +  PFE+ISA  W S+AK++ GS   TVT+ K + 
Sbjct  240   SFSFKLNPTQLANL-----QTQMPHQTPPFESISAALWHSIAKLRRGSEPTTVTLCKLDP  294

Query  976   FHSRGNGLLPCRNGQVISAVK-AEMRVSEADVLELAN-LIGEKAVDETGIIDETMEEENG  1149
                +G  +    N Q IS VK A   VS+ D  +LA  L+G  A DE  +I+E +  ++G
Sbjct  295   VKQQGKVI---GNTQKISTVKSAAAAVSDVDQRDLAALLVGSAADDEGELIEEAVNRDDG  351

Query  1150  KSADFFVYGANLTFVNLEEVKIYG---FDMKGQKPIFANYTI--GGVGDEGAVLVLPGPE  1314
              S DF VYGANLTFV  ++  +YG    ++  +KP F  YT+   G G    V+  P  +
Sbjct  352   VS-DFIVYGANLTFVKWDDANLYGNGIMELDYEKPKFVYYTLHGVGDGGAVVVVPGPVDD  410

Query  1315  NLKGKEG-GRIVNVILPEHLLGKLKNEI  1395
              + G++  GR V VILPE+ + +LK E+
Sbjct  411   GVSGRDDRGRFVTVILPENEVVELKAEL  438



>ref|XP_006414850.1| hypothetical protein EUTSA_v10025273mg [Eutrema salsugineum]
 gb|ESQ56303.1| hypothetical protein EUTSA_v10025273mg [Eutrema salsugineum]
Length=427

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 164/426 (38%), Positives = 232/426 (54%), Gaps = 24/426 (6%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             VY+ RLS+V     +  G     T  DLAMKLHYL+  Y++ SE    L    +K  MF 
Sbjct  14    VYNIRLSTVGATRPSKTGATREPTGLDLAMKLHYLKAAYIYSSETARDLTVKHVKEAMFM  73

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR     + GRP++KCNDSG R VE +C+ T++EWL   D+S  D +L + 
Sbjct  74    LFDQIAWTTGRFWRR-DSGRPYIKCNDSGTRFVEGQCNLTVEEWLSKPDRS-IDEVLVYH  131

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L FSPL+++Q+T FKCGGL++G++WAH++GD+FSL    N +  AM+G      
Sbjct  132   QPIGPELSFSPLIYVQMTRFKCGGLALGLNWAHIMGDSFSLLYAFNFWAKAMSGE-----  186

Query  664   KHPHMPTADN-HNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
             K   + T+D       P      P S+  V PVGD W   N  KMA  S++++     + 
Sbjct  187   KIYTLETSDGIRRFRSPNLTVKAPVSIKRVDPVGDLWITPNNKKMAKFSFNLSVADQVSP  246

Query  841   IFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRN  1014
              F   G  Q+   + FE ++ + WK +AKV+E      VTI++       N L P   RN
Sbjct  247   HFPAYGDDQT---QVFEILAGIIWKCIAKVREEPEPLIVTIIRKD----PNMLKPKGIRN  299

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFV  1194
              QVIS+V  +  V EA V EL   I E A DE   IDE  E  +G + DF VYGA LTFV
Sbjct  300   SQVISSVHVDFPVGEATVEELVKRIAE-ATDERCGIDEIGESCDG-NLDFVVYGAKLTFV  357

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLL  1374
             +L E+  Y   + G+ P    Y + GVG+EG V+V P   + +     R+V + LPE  +
Sbjct  358   DLSELGFYEARVMGKSPESVYYNVEGVGEEGLVVVFPAKNSEE-----RVVTMTLPEEEM  412

Query  1375  GKLKNE  1392
               +K E
Sbjct  413   ESVKLE  418



>gb|KFK36272.1| hypothetical protein AALP_AA4G100900 [Arabis alpina]
Length=421

 Score =   259 bits (663),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 159/428 (37%), Positives = 239/428 (56%), Gaps = 22/428 (5%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF  300
             ++Y+ RLS+V     +  G +   T  DLAMKLHYL+ VY++ SE    L    LK  MF
Sbjct  11    LIYNMRLSTVGSTRASEIGTIHEPTGLDLAMKLHYLKAVYIYSSETARDLTVTQLKEAMF  70

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
              + +      GR  +  + GRP++KCND G R VE +C+ T++EWL   D+S  D +L +
Sbjct  71    VLFDQIAWTTGRF-SRRDSGRPYIKCNDCGTRFVEGECNLTVEEWLGKPDRS-VDEVLVY  128

Query  481   DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLP  660
              Q +GP+L FSPL+++Q+  FKCGGL++G+SWA+++GDAFSL    N +  A++G +   
Sbjct  129   HQPVGPELAFSPLIYVQMIRFKCGGLALGLSWANIMGDAFSLFHSFNLWTKAISGEKIFI  188

Query  661   PKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
             PK  ++       SP P  +   P S+  V PVGD W   N  KM+  S+ +      + 
Sbjct  189   PKTFNV--NKTFQSPNPTVKD--PDSIKRVNPVGDLWVTPNNKKMSNYSFTLAIADQISP  244

Query  841   IFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHS-RGNGLLPCRNG  1017
              F  +       +  FE ++ + WK +AKV+E +   TVTI+K   +  + NG +  RN 
Sbjct  245   HFPAN---SDGYLPVFEILTGIIWKCIAKVREETKPVTVTIIKKDPNDLKPNGSI--RNS  299

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
             Q+IS+V  +  V EA V EL   IGE   DE   IDE  +E    + D  VYGA LTF++
Sbjct  300   QMISSVSVDFPVGEASVEELVRCIGE-GKDERDGIDEIGDE----NLDLVVYGARLTFMD  354

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLG  1377
             L EV++Y   + G+ P      + G+G+EG V+V      +K +E  R+V + LPE  + 
Sbjct  355   LSEVRLYEAKVNGKSPESVYCNVEGIGEEGLVVVYTA---VKAEE--RVVTMSLPEEEID  409

Query  1378  KLKNEISK  1401
             ++K E  K
Sbjct  410   RVKLEFKK  417



>ref|XP_006297739.1| hypothetical protein CARUB_v10013773mg [Capsella rubella]
 gb|EOA30637.1| hypothetical protein CARUB_v10013773mg [Capsella rubella]
Length=425

 Score =   259 bits (661),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 166/429 (39%), Positives = 241/429 (56%), Gaps = 29/429 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             ++  RLS+V  +  T  G     T  DLAMKLHY++ VY++ +E    L   ++K+  F 
Sbjct  12    IHGFRLSTVGSSRPTETGTTHEPTGLDLAMKLHYIKLVYIYSAETARDLTVMNVKASFFP  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR R   E GRP++KCND G R VE+ C  T++EWL   D+S  + L++H 
Sbjct  72    VFDQNPWITGRFRRH-ESGRPYIKCNDCGTRFVESHCDLTVEEWLRAPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+LG SPL++IQ+T F CGGL++G+SWAHV+GD FSLS F N +  A AG +   P
Sbjct  130   QPVGPELGSSPLIYIQMTRFNCGGLALGLSWAHVMGDPFSLSHFFNLWARAFAGEKIYCP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
                 +       +    T+   P S+  V PV D W   +  +M T S+++T   ++A+ 
Sbjct  190   NTSDLERVFQKPNSTGTTK---PNSIKRVDPVEDLWVAPSNSRMITFSFNLT---VDAIK  243

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLLP--CRN  1014
                  + +      FE +  + WK +AKV+ E S   T+T+++    S  NGL P   RN
Sbjct  244   SNFPAIGEDV----FEILIGIIWKCVAKVREEESDPVTITVIR----SDPNGLKPRAVRN  295

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFV  1194
              Q+IS+V  +  V+EA + E+   IG  A DE   IDE +   NG S DF VYGANLTFV
Sbjct  296   SQMISSVHVDFSVAEASLEEILKSIG-GADDERFWIDEIV---NGVS-DFIVYGANLTFV  350

Query  1195  NLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLL  1374
             ++  V  Y   +KG+ P      + G+GD GAV+VLP      G E  R+V V LPE  +
Sbjct  351   DMSGVDFYEAKVKGKSPESVYCNVQGIGDGGAVVVLP-----SGVEEERVVTVTLPEDEV  405

Query  1375  GKLKNEISK  1401
              K+K E++K
Sbjct  406   EKVKCEMNK  414



>ref|XP_010495840.1| PREDICTED: protein ECERIFERUM 26 [Camelina sativa]
Length=428

 Score =   257 bits (657),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 164/433 (38%), Positives = 235/433 (54%), Gaps = 31/433 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             ++  RLS+V  A  T  G     T  DLAMKLHYL+  Y++  E    L    +K  MF 
Sbjct  14    IHSIRLSTVGAARPTETGTTHEPTGLDLAMKLHYLKAAYIYSPETARDLTVRHMKESMFM  73

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR  +  + GRP++KCNDSG R VE +C+ T++EWL   D+S  + L++H 
Sbjct  74    LFDQIAWTTGRF-SRRDSGRPYIKCNDSGTRFVEGQCNLTVEEWLSQPDRSVDEFLVYH-  131

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L  SPL+++Q+T FKCGGL +G+SWA+++GD+ SL    N +  A+ G +    
Sbjct  132   QPIGPELTISPLIYVQMTRFKCGGLGLGLSWANIIGDSSSLFYAFNLWTKAITGEKI---  188

Query  664   KHPHMPTAD----NHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
                H PT      +  SP P  +   P S+  V PVGD W   N  KMAT  ++++    
Sbjct  189   ---HAPTPSKGDRSFQSPNPTVKD--PVSIKRVDPVGDLWVTPNNKKMATYCFNLSVADQ  243

Query  832   NALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--  1005
              +  F  +G      V  FE IS + WK +AKV+      TVTI+KN      N L P  
Sbjct  244   ISPHFPANG---GNSVPVFEIISGIIWKCIAKVRAEPEPVTVTIIKND----PNDLKPNN  296

Query  1006  -CRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
               RN QVIS+V+ +  V+EA V EL   +GE A+DE   I+E     +G + DF VYGA 
Sbjct  297   AIRNSQVISSVQVDFPVAEATVEELVRAMGE-AMDERFGIEEIGGSCDG-NLDFVVYGAK  354

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILP  1362
             LTFV+L    +YG  + G+ P      + GVG+EG V++      +  K   R+V V LP
Sbjct  355   LTFVDLSGEDLYGARVMGKSPDSVYCNVEGVGEEGLVVIY-----VAAKSEERVVTVTLP  409

Query  1363  EHLLGKLKNEISK  1401
             E  + ++K E  K
Sbjct  410   EEEMERVKLEFKK  422



>ref|XP_006297755.1| hypothetical protein CARUB_v10013790mg [Capsella rubella]
 gb|EOA30653.1| hypothetical protein CARUB_v10013790mg [Capsella rubella]
Length=421

 Score =   256 bits (654),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 161/428 (38%), Positives = 235/428 (55%), Gaps = 29/428 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  T  G     T  DLAMKLHY++ VY++ +E    L    +K+P+F 
Sbjct  12    VHGFRLSTVSSSRPTETGTTHEPTGLDLAMKLHYIKVVYIYSAETARDLTVMSVKAPLFP  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR+R   E GRP++KCND G R VE+ C  T+DEWL + D+S  + L++H 
Sbjct  72    VFDQISWITGRLRRH-ESGRPYIKCNDCGTRFVESHCDLTVDEWLRVPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GPD+ FSPL+++Q+T F CGGL++G+SWAH++GD  SLS   N +  A AG +    
Sbjct  130   QPVGPDMAFSPLIYLQMTRFSCGGLALGLSWAHIMGDPLSLSHVFNLWARAFAGEK----  185

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
              + H  +        P +    P S+  V PVGD W   +  KM T S+++T K + +  
Sbjct  186   IYSHKTSELERVFQNPNSTGAKPESIKRVDPVGDLWVTPSNSKMTTFSFNLTVKDIKSK-  244

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRNG  1017
             F  +G         FE +  + WK +AKV+ GS   T+T+++       NGL P   RN 
Sbjct  245   FPANGDDV------FEILIGVIWKCIAKVRGGSDPVTITVIR----PDPNGLKPRAVRNS  294

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
             QVIS+V     V+EA + E+   IGE A DE   IDE +++     +DF VYGANLTFV+
Sbjct  295   QVISSVHVGFSVAEASLEEIVKSIGE-ASDERSKIDEIVDD----VSDFIVYGANLTFVD  349

Query  1198  LEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLG  1377
             L EV  Y   + G+ P      + G+GD GAV+      +       R+  V LP   + 
Sbjct  350   LSEVDFYEAKVLGKSPESVYCNVQGIGDGGAVV-----VSPGVVVDERVATVTLPGDDIE  404

Query  1378  KLKNEISK  1401
             K+K E+ K
Sbjct  405   KVKCEMDK  412



>ref|XP_002862408.1| hypothetical protein ARALYDRAFT_497463 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38666.1| hypothetical protein ARALYDRAFT_497463 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 157/427 (37%), Positives = 234/427 (55%), Gaps = 27/427 (6%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  +  G     T  DLAMKLHYL+ VY++ +E    L    +K+P+F 
Sbjct  12    VHGFRLSTVSASQPSETGTTHEPTGLDLAMKLHYLKAVYIYSAETARDLTVMHVKTPLFS  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR R   + GRP++KCND G R VE+ C  T++EWL + D+S  + L++H 
Sbjct  72    VFDQIPCIIGRFRRH-DSGRPYIKCNDCGTRFVESHCDLTVEEWLHVPDRSVDEALVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L FSPL++IQ+T F CGGL++G+SWAHV+GD FSLS F N +  A AG +   P
Sbjct  130   QSVGPELAFSPLLYIQMTRFSCGGLALGLSWAHVMGDPFSLSHFFNLWAQAFAGEKIYSP  189

Query  664   KHPHMPTADNHN-SPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
             K     T+D       P +    P S+  V PVGD W   N  KM T S++ T   L + 
Sbjct  190   K-----TSDTERVCQNPNSTVKKPNSIKRVDPVGDLWVAPNNSKMTTFSFNSTVNDLKSH  244

Query  841   IFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQ  1020
              F  +G  +      F+ ++ + WK +A  +  S   T+T+++     +       RNGQ
Sbjct  245   -FPANGDDE------FKILAGIIWKCVATARGESAPVTITVIR--LDPKELKPRAVRNGQ  295

Query  1021  VISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNL  1200
             +IS+V  +  V+EA + E+   IGE   +  G     +++     +DF VYGANLTFV++
Sbjct  296   MISSVHVDFSVAEASLEEIVKAIGEARDERFG-----IDDIVDDVSDFIVYGANLTFVDM  350

Query  1201  EEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGK  1380
              EV  Y   + G+ P      + G+GD+GAV+VLPG    +         V LPE  + K
Sbjct  351   SEVDFYEAKVMGKSPESVYCNVQGIGDDGAVVVLPGVVEEERVV-----TVTLPEDEIEK  405

Query  1381  LKNEISK  1401
             +K E+ K
Sbjct  406   VKWEMKK  412



>ref|XP_002883466.1| hypothetical protein ARALYDRAFT_479896 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59725.1| hypothetical protein ARALYDRAFT_479896 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 155/427 (36%), Positives = 233/427 (55%), Gaps = 27/427 (6%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  +        T  DLAMKLHYL+ VY++ +E    L    +K+P+F 
Sbjct  12    VHGFRLSTVSASQPSETDTTHEPTGLDLAMKLHYLKAVYIYSAETARDLTVMHVKTPLFS  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR R   + GRP++KCND G R VE+ C  T++EWL + D+S  + L++H 
Sbjct  72    VFDQIPCIIGRFRRH-DSGRPYIKCNDCGTRFVESHCDLTVEEWLHVPDRSVDEALVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L FSPL++IQ+T F CGGL++G+SWAH +GD FSLS F N +  A AG +   P
Sbjct  130   QPVGPELAFSPLLYIQMTRFSCGGLALGLSWAHAMGDPFSLSHFFNLWAQAFAGEKIYSP  189

Query  664   KHPHMPTADNHN-SPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
             K     T+D       P +    P S+  V PVGD W   N  KM T S+++T   L + 
Sbjct  190   K-----TSDTERVCQNPNSTVKKPNSIKRVDPVGDLWVAPNNSKMTTFSFNLTVNDLKSH  244

Query  841   IFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQ  1020
              F  +G  +      F+ ++ + WK +A  +  S   T+T+++     +       RNGQ
Sbjct  245   -FPANGDDE------FKILAGIIWKCVATARGESAPVTITVIR--LDPKELKPRAVRNGQ  295

Query  1021  VISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNL  1200
             +IS+V  +  V+EA + E+   IGE   +  G     +++     +DF VYGANLTFV++
Sbjct  296   MISSVHVDFSVAEASLEEIVKAIGEARDERFG-----IDDIVDDVSDFIVYGANLTFVDM  350

Query  1201  EEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGK  1380
              EV  Y   + G+ P      + G+GD+GAV+VLPG    +         V LPE  + K
Sbjct  351   SEVDFYEAKVMGKSPESVYCNVQGIGDDGAVVVLPGVVEEERVV-----TVTLPEDEIEK  405

Query  1381  LKNEISK  1401
             +K E+ K
Sbjct  406   VKWEMKK  412



>ref|XP_010435220.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=428

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 159/433 (37%), Positives = 227/433 (52%), Gaps = 31/433 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             ++  RLS+V  A  T  G     T  DLAMKLHYL+  Y++  E    L    +K  MF 
Sbjct  14    IHSIRLSTVGAARPTETGTTHEPTGLDLAMKLHYLKAAYIYSPETARDLTVRHMKESMFM  73

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR  +  + GRP++KCND G R VE +C+ T++EWL   D+S  + L++H 
Sbjct  74    LFDQIAWTTGRF-SRRDSGRPYIKCNDCGTRFVEGQCNLTVEEWLSQPDRSVDEFLVYH-  131

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L  SPL+++Q+T FKCGGL +G+SWA+++GD+FSL    N +  A+ G      
Sbjct  132   QPIGPELAISPLIYVQLTRFKCGGLGLGLSWANIIGDSFSLFYAFNFWTKAITGET----  187

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
              H  +P+  +     P      P S+  + PVGD W   N  KMAT  ++++     +  
Sbjct  188   IHAPIPSKGDRGFQSPNPTVKDPVSVKRIDPVGDLWVTPNNKKMATYCFNLSVADQISPH  247

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP---CRN  1014
             F  +G      +  FE I+ + WK +AKV+      TVTI+K       N L P    RN
Sbjct  248   FPANG---DNSIPVFEIIAGIIWKCVAKVRAEPEPVTVTIIKKD----PNDLKPNNAIRN  300

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSA----DFFVYGAN  1182
              QVIS+V+ +  V+EA V EL   IGE   +  GI      EE G S     DF VYGA 
Sbjct  301   SQVISSVQVDFPVAEATVEELVRSIGEAKDERFGI------EEIGGSCDGNLDFVVYGAK  354

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILP  1362
             LTFV+L    +YG  + G+ P    + + GVG+EG V+V         K   R+V V LP
Sbjct  355   LTFVDLSGEDLYGARVMGKSPHSVYFNVEGVGEEGLVVVYAA-----AKSEERVVTVTLP  409

Query  1363  EHLLGKLKNEISK  1401
             E  +  +K E  K
Sbjct  410   EEEMEMVKLEFKK  422



>emb|CAN81455.1| hypothetical protein VITISV_003221 [Vitis vinifera]
Length=312

 Score =   248 bits (632),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 189/301 (63%), Gaps = 16/301 (5%)
 Frame = +1

Query  523   FIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP-HMPTADNHN  699
              +Q+T FKCGG+S+G+SWAHVLGDAFS SDF+N +G AMA +    P+HP  +P +    
Sbjct  17    LLQVTSFKCGGMSLGLSWAHVLGDAFSASDFINMWGQAMANQL---PQHPVDLPKSSCFM  73

Query  700   SPKPRTQKLFP---FSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQS  870
               KP  +        S+  V PVGD+W   N CKM   S+HIT  QL  L  K+SG K +
Sbjct  74    LVKPANRPQLATDSLSIKRVDPVGDNWITANNCKMEPFSFHITATQLTQLQAKISGHKAT  133

Query  871   AKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMR  1050
                 PFE +  +FW+S+A+V      E VT+ KN   SR  G L   + Q+IS VKA+  
Sbjct  134   P---PFECLCTIFWQSIARVCSRHEPEIVTVCKNERGSRRTGTLS-NSAQIISTVKADFS  189

Query  1051  VSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDM  1230
             V EA   ++A L+ E AVDE G+I+  +E + G S DF +YGANLTFVNLEE   YG ++
Sbjct  190   VKEAKPKDVAALLVEHAVDERGLIEAAVERDGGVS-DFIIYGANLTFVNLEEASFYGLEL  248

Query  1231  KGQKPIFANYTIGGVGDEGAVLVL-PGPENLKGKEG--GRIVNVILPEHLLGKLKNEISK  1401
              GQKP+  +Y I G+GDEG VLV  PGP++  GK+   G+IV VILPE  + +LK+E+ +
Sbjct  249   NGQKPVHVSYLIDGIGDEGVVLVAPPGPKD-SGKDSNEGKIVTVILPEDQVMELKSELKR  307

Query  1402  E  1404
             E
Sbjct  308   E  308



>ref|XP_006283805.1| hypothetical protein CARUB_v10004904mg [Capsella rubella]
 gb|EOA16703.1| hypothetical protein CARUB_v10004904mg [Capsella rubella]
Length=421

 Score =   251 bits (641),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 160/430 (37%), Positives = 231/430 (54%), Gaps = 33/430 (8%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V     T  G     T  DLAMKLHY++ VY++  E    L    LK  MF 
Sbjct  14    VHSIRLSTVGATRPTEIGTTHEPTGLDLAMKLHYIKAVYIYSPETARDLTVRQLKEAMFM  73

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR  +  + GRP++KCND G R VE +C+ T++EWL   D+S  + L++H 
Sbjct  74    LFDQIAWTTGRF-SRRDSGRPYIKCNDCGTRFVEGQCNLTVEEWLSKPDRSVDEFLVYH-  131

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L FSPL+++Q+T FKCGGLS+G+SWA+++GD+FSL    N +  A+AG     P
Sbjct  132   QPIGPELTFSPLIYVQMTRFKCGGLSLGLSWANIIGDSFSLFYAFNLWAKAIAGENIQAP  191

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT---DKQLN  834
                 +P+               P S+  V PVGD W   N  KM + S++I+    K  +
Sbjct  192   ----IPSKGGRRFQNLNPTVKDPVSVKRVDPVGDLWVTPNNKKMLSHSFNISVADHKPPH  247

Query  835   ALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLLPCR  1011
             +L+              FE+I  + WK +AKV+ E   L TVTI+K   +     ++  R
Sbjct  248   SLV--------------FESIVGIIWKCIAKVRAEPEPLTTVTIIKKDVNDMKPNVI--R  291

Query  1012  NGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTF  1191
             N QVIS+V+ +  V+EA V EL   +  KA DE   I+E + E  G + DF +YGA LTF
Sbjct  292   NSQVISSVQVDFSVAEAMVEELVKSMA-KATDERFGIEE-VGESCGGNLDFVLYGAKLTF  349

Query  1192  VNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHL  1371
             V+L    +Y   M G+ P      + GVG+EG V+V         K   R+V V LPE  
Sbjct  350   VDLSGEDLYEAKMMGKSPESVYCNVEGVGEEGLVVVYAA-----AKSEERVVTVTLPEEE  404

Query  1372  LGKLKNEISK  1401
             + ++K E  K
Sbjct  405   MERVKVEFKK  414



>ref|NP_193120.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 sp|Q9SVM9.1|CER26_ARATH RecName: Full=Protein ECERIFERUM 26; AltName: Full=CER2-like 
protein 1; Short=CER2-like1 [Arabidopsis thaliana]
 gb|AAL48240.1|AF446369_1 AT4g13840/F18A5_230 [Arabidopsis thaliana]
 emb|CAB36848.1| fatty acid elongase-like protein (cer2-like) [Arabidopsis thaliana]
 emb|CAB78426.1| fatty acid elongase-like protein (cer2-like) [Arabidopsis thaliana]
 gb|AAN18163.1| At4g13840/F18A5_230 [Arabidopsis thaliana]
 dbj|BAE98388.1| fatty acid elongase - like protein [Arabidopsis thaliana]
 gb|AEE83332.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=428

 Score =   251 bits (640),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 156/426 (37%), Positives = 227/426 (53%), Gaps = 17/426 (4%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V     T  G     T  DLAMKLHYL+  Y++ +E    L    LK  MF 
Sbjct  14    VHSIRLSTVGATRPTETGTTHEPTGLDLAMKLHYLKAAYIYSAETARDLTVRHLKEAMFM  73

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR  +  + GRP++KCND G R VE +C+ T++EWL   D+S  + L++H 
Sbjct  74    LFDQIAWTTGRF-SRRDSGRPYIKCNDCGTRFVEGQCNLTVEEWLSKPDRSVDEFLVYHH  132

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
              + GP+L FSPL+++Q+T FKCGGL +G+SWA+++GDAFSL    N +  A+ G +   P
Sbjct  133   PI-GPELTFSPLIYVQMTRFKCGGLGLGLSWANIIGDAFSLFYAFNLWAKAITGEKIYAP  191

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
               P +       SP P  +   P S+  V PVGD W   N  K+A   ++++     +  
Sbjct  192   TTPSI-GERRFQSPNPTVKD--PVSIKRVEPVGDLWVTPNDKKLANYCFNLSVADQISPH  248

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQV  1023
             F   G      +  FE ++ + WK +AKV+      TVTI+K   +     L   RN QV
Sbjct  249   FPAKG---DDSIPVFEILAGIIWKCIAKVRVEPKPVTVTIIKKDPNDL--KLNAIRNSQV  303

Query  1024  ISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLE  1203
             IS+V  +  V+EA V EL   +GE A DE   I+E  E  +G + DF VYGA LTF++L 
Sbjct  304   ISSVSVDFPVAEATVEELVKAMGE-AKDERCGIEEIGESCDG-NLDFVVYGAKLTFLDLT  361

Query  1204  EVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKL  1383
                +Y   + G+ P      + G+G+EG V+V         K   R+V V LPE  + ++
Sbjct  362   GEDLYEAKVMGKSPESVYCNVEGIGEEGLVVVYAA-----AKSEERVVTVTLPEEEMERV  416

Query  1384  KNEISK  1401
             K E  K
Sbjct  417   KLEFKK  422



>ref|XP_010512967.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
 ref|XP_010488464.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=426

 Score =   249 bits (636),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 147/382 (38%), Positives = 216/382 (57%), Gaps = 26/382 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V  +  T  G    LT  DLAMKLHYL+ VY++ +E    L   ++K+P+F 
Sbjct  12    VHGFRLSTVSSSRPTETGTTHELTGLDLAMKLHYLKVVYIYSAETASDLTVMNVKAPLFP  71

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR+R   E GRP++KCND G R VE+ C  T+DEWL + D+S  + L++H 
Sbjct  72    VFDQISWITGRLRRH-ESGRPYIKCNDCGTRFVESHCDLTVDEWLRVPDRSVDESLVYH-  129

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP++ FSPL++IQ+T F CGGL++G+SWAH++GD  SLS   N +  A  G +   P
Sbjct  130   QPVGPEMAFSPLIYIQMTRFSCGGLALGLSWAHIMGDPLSLSHVFNLWARAYVGEKIHCP  189

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             K   +     +    P +    P S+  V PVGD W      KM T S+++T  ++ +  
Sbjct  190   KTSELERVFQN----PNSTGKEPESIKRVDPVGDLWVAPGNNKMTTFSFNLTVNEIKSH-  244

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRNG  1017
             F  +G  +      FE +S + WK +AK +  S   T+T++K    S  NGL P   RN 
Sbjct  245   FPATGENE------FEILSGIIWKCIAKARGESAPVTITVIK----SDPNGLKPRAVRNS  294

Query  1018  QVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVN  1197
             Q+IS+V  +  V+EA + E+   IGE   DE   IDET+++      DF VYG NLTFV+
Sbjct  295   QMISSVHVDFSVAEASLEEIVKSIGETN-DERFGIDETVDD----VTDFIVYGTNLTFVD  349

Query  1198  LEEVKIYGFDMKGQKP--IFAN  1257
             L  V  Y   + G+ P  ++ N
Sbjct  350   LSGVDFYEAKVMGKSPESVYCN  371



>ref|XP_010450155.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=428

 Score =   248 bits (633),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 162/433 (37%), Positives = 227/433 (52%), Gaps = 31/433 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             ++  RLS+V  A  T  G     T  DLAMKLHYL+  Y++  E    L    +K  MF 
Sbjct  14    IHSIRLSTVGAARPTETGTTHEPTGLDLAMKLHYLKAAYIYSPETARDLTVRHMKDSMFM  73

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR  +  + GRP++KCNDSG R VE +C+ T++EWL   D+S  + L++H 
Sbjct  74    LFDQIAWTTGRF-SRRDSGRPYIKCNDSGTRFVEGQCNLTVEEWLSQPDRSVDEFLVYH-  131

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L  SPL+++Q+T FKCGGL +G+SWA+++GD+FSL    N +  A+ G     P
Sbjct  132   QPIGPELAISPLIYVQLTRFKCGGLGLGLSWANIIGDSFSLFYAFNFWTKAITGETIHAP  191

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
               P         SP P  +   P S+  V PVGD W   N  KMAT  ++++     +  
Sbjct  192   --PPSRGDRRFQSPNPTVKD--PVSVKQVDPVGDLWVTPNNKKMATYCFNLSVADQISPH  247

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP---CRN  1014
             F V+G+     +  FE I+ + WK +AKV+      TVTI+K       N L P    RN
Sbjct  248   FPVNGINS---IPVFEIIAGIIWKCVAKVRAEPEPVTVTIIKKD----PNDLKPNNAIRN  300

Query  1015  GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSA----DFFVYGAN  1182
              QVIS+V+ +  V+EA V EL   +GE   +  GI      EE G S     DF VYGA 
Sbjct  301   SQVISSVQVDFPVAEATVEELVRSMGEAKDERFGI------EEIGGSCDGNLDFVVYGAK  354

Query  1183  LTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILP  1362
             LTFV+L    +Y   + G+ P      + GVG+EG V+V         K   R V V LP
Sbjct  355   LTFVDLSGEDLYEARVMGKSPDSVYCNVEGVGEEGLVVVYAA-----AKSEERGVTVTLP  409

Query  1363  EHLLGKLKNEISK  1401
             E  +  +K E  K
Sbjct  410   EGEMEMVKLEFKK  422



>ref|NP_001151321.1| transferase [Zea mays]
 gb|ACG42374.1| transferase [Zea mays]
Length=463

 Score =   248 bits (632),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 156/448 (35%), Positives = 235/448 (52%), Gaps = 32/448 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+ H+LS+VVP+++TGE     L +ADL  KLHY+R V++FR+     L   +LK PMF 
Sbjct  25    VHGHQLSTVVPSSVTGEEVNYELADADLLHKLHYVRAVHVFRAPP---LTIRELKEPMFP  81

Query  304   MLEDFYPAAGRIRTSPED----------GRPFVKCNDSGVRIVEAKCSKTIDEWLDM-SD  450
              L+ ++P +GR+R               GRP+V+CND GVRIVE  C  T+++WL+  ++
Sbjct  82    WLDMYFPVSGRLRRRQAAEGEEAAAAAVGRPYVRCNDCGVRIVEVDCDATVEQWLEAEAE  141

Query  451   QSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG  630
             +      L +D+V+GP+L FSPL+++QIT FKCGG+++G +WAH++GD  S      K+ 
Sbjct  142   RGGLCKALAYDKVIGPELFFSPLLYVQITSFKCGGMALGFTWAHLIGDIPSAVASFRKWA  201

Query  631   PAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSY  810
               + G +   P     P A   ++P P +  + P    +  PVGDHW +  T  M + S+
Sbjct  202   QVLGGNKAPAPTL-RDPLAVPPSAP-PTSVTVPPSVKATAAPVGDHWVVPTTHDMVSLSF  259

Query  811   HITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK---EGSGLETVTIVKNGFH  981
             H+T++QL  L    +   +   V PFE +SAL W++LA ++   E     TVT+VK G  
Sbjct  260   HVTEQQLQELRLSATKGHRREVVGPFELVSALMWRALAAIRGPEEEEATRTVTVVKTGAA  319

Query  982   -SRGNGLLPC-----RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEE  1143
              + G G  P      R G V+ A       +       A L    A  E           
Sbjct  320   PTSGGGPRPALTNEHRIGHVVFATGGSSPATADVAKLAALL--AGAHLEEASAVAAAAFA  377

Query  1144  NGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLK  1323
                 AD  VYGANLTFV+ E +++Y  ++ G++P    Y + GVGD GA +V     +  
Sbjct  378   GADDADVVVYGANLTFVDAEGLEVYELELAGRRPAHVEYAVDGVGDGGAAVVH---RDAG  434

Query  1324  GKEGGRIVNVILPEHLLGKLKNEISKEL  1407
             G+  GR V  +L      +L+  I   L
Sbjct  435   GR--GRTVAAVLRRGKADRLRAAIRDAL  460



>ref|XP_002868333.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44592.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=425

 Score =   246 bits (629),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 159/432 (37%), Positives = 226/432 (52%), Gaps = 30/432 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+  RLS+V     T  G     T  DLAMKLHYL+  Y++ +E    L    LK  MF 
Sbjct  14    VHSIRLSTVGAIRPTETGTTHEPTGLDLAMKLHYLKAAYIYSAETARDLTVRHLKEAMFM  73

Query  304   MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
             + +      GR  +  + GRP++KCND G R VE +C+ T++EWL   D+S  + L++H 
Sbjct  74    LFDQIAWTTGRF-SRKDSGRPYIKCNDCGTRFVEGQCNLTVEEWLSKPDRSVDEFLIYH-  131

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
             Q +GP+L FSPL+++Q+  FKCGGL +G+SWA+++GD+FSL    N +   + G +    
Sbjct  132   QPIGPELTFSPLIYVQMIRFKCGGLGLGLSWANIIGDSFSLFYAFNLWAKLITGEKI---  188

Query  664   KHPHMPTAD----NHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
                H+PT         SP P  +   P S+  V PVGD W   N  KMA   + I     
Sbjct  189   ---HVPTLSKGDRRFQSPNPTVKD--PDSIKRVNPVGDLWVTPNDKKMANYCFKIVVADQ  243

Query  832   NALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--  1005
                 F   G   +  +  FE  + + WK +AKV+E     TVTI+K       N L P  
Sbjct  244   IQPHFPAKG---ADPIPVFEITAGIIWKCIAKVREEPKPVTVTIIKKD----PNDLKPNA  296

Query  1006  CRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANL  1185
              RN QVIS+V+ +  V++A V EL   +GE A DE   I+E  E   G + DF VYGA L
Sbjct  297   IRNSQVISSVQVDFPVADATVEELVKAMGE-AKDERSGIEEIGESCYG-NLDFVVYGAKL  354

Query  1186  TFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPE  1365
             TF++L    +Y   + G+ P      + G+G+EG V+V         K   R+V V LPE
Sbjct  355   TFLDLSGEDLYEAKVMGKSPESVYCNVEGIGEEGLVVVYAA-----AKSEERMVTVTLPE  409

Query  1366  HLLGKLKNEISK  1401
               + ++K E  K
Sbjct  410   EEIERVKLEFKK  421



>gb|AFW57004.1| transferase [Zea mays]
Length=470

 Score =   247 bits (630),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 157/452 (35%), Positives = 236/452 (52%), Gaps = 33/452 (7%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSE---AVDGLNTGDLKSP  294
             V+ H+LS+VVP+++TGE     L +ADL  KLHY+R V++FR+    A   L   +LK P
Sbjct  25    VHGHQLSTVVPSSVTGEEVNYELADADLLHKLHYVRAVHVFRAPTGVAAPPLTIRELKEP  84

Query  295   MFRMLEDFYPAAGRIRTSPED----------GRPFVKCNDSGVRIVEAKCSKTIDEWLDM  444
             MF  L+ ++P +GR+R               GRP+V+CND GVRIVE  C  T+++WL+ 
Sbjct  85    MFPWLDMYFPVSGRLRRRQAAEGEEAAAAAVGRPYVRCNDCGVRIVEVTCGATVEQWLEA  144

Query  445   -SDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLN  621
              +++      L +D+V+GP+L FSPL+++Q+T FKCGG+++G +WAH++GD  S      
Sbjct  145   EAERGGLCKALAYDKVIGPELFFSPLLYVQVTSFKCGGMALGFTWAHLIGDIPSAVASFR  204

Query  622   KYGPAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMAT  801
             K+   + G +   P     P A   ++P P +  + P    +  PVGDHW +  T  M +
Sbjct  205   KWAQVLGGNKAPAPTL-RDPLAVPPSAP-PTSVTVPPSVKATAAPVGDHWVVPTTHDMVS  262

Query  802   QSYHITDKQLNALIFKVS-GLKQSAKVKPFEAISALFWKSLAKVK---EGSGLETVTIVK  969
              S+H+T++QL  L    + G  +   V PFE +SAL W++LA ++   E      VT+VK
Sbjct  263   FSFHVTEQQLQGLQLSATKGHHRREVVGPFELVSALMWRALAAIRGPEEEEATRMVTVVK  322

Query  970   NG-FHSRGNGLLPC-----RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDET  1131
              G   + G G  P      R G V+ A       +       A L    A  E       
Sbjct  323   TGPAPTSGGGPRPALTNEHRIGHVVFATGGSSPATADVAKLAALL--AGAHLEEASAVAA  380

Query  1132  MEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGP  1311
                     AD  VYGANLTFV  E +++Y  ++ G++P    Y + GVGD GA +V    
Sbjct  381   AAFAGADDADVVVYGANLTFVEAEGLEVYELELAGRRPAHVEYAVDGVGDGGAAVVH---  437

Query  1312  ENLKGKEGGRIVNVILPEHLLGKLKNEISKEL  1407
              +  G+  GR V  +L     G+L+  I   L
Sbjct  438   RDAGGR--GRTVAAVLRRGEAGRLRAAIRDAL  467



>gb|KCW59963.1| hypothetical protein EUGRSUZ_H026881, partial [Eucalyptus grandis]
Length=293

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/292 (44%), Positives = 182/292 (62%), Gaps = 5/292 (2%)
 Frame = +1

Query  532   ITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKP  711
             +T FKCGG+S+G+SWAHVLGD FS SD  N  G +++G     PK P   +     +  P
Sbjct  1     VTRFKCGGMSLGLSWAHVLGDPFSASDCFNMLGRSLSGLLADGPKGPRALSGPRRLADPP  60

Query  712   RTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFE  891
                +  P S+  V PVGDHW +   C M T ++H++  QL  L  KV G     K  PFE
Sbjct  61    ELAR-EPASIKRVSPVGDHWVVDGNCNMGTFTFHLSPDQLAHLKSKVGGEGHGEKFPPFE  119

Query  892   AISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVL  1071
             ++ A+ W+ +AKV+ G+   TVT++KN    R NG+L   N   I +VKA+  V++AD  
Sbjct  120   SLCAILWQLIAKVRAGNEPSTVTLIKNDPSKRENGIL--SNSLKICSVKADFSVADADPG  177

Query  1072  ELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIF  1251
             E+  L+ ++A +E+ +I+E +E + G  AD+ VYGANL+FV  EEV +YG  + G +PIF
Sbjct  178   EILRLLIDRAENESNLIEEAVERDGG-VADYVVYGANLSFVEWEEVSMYGLQLNGNRPIF  236

Query  1252  ANYTIGGVGDEGAVLVLPGPENLKGKEG-GRIVNVILPEHLLGKLKNEISKE  1404
             A+Y I GV DEGAV VLPGP +     G GR+V VILPE+ L +LK+E+ K+
Sbjct  237   ASYVIEGVADEGAVFVLPGPPSSGKDSGQGRVVTVILPEYQLLQLKSELVKQ  288



>ref|XP_004972581.1| PREDICTED: rosmarinate synthase-like [Setaria italica]
Length=450

 Score =   235 bits (600),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 149/417 (36%), Positives = 220/417 (53%), Gaps = 39/417 (9%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEA--VDGLNTGDLKSPM  297
             V+ +RLS+VVP ++TGE     L +ADL  KLHYLR V++FR+ A     +   DLK PM
Sbjct  14    VHSYRLSTVVPGSVTGEAVDYELADADLLHKLHYLRAVHVFRAPAPGAAAVTVRDLKEPM  73

Query  298   FRMLEDFYPAAGRIRTSPED----------GRPFVKCNDSGVRIVEAKCSKTIDEWLDM-  444
             F  L+ ++P +GR+R    +          GRP+V+CND GVRIVEA C  T+DEWL+  
Sbjct  74    FPWLDMYFPVSGRLRRRQAEADGEKAEAAAGRPYVRCNDCGVRIVEAACDATVDEWLEAE  133

Query  445   SDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNK  624
             +++      L +D+V+GP+L FSPL+++Q+T FKCGG+++G +WAH++GD  S +   + 
Sbjct  134   AERGGLSKALAYDKVIGPELFFSPLLYVQVTSFKCGGMALGFTWAHLIGDIPSAAACFST  193

Query  625   YGPAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLF-----PFSLGSVGPVGDHWKLTNTC  789
             +    +G      K P  PT  +  +  P           P    +  PVGDHW +  T 
Sbjct  194   WAQLFSG------KKPPAPTLRDPLARPPSAAAPAGVTAPPSVKATAAPVGDHWAVPITR  247

Query  790   KMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK-----EGSGLET  954
              M   S+H+T++QL        GL+   +V  FE + AL W++LA ++     E +   T
Sbjct  248   DMVPFSFHVTEQQLE-------GLQLGRQVGTFELVVALMWRALAAIRGPDEEEATRTVT  300

Query  955   VTIVKNGFHSRGNGLLPCRNGQVISAVKA--EMRVSEADVLELANLIGEKAVDETGIIDE  1128
             V    N   +   G L   N   I  V A      + ADV +LA L+   A  +      
Sbjct  301   VVRTTNPVPATSGGRLGLTNEHRIGHVIAVGPSSPAAADVSKLAALL-AGARLKGVGAVA  359

Query  1129  TMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLV  1299
                    + AD  VYGANLTFV+ E + +YG ++   +P    Y + GVGD GA +V
Sbjct  360   AAALAGAEDADVVVYGANLTFVDAESLDVYGLELGAWRPAHVEYAVDGVGDGGAAVV  416



>ref|XP_002445215.1| hypothetical protein SORBIDRAFT_07g006100 [Sorghum bicolor]
 gb|EES14710.1| hypothetical protein SORBIDRAFT_07g006100 [Sorghum bicolor]
Length=474

 Score =   234 bits (597),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 147/420 (35%), Positives = 222/420 (53%), Gaps = 33/420 (8%)
 Frame = +1

Query  124   VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
             V+ HRLS+VVP+++TGE     L +ADL  KLHYLR V++FR+ A   +    LK PMF 
Sbjct  26    VHGHRLSTVVPSSVTGEEVNYELADADLLHKLHYLRAVHVFRAPAAFAMEA--LKEPMFP  83

Query  304   MLEDFYPAAGRIRTSPE-----------------DGRPFVKCNDSGVRIVEAKCSKTIDE  432
              L+ ++P +GR+R   +                   RP+V+CND GVR+VE  C  T+++
Sbjct  84    WLDMYFPVSGRLRRRRQAEDGDGDGKDDAAAAAVGRRPYVRCNDCGVRVVEVACDATVEQ  143

Query  433   WLDM-SDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLS  609
             WL+  +++      L +D+V+GP+L FSPL+++Q+T FKCGG+++G +WAHV+GD  S +
Sbjct  144   WLEAEAERGGLCKALAYDKVIGPELFFSPLLYVQVTSFKCGGMALGFTWAHVIGDIPSAA  203

Query  610   DFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTC  789
                +K+    +G++   P            +         P    +  PVGDHW +  T 
Sbjct  204   ACFSKWAQLFSGKKAPAPTLRDPLAMPPSAASPASVAAPPPSVKATAAPVGDHWAVPTTR  263

Query  790   KMATQSYHITDKQLNALIFKVS--GLKQSAKVKPFEAISALFWKSLAKVKEGSGLE----  951
              M   S+H+T++QL  L+   +  G +Q   V PFE +SAL W++LA ++   G E    
Sbjct  264   DMVPFSFHVTEQQLQGLLLSAAPEGHQQRHVVGPFELVSALIWRALAAIRGPGGEEEATR  323

Query  952   TVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEADV---LELANLIGEKAVDETGII  1122
             TVT+VK        GL    N   I  V A    S   V      A L G    + + + 
Sbjct  324   TVTVVKTEPTPTPAGLA---NEHRIGHVVATGGSSPGTVDVAKLAALLAGAHLEEASAVA  380

Query  1123  DETMEEENGKSADFFVYGANLTFVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLV  1299
                +    G+  D  VYGANLTFV+ E + +Y G ++ G++P    Y + GVGD GA +V
Sbjct  381   AAALAGAEGEDVDVVVYGANLTFVDAEGLAVYDGLELAGRRPAHVEYAVDGVGDGGAAVV  440



>gb|ACJ85714.1| unknown [Medicago truncatula]
 gb|AFK38674.1| unknown [Medicago truncatula]
Length=318

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 194/321 (60%), Gaps = 17/321 (5%)
 Frame = +1

Query  442   MSDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLN  621
             M D   Y  LL   QV+GP+L FSP V +Q+T FKCGG+S+G+SWAHV+GD  S SDF+N
Sbjct  1     MMDWHSY-KLLVSQQVIGPELSFSPSVLLQVTQFKCGGISLGLSWAHVMGDPHSASDFIN  59

Query  622   KYGPAMAG-RRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMA  798
              +G  +      LP   P   +   +  P+       P ++  V PVGDHW   N  KM 
Sbjct  60    LWGQTLNNLSLKLPFNIPRSVSTPLNFGPEKD-----PATVKRVDPVGDHWIPANNKKMD  114

Query  799   TQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGF  978
             T S+HIT   +N L  ++ G     +  PF ++ A+ W+ +A+V+EGS   TVT+ +   
Sbjct  115   TFSFHITSSLMNNLQEQIWG-PNVEQTPPFASLCAIIWRCIARVREGSEPTTVTVCRPDP  173

Query  979   HSRGNGLLPCRNGQVISAVKA--EMRVSEADVLELANLIGEKAVDETGIIDETMEEENGK  1152
             + RGN ++   N Q+I  V+A  E  + + D+  LA+++ ++ +DE   I + +E + G 
Sbjct  174   NGRGNDIM--GNDQLICKVEAGKECSIVDTDLKNLASMLVDQGIDERNQIKDIVENDQGV  231

Query  1153  SADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE  1332
             + DFFVYGANLTF++LE+V ++   +KGQKP F  YT+ GVGDEG VLVLP   +++GK 
Sbjct  232   T-DFFVYGANLTFLDLEDVNVHDLKLKGQKPRFVYYTLQGVGDEGVVLVLPKVNDIEGK-  289

Query  1333  GGRIVNVILPEHLLGKLKNEI  1395
                 V +ILPE  + KLK+E+
Sbjct  290   ---FVTIILPEDEMVKLKSEL  307



>ref|XP_002535495.1| transferase, putative [Ricinus communis]
 gb|EEF26888.1| transferase, putative [Ricinus communis]
Length=315

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 186/300 (62%), Gaps = 18/300 (6%)
 Frame = +1

Query  526   IQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP-----KHPHMPTAD  690
             +Q T FKCGG+S+G+SWAH+LGD FS S+ +N +G  ++G +   P     K P  P   
Sbjct  18    LQFTDFKCGGMSVGLSWAHILGDPFSASECINTWGLFLSGLKSNGPLQIMKKSPERPE--  75

Query  691   NHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQS  870
                  K    +    +L  V PVGD W   N CKM T S ++T  Q++ L+  + G    
Sbjct  76    -----KSENVRAAVLALKRVEPVGDLWVTANNCKMETFSGYLTAVQISHLLSNIWGQSSV  130

Query  871   AKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMR  1050
              +V  FE++ A  W+ +AKV++G     VT+ K       +G+L   NGQ+IS V+ +  
Sbjct  131   EEVPLFESLCATMWQCIAKVRDGHEPRRVTVCKKDPDYPESGIL--SNGQIISTVETDSP  188

Query  1051  VSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDM  1230
             V+++++ +LA L+G++A D+   I E +E++NG   D+ VYGANLTF+NLEE  IYG + 
Sbjct  189   VADSNLRKLAILLGDRATDKKKQIGEIVEKDNG-VLDYIVYGANLTFLNLEEANIYGLEW  247

Query  1231  KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GRIVNVILPEHLLGKLKNEISKE  1404
             KG KPIF +Y+I GVGDEGAV+VLP PE+  GK G  GR+V VILPE  + +LK+E+ ++
Sbjct  248   KGNKPIFVHYSIQGVGDEGAVIVLPWPED-DGKRGDTGRVVTVILPEKEMIELKSELKEK  306



>ref|XP_010109332.1| hypothetical protein L484_011074 [Morus notabilis]
 gb|EXC21909.1| hypothetical protein L484_011074 [Morus notabilis]
Length=300

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 184/302 (61%), Gaps = 24/302 (8%)
 Frame = +1

Query  523   FIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG-RRDLPPKHPHMPTADNHN  699
             ++Q+T FKC G+S+G+SWAHVLGDAFS +DF+NK+   +   +   PPK   +P  +   
Sbjct  4     YLQVTHFKCRGISLGLSWAHVLGDAFSAADFMNKWAQVVTEIQSSGPPKTTTLPLPN---  60

Query  700   SPKPR-------TQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSG  858
              PKP          K  P SL  V  VGDHW  TNT KM T S+ I+  Q+  L  K+ G
Sbjct  61    -PKPEDFEAPTLLTKDLPVSLNRVDQVGDHWITTNTTKMETFSFPISPSQIANLKVKIVG  119

Query  859   LKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVK  1038
                      FE++ A+ W+S+A +++ +  +TVTI K+    R  G+L   N Q+IS VK
Sbjct  120   -------PFFESLCAIIWQSIAILRQENEPKTVTICKHN-SKRTKGVL--SNSQIISTVK  169

Query  1039  AEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIY  1218
             A+  +  AD  +LA L+ ++A +ET  I E +E++ G S D  VYGANLTFV+ +E   Y
Sbjct  170   ADFSIIGADPKKLATLLADQATEETTQIVEAIEKDQGVS-DVIVYGANLTFVDWQEANFY  228

Query  1219  GFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENL-KGKEGGRIVNVILPEHLLGKLKNEI  1395
               +++G  P F +Y+I G+GD GAVLVLPG  +  KG E GR+V VILP++ + +LK+E+
Sbjct  229   ELELQGHNPDFVSYSIQGIGDNGAVLVLPGSNHFGKGWEKGRLVTVILPQNEVWELKSEL  288

Query  1396  SK  1401
              K
Sbjct  289   KK  290



>gb|EYU36447.1| hypothetical protein MIMGU_mgv1a0065642mg, partial [Erythranthe 
guttata]
Length=289

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 183/299 (61%), Gaps = 18/299 (6%)
 Frame = +1

Query  532   ITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKP  711
             +T FKCGG+ +G+ W H+LGDAFS ++ +N +G  MA ++  P      P    H  P  
Sbjct  1     LTRFKCGGVCVGMRWTHILGDAFSATECINTWGKIMANQKLPPHSLDSPPITPRHVGPMM  60

Query  712   RTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFE  891
              +   F  SL  +  +GD+W   N  KM T ++HIT KQLN+L+ +         + PFE
Sbjct  61    TSS--FCHSLKPLDSLGDNWLTPNNFKMQTHTFHITQKQLNSLLSEDRNKCNKITINPFE  118

Query  892   AISALFWKSLAKVKEGSGLETVTIVKNG-FHSR--GNGLLPCRNGQVISAVKAEMR--VS  1056
              ISA+ WKS+AK+KE    + +T+ K G F S    N  L     QVI  V+AE    ++
Sbjct  119   VISAIVWKSMAKIKE---TKIITVCKKGKFDSSILENKFLG-NTHQVIGTVEAENTSLIA  174

Query  1057  EADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG-ANLTFVNLEEVKIYGFDMK  1233
             ++D +E+A +IGE+ VDET +I++ MEE +G + D  VYG +NLTFV+LE V +YG +M 
Sbjct  175   DSDPIEIAKMIGEEFVDETSLIEKRMEEGDG-NVDVLVYGGSNLTFVDLEGVDLYGLEMN  233

Query  1234  GQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISKELG  1410
             GQ P+FA+ +IGGVGDEGAV+V+P        + GRIVNVILPE+ L  LK+ +  + G
Sbjct  234   GQGPVFADVSIGGVGDEGAVVVVP-----NAGQQGRIVNVILPENQLQLLKDALRSDWG  287



>gb|EYU36443.1| hypothetical protein MIMGU_mgv1a027079mg, partial [Erythranthe 
guttata]
Length=289

 Score =   216 bits (549),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 182/299 (61%), Gaps = 18/299 (6%)
 Frame = +1

Query  532   ITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKP  711
             +T FKCGG+ +G+ W H+LGDAFS ++ +N +G  MA ++  P      P    H  P  
Sbjct  1     LTRFKCGGVCVGMRWTHILGDAFSATECINTWGKIMANQKLPPHSLDSPPITPRHVGPMM  60

Query  712   RTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFE  891
              +   F  SL  +  +GD+W   N  KM T ++HIT KQLN+L+ +         + PFE
Sbjct  61    TSS--FCHSLKPLDSLGDNWLTPNNFKMQTHTFHITQKQLNSLLSEDRNKCNKITINPFE  118

Query  892   AISALFWKSLAKVKEGSGLETVTIVKNG-FHSR--GNGLLPCRNGQVISAVKAEMR--VS  1056
              ISA+ WKS+AK+KE    + +T+ K G F S    N  L     QVI  V+AE    ++
Sbjct  119   VISAIVWKSMAKIKE---TKIITVCKKGKFDSSILENKFLG-NTHQVIGTVEAENTSLIA  174

Query  1057  EADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG-ANLTFVNLEEVKIYGFDMK  1233
             ++D +E+A +IGE+ VDET +I++ MEE +G + D  VYG +NLTFV+LE V +YG +M 
Sbjct  175   DSDPIEIAKMIGEEFVDETSLIEKRMEEGDG-NVDVLVYGGSNLTFVDLEGVDLYGLEMN  233

Query  1234  GQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISKELG  1410
             GQ P+FA+ +IGGVGDEGAV+V+P        + GRIVNVILPE+ L  LK  +  + G
Sbjct  234   GQGPVFADVSIGGVGDEGAVVVVP-----NAGQQGRIVNVILPENQLHLLKEALRSDWG  287



>gb|KDO81199.1| hypothetical protein CISIN_1g023125mg [Citrus sinensis]
Length=287

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/298 (42%), Positives = 176/298 (59%), Gaps = 30/298 (10%)
 Frame = +1

Query  556   LSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHM----------PTADNHNSP  705
             +S+G+SWAHVLGD FS S F++ +   MAGR  +PPK  H            T     + 
Sbjct  1     MSLGLSWAHVLGDPFSASAFVSMWAQIMAGR--VPPKSLHEPEPEPEPEKSETETQTRAS  58

Query  706   KPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI--FKVSGLKQSAKV  879
             +     L+P  +  V PVGDHW+  N C + T ++  T KQL+ +    +  G++++A V
Sbjct  59    ESVAGNLYP--IKRVDPVGDHWQFPNNCNIKTHTFQFTKKQLDQMASNLRYRGIREAAAV  116

Query  880   KPFEAISALFWKSLAKVKEGSGLETVTIVK-NGFHSRGNGLLPCRNGQVISAVKAEMRVS  1056
               FE ISA  WK LAK  E SG   VTI + NG   R N      N  V+S  + +  VS
Sbjct  117   SHFEVISATIWKLLAKASEDSGPGVVTICRYNG--QRENE--TASNDMVLSTAEVDFDVS  172

Query  1057  EADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKG  1236
             ++DV EL+ LI +K  D    +DE +  E   S+DF +YGANLTFV++EE  +YG  ++G
Sbjct  173   KSDVWELSTLIADKRKD----VDEKVLSE---SSDFIMYGANLTFVDMEEADVYGLKLQG  225

Query  1237  QKPIFANYTIGGVGDEGAVLVLPGPE--NLKGKEGGRIVNVILPEHLLGKLKNEISKE  1404
             QKP+  NY+I GVG++G VLVL GPE  + +G++ G  V V+LPE+ L KL NE+++E
Sbjct  226   QKPVDVNYSINGVGEQGVVLVLAGPEEDSGRGRDRGSTVTVVLPENQLEKLMNELNQE  283



>ref|XP_004173061.1| PREDICTED: anthranilate N-benzoyltransferase protein 3-like [Cucumis 
sativus]
Length=296

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 178/297 (60%), Gaps = 12/297 (4%)
 Frame = +1

Query  529   QITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPK  708
             Q+T FKCGGLS+G+SW HVLGD FS S F+N +G  M  R    P H   P    H  P 
Sbjct  7     QLTRFKCGGLSVGLSWTHVLGDIFSASTFINVWGHIMNNR----PLHQLRPAPATH-IPT  61

Query  709   PRTQKLFPFS-LGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKP  885
              R+ +L     L  + P GD W  +  CKMAT+S+ IT  QL+  I  V G  +S     
Sbjct  62    SRSSRLISTPPLKRLDPTGDLWIGSTDCKMATRSFRITSAQLDR-ITSVVGRNRSMNFST  120

Query  886   FEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEA  1062
             FE+I+A+FW SL+K++ E S   T++I      +R + +    NG  +S V+A+  V+ A
Sbjct  121   FESITAVFWNSLSKIRLEDSDSRTISIYSTKCPNRESEI--PSNGMEMSGVEADFPVAGA  178

Query  1063  DVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQK  1242
                ELA +I +K +DE G ++E +E +   S DF  YGA LTFV+LEE  +YGF+++GQK
Sbjct  179   AEGELAEVIVKKRIDEGGEVEELVETKMDDS-DFIAYGARLTFVDLEEADVYGFELEGQK  237

Query  1243  PIFANYTIGGVGDEGAVLVLPGPENLKGKE-GGRIVNVILPEHLLGKLKNEISKELG  1410
              +  NY IGGVG+ G V+VLPGP    G++ GGR V VILPE  +  L +E+ K+ G
Sbjct  238   AVHVNYEIGGVGENGVVMVLPGPPRSDGRDGGGRTVTVILPEKEVPDLIDEMEKQWG  294



>ref|XP_010914412.1| PREDICTED: protein ECERIFERUM 26-like, partial [Elaeis guineensis]
Length=297

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/303 (39%), Positives = 177/303 (58%), Gaps = 13/303 (4%)
 Frame = +1

Query  517   LVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG-RRDLPPKHPHMPTADN  693
             L F Q T FKCGG++IG SW+HVLGDA + ++F+N +   ++G      P H H    + 
Sbjct  5     LFFFQFTRFKCGGMAIGFSWSHVLGDAITATNFINLWAQLLSGGSPKCQPIHNHKIKTEK  64

Query  694   HNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSA  873
                  P + +L   S+  V  VGD W   N  KMAT S+ IT+ ++  +       K+S+
Sbjct  65    TLIKSPTSLELL--SVKQVELVGDPWLSLNNSKMATYSFQITEAKIKQI-----QAKESS  117

Query  874   KVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMRV  1053
             +V  FE ISAL W+ LAK+++      VTI KN    + + LL   N Q I  V ++   
Sbjct  118   QVSSFEIISALIWQCLAKIRKDKEPTLVTICKNDPSVKRSWLL--SNEQKIGTVVSDFFP  175

Query  1054  SEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMK  1233
             S+  V ELA++I ++ V ET +I++ +E E+G + DF +YGANLTF+++E V +Y  ++K
Sbjct  176   SKVAVSELASIIAKQQVIETKMIEDLVEGESG-TPDFIIYGANLTFIDMEGVPLYELELK  234

Query  1234  GQKPIFANYTIGGVGDEGAVLVLPGPENLKGK--EGGRIVNVILPEHLLGKLKNEISKEL  1407
              QKPI  +++I GVGDEGAVLVL  P+   G    GG++V +ILPE  +  L+  +    
Sbjct  235   DQKPIHVDFSIDGVGDEGAVLVLQCPQKTYGSGGSGGKMVMLILPEDQISPLREALESAW  294

Query  1408  GTS  1416
             G +
Sbjct  295   GIA  297



>gb|KHN08277.1| hypothetical protein glysoja_017755 [Glycine soja]
Length=287

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 152/272 (56%), Gaps = 26/272 (10%)
 Frame = +1

Query  526   IQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSP  705
              Q TWFKCGGLS+G+SWAHVLGDAFS  +F++K+   ++G+   PPK  H P     N P
Sbjct  5     FQFTWFKCGGLSVGLSWAHVLGDAFSAFNFISKWSQILSGQA--PPKSLHTP-----NLP  57

Query  706   KPRTQKLFP--------FSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIF----K  849
             +P+T    P         S+     VG++W  TN   +AT S+HIT K+L+ L+     +
Sbjct  58    QPKTS---PNSIVENPLISIKKTNIVGEYWLATNDNDVATYSFHITSKKLHHLVTTTFNQ  114

Query  850   VSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLLPCRNGQVI  1026
              +     AK   FE ISAL WK +A ++ +  G   VTI  +   +R     P     V+
Sbjct  115   TNDNTNEAKTTYFEIISALLWKCIANIRGQHFGPNVVTICTSE-SNRAENEFPTNGFLVL  173

Query  1027  SAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEE  1206
             S V+A+    + ++ EL  LI E  + E  +++E +E + G+  DF  YG NLTFVNLEE
Sbjct  174   SKVEADFSTGKFEISELVKLIAENKMVENHVMEELVEGDEGRE-DFIAYGLNLTFVNLEE  232

Query  1207  VKIY-GFDMKGQKPIFANYTIGGVGDEGAVLV  1299
               IY G  +  QKPI AN T  GV D+G VLV
Sbjct  233   ANIYDGVKLNEQKPIMANCTFRGVSDQGVVLV  264



>gb|KEH20651.1| anthranilate N-benzoyltransferase-like protein, putative [Medicago 
truncatula]
Length=271

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 159/273 (58%), Gaps = 16/273 (6%)
 Frame = +1

Query  586   LGDAFSLSDFLNKYGPAMAGRR-DLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVG  762
             +GD  S SDF+N +G  +      LP   P   +   +  P+       P ++  V PVG
Sbjct  1     MGDPHSASDFINLWGQTLNNLSLKLPFNIPRSVSTPLNFGPEKD-----PATVKRVDPVG  55

Query  763   DHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGS  942
             DHW   N  KM T S+HIT   +N L  ++ G     +  PF ++ A+ W+ +A+V+EGS
Sbjct  56    DHWIPANNKKMDTFSFHITSSLMNNLQEQIWG-PNVEQTPPFASLCAIIWRCIARVREGS  114

Query  943   GLETVTIVKNGFHSRGNGLLPCRNGQVISAVKA--EMRVSEADVLELANLIGEKAVDETG  1116
                TVT+ +   + RGN ++   N Q+I  V+A  E  + + D+  LA+++ ++ +DE  
Sbjct  115   EPTTVTVCRPDPNGRGNDIM--GNDQLICKVEAGKECSIVDTDLKNLASMLVDQGIDERN  172

Query  1117  IIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVL  1296
              I + +E + G + DFFVYGANLTF++LE+V ++   +KGQKP F  YT+ GVGDEG VL
Sbjct  173   QIKDIVENDQGVT-DFFVYGANLTFLDLEDVNVHDLKLKGQKPRFVYYTLQGVGDEGVVL  231

Query  1297  VLPGPENLKGKEGGRIVNVILPEHLLGKLKNEI  1395
             VLP   +++GK     V +ILPE  + KLK+E+
Sbjct  232   VLPKVNDIEGK----FVTIILPEDEMVKLKSEL  260



>ref|XP_011069444.1| PREDICTED: protein ECERIFERUM 26-like, partial [Sesamum indicum]
Length=248

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 99/226 (44%), Positives = 139/226 (62%), Gaps = 10/226 (4%)
 Frame = +1

Query  730   PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALF  909
             P S+  VGPVGDHW     CKM   S+++T  QL+ L  K+S      +   FEA+SA+ 
Sbjct  28    PLSIKRVGPVGDHWVNVTKCKMEAFSFNVTPTQLSHLQSKLS--PNGTQFGAFEALSAVI  85

Query  910   WKSLAKVKEGSGLETVTIVKNGFHSRG-NGLLPCRNGQVISAVKAEMRVSEADVLELANL  1086
             W+ +AK++E      VTI K    S+  +G L   N QV+S V A  ++ +++  ELA L
Sbjct  86    WQCIAKIREWDS-NVVTICKGSEESKTCDGTL--SNSQVVSVVNANFQILDSNPSELALL  142

Query  1087  IGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTI  1266
             +   A+DE   I+E ME + G   DF VYGA LTFVNLE+ + Y F+ +GQ+P+  +Y I
Sbjct  143   VQNGALDEREKIEEAMERDGGL-PDFIVYGAKLTFVNLEDARFYAFEYRGQRPVNISYRI  201

Query  1267  GGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISKE  1404
              GVG+EG +LVLPGP   KG +GGR V  ILPE+ + +LK E+ +E
Sbjct  202   EGVGEEGTILVLPGP---KGDDGGRSVMAILPENEIEELKLELKRE  244



>gb|EYU36448.1| hypothetical protein MIMGU_mgv1a0065641mg, partial [Erythranthe 
guttata]
Length=150

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 103/143 (72%), Gaps = 2/143 (1%)
 Frame = +1

Query  109  DVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLK  288
            + +N++ D +LS+VVPA+IT E ++ +LT ADLAMKLH++  V+ F  +A +GL+  D K
Sbjct  8    NADNLICDIKLSTVVPASITPEDKIHHLTGADLAMKLHHITTVHFFGGDAAEGLSIEDFK  67

Query  289  SPMFRMLEDFYPAAGRIRTSPED-GRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYD  465
              MF+ L+ +YP +GRIR    D GRPFVKCNDSGVRIVEAKC+KT+ EWL   D  +Y 
Sbjct  68   RAMFQWLQLYYPISGRIRRHDGDGGRPFVKCNDSGVRIVEAKCAKTVAEWLASVDGGDYH  127

Query  466  -HLLHHDQVLGPDLGFSPLVFIQ  531
              L++H  +L  D GF+PLVF+Q
Sbjct  128  RRLVYHQPLLDRDFGFTPLVFLQ  150



>gb|KDO50656.1| hypothetical protein CISIN_1g030487mg [Citrus sinensis]
Length=176

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  121  IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF  300
            +++  RLSSV P   TG   V  L+  DLAMKLHYL+G Y+FRS AV GL+   +K   F
Sbjct  6    LIHSIRLSSVGPGKATGSDVVHELSGMDLAMKLHYLKGFYIFRSHAVQGLSIKLIKESTF  65

Query  301  RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
             +  ++Y   GR+R S + GRP++KCND G R VEA+C KT+DE L+M D S + +LL +
Sbjct  66   YLFNNYYWTCGRLRRS-DSGRPYLKCNDCGARFVEAQCDKTVDELLEMGDYSSFPNLLVY  124

Query  481  DQVLGPDLGFSPLVFIQI  534
             Q +GPDL FSP +++Q+
Sbjct  125  HQPIGPDLAFSPPIYLQV  142



>emb|CDY64789.1| BnaCnng44950D [Brassica napus]
Length=281

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 153/293 (52%), Gaps = 21/293 (7%)
 Frame = +1

Query  532   ITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKP  711
             +T FKC GL+ G+SWA+++GD+FSL    N +   ++G +   P+   +       +P P
Sbjct  1     MTRFKCRGLAFGLSWANIMGDSFSLFYAFNLWVKVLSGEKIYAPETSIIDR--RFQNPNP  58

Query  712   RTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFE  891
               +   P S+  V PVGD W   +  KM +  +++T     +  F  +G  Q   +  FE
Sbjct  59    TVKD--PESIKQVDPVGDLWITPSNKKMVSYCFNLTVTDQMSPHFPANGDDQ---IPVFE  113

Query  892   AISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCR---NGQVISAVKAEMRVSEA  1062
              ++ + WK++AKV+E     TVTI++       N L P R   N Q+IS+V  +  V+EA
Sbjct  114   ILAGIIWKNIAKVREDPEPLTVTIIRKD----PNDLKPIRSIRNSQMISSVHVDSPVAEA  169

Query  1063  DVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQK  1242
              V EL   I E+A DE   IDE     +G S DF VYGA L F++L EV +Y   + G+ 
Sbjct  170   TVEELVRCI-ERATDERCGIDEIGGSCDG-SLDFIVYGAKLAFMDLSEVDLYEAKVMGKS  227

Query  1243  PIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISK  1401
             P      + G+G+EG V+V         K   R+V + LPE  + ++K+E  K
Sbjct  228   PESVYCNVEGIGEEGLVVVYAA-----AKSEERVVTMTLPEEEMERVKSEFKK  275



>tpg|DAA36074.1| TPA: glossy2 [Zea mays]
Length=160

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 100/146 (68%), Gaps = 9/146 (6%)
 Frame = +1

Query  124  VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
            V+ HRLS+VVP+++TGE     L +ADLA KLHYLRGVY +RS   DGL T  LK PMF 
Sbjct  16   VHGHRLSTVVPSSVTGEVD-YALADADLAFKLHYLRGVYYYRSG--DGLATKVLKDPMFP  72

Query  304  MLEDFYPAAGRIRTSPEDG-----RPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDH  468
             L+D +P AGR+R +  +G     RP++KCND GVRIVEA+C + + EW+  +       
Sbjct  73   WLDDHFPVAGRVRRAEAEGDGAPRRPYIKCNDCGVRIVEARCDRDMAEWIRDAAPGRIRQ  132

Query  469  LLHHDQVLGPDLGFSPLVFIQITWFK  546
            L  +D+VLGP+L FSPL+++Q+T  +
Sbjct  133  LC-YDKVLGPELFFSPLLYVQVTVLR  157



>gb|KDO36781.1| hypothetical protein CISIN_1g037425mg, partial [Citrus sinensis]
Length=141

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = +1

Query  121  IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMF  300
            +++  RLSSV P   TG   V  L+  DLAMKLHYL+G Y+FRS AV GL+   +K   F
Sbjct  6    LIHSIRLSSVGPGKATGSDVVHELSGMDLAMKLHYLKGFYIFRSHAVQGLSVKLIKESTF  65

Query  301  RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHH  480
             +  ++Y    R+R S + GRP++KCND G R VEA+C KT+DE L+M D S + +LL +
Sbjct  66   YLFNNYYWTCARLRRS-DSGRPYLKCNDCGARFVEAQCDKTVDELLEMGDYSSFPNLLVY  124

Query  481  DQVLGPDLGFSPLVFIQ  531
             Q +GPDL FSP +++Q
Sbjct  125  HQPIGPDLAFSPPIYLQ  141



>ref|XP_004517298.1| PREDICTED: uncharacterized protein LOC101493204 [Cicer arietinum]
Length=211

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 125/204 (61%), Gaps = 7/204 (3%)
 Frame = +1

Query  793   MATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKN  972
             M T S+HIT   +N L  ++ G     +  PFE++ A+ W+ +A+V+EGS   TVT+ + 
Sbjct  1     MDTLSFHITSSHMNNLQTQIWG-PSVEQTPPFESLCAIIWRCIARVREGSEPTTVTVCRT  59

Query  973   GFHSRGNGLLPCRNGQVISAV--KAEMRVSEADVLELANLIGEKAVDETGIIDETMEEEN  1146
                S  N +    N Q+I  V  K+E  + + ++  LA+++  + VDE   I+E +E++ 
Sbjct  60    DPLSSSNDIF--GNDQLICKVEAKSECSIIDTNLRVLASMLVNQGVDERDQINEMVEKDQ  117

Query  1147  GKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN-LK  1323
             G   D+FVYGANLTF++LE++ +Y   +KG KP F  YT+ GVGDEG +LVLP  ++ + 
Sbjct  118   G-VIDYFVYGANLTFLDLEDINLYDLKLKGHKPKFVYYTLQGVGDEGVILVLPWSKDPIM  176

Query  1324  GKEGGRIVNVILPEHLLGKLKNEI  1395
                 G+ V +I+PE  + KLK+E+
Sbjct  177   NGIDGKFVTIIMPEDEMVKLKSEL  200



>emb|CAE05194.3| OSJNBa0070C17.1 [Oryza sativa Japonica Group]
Length=172

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 97/145 (67%), Gaps = 10/145 (7%)
 Frame = +1

Query  124  VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS-EAVDGLNTGDLKSPMF  300
            V+ HRLS+VVP+++TGE    +L +ADLA KLHYLRG Y + + +AV G+    LK PMF
Sbjct  14   VHGHRLSTVVPSSVTGEAN-YDLADADLAYKLHYLRGAYYYPAGDAVRGITIKSLKDPMF  72

Query  301  RMLEDFYPAAGRIRTSP-------EDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSE  459
              L+ ++P AGRIR +           RP++KCND GVRIVEA+C + +D+WL       
Sbjct  73   PWLDAYFPVAGRIRRAEGDDADAAAARRPYIKCNDCGVRIVEARCDRALDDWLRDESPDR  132

Query  460  YDHLLHHDQVLGPDLGFSPLVFIQI  534
              HL  +D+VLGP+L FSPL++IQ+
Sbjct  133  LRHLC-YDKVLGPELFFSPLLYIQV  156



>ref|XP_003629600.1| hypothetical protein MTR_8g081480 [Medicago truncatula]
 gb|AET04076.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=147

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 87/140 (62%), Gaps = 2/140 (1%)
 Frame = +1

Query  115  ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
            E++VYD R+SSV P   TG          DL MKLHYL+ VY F SEA  GL    +K  
Sbjct  9    ESLVYDLRVSSVGPGHATGSDVFHYPNGLDLTMKLHYLKVVYFFDSEAAQGLTIKKIKES  68

Query  295  MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
            +F +L+ ++   GR R S E GRPF+KCND G R +EA C+KT+DEWL M D   Y  LL
Sbjct  69   LFNLLDYYFIPCGRFRRS-ESGRPFIKCNDCGARTIEANCTKTLDEWLAMMDWHSYK-LL  126

Query  475  HHDQVLGPDLGFSPLVFIQI  534
               QV+GP+L FSP V +Q+
Sbjct  127  VSQQVIGPELSFSPSVLLQV  146



>gb|KCW59962.1| hypothetical protein EUGRSUZ_H026882, partial [Eucalyptus grandis]
Length=144

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 83/139 (60%), Gaps = 1/139 (1%)
 Frame = +1

Query  115  ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
            E +VY  +LSSV PA +TG   V     ADLAMKLHYLRGVY F   AV+GL    +K  
Sbjct  7    EKLVYGLKLSSVGPARVTGADAVHEPAAADLAMKLHYLRGVYFFAGPAVEGLTVPRIKES  66

Query  295  MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
            MF    D+Y   GR R S + GRP++KCND GVR VEA+C  T+DEWL+          L
Sbjct  67   MFSWCTDYYAVCGRFRRS-DSGRPYIKCNDCGVRFVEAECDSTVDEWLEADGHGSLLGPL  125

Query  475  HHDQVLGPDLGFSPLVFIQ  531
               QV+GP+  FSP   +Q
Sbjct  126  VSHQVVGPEPFFSPTCLVQ  144



>ref|XP_006829665.1| hypothetical protein AMTR_s00122p00127100 [Amborella trichopoda]
 gb|ERM97081.1| hypothetical protein AMTR_s00122p00127100 [Amborella trichopoda]
Length=461

 Score =   140 bits (354),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 132/473 (28%), Positives = 214/473 (45%), Gaps = 71/473 (15%)
 Frame = +1

Query  109   DVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR----SEAVDGLNT  276
             D+ +++      ++V A +T  G++  L+  D  M+LH +R VY +R     EA+  +N 
Sbjct  3     DLASLISICSKRTIVSAYVTPPGKIFLLSPLDRIMELHNIRAVYYYRFGGEDEALVLVN-  61

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
               LK  +  +L  F    GR+    E G  +VK  D+GVR+VE + + TIDEWL + ++ 
Sbjct  62    -KLKESLSMLLSSFPVMTGRL-VRGETGSWWVKLIDTGVRLVEGRVNMTIDEWLTVVNRD  119

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
                 L H +  +  D+ F    ++Q+T F+ GGL++G S +H+L DA   + F+ K+   
Sbjct  120   AELKLAHWED-MRVDMYFWSTFYVQLTVFEGGGLALGFSCSHLLSDAICAAQFVKKWAET  178

Query  637   MAGRRDL-PPKH---------------------PHMPTADNHNSPKPRTQKLFPFSLGSV  750
                +  + PP H                      H  +A   ++ + R+Q       G  
Sbjct  179   HLKQISIYPPTHLSLTPITGAVSSSFLNDSPCVKHYESAAKAHTEQGRSQ-------GLR  231

Query  751   GPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVS-GLKQSAKVKPFEAISALFWKSLAK  927
              P+  H         +T ++H +++ +   I     G     +  PFEA++ALFW + ++
Sbjct  232   DPIAAH---------STVTFHFSNEMVQKCIRDAQWGSLNGLQPTPFEALTALFWVACSR  282

Query  928   VKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISA-------VKAEMRVSEADVL-----  1071
             VK    L  +++  N   + G G     N  V +        +K EM+  E   L     
Sbjct  283   VKGQETLVDLSLCLNMRSTLGLGDEFFGNAMVFTIMDPHNMNIKKEMKEGELGYLTRILQ  342

Query  1072  ELANLIG-EKAVDETGIIDETMEEENGKSA--DFFVYGANLTFVNLEEVKIYGFDM-KGQ  1239
             E  N IG E+A+     ++   E E GK     F VYG  L   NLEE+ +Y      G 
Sbjct  343   EAVNKIGEEEAMHLLRWVESKREGEGGKKQYEPFPVYGPGLVCANLEELPLYEVVFGNGL  402

Query  1240  KPIFANYTIGGVGDEGAVLVLPGPENLKGKEGG--RIVNVILPEHLLGKLKNE  1392
             +P+  +  +  V  EG +L+LP P      EGG  R V+V LP+    KL  E
Sbjct  403   EPVRVSLYVEPVAGEGEILILPSP------EGGLARNVSVTLPKDQALKLSKE  449



>gb|EMS59951.1| hypothetical protein TRIUR3_02819 [Triticum urartu]
Length=209

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 102/168 (61%), Gaps = 14/168 (8%)
 Frame = +1

Query  97   MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
            M S      V+ H+LS+VVP+++T  G    L  ADLA +LHYLRGVY + +    G+ T
Sbjct  1    MGSEAAAAAVHGHQLSTVVPSSVTEVGS-YELAEADLAFRLHYLRGVYYYSA----GVTT  55

Query  277  GDLKSPMFRMLEDFYPAAGRIRTSPEDG----RPFVKCNDSGVRIVEAKCSKTIDEWLDM  444
              LK PMF  L+ +YP AGR+R   ++     RP+VKCND G+R+VEA+C + +D+ L  
Sbjct  56   MVLKEPMFAWLDAYYPLAGRVRRPADEADASRRPYVKCNDCGIRVVEAQCDRALDDLLRD  115

Query  445  SDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSI-GISWAHV  585
                    L +HD VLGP+L FSPL+F+Q+  +   GL I G   AHV
Sbjct  116  DAVDRVKQLCYHD-VLGPELSFSPLLFVQVDLY---GLEIKGQRPAHV  159


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 7/78 (9%)
 Frame = +1

Query  1168  VYGANLTFVNL--EEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGR  1341
             V G  L+F  L   +V +YG ++KGQ+P    Y + GVG EGAVLV P    L     GR
Sbjct  129   VLGPELSFSPLLFVQVDLYGLEIKGQRPAHVEYGMDGVGQEGAVLVQPDASGL-----GR  183

Query  1342  IVNVILPEHLLGKLKNEI  1395
             +V V+LP   +  L+ E+
Sbjct  184   VVMVVLPNDDVQALRAEL  201



>emb|CDY05591.1| BnaC02g39460D [Brassica napus]
Length=436

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 125/437 (29%), Positives = 200/437 (46%), Gaps = 39/437 (9%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             +N V    + + + +  +  G+V   T  D AM  H +  ++ +        +   ++ P
Sbjct  6     QNRVEVKSMLTAISSKPSRSGQVHTFTALDNAMSPHTVHVIFYYPRSPFGSFDLDSVRIP  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +  +L  + PA GR+  +PE G   VKCND+G+RI++AK S  IDEWL  +D  E  +L 
Sbjct  66    LSELLSMYPPAIGRVTKNPE-GILEVKCNDAGLRILKAKVSVGIDEWLRSADGHEESNLT  124

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               + +      +SP   +QI  F+ GG++IG+S  H+  DA +L+  L  +    A RR 
Sbjct  125   AWEDMPEDPSTWSPFR-LQINEFEGGGVAIGLSCPHMHADATTLTVLLKSW--TEAQRRQ  181

Query  655   L---PPKHPHMP--TADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHIT  819
                 PP    +P    D       R      FS    GPV        + K AT ++  +
Sbjct  182   CITHPPSFSPLPYNLTDTDAVKSDRDS----FSKPIAGPV--------STKTATATFRFS  229

Query  820   DKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGL  999
                    + + S  + S K  PF+  +ALFW  +A VK+ S  + V +  +      N L
Sbjct  230   GSAFTRCVKEHSIHEISPKATPFDVFAALFWTRVALVKDNS--DRVCVCVDFRRLLPNPL  287

Query  1000  LPCRNGQVISAVKAEM-RVSEADVLELANLIGEKAVDETGIIDETMEEENGKS-ADFFVY  1173
                  G  ++    EM  V   +V  +A+LI +      G+  E +     ++ +   +Y
Sbjct  288   PYGFFGNALNFSSLEMANVVNMEVRHVASLINKHVA---GLNVEKIRSGLKRAGSQRKMY  344

Query  1174  GANLTFVNLEEVKIYGFDM-------KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE  1332
             G +LT VN+E + + G  +       +G KP+  +Y IG  G EG + V+P PE    K 
Sbjct  345   GTDLTIVNMEHMIVDGEPLMYETVFEEGVKPMHVSYRIGNNGGEGVITVIPSPE----KG  400

Query  1333  GGRIVNVILPEHLLGKL  1383
              GR V V LPE  + KL
Sbjct  401   FGRTVAVTLPEAEMSKL  417



>ref|XP_010455172.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=431

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 119/435 (27%), Positives = 199/435 (46%), Gaps = 40/435 (9%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN V    + + V +  +  GRV   T  D AM  H L  +  +        +   ++  
Sbjct  6     ENRVEVKSMLTAVSSKPSRSGRVHPFTTLDNAMSRHTLHVIVYYPRSPFGSFDLDSVRIS  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +  +L  + P  GR+  +P DG   VKCND+G+R ++AK    IDEWL  +D  +   L 
Sbjct  66    LSELLSMYPPVVGRVAKTP-DGILEVKCNDAGLRTLKAKVCVGIDEWLRSADGHDESDLT  124

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               + +      ++P   +QI  F+ GG++IG+S  H   DA +L+  L  +  A   RR 
Sbjct  125   AWEDMPEDPSTWAPF-RLQINEFEGGGVAIGLSCPHRQADATTLTVLLKSWTEAQR-RRC  182

Query  655   L--PPKHPHMPT--ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
             L  PP    +P+   D+ ++ KP +  +         P+        + K AT ++  + 
Sbjct  183   LVHPPSFSPLPSILTDDTDAVKPNSASI-------SEPI--------STKTATATFRFSS  227

Query  823   KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLL  1002
                   + +  G+    K  P +  +ALFW  +A VK  S  + V +  +      N L 
Sbjct  228   SAFKKYV-EEEGI--FPKASPLDVFAALFWTRVALVKRKSH-DRVCMCVDFRRLLPNPLP  283

Query  1003  PCRNGQVISAVKAEM-RVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGA  1179
                 G  ++    EM  V++  ++ +A LI +   + T  +++   + N       +YG 
Sbjct  284   YGFFGNALNFSSLEMTNVADQGIVHVARLINDHVTNLT--VEKIRSDLNRVGEQELMYGR  341

Query  1180  NLTFVNLEEVKIYGFDM-------KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGG  1338
             +LT VN+E + + G  M        G +P+  +Y IG VG EG ++V+P PE    K  G
Sbjct  342   DLTIVNMEHMIVEGDPMMYDAVFEDGVRPVHVSYRIGNVGGEGVIMVMPSPE----KGFG  397

Query  1339  RIVNVILPEHLLGKL  1383
             R+V+V LPE  + KL
Sbjct  398   RVVSVTLPEEEMSKL  412



>ref|XP_010494090.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=431

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 121/435 (28%), Positives = 198/435 (46%), Gaps = 40/435 (9%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN V    + + V +  +   RV   T  D AM  H L  +  +        +   ++  
Sbjct  6     ENRVEVKSMLTAVSSKPSRSARVHPFTALDNAMSPHTLHVIVYYPRSPFGSFDLDSVRIS  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSD-QSEYDHL  471
             +  +L  + P  GR+  +P DG   VKCND+G+R ++AK    IDEWL  +D   E D  
Sbjct  66    LSELLSMYPPVVGRVAKTP-DGILEVKCNDAGLRTLKAKVCVGIDEWLRSADGHDESDLT  124

Query  472   LHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRR  651
                D    P   ++P   +QI  F+ GG++IG+S  H   DA +L+  L  +  A   R 
Sbjct  125   AWGDMPEDPST-WAPF-RLQINEFQGGGVAIGLSCPHRQADATTLTVLLKSWTEAQRRRC  182

Query  652   DL-PPKHPHMPT--ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
              + PP    +P+   D+ ++ KP +  +         P+        + K AT ++  + 
Sbjct  183   IVHPPSFSPLPSILTDDTDAVKPNSATI-------SKPI--------STKTATATFRFSS  227

Query  823   KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLL  1002
                   I +  G+    K  PF+  +ALFW  +A VK  S  + V +  +      N L 
Sbjct  228   SSFKKYI-EEDGI--FPKASPFDVFAALFWTRVALVKRKSH-DRVCMCVDFRRLLPNPLP  283

Query  1003  PCRNGQVISAVKAEM-RVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGA  1179
                 G  ++    EM  V++  ++ +A LI +   + T  +++   + N       +YG 
Sbjct  284   YGFFGNALNFSSLEMTNVADQGIVHVARLINDHVTNLT--VEKIRSDLNRVGEQELMYGG  341

Query  1180  NLTFVNLEEVKIYGFDM-------KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGG  1338
             +LT VN+E + + G  M        G +P+  +Y IG VG EG ++V+P PE    K  G
Sbjct  342   DLTIVNMEHMIVEGDPMMYEAVFEDGVRPVHVSYRIGNVGGEGVIMVMPSPE----KGFG  397

Query  1339  RIVNVILPEHLLGKL  1383
             R+V+V LPE  + KL
Sbjct  398   RVVSVTLPEEEVSKL  412



>ref|XP_006286502.1| hypothetical protein CARUB_v10001016mg [Capsella rubella]
 gb|EOA19400.1| hypothetical protein CARUB_v10001016mg [Capsella rubella]
Length=429

 Score =   132 bits (331),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 121/434 (28%), Positives = 187/434 (43%), Gaps = 40/434 (9%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN V    + + V +      RV   T  D AM  H L  +  +        +   +++ 
Sbjct  6     ENRVEVKSMLTAVSSKPCRSDRVHPFTALDNAMSPHTLHVIVYYSRSPFGSFDLDSVRTS  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +  +L  + P  GR+  +P DG   VKCND+G+R + AK S  +DEWL  +D  E   L 
Sbjct  66    LSELLSLYPPVVGRVAKTP-DGILEVKCNDAGLRTLRAKVSVGVDEWLRSADGLEEGDLT  124

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               D +      ++P   +QI  F+ GG++IG+S  H   DA +L+  L  +  A   +  
Sbjct  125   AWDDMPDDPSTWAPF-RLQINEFEGGGVAIGLSCPHRQADATTLTVLLKSWTEAQRHQSI  183

Query  655   L-PPKHPHMPTADNHNSP-KPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
             + PP    +P+      P KP ++           P+        T    + S     K 
Sbjct  184   IHPPSFSPLPSILTDTKPVKPNSE-----------PISKPISTKTTTATFSFSTSAFKKC  232

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC  1008
             L   IF         K  PF+  +ALFW  +A  K  S       V   F       LP 
Sbjct  233   LQDGIF--------PKASPFDVFAALFWTRVALTKRKSHDRVCMCVD--FRRLLPDPLPY  282

Query  1009  -RNGQVISAVKAEM-RVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
                G  +S    EM  V++ ++  +A LI +     T  +++   E N       +YG +
Sbjct  283   GFFGNALSFTSLEMCNVADQEIRHVARLINDHVASLT--VEKIRSELNRVGEQGLMYGGD  340

Query  1183  LTFVNLEEVKIYGFDM-------KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGR  1341
             LT VN+E + + G  +        G +P+  +Y IG VG EG ++V+P PE    K  GR
Sbjct  341   LTIVNMEHMIVEGEPLMYEAVFENGVRPVHVSYRIGKVGGEGVIMVMPSPE----KGFGR  396

Query  1342  IVNVILPEHLLGKL  1383
             +V+V LPE  + KL
Sbjct  397   VVSVTLPEEEMSKL  410



>ref|XP_006395015.1| hypothetical protein EUTSA_v10004237mg [Eutrema salsugineum]
 gb|ESQ32301.1| hypothetical protein EUTSA_v10004237mg [Eutrema salsugineum]
Length=438

 Score =   132 bits (331),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 122/437 (28%), Positives = 194/437 (44%), Gaps = 38/437 (9%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN V    + + V +  +G  RV   T  D  +  H +  ++ +     +  N   ++ P
Sbjct  6     ENRVEVKSMLTAVSSKPSGSDRVHPFTALDDVLSPHTVHVIFYYARSPFESFNLDSVRIP  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSD-QSEYDHL  471
             +  +L  + P  GR+  +P DG   VKCND+G+R+++AK S  IDEWL  +D   EYD  
Sbjct  66    LSELLSMYPPVIGRVTKNP-DGIWQVKCNDAGLRVLKAKVSVGIDEWLRSADGLEEYDLT  124

Query  472   LHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRR  651
                D        +SP   +QI  F+ GG++IG+S  H   D  +L+  L  +    A RR
Sbjct  125   AWQDMPEEDPTTWSPFR-LQINEFEGGGVAIGLSCPHRQADPTTLTILLKSW--TEAQRR  181

Query  652   DL---PPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
                  PP    +P++          ++ FP  +   GPV        + K AT ++  ++
Sbjct  182   QCIVHPPSFTPLPSSLTDTDAVKSDREPFPKPI--TGPV--------STKTATATFRFSE  231

Query  823   KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLL  1002
                   + + S      K  PF+  +ALFW  +A VK     + V I  +      N L 
Sbjct  232   SAFKTCLDEYSIEGVFPKASPFDVFAALFWTRVALVKRMC--DRVCICVDFRRLLPNPLP  289

Query  1003  PCRNGQVISAVKAEMR-VSEADVLELANLIGE--KAVDETGIIDETMEEENGKSADFFVY  1173
                 G  ++    EM  V    +  +A  I E  K++D    +++   +     +   +Y
Sbjct  290   YGFFGNALNFSSLEMTGVVVRGIGHVARSINEHVKSLD----VEKIRSDLKRAGSQGQMY  345

Query  1174  GANLTFVNLEEVKIYGFDM-------KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE  1332
             G +LT VN+E + + G  +        G KP+  +Y IG  G EG + V+P PE    K 
Sbjct  346   GRDLTIVNMEHMIVEGEPLMYEAVFEDGVKPVHVSYRIGNHGGEGMITVMPSPE----KG  401

Query  1333  GGRIVNVILPEHLLGKL  1383
              GR V V LPE  + KL
Sbjct  402   FGRTVAVTLPEEEMSKL  418



>emb|CAE05195.3| OSJNBa0070C17.2 [Oryza sativa Japonica Group]
Length=274

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 91/290 (31%), Positives = 144/290 (50%), Gaps = 28/290 (10%)
 Frame = +1

Query  556   LSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPF  735
             +++G SWAH++GD  S +   N +   ++G      K P     +  N P  R       
Sbjct  1     MALGFSWAHLIGDVASATACFNTWAQILSG------KKPAGTVLEPANKPLDRAPAAAAA  54

Query  736   ----SLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISA  903
                 S+  VGP+ DHW +     MA  S+ +T+  L  L  + +  + +A    FE +SA
Sbjct  55    APPRSVKPVGPIEDHWLVPAGRAMAWYSFRVTEPALKKL--QSAAGRHAAGT--FELVSA  110

Query  904   LFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELAN  1083
             L W+++AK++  +  E  T+                N Q +  V+A    ++ DV ELA 
Sbjct  111   LLWQAVAKIRAAASKEVTTVTVVRTDMAARSGKSLANEQRVGYVEAASSPAKTDVAELAA  170

Query  1084  LI-GEKAVDETGIIDETMEEENGKSADFFVYG-ANLTFVNLEEVKIYGFDMKGQKPIFAN  1257
             ++ G+K VDETG +            D  VYG ANLTFV++E+V  Y  ++KGQ+P+   
Sbjct  171   MLAGDKVVDETGAV-------AAFPGDVVVYGGANLTFVDMEQVAPYELELKGQRPVHVE  223

Query  1258  YTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISKEL  1407
             Y + GVG+EGAVLV P   +  G+  GR+V V++P   +  L+  +   L
Sbjct  224   YGLDGVGEEGAVLVQP---DAGGR--GRVVTVVIPRDEVDSLRAALGSTL  268



>ref|XP_008222902.1| PREDICTED: protein ECERIFERUM 26-like [Prunus mume]
Length=207

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 133/299 (44%), Gaps = 106/299 (35%)
 Frame = +1

Query  517   LVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNH  696
             ++ +Q+T F+CGG+S+G+SWAHVLGDAF+ SDF+N  G  M+     P + P+  T++  
Sbjct  1     MLSLQVTHFRCGGISLGLSWAHVLGDAFAASDFINGLGQIMSALE--PNRLPNYTTSNT-  57

Query  697   NSPKPRTQKLF----PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLK  864
                  R QKL     P S+  V PVGDHW                               
Sbjct  58    -----RFQKLENRPPPLSIKQVNPVGDHW-------------------------------  81

Query  865   QSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKAE  1044
                 + P            +KV+EGS  + VTI K     R      C N Q+IS VKA+
Sbjct  82    ----ITPIN----------SKVREGSEPKLVTICKKDPEER----TICSNSQIISTVKAD  123

Query  1045  MRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGF  1224
               +++AD  +LA L+ ++A +E   I+E ME  NG  ADF VYGANLTF           
Sbjct  124   FSITDADPKKLATLLVKQAGNERSQIEEAMENNNG-VADFVVYGANLTF-----------  171

Query  1225  DMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISK  1401
                                              G+  GR+VN+ILPE  +  LK+E+ K
Sbjct  172   ---------------------------------GRGEGRVVNIILPEKEVFGLKSELRK  197



>emb|CDY52503.1| BnaAnng11500D [Brassica napus]
Length=436

 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 122/439 (28%), Positives = 200/439 (46%), Gaps = 43/439 (10%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             +N V    + + + +  +  G++   T  D AM  H +  ++ +        +   ++ P
Sbjct  6     QNRVEVRSMLTAISSKPSRSGQIHTFTALDNAMSPHTVHVIFYYPRSPFGSFDLDSVRIP  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +  +L  + PA GR+  +PE G   VKCND+G+RI++AK S  IDEWL  +D  E  +L 
Sbjct  66    LSELLSMYPPAIGRVTKNPE-GILEVKCNDAGLRILKAKVSVGIDEWLRSADGHEESNLT  124

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               + +      +SP   +QI  F+ GG++IG+S  H+  DA +L+  L  +  A   RR 
Sbjct  125   AWEDMPEDPSTWSPFR-LQINEFEGGGVAIGLSCPHMHADATTLTVLLKSWTEAQ--RRQ  181

Query  655   L---PPKHPHMP----TADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYH  813
                 PP    +P      D  NS +    K          P+      T + K AT ++ 
Sbjct  182   CITHPPSFSPLPYNLTDTDAVNSDRDSFSK----------PIAG----TVSTKTATATFR  227

Query  814   ITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGN  993
              +       + + S  + S K  PF+  +ALFW  +A VK+ S  + V +  +      N
Sbjct  228   FSGSAFTRCVKEHSIHEISPKATPFDVFAALFWTRVALVKDKS--DRVCVCVDFRRLLPN  285

Query  994   GLLPCRNGQVISAVKAEM-RVSEADVLELANLIGEKAVDETGIIDETMEEENGKS-ADFF  1167
              L     G  ++    EM  V + ++  +A LI E      G+  E +     ++ +   
Sbjct  286   PLPYGFFGNALNFSSLEMANVVDMEIGHVARLINEHVA---GLNVEKIRSGLKRAGSQRK  342

Query  1168  VYGANLTFVNLEEVKIYGFDM-------KGQKPIFANYTIGGVGDEGAVLVLPGPENLKG  1326
             +YG +LT VN+E + + G  +       +G KP+  +Y IG  G EG + V+P  E    
Sbjct  343   MYGTDLTIVNMEHMIVNGEPLMYETVFEEGVKPMHVSYRIGNKGGEGVITVIPSTE----  398

Query  1327  KEGGRIVNVILPEHLLGKL  1383
             K  GR V V LPE  + KL
Sbjct  399   KGFGRTVAVTLPEEEMSKL  417



>ref|XP_010256176.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nelumbo nucifera]
Length=454

 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 121/432 (28%), Positives = 196/432 (45%), Gaps = 49/432 (11%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFYP  324
             +VV  T T  G+  +L+  D  M LH L  V+ +R +  +  + G L+  +  +L  + P
Sbjct  15    TVVSDTPTRPGKTFSLSLLDHTMGLHTLHIVFYYRHKWSNSDDLGRLRESLADVLNYYPP  74

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSE-YDHLLHHDQVLGPD  501
               GR +   EDG   V CND+GVRI+++    T+D+WL  ++ SE  D  +  D    P 
Sbjct  75    ITGRFQKG-EDGNWVVACNDAGVRILKSNVHTTLDDWLKSAEGSEERDLTVWEDMPEDPT  133

Query  502   LGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP--H  675
             L +SP   IQ+  F+  G++IG+S +H+  D    + F   +      RRD     P  H
Sbjct  134   L-WSPFR-IQLNEFEGEGMAIGLSCSHMHADPTCATIFFKSWTETY--RRDAIKHSPFFH  189

Query  676   MPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVS  855
              P      SP   T+    ++  S        +  +  KM+T ++  ++  +   + +V 
Sbjct  190   PPGLRGRPSPNTNTESAKYYAAKSKA------EPPSPVKMSTATFRFSEAAIQKCLSEVQ  243

Query  856   GLKQSAKVKPFEAISALFWKSLAKVK--------EGSGLETVTIVKNGFHSRGNGLLPCR  1011
                Q     PF+ ++ALFW S  + K        +   L     ++   H+      P  
Sbjct  244   N--QCPDATPFDVLAALFWTSAVRAKTAPEAIPEQKRSLSICIDIRKLMHA------PLP  295

Query  1012  NGQVISAVKAEMRVSEADVLE---LANLIGEKAVDETGIIDETM---------EEENGKS  1155
             +G   +A+   +  SEA  ++   LA + G      + + +E           ++E GK 
Sbjct  296   HGYFGNALYFSLVSSEAGKMDEGGLAYVAGLVRSHMSSLKEEDFWSAIDWIESQKEGGKF  355

Query  1156  ADFF-VYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE  1332
             A  + +YG  LT  N+E +  Y   ++  KP+  +Y IG V  EG +LVLP PE     E
Sbjct  356   APAWRMYGPELTCANMEHLFSYSAMLEELKPVHVSYHIGNVEGEGLILVLPSPE-----E  410

Query  1333  G-GRIVNVILPE  1365
             G GR V V LPE
Sbjct  411   GLGRTVMVTLPE  422



>tpg|DAA36076.1| TPA: glossy2 [Zea mays]
Length=303

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 10/146 (7%)
 Frame = +1

Query  124  VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
            V+ HRLS+VVP+++TGE     L +ADLA KLHYLRGVY +RS   DGL T  LK PMF 
Sbjct  16   VHGHRLSTVVPSSVTGEVD-YALADADLAFKLHYLRGVYYYRSG--DGLATKVLKDPMFP  72

Query  304  MLEDFYPAAGRIRTSPEDG-----RPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDH  468
             L+D +P AGR+R +  +G     RP++KCND GVRIVEA+C + + EW+  +       
Sbjct  73   WLDDHFPVAGRVRRAEAEGDGAPRRPYIKCNDCGVRIVEARCDRDMAEWIRDAAPGRIRQ  132

Query  469  LLHHDQVLGPDLGFSPLVFIQITWFK  546
            L  +D+VLGP+L  S LV+  +   +
Sbjct  133  LC-YDKVLGPEL-VSALVWQAVAKIR  156


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 102/181 (56%), Gaps = 20/181 (11%)
 Frame = +1

Query  874   KVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP--CRNGQVISAVKAEM  1047
             KV   E +SAL W+++AK++    ++TVT+V+    +R    L    + G V SA  +  
Sbjct  137   KVLGPELVSALVWQAVAKIR--GDVDTVTVVRADAAARSGKSLANEMKVGYVESAGSSP-  193

Query  1048  RVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG-ANLTFVNLEEVKIYGF  1224
               ++ DV ELA L+ +  VDET  +            D  VYG ANLT V++E+V +YG 
Sbjct  194   --AKTDVAELAALLAKNVVDETAAV-------AAFQGDVLVYGGANLTLVDMEQVDLYGL  244

Query  1225  DMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISKE  1404
             ++KGQ+P++  Y + GVGDEGAVLV P   +  G+  GR+V V+LP   +  L+  +   
Sbjct  245   EIKGQRPVYVEYGMDGVGDEGAVLVQP---DADGR--GRLVTVVLPGDEIDSLRAALGSA  299

Query  1405  L  1407
             L
Sbjct  300   L  300



>ref|XP_010421688.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=431

 Score =   129 bits (324),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 120/434 (28%), Positives = 197/434 (45%), Gaps = 38/434 (9%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN V    + + V +  +   RV   T  D AM  H L  +  +        +   ++  
Sbjct  6     ENRVEVKSMLTAVSSKPSRSARVHPFTTLDNAMSRHTLHVIVYYPRSPFGSFDLDSVRIS  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +  +L  + P  GR+  +P DG   VK ND+G+R ++AK    IDEWL  +D  +   L 
Sbjct  66    LSELLSMYPPVVGRVAKTP-DGILEVKRNDAGLRTLKAKVCVGIDEWLRSADGHDESDLT  124

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               + +      ++P   +QI  F+ GG++IG+S  H   DA +L+  L  +  A   R  
Sbjct  125   AWEDMPEDPSTWAPF-RLQINEFEGGGVAIGLSCPHRQADATTLTVLLKSWTEAQRRRCI  183

Query  655   L-PPKHPHMPT--ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDK  825
             + PP    +P+   D+ ++ KP +    P S     P+        + K AT ++  +  
Sbjct  184   VHPPSFSPLPSILTDDTDAVKPNSA---PIS----KPI--------STKTATATFRFSSS  228

Query  826   QLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP  1005
                  I +  G+    K  PF+  +ALFW  +A VK  S  + V +  +      N L  
Sbjct  229   AFKKYI-EEEGI--FPKASPFDVFAALFWTRVALVKRKSH-DRVCLCVDFRRLLPNPLPY  284

Query  1006  CRNGQVISAVKAEM-RVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGAN  1182
                G  ++    EM  V++  +  +A LI +   + T  +++   + N       VYG +
Sbjct  285   GFFGNALNFSSLEMTNVADQGIGHVARLINDHVTNLT--VEKIRSDLNRVGEQGLVYGGD  342

Query  1183  LTFVNLEEVKIYGFDM-------KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGR  1341
             LT VN+E + + G  M        G +P+  +Y IG VG EG ++V+P PE    K  GR
Sbjct  343   LTIVNMEHMIVEGDPMMYDAVFEDGVRPVHVSYRIGNVGGEGVIMVMPSPE----KGFGR  398

Query  1342  IVNVILPEHLLGKL  1383
             +V+V LPE  + KL
Sbjct  399   VVSVTLPEEEMSKL  412



>ref|XP_010914319.1| PREDICTED: protein ECERIFERUM 26-like [Elaeis guineensis]
Length=184

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 118/195 (61%), Gaps = 16/195 (8%)
 Frame = +1

Query  793   MATQSYHITD---KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTI  963
             MAT S+ IT    KQ+ A        K+S++V  FE ISAL W+ LAK+++      VTI
Sbjct  1     MATYSFQITKAKIKQIQA--------KESSQVSSFEIISALIWQCLAKIRKDKEPTLVTI  52

Query  964   VKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEE  1143
              KN    + +GLL   N   I  V ++    +  V ELA++I ++ V  T +I++ +E E
Sbjct  53    CKNDPLVKRSGLL--SNELKIGTVVSDFFPFKVAVSELASMIAKQQVIGTKMIEDLVEGE  110

Query  1144  NGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLK  1323
             + ++ +F +YGANLTF+++E V +Y  ++K QKPI  +++I GVGDEGAVLVL  P+   
Sbjct  111   S-ETPNFIIYGANLTFIDIEGVPLYELELKDQKPIHVDFSIDGVGDEGAVLVLQCPQKTY  169

Query  1324  GK--EGGRIVNVILP  1362
             G    GG++V + LP
Sbjct  170   GSGGSGGKMVMLSLP  184



>ref|XP_011026508.1| PREDICTED: protein ECERIFERUM 26 [Populus euphratica]
Length=445

 Score =   125 bits (315),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 125/432 (29%), Positives = 198/432 (46%), Gaps = 35/432 (8%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEA--VDGLNTGDLKSPMFRMLEDF  318
             +VV       G+  +L+  D  M+ ++LR VY FR+      G  T  L+  +  ML  F
Sbjct  11    TVVSTKSVQPGKHCSLSVLDRLMEQNHLRSVYYFRTPGGREPGEITKKLRESLSEMLTCF  70

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
                 GR+   P+ G   +KCND+GVR+VEA+   ++++WL   D+ +   L+H +++   
Sbjct  71    PIVTGRLLKDPK-GHWMIKCNDAGVRMVEARIKGSVEDWLKSVDREQELKLVHWEEMYHK  129

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP-AMAGRRDLPPKHPH  675
                +S   ++QIT F  GGL+IG+S  H+L D    + F+  +    + G+   PP    
Sbjct  130   PYFWSTF-YVQITEFGEGGLAIGLSCFHLLADPTCATMFVKAWADVTLTGKMLNPPLFHQ  188

Query  676   MPTADNHNSPKPRTQKLFPFS--LGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFK  849
             +P       P  +     P+   +    P+ D   L    K AT +   +D  + A +  
Sbjct  189   LPP----RRPGGKNSSHEPYMELINCYKPIADKTNLVTDTKHATIALAFSDPMVRACMAN  244

Query  850   ---VSGLKQSAKVKPFEAISALFWKSLAKVKEGSG-----LETVTIVKNGFHSRGNGLLP  1005
                 + + QS    PFEA+  LFW  ++K+K G+G     +   + ++N  H   NG   
Sbjct  245   GQATNAIDQSIP-SPFEALGGLFWVCISKLK-GAGDRLIDMSICSDMRNVLH-LDNGFF-  300

Query  1006  CRNGQVISAVKAEMRVSEADVLELANLIGE--KAVDETGIIDET-MEEENGKSADFFVYG  1176
               N  V + V ++  ++E  + ++A  IGE    +D  GIID     E NG  +   + G
Sbjct  301   -GNCMVYNKVNSK-SLTEHKLSDVAKAIGEVMAKMDNDGIIDLIEWLEHNGCQSPPPMNG  358

Query  1177  ANLTFVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GRIV  1347
               L   +LE V  Y     +G  PI  +  +  V   G VLVLP P      EG   R V
Sbjct  359   CELMCASLEAVDPYLAVFEEGFVPIRVSSYVEPVVGAGHVLVLPSPPC----EGPLSRTV  414

Query  1348  NVILPEHLLGKL  1383
              V LPE    +L
Sbjct  415   MVTLPEDEAARL  426



>gb|KHN31456.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=445

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 125/455 (27%), Positives = 205/455 (45%), Gaps = 58/455 (13%)
 Frame = +1

Query  121   IVYDHRLSSVV--PATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             +V + +L+ V   P + +G+G+   L+  D AM  H +  +Y +++E      + DL  P
Sbjct  6     VVVNSKLTVVSSRPVSASGKGKAHALSALDSAMGSHTVHVIYYYKNEE-KWFESFDLLDP  64

Query  295   MFRMLED---FYPA-AGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEY  462
             +   L +    YP   GR+     DG   VKCND+GVR+++A    T+D+WL  +  SE 
Sbjct  65    LRESLSEVLTLYPTVTGRLGKRGVDGGWEVKCNDAGVRVIKASVDATLDQWLKSASGSEE  124

Query  463   DHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMA  642
             + L+  D +      +SP   IQ+  F+ GG++IGIS +H++ D   L+ F   +     
Sbjct  125   NLLVAWDHMPDDPTTWSPFR-IQVNRFEGGGVAIGISCSHMVADLTFLASFFKSWTEV--  181

Query  643   GRRDLPPKHP----HMPT-ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS  807
               R L   HP     +P  AD+     PR                 H K  +   MAT +
Sbjct  182   -HRHLAITHPPFVAPLPNHADDDAESLPR-----------------HAKTHSPRNMATAT  223

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK--EGSGLETVTIVKNGFH  981
             +  +   +N  + KV G   +A   PF+ ++ALFW  +A+VK  +         +   F 
Sbjct  224   FKFSSSIINRCLSKVHGTCPNA--TPFDFLAALFWNRIARVKPPKNHHQTHCLCICTDFR  281

Query  982   SRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSAD  1161
             +     LP   G   +A+   M   + + ++L  ++        G+ +E +   N +   
Sbjct  282   NLIKASLPI--GYFGNALHFSMLSQKVEDMQLGGIVSAVHSHLKGLSEEEIWSTNNEGNY  339

Query  1162  FFVYGANLTFVNLE--------EVKIYGFDM-KGQKPIFANYTIGGVG-DEGAVLVLPGP  1311
             + +YG  LT V +E        E  +Y       +KPI  +  +G V   EG + V+P  
Sbjct  340   YCMYGTELTCVCMEHLVFEEENESLLYAAMFGNNEKPIQVSCRVGNVDYGEGLITVMP--  397

Query  1312  ENLKGKEGG--RIVNVILPEHLLGKL-KNEISKEL  1407
                  +EGG  R V V+LPE  L +L K+E   EL
Sbjct  398   ----SEEGGLSRTVMVMLPEEELAELSKDEAILEL  428



>ref|XP_006577283.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=445

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 122/442 (28%), Positives = 198/442 (45%), Gaps = 56/442 (13%)
 Frame = +1

Query  154   PATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED---FYP  324
             P + +G+G+   L+  D AM  H +  +Y +++E      + DL  P+   L +    YP
Sbjct  19    PVSASGKGKAHALSALDSAMGSHTVHVIYYYKNEE-KWFESFDLLDPLRESLSEVLTLYP  77

Query  325   A-AGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPD  501
                GR+     DG   VKCND+GVR+++A    T+D+WL  +  SE + L+  D +    
Sbjct  78    TVTGRLGKRGVDGGWEVKCNDAGVRVIKASVDATLDQWLKSASGSEENLLVAWDHMPDDP  137

Query  502   LGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP---  672
               +SP   IQ+  F+ GG++IGIS +H++ D   L+ F   +       R L   HP   
Sbjct  138   TTWSPFR-IQVNRFEGGGVAIGISCSHMVADLTFLASFFKSWTEV---HRHLAITHPPFV  193

Query  673   -HMPT-ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIF  846
               +P  AD+     PR                 H K  +   MAT ++  +   +N  + 
Sbjct  194   APLPNHADDDAESLPR-----------------HAKTHSPRNMATATFKFSSSIINRCLS  236

Query  847   KVSGLKQSAKVKPFEAISALFWKSLAKVK--EGSGLETVTIVKNGFHSRGNGLLPCRNGQ  1020
             KV G   +A   PF+ ++ALFW  +A+VK  +         +   F +     LP   G 
Sbjct  237   KVHGTCPNA--TPFDFLAALFWNRIARVKPPKNHHQTHCLCICTDFRNLIKASLPI--GY  292

Query  1021  VISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNL  1200
               +A+   M   + + ++L  ++        G+ +E +   N +   + +YG  LT V +
Sbjct  293   FGNALHFSMLSQKVEDMQLGGIVSAVHSHLKGLSEEEIWSTNNEGNYYCMYGTELTCVCM  352

Query  1201  E--------EVKIYGFDM-KGQKPIFANYTIGGVG-DEGAVLVLPGPENLKGKEGG--RI  1344
             E        E  +Y       +KPI  +  +G V   EG + V+P       +EGG  R 
Sbjct  353   EHLVFEEENESLLYAAMFGNNEKPIQVSCRVGNVDYGEGLITVMP------SEEGGLSRT  406

Query  1345  VNVILPEHLLGKL-KNEISKEL  1407
             V V+LPE  L +L K+E   EL
Sbjct  407   VMVMLPEEELAELSKDEAILEL  428



>ref|XP_009129839.1| PREDICTED: protein ECERIFERUM 26-like [Brassica rapa]
Length=436

 Score =   123 bits (308),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 119/435 (27%), Positives = 195/435 (45%), Gaps = 35/435 (8%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             +N V    + + + +  +  G++   T  D AM  H +  ++ +        +   ++ P
Sbjct  6     QNRVEVRSMLTAISSKPSRSGQIHTFTALDNAMSPHTVHVIFYYPRSPFGSFDLDSVRIP  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +  +L  + PA GR+  +PE G   VKCND+G+RI++AK S  IDEWL  +D  E  +L 
Sbjct  66    LSELLSMYPPAIGRVTKNPE-GILEVKCNDAGLRILKAKVSVGIDEWLRSADGHEETNLT  124

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               + +      +SP   +QI  F+ GG++IG+S  H+  DA +L+  L  +    A RR 
Sbjct  125   AWEDMPEDPSTWSPFR-LQINEFEGGGVAIGLSCPHMHADATTLTVLLKSW--TEAQRRQ  181

Query  655   L---PPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDK  825
                 PP    +P            +  F   +            T + K  T ++  +  
Sbjct  182   CITHPPSFSPLPYNLTETDAVKSDRDSFSKPIAG----------TVSTKTTTATFRFSGS  231

Query  826   QLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP  1005
                  + + S  + S K  PF+  +ALFW  +A VK  S  + V +  +      N L  
Sbjct  232   AFTRCVKEHSIHEISPKATPFDVFAALFWTRVALVKNKS--DRVCVCVDFRRLLPNPLPY  289

Query  1006  CRNGQVISAVKAEM-RVSEADVLELANLIGEKAVDETGIIDETMEEENGKS-ADFFVYGA  1179
                G  ++    EM  V + +V  +A LI E      G+  E +     ++ +   +YG 
Sbjct  290   GFFGNALNFSSLEMANVVDMEVGHVARLINEHV---AGLNVEKIRSGLKRAGSQRKMYGT  346

Query  1180  NLTFVNLEEVKIYGFDM-------KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGG  1338
             +LT VN+E + + G  +       +G KP+  +Y IG  G EG + V+P PE    K  G
Sbjct  347   DLTIVNMEHMIVDGEPLMYETVFEEGVKPMHVSYRIGNNGGEGVITVIPSPE----KGFG  402

Query  1339  RIVNVILPEHLLGKL  1383
             R V V LPE  + KL
Sbjct  403   RTVAVTLPEEEMSKL  417



>ref|XP_011091952.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=458

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 122/440 (28%), Positives = 194/440 (44%), Gaps = 55/440 (13%)
 Frame = +1

Query  133   HRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAV-DG---LNTGDLKSPMF  300
             H L SVV  +    G+V  L+  D AM  H +  V+ + S    DG   L+  +L+  + 
Sbjct  20    HSLLSVVSGSPVAPGKVHILSPLDRAMGHHTIHIVFYYESNPFKDGPFPLDIDNLRVSLS  79

Query  301   RMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS-EYDHLLH  477
             ++L+++    GR+    E G   V+CND+GVRI++A  + ++DEWL  +D S E D  L 
Sbjct  80    KLLDEYPIVTGRLTRGAEGGWQ-VRCNDAGVRILQATVNTSMDEWLRSADASEERDLTLW  138

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDL  657
              D    P   +SP   IQI  F+CG L+IG+S  H+  D  S +  +  +    +G+   
Sbjct  139   EDMPQDPSY-WSPFR-IQINNFECGALAIGLSCTHMHADMTSATMLIKSWTEVHSGQ---  193

Query  658   PPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGP--VGDHWKLTNTCKMATQSYHITDKQL  831
             P  H     +   N P P      P S G+  P     H  +T    M T +   +   +
Sbjct  194   PLTH-----SPIFNLPPP------PSSHGNFVPSFTALHSPIT-PANMGTVTMKFSGSVI  241

Query  832   NALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCR  1011
                + +V    Q     PF+ + A+FW  +A+ +E S       +     SR  G     
Sbjct  242   ENCLLQVQ--SQCPDATPFDVLVAIFWSRIARWQEPSFNNHKCSLSICVDSRSAGHPEVP  299

Query  1012  NGQVISAVKAEMRVSEADVLELANL----------IGEKAVDETGIIDETMEEE-NGKSA  1158
              G   +A+   +   +AD L    L          + +   DE   +   ++E  N    
Sbjct  300   FGYFGNALHFSVLYVDADKLLSCGLGQVSQYVHSHVAKARADEFWSVMRWLDEHSNEGEG  359

Query  1159  DFFVYGANLTFVNLEEVKI--------YGFDM-KGQKPIFANYTIGGVGDEGAVLVLPGP  1311
              F +YG  LT +N+E + +        Y     KG++PI  +Y +G V  +G ++V+P  
Sbjct  360   PFTIYGPRLTCINMEHMAVAENGTALMYAASFKKGERPIHVSYHVGKVEGQGLIMVMP--  417

Query  1312  ENLKGKEGG--RIVNVILPE  1365
                   EGG  R V V+LPE
Sbjct  418   ----SAEGGLARTVTVMLPE  433



>emb|CDY12721.1| BnaC04g29200D [Brassica napus]
Length=165

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 89/149 (60%), Gaps = 2/149 (1%)
 Frame = +1

Query  124  VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
            +Y+ RLS+V     T  G     T  DLAMKLHYL+  Y++  E    L+   +K  +F+
Sbjct  12   IYNMRLSTVGATRATETGTTHEPTGLDLAMKLHYLKAAYIYTPEMARDLSVTHVKEAIFK  71

Query  304  MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
            + +      GR+    + GRP++KCND G R VE KC+ T++EWL   D+S  + L++H 
Sbjct  72   LFDQIAWTTGRLWRR-DSGRPYIKCNDCGARFVEGKCNFTVEEWLSKPDRSVDEFLVYH-  129

Query  484  QVLGPDLGFSPLVFIQITWFKCGGLSIGI  570
            Q +GP+L FSPL+++Q+ +F    +SI I
Sbjct  130  QPVGPELPFSPLIYVQVNFFWEVRVSIWI  158



>ref|XP_006838953.1| hypothetical protein AMTR_s00002p00270800 [Amborella trichopoda]
 gb|ERN01522.1| hypothetical protein AMTR_s00002p00270800 [Amborella trichopoda]
Length=474

 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 121/447 (27%), Positives = 206/447 (46%), Gaps = 53/447 (12%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS--EAVDGLNTGDLKSPMFRMLEDF  318
             +V+PA      ++  L+  D  M +H LR V+ +++     +GL    LK  +   L  +
Sbjct  20    TVIPAVPGQLSKIHPLSLLDHMMGVHNLRIVFYYKTPRNKEEGLRHESLKEALSETLSSY  79

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
                 GR++   E+GR  V+CND+GVR+VEAK   T+++WL+ ++ ++ + L + ++ +  
Sbjct  80    PIVTGRLKGGNEEGRWEVQCNDAGVRVVEAKVEGTVEDWLERAEAADEEGLTYWEK-MPE  138

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHM  678
             D  F    ++Q+T F+ GG +IG+S  H+  D  S +  +  +      +    P   H 
Sbjct  139   DPCFWSTFYVQLTQFEGGGFAIGLSCTHLSADPTSATLLIKAWSEIHRRKAISTPPFFHA  198

Query  679   PTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLT--NTCK-----MATQSYHITDKQLNA  837
                    SP P+       ++ +      H KLT  NT +       + ++H     +  
Sbjct  199   YAL----SPNPQI-----LTVHTPATHLLHSKLTAQNTPQNFGENYPSATFHFPPSSVRT  249

Query  838   LIFKVSGLKQSAKVKPFEAISALFW-------------KSLAKVKEGSGLETVTIVKNGF  978
             LI K+   +   +V PFEA++ALFW             +S+    E   L  V + +  F
Sbjct  250   LISKIEE-ETKLQVTPFEALAALFWVASTRSHHTDSYTESICLCTEFRRLLQVPLPQGYF  308

Query  979   HSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGE---KAVDET--GIID--ETME  1137
                GN L    +   +S  +A +    + +   A LI E   KA +E    +I+     +
Sbjct  309   ---GNAL----HFSEVSEKRANLARYNSGLALAARLIHEDQDKAKEEEIWSVINWLAARK  361

Query  1138  EENGKSAD-FFVYGANLTFVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLVLPGP  1311
              ++G+S+  F +YG  LT  N E V  Y     +G +P+  +Y +  V  EG VLVLP  
Sbjct  362   SDSGRSSSPFPIYGPGLTVANFEGVMSYNAVFTEGDRPLHVSYRVEPVVGEGMVLVLPSD  421

Query  1312  ENLKGKEGGRIVNVILPEHLLGKLKNE  1392
             E     + GRIV V L    L +L+ +
Sbjct  422   EG----DFGRIVVVTLQGDRLSRLRKD  444



>ref|XP_009139678.1| PREDICTED: protein ECERIFERUM 26-like [Brassica rapa]
Length=147

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 84/137 (61%), Gaps = 2/137 (1%)
 Frame = +1

Query  124  VYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFR  303
            +Y+ RLS+V     T  G +   T  DLAMKLHYL+  Y++  E    L+   +K  MF+
Sbjct  12   IYNMRLSTVGATRATETGAIHEPTGLDLAMKLHYLKAAYIYSPELASDLSVTHVKEAMFK  71

Query  304  MLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHD  483
            + +      GR+    + GRP++KCND G R VE +C+ T++EWL   D+S  + L++H 
Sbjct  72   LFDQIAWTTGRLWRR-DSGRPYIKCNDCGARFVEGECNFTVEEWLSKPDRSVDEFLVYH-  129

Query  484  QVLGPDLGFSPLVFIQI  534
            Q +GP+L FSPL+++Q+
Sbjct  130  QPVGPELPFSPLIYVQV  146



>ref|XP_008218251.1| PREDICTED: protein ECERIFERUM 26-like [Prunus mume]
Length=458

 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 125/465 (27%), Positives = 206/465 (44%), Gaps = 63/465 (14%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M +     +V   +L++V    +   G   NLT  D AM LH L  V+ ++ + +   + 
Sbjct  1     MSTTQRSRVVVHSKLTAVSSRPVKA-GTTHNLTALDHAMGLHTLHVVFYYKHKLLGCFDL  59

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
               L+  +   L    P  GR+   P DG   VKCND+GVR+  A+ + T+D+WL  +D S
Sbjct  60    DPLRLSLSEALSLHPPVMGRMAQKP-DGNWEVKCNDAGVRVYMARVATTLDQWLRSADGS  118

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
             E   L   D +      +SP   IQI  F+ GG +IG+S  H+  D   ++  +  +   
Sbjct  119   EERLLTVWDDMPDDPSIWSPY-RIQINEFEGGGAAIGVSCTHMHADPTCVTLLVKAWAET  177

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPF----------SLGSVGPVGDHWKLTNT  786
                 R     HP +    +    +P  Q +             S+ +  P+ +       
Sbjct  178   ---HRKQAIAHPLLVGESSALGGRPVDQDIIKTKSAAAYYEAKSVAAKTPLPEK------  228

Query  787   CKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK--EGSGLETVT  960
              KM+T ++  +   +   + ++   K   +  PF+ ++ALFW S+A++K  + +   +++
Sbjct  229   -KMSTATFKFSSAMIEQGLLQIH--KTCPEANPFDLLAALFWTSIARLKPPKSATKHSLS  285

Query  961   IVKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDET---GIIDET  1131
             I  +   SR      C      +A+   M +S  DV E+ N  G + V E     +  + 
Sbjct  286   ICTD---SRKK---LCSGWHYGNALHFSM-LSVPDVEEVENANGLEHVAEAVHRHVWSQN  338

Query  1132  MEE-------------ENGK-SADFFVYGANLTFVNLEEVK-----IYG--FDMKGQKPI  1248
              EE             E GK  A F +YG  LT V++E +      +Y   FD K +KP 
Sbjct  339   EEEFWSGVDWFGSQKGEEGKFGAAFRMYGPELTCVSMEHMNDKEPLMYAAMFD-KDKKPA  397

Query  1249  FANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKL  1383
               +Y +G V  EG ++V+P      G   GR+V V LPE  LG+L
Sbjct  398   HVSYRVGNVEGEGFIMVMPA----SGGGLGRMVMVTLPEEELGQL  438



>emb|CDP04825.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 118/425 (28%), Positives = 193/425 (45%), Gaps = 33/425 (8%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS--EAVDGLNTGDLKSPMFRMLEDF  318
             +VV       G+   L+  D  M+ +++R V  +R   E   G +   L+  +  +L  +
Sbjct  11    TVVSTKPVEAGKFCPLSVLDRIMEHNHVRVVLYYRCPKERKAGESIRMLRESLAELLSAY  70

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
                 GR+  + E G   +KCND+GVR+VEA+    +D+WL   D+ +  +L+H + +   
Sbjct  71    PIVTGRLLKTAE-GHWMIKCNDAGVRMVEARAKGRVDKWLQNFDREKELNLVHWEPMFH-  128

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP-AMAGRRDLPPKHPH  675
              L F    ++Q+T F+ GGL++G+S  H+L D   ++ F+  +    + G+   PP    
Sbjct  129   KLYFWSTFYVQLTEFEEGGLAVGLSCGHLLSDPICVTIFIKAWADMTLNGKMVTPPLFHR  188

Query  676   MPTADNHN-----SPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
             +P     N      P P     +  +L    PV          K  T      D+ + + 
Sbjct  189   LPRRRQCNETTNPQPFPELINYYKSTLEKPVPVVQ-------AKQTTIKIAFGDEMVRSC  241

Query  841   IF--KVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLLPCR  1011
             I      G        PF+A++ LFW  ++K+K   +GL T++I  +     G       
Sbjct  242   IAMSHAPGSPDEPSPTPFQALAGLFWVGISKIKGLKNGLITMSICLDMRKVLGLDKGFFG  301

Query  1012  NGQVISAVKAEMRVSEADVLELANLIGE--KAVDETGIIDETMEEENGKSADF--FVYGA  1179
             N  V + V  +  + E ++ + AN I E    +D  GI++  +E   GK+  F   + G 
Sbjct  302   NCMVYNRVPGD-GIEEYELSKAANAIREVVDTMDAEGIMN-LIEWMEGKADQFSCLMNGY  359

Query  1180  NLTFVNLEEVKIYGFDMKGQ-KPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GRIVN  1350
             +L  VNLE V  Y    +   KPI A+Y I     EG +LVLP P      EG   R+V 
Sbjct  360   DLICVNLEHVDSYSAIFEENFKPIHASYYIEPTVGEGMILVLPSPPG----EGSFSRVVM  415

Query  1351  VILPE  1365
             + LPE
Sbjct  416   ITLPE  420



>ref|XP_010695055.1| PREDICTED: protein ECERIFERUM 26-like [Beta vulgaris subsp. vulgaris]
Length=476

 Score =   119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 124/471 (26%), Positives = 207/471 (44%), Gaps = 73/471 (15%)
 Frame = +1

Query  118   NIVYDHRLSSVVPAT-ITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             +IV  H + +VV +  +    +   LT  D AM  H L  ++ FRS ++D     D   P
Sbjct  18    SIVAVHSVLTVVSSIPVNPSDKTCPLTVVDRAMGQHSLHVIFYFRSGSLDF----DGIRP  73

Query  295   MFRMLEDFYP-AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHL  471
                 +   YP   GR+    +D    +KC D+G+R+  AK   ++DEWL  +   +  +L
Sbjct  74    AINEVLSMYPNVTGRLAKD-DDSNWVIKCTDAGMRVHRAKVETSVDEWLRSASADDERYL  132

Query  472   LHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRR  651
               + ++      +SP   +++T F+ GG +I +S  H+L D  S++  +  +  A     
Sbjct  133   SVYQELPDDPKYWSPFR-MKVTDFEGGGTAISLSCPHMLADPISMTLLIKSWTEAYHHDV  191

Query  652   DLPPK--HPH-MPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
              + P   HPH +       +P P T     +   S     +        KMA+ ++  ++
Sbjct  192   VVHPPFLHPHALNIPHTFTTPLPNTTSPSYYLSKSKTSYPN-----PKVKMASATFDFSN  246

Query  823   KQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGL  999
               +   + K   +   A   PF+ ++ALFW S+AK+K +   L+    +      R    
Sbjct  247   LAIKQFLVKNCSVLPDA--TPFDLLTALFWTSIAKLKAQTDDLKQSISICMDMRKRLRAA  304

Query  1000  LP-------------CRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDE----  1128
             LP               NG  IS        ++ D+ ++A L+    V   G+ DE    
Sbjct  305   LPYGYFGNALHFSQLTVNGNKIS--------NKGDIGQVAELVHRHVV---GLKDEEFWS  353

Query  1129  ------TMEEENGKS-ADFFVYGANLTFVNLEEV-------------KIYGFD-MKGQKP  1245
                   + +++ GK    F +YG  LTFVN+E +              +YG + MK QKP
Sbjct  354   AVDWLNSRKDDQGKFLPPFRMYGPELTFVNMESMIAPIGLNMNEAQPLMYGVEFMKDQKP  413

Query  1246  IFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGK-LKNEI  1395
             +  +Y +  V  EG +LV+P PE    +E  R V V LPE  + K LK+E+
Sbjct  414   VHVSYHVENVEGEGLILVMPSPE----EELARRVTVTLPEEEIEKLLKDEV  460



>ref|XP_007161246.1| hypothetical protein PHAVU_001G054300g [Phaseolus vulgaris]
 gb|ESW33240.1| hypothetical protein PHAVU_001G054300g [Phaseolus vulgaris]
Length=443

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 114/409 (28%), Positives = 198/409 (48%), Gaps = 36/409 (9%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS--EAVD-GLNTGDLKSPMFRMLED  315
             +VV       G+   L+  D  M+ +++R V  ++S  E V+ G  +  L+  +  ML D
Sbjct  12    TVVSTKAVEPGKYFPLSALDRYMENNHIRLVCYYQSSREVVELGEMSKKLRESLSEMLTD  71

Query  316   FYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLG  495
             F   +GR+ T  E G   +KCND+GVR+VEAK   +++ WL   D+ +   L+H +++  
Sbjct  72    FPMVSGRL-TRDERGHWKIKCNDAGVRVVEAKAKGSVEGWLANLDREKELQLVHWEEMFH  130

Query  496   PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPK--H  669
                 +S   ++Q+T F+ GGL+IG+S AH+L D+ S   F+  +     G + L P   H
Sbjct  131   KPYYWSTF-YVQLTEFEEGGLAIGLSCAHLLADSTSAISFMKAWADISKGNKILTPPLFH  189

Query  670   PHMPTADNHNSPK--PRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
             P   T + + +P   P  + +  +      P+        T  M   ++ +         
Sbjct  190   PLPLTREPNTNPNHHPHMELIHHYKSLIQKPISLKESRYTTISMGFSAHMVQA-------  242

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKE-GSGLETVTI---------VKNGFHSRGN  993
               +S  + +  + PF A++ALFW SL+KVK   +GL  ++I         +  GF   GN
Sbjct  243   -CMSTAQLNGPITPFAALAALFWISLSKVKGFRNGLVDMSICLDMRKVLGLDTGFF--GN  299

Query  994   GLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIID--ETMEEENGKSADFF  1167
              ++  +  +V      ++   EA V  +++++ +  +D  G++D  E +E ++  S    
Sbjct  300   CMVYNKVHEV-EGGNHKLNFPEA-VRAISDVVAK--MDYEGVMDLIEWLENDDVNSPPTM  355

Query  1168  VYGANLTFVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLVLPGP  1311
             + G +L   +LE V  Y      G KPI  +  +  V  EG VL+LPGP
Sbjct  356   MNGHDLVCASLEGVDPYLTVFQDGFKPIHVSCYVEPVLGEGQVLILPGP  404



>ref|XP_006604843.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=433

 Score =   117 bits (292),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 117/449 (26%), Positives = 197/449 (44%), Gaps = 53/449 (12%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEA--VDGLNTGDLKSP  294
             +  + +L+ V    ++  G+   L+  D  M  H L  +Y +++E    +  +   L+  
Sbjct  6     VALNSKLTVVSSRPVSSSGKAHALSALDRGMGSHTLHVIYYYKNEENWFESFDLNSLRES  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +  +L  +    GR+     DG   VKCND+GVR+++A    T+D+WL  +  SE + L+
Sbjct  66    LSEVLTLYPTVTGRLGIRGVDGGWEVKCNDAGVRVIKASVDATLDQWLKSASGSEENLLV  125

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               D +      +SP   IQI  F+ GG++IGIS +H++ D   ++ F   +       R 
Sbjct  126   AWDHMPDDPTTWSPFR-IQINSFQGGGVAIGISCSHMVADLTFVASFFKSWTEV---HRH  181

Query  655   LPPKHPHMPTADNHNSPK--PRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
             LP  HP    A NH   +  PR                 H K  +   MAT ++  +   
Sbjct  182   LPITHPPF-VAPNHADAESLPR-----------------HAKTDSPRNMATATFKFSTSI  223

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKV---KEGSGLETVTIVKNGFHSRGNGL  999
             +N  + KV     +A   PF+ ++ALFW  +A+V   K     +++ I  + F S     
Sbjct  224   INQCLTKVHDTCPNA--TPFDFLAALFWSRIARVKPPKNHHQTQSLCICTD-FRSLIKAS  280

Query  1000  LPC-RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
             LP    G  +       +V + +  +L  ++        G+ +E +   N    ++ +YG
Sbjct  281   LPIGYFGNALHFSMLSQKVEDMESGQLGGIVSAVHGHLGGLSEEEIWSTN--EGNYCMYG  338

Query  1177  ANLTFVNLE--------EVKIYGFDM-KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGK  1329
               LT V +E        E  +Y       +KP+  +  +G V  EG + V+P        
Sbjct  339   TELTCVCMEHLVFEEENESLLYAAMFGNNEKPVHVSCRVGNVDGEGLITVMP------SS  392

Query  1330  EGG--RIVNVILPEHLLGKL-KNEISKEL  1407
              GG  R V V+LPE  L +L K+E   EL
Sbjct  393   VGGLSRTVMVMLPEEELAELSKDEAILEL  421



>gb|KHN43198.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=433

 Score =   117 bits (292),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 117/449 (26%), Positives = 197/449 (44%), Gaps = 53/449 (12%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEA--VDGLNTGDLKSP  294
             +  + +L+ V    ++  G+   L+  D  M  H L  +Y +++E    +  +   L+  
Sbjct  6     VALNSKLTVVSSRPVSSSGKAHALSALDRGMGSHTLHVIYYYKNEENWFESFDLNSLRES  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +  +L  +    GR+     DG   VKCND+GVR+++A    T+D+WL  +  SE + L+
Sbjct  66    LSEVLTLYPTVTGRLGIRGVDGGWEVKCNDAGVRVIKASVDATLDQWLKSASGSEENLLV  125

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               D +      +SP   IQI  F+ GG++IGIS +H++ D   ++ F   +       R 
Sbjct  126   AWDHMPDDPTTWSPFR-IQINSFQGGGVAIGISCSHMVADLTFVASFFKSWTEV---HRH  181

Query  655   LPPKHPHMPTADNHNSPK--PRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
             LP  HP    A NH   +  PR                 H K  +   MAT ++  +   
Sbjct  182   LPITHPPF-VAPNHADAESLPR-----------------HAKTDSPRNMATATFKFSTSI  223

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKV---KEGSGLETVTIVKNGFHSRGNGL  999
             +N  + KV     +A   PF+ ++ALFW  +A+V   K     +++ I  + F S     
Sbjct  224   INQCLTKVHDTCPNA--TPFDFLAALFWSRIARVKPPKNHHQTQSLCICTD-FRSLIKAS  280

Query  1000  LPC-RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYG  1176
             LP    G  +       +V + +  +L  ++        G+ +E +   N    ++ +YG
Sbjct  281   LPIGYFGNALHFSMLSQKVEDMESGQLGGIVSAVHGHLGGLSEEEIWSTN--EGNYCMYG  338

Query  1177  ANLTFVNLE--------EVKIYGFDM-KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGK  1329
               LT V +E        E  +Y       +KP+  +  +G V  EG + V+P        
Sbjct  339   TELTCVCMEHSVFEEENESLLYAAMFGNNEKPVHVSCRVGNVDGEGLITVMP------SS  392

Query  1330  EGG--RIVNVILPEHLLGKL-KNEISKEL  1407
              GG  R V V+LPE  L +L K+E   EL
Sbjct  393   VGGLSRTVMVMLPEEELAELSKDEAILEL  421



>ref|XP_002282283.1| PREDICTED: protein ECERIFERUM 26-like [Vitis vinifera]
 emb|CBI20979.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 123/447 (28%), Positives = 207/447 (46%), Gaps = 37/447 (8%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVD--GLNTGDLKSPMFRMLEDF  318
             +VV       G+   L+  D AM  + +R VY +R+      G  T  L+  +  ML  F
Sbjct  11    TVVSTKPVQPGKTHPLSALDRAMDHNRVRIVYYYRTPPGREVGEVTKRLRETISEMLTSF  70

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
                 GR++ + E+G+  VKCND+GVR+VEA+   ++ EWL   D+ +   L+H + +   
Sbjct  71    PMVTGRLQRN-EEGQWVVKCNDAGVRMVEARAKGSVGEWLKSVDREKELKLVHWEDMFH-  128

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG-PAMAGRRDLPPK-HP  672
              + F    ++Q+T F+ GGL+IG S  H+L D    +  +  +   ++ G    PP  H 
Sbjct  129   KIYFWSTFYVQLTEFEEGGLAIGFSCTHLLADPICATMIIKAWADTSLLGEMPNPPLFHS  188

Query  673   HMP-----TADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNA  837
              +P      + NHN P       +  SL +  PV      TNT K  T +   T+  + A
Sbjct  189   SLPLIRPVNSINHN-PYTHLINHYKSSLDNSTPV------TNT-KYTTIALLFTNPMVQA  240

Query  838   LIFKVSGLKQSAKV----KPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLL  1002
              +       ++        PFEA++ LFW  ++ VK    GL  ++I  +     G    
Sbjct  241   CMEMARTHPEAHGTPIFPSPFEALAGLFWTCISNVKGWREGLINMSICLDMRKVLGLDEG  300

Query  1003  PCRNGQVISAVKA----EMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFV  1170
                N  V +AV+        +S+A  + +  ++ +   +E   + + +E ++ +S+    
Sbjct  301   FFGNCMVYNAVRGGDFNRHEISKA-AMAIRGVMEKMDSEEIMDLIQWLECDSNRSSVLMG  359

Query  1171  YGANLTFVNLEEVKIYGFDM-KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GR  1341
                +L   NLE+V+ Y     +G  P+  +Y I  V  +G VL+LP P     +EG   R
Sbjct  360   GCEHLICTNLEDVEPYSAKFEEGYAPVRVSYHIEPVSTKGQVLILPAPP----EEGPLSR  415

Query  1342  IVNVILPEHLLGKLKNEISKELGTSPN  1422
             +V V LPE+   KL  ++ + L  SP 
Sbjct  416   VVMVTLPENEAVKLCKDV-RVLSFSPT  441



>ref|XP_010917798.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 26-like [Elaeis 
guineensis]
Length=434

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 117/428 (27%), Positives = 186/428 (43%), Gaps = 48/428 (11%)
 Frame = +1

Query  142   SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFY  321
             S+ V  T    G+   L++ D  M  H L  V+ +R      L+   LK  +  +L  + 
Sbjct  14    STAVSGTPVRPGKTYPLSSLDHLMGRHTLHLVFYYRPGPT--LDRDGLKESLSEVLSHYP  71

Query  322   PAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPD  501
              A GR+    EDG   VKCND+GVR+++A+ + T++EWL  S  +E +  L + + +G D
Sbjct  72    AATGRLSRG-EDGGWIVKCNDAGVRLLDARANVTLEEWLG-SASAEEEMELAYWEPMGDD  129

Query  502   LGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP--H  675
                    +IQIT F+    +IG+S  H+  D    +  +  +  A + RR      P  H
Sbjct  130   PSIWSPYYIQITEFEDKAFAIGLSCTHMHADPTCATLLVRAW--ADSHRRACIAYAPFLH  187

Query  676   MPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVS  855
              P       P+P +  L      S           +  KM++ ++  +D  + +L+  + 
Sbjct  188   PPAFLPRPDPRP-SHPLLSLKSSST-------PFASNSKMSSATFRFSDLAVKSLLADL-  238

Query  856   GLKQSAKVKPFEAISALFWKSLAK---VKEGSG-LETVTIVKNGFHS------RGNGLLP  1005
                      PF A++ALFW  +A+   V  G G L  V  V+   H+       GN L  
Sbjct  239   ----QPDASPFSALAALFWSRIARAAGVPPGPGELTLVVDVRKRMHAPLPHGFYGNALH-  293

Query  1006  CRNGQVISAVKAEMRVSEADVL-ELANLIGEKAVDETGIIDETMEEENGKSADFF-VYGA  1179
                    S  +A +    A V+ EL   +     DE     E   E   +  + F +YG 
Sbjct  294   ------FSRARANLAAGVAHVVDELGRHVAGLPEDEVWAAAEWAHERRHRGEEAFQMYGP  347

Query  1180  NLTFVNLEEVKIYG--FDMKGQ--KPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIV  1347
              LT   L+ +  YG  F+ +G+  +P   +  +GG   EG V+VLP  E    +   R V
Sbjct  348   ELTCFALDHLMAYGAAFEKEGEGGRPAHVSCRVGGAEGEGLVVVLPAAE----EGAARTV  403

Query  1348  NVILPEHL  1371
              V LPE +
Sbjct  404   MVTLPEEV  411



>ref|XP_004170167.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
Length=270

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 90/231 (39%), Positives = 127/231 (55%), Gaps = 18/231 (8%)
 Frame = +1

Query  730   PFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALF  909
             P SL  V PVGDHW  TN  KM + S+ +   QL  L       +   +  PFE+ISA  
Sbjct  37    PLSLRRVDPVGDHWIPTNKYKMESFSFKLNPTQLANL-----QTQMPHQTPPFESISAAL  91

Query  910   WKSLAKVKEGSGLETVTIVK-NGFHSRGNGLLPCRNGQVISAVK-AEMRVSEADVLELAN  1083
             W S+AK++ GS   TVT+ K +    +G  +    N Q IS VK A   VS+ D  +LA 
Sbjct  92    WHSIAKLRRGSEPTTVTLCKLDPVKQQGKVI---GNTQKISTVKSAAAAVSDVDQRDLAA  148

Query  1084  L-IGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYG---FDMKGQKPIF  1251
             L +G  A DE  +I+E +  ++G S DF VYGANLTFV  ++  +YG    ++  +KP F
Sbjct  149   LLVGSAADDEGELIEEAVNRDDGVS-DFIVYGANLTFVKWDDANLYGNGIMELDYEKPKF  207

Query  1252  ANYTI--GGVGDEGAVLVLPGPENLKGKEG-GRIVNVILPEHLLGKLKNEI  1395
               YT+   G G    V+  P  + + G++  GR V VILPE+ + +LK E+
Sbjct  208   VYYTLHGVGDGGAVVVVPGPVDDGVSGRDDRGRFVTVILPENEVVELKAEL  258



>ref|XP_011032417.1| PREDICTED: protein ECERIFERUM 26-like [Populus euphratica]
Length=450

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 117/438 (27%), Positives = 194/438 (44%), Gaps = 37/438 (8%)
 Frame = +1

Query  133   HRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLE  312
             H + + V +   G G+   L+  D AM LH L  V+ ++       +   L+  +  +L 
Sbjct  11    HSMLTAVSSKPVGPGQTHPLSALDHAMALHTLHLVFYYKKNPFGIFDVDPLRVSLSEVLS  70

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVL  492
              +    GR+ T  E G   VKCND+GVRIV A    TIDEWL  +D SE   L   +++ 
Sbjct  71    LYPQVTGRL-TRGESGNWEVKCNDAGVRIVRANVGVTIDEWLRSADVSEEKDLAVWEEMP  129

Query  493   GPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP  672
                  +SP   IQ+T F+ GG++ G+S  H+  D  SL+     +   +   R  P +HP
Sbjct  130   EDPSTWSPF-RIQVTEFEGGGVAFGLSCTHMNADPTSLTLLFKSW---IESHRQEPIEHP  185

Query  673   HMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKL-TNTCKMATQSYHITDKQLNALIFK  849
              +      NS  P  Q++   S  S     +     T   KM T ++  ++  +N  + +
Sbjct  186   PL-----FNSTPPHHQQVPDTSGKSTNYYANKANARTPLVKMVTATFRFSNSAINKCLNE  240

Query  850   VSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTI-VKNGFHSRGNGLLP------C  1008
             V    Q  +  PF+ ++ALFW  L  +K        ++ V   F       +P       
Sbjct  241   VH--DQCPEATPFDLLAALFWTRLVLLKAPKHDNKCSLSVCLDFRRLVQPPIPLGYFGNA  298

Query  1009  RNGQVISAVKAEMRVSE-ADVLELANL----IGEKAVDETGIIDETMEEENGKSA-DFFV  1170
              +  +I+  + EM   +   ++EL +     +GE+ + +     E+ +EE GK A  F +
Sbjct  299   LHFAMITVTEEEMDNGKLGHMVELVHRHVSGVGEEEIWDAVDWLESRKEEGGKHAPPFRM  358

Query  1171  YGANLTFVNLEEVKIYGFDMKG-------QKPIFANYTIGGVGDEGAVLVLPGPENLKGK  1329
             YG  LT V++E + I    +         +KP+        V  EG ++V+P       +
Sbjct  359   YGPELTCVSMEHMIIGNKSLMSSASFKSDEKPVHVACHFDNVVGEGLIVVMPS----INE  414

Query  1330  EGGRIVNVILPEHLLGKL  1383
             +  R V V LPE  + +L
Sbjct  415   DLARTVIVTLPEEEMPQL  432



>ref|XP_004494691.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=452

 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 114/452 (25%), Positives = 189/452 (42%), Gaps = 67/452 (15%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEA--VDGLNTGDLKSPMFRMLEDF  318
             +VV +     G+   L+  D  M  H L  ++ ++++    +      L+  +  +L  +
Sbjct  13    TVVSSRPVSYGKTHKLSALDHGMGFHTLHFIFYYKNKDKWFESFELDPLRESLSEVLSVY  72

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDH--LLHHDQVL  492
                 GR+     DG   V+CND+GVR+++A    T+DEWL  S    YD   L+  D + 
Sbjct  73    PTITGRLGNG--DGNWEVRCNDAGVRVIKANVDTTLDEWLSTSSHFVYDEADLIAWDHMP  130

Query  493   GPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP  672
                  +SP   IQI  FK GG++IG+S +H+L D    S F   +       R  P  HP
Sbjct  131   LDYNTWSPFQ-IQINRFKEGGVAIGLSCSHMLADLTCASSFFKSWSQTY---RHFPISHP  186

Query  673   HMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKV  852
                T    +SP P       FS      +           MAT ++  ++  +   + K+
Sbjct  187   PFCTPITTSSPLPNNIA-NSFSKPQTSIISSK-------NMATSTFKFSNSIIKHCLSKI  238

Query  853   SGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRN------  1014
                  +A   PF+ ++ALFW  +  +K                S+ + L  CR+      
Sbjct  239   QNTCPNA--TPFDFLTALFWTRVIHLKPSKS-----------QSQSHSLSICRDFRKLIK  285

Query  1015  --------GQVISAVKAEMRVSEADVLELANLIGE-----KAVDETGIIDETMEEENGKS  1155
                     G  +   +  ++V + +  EL N+  +     K + E  I+      E+ K 
Sbjct  286   PSLPIGFFGNALHFSELSLKVEDMENDELGNIAKQIHNHLKEITEEEILSSIEWFESQKE  345

Query  1156  AD---FF----VYGANLTFVNLEEVK-----IY-GFDMKGQKPIFANYTIGGVGDEGAVL  1296
             ++   F     +YG+ LT V +EE K     +Y       +KP   +  +G VG EG ++
Sbjct  346   SEGGKFLTPKCMYGSELTCVYMEEEKETESLLYDAMFSDNEKPAHVSCRVGNVGGEGLIM  405

Query  1297  VLPGPENLKGKEGGRIVNVILPEHLLGKLKNE  1392
             V+P  E    +   R V  +LPE  L KL N+
Sbjct  406   VMPSME----RGFARTVIAMLPEEELEKLSND  433



>ref|XP_011004269.1| PREDICTED: protein ECERIFERUM 26-like [Populus euphratica]
 ref|XP_011004270.1| PREDICTED: protein ECERIFERUM 26-like [Populus euphratica]
Length=472

 Score =   115 bits (287),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 114/430 (27%), Positives = 193/430 (45%), Gaps = 45/430 (10%)
 Frame = +1

Query  169   GEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFYPAAGRIRTS  348
             G G+   L+  D AM LH +  V+ +++      +   L+  +  +L  +    GR+ T 
Sbjct  45    GSGKTHPLSVLDHAMGLHTVHVVFYYKNNPFGIFDVDPLRIALSEVLCLYPQVTGRL-TR  103

Query  349   PEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVFI  528
              E G   VKC+D+GVR++ AK   T+DEWL  +D SE   L   +++      +SP   +
Sbjct  104   GESGNWLVKCHDAGVRVLRAKVEATMDEWLRSADGSEEKDLTFWEEIPEEPSTWSPFR-V  162

Query  529   QITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADN-HNSP  705
             Q+  F+ GG++ G+S  H+  D  S++     +   +   R  P +HP + ++   H+  
Sbjct  163   QVNEFEGGGVAFGLSCTHMNADPTSITLLFKSW---IECHRQEPLEHPPLFSSTTLHHQQ  219

Query  706   KPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKVKP  885
              P T         + G        T + KM T ++  +   +   + +V    Q AK  P
Sbjct  220   VPNTSTKPDNYYATKGNAE-----TPSVKMVTATFKFSGSAIKKWLDEVH--DQCAKATP  272

Query  886   FEAISALFWKSLAKVK--EGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKAEMRVSE  1059
             FE ++ALFW  +A +K  +     +++I  +    R     P   G   +A+   +   +
Sbjct  273   FELLAALFWTRVAHLKAPKNDNKHSLSICLD---FRRLVQPPISLGYFGNALHFSLLTLD  329

Query  1060  ADVLELANL-------------IGEKAVDETGIIDETMEEENGKSAD-FFVYGANLTFVN  1197
              + ++   L             +GE+ V       E+ +EE GK A  F +YG  LT V+
Sbjct  330   EEEMDYGKLGHVVNMVHRHISNVGEEEVWSVVDWFESQKEEGGKYAQPFRMYGPELTCVS  389

Query  1198  LEEVKI------YGFDMKG-QKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG-GRIVNV  1353
             +E + I      +    K  +KP+  +  +G V  EG ++VLP  E     EG  R V V
Sbjct  390   MEHMIIGHKSLMFPASFKSDEKPVHVSCHVGNVRGEGLIVVLPSVE-----EGLARTVMV  444

Query  1354  ILPEHLLGKL  1383
              LPE  + KL
Sbjct  445   TLPEEEMPKL  454



>ref|XP_008455878.1| PREDICTED: protein ECERIFERUM 26 [Cucumis melo]
Length=471

 Score =   114 bits (286),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 113/443 (26%), Positives = 197/443 (44%), Gaps = 51/443 (12%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFYP  324
             + V +  +  GRV  L  AD A+  H    V  +            ++  + ++L  +  
Sbjct  15    TAVSSNPSVSGRVYPLLAADHALARHSAAVVMYYSENPFGSFILDPMRESLSKILTLYPT  74

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
               GR+ T  E+G   VK ND+GVR+   K   ++DEWL  +D  E   L   D +     
Sbjct  75    VTGRL-TRTENGNWAVKGNDAGVRVTMTKVGSSLDEWLRSADSVEERDLAAFDDMPEDPY  133

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP-HMP  681
              +SP   IQI  F+ GG++IG+S+ H+L D  S +  L  +  A  GR   PP     + 
Sbjct  134   IWSPFR-IQINEFEGGGVAIGVSFTHLLADPTSATFLLKTWADAHRGRPVSPPLFTRRLS  192

Query  682   TADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGL  861
               D    P   T+    ++  S   + DH  + +  KM++ ++  ++  +N  + K+   
Sbjct  193   LGDGEKIPNIATKSTTFYANKS--KLDDH--IVSPTKMSSVTFKFSNTTMNQCLSKIK--  246

Query  862   KQSAKVKPFEAISALFWKSLAKVKEGS------------GLETVTIVKNGFHSRGNGLLP  1005
                    PF+ +++LFWK + K+K  S             L   + ++N F S  +    
Sbjct  247   PHCPNATPFDFLASLFWKQILKIKSNSPKDGQNNNNNNHSLSICSDIRNSFQSSNSQRYY  306

Query  1006  CRNGQVISAVK---AEMRVSE-ADVLELAN----LIGEKAVDETGIID--ETMEEENGKS  1155
               N   IS +     EM  +E   ++EL +     +GE+  +    ++  E+ +E++G+ 
Sbjct  307   FGNALHISQLTIDPKEMAENELGHIVELVHNHLERLGEEEEETWSAMEWLESQKEKDGRY  366

Query  1156  A-DFFVYGANLTFVNLEEVKIYGFD-----------MKGQKPIFANYTIGGVGDEGAVLV  1299
                F +YG  L+ V++E + +   +           +K  KP+  +Y IG V  EG +++
Sbjct  367   VMPFTMYGPELSCVSMEHMMMKKGNENESLSYATKFVKDSKPVHVSYNIGNVEGEGLIII  426

Query  1300  LPGPENLKGKEGG--RIVNVILP  1362
             +P        EGG  R V V+LP
Sbjct  427   MP------SNEGGVARNVKVMLP  443



>ref|XP_002463889.1| hypothetical protein SORBIDRAFT_01g008360 [Sorghum bicolor]
 gb|EER90887.1| hypothetical protein SORBIDRAFT_01g008360 [Sorghum bicolor]
Length=465

 Score =   114 bits (285),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 121/444 (27%), Positives = 188/444 (42%), Gaps = 57/444 (13%)
 Frame = +1

Query  142   SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFY  321
             S+    T    G+   L+  D AM+ H +  V   R  A  GL+   LK  +  +L   Y
Sbjct  26    STAASVTPVRPGKTHALSPLDNAMERHTVHVVLYLR--AAPGLDREQLKESLSEVL-SLY  82

Query  322   PA-AGRI-RTSPEDGRP-------------FVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
             PA  GR+ R    DG                VKCND+GVR+V+A+   T+DEWL  +   
Sbjct  83    PAMTGRLTRGEGSDGAGTGSADAAHAHRGWVVKCNDAGVRMVDARAGVTLDEWLATATGD  142

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
             E   LL+++  LGPD       ++Q+T F     ++G+S  H+  D  + + F + +  A
Sbjct  143   EEMDLLYYEP-LGPDPYIWSPFYVQLTEFADKSYALGLSCTHIHNDPTAAALFFHAW--A  199

Query  637   MAGRRDLPPKHP--HMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSY  810
              A RR   P  P  H P      +  P    L      +V P       T+   M++ ++
Sbjct  200   AAHRRTTSPYPPFLHAPALAVSPTSPPPPPPLLAEKASAVSPAS-----TDATAMSSATF  254

Query  811   HITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRG  990
             H     + AL+  +          PF A++ALFW  +    +G G  T+ +    F  R 
Sbjct  255   HFPASAVRALLSTL-----EPGTTPFAALAALFWLRITGAADGEGELTLAL---DFRKRM  306

Query  991   NGLLPCRNGQVISAVK-AEMRVSEADVLELANLIGEKAVDETGIIDETM-----------  1134
                LP   G   S+V  A  R   A  L       ++ V   G+ ++ +           
Sbjct  307   YAPLPL--GYYGSSVHFARARADLASGLPAVAAALDRHV--AGVPEDDLWRALEWLHARQ  362

Query  1135  EEENGKSADFFVYGANLTFVNLEEVKIYGFDMK-GQKPIFANYTIGGVGDEGAVLVLPGP  1311
             ++E   +A F +YG  LT   L+ V +YG + + G  P   +  +GG   EG VLVLP  
Sbjct  363   QQEGDAAAPFQMYGPELTCAALDHVLMYGAEFEAGVPPARVSCRVGGAAGEGLVLVLPAA  422

Query  1312  ENLKGKEGGRIVNVILPEHLLGKL  1383
             E  + ++    V V LP     ++
Sbjct  423   EGGEARD----VVVTLPAEATARI  442



>ref|XP_003626431.1| Omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
 gb|AES82649.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=459

 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 120/462 (26%), Positives = 194/462 (42%), Gaps = 67/462 (15%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEA--VDGLNTGDLKSP  294
             +  D +L+ VV +     G+   LT  D  M  H L  +Y +++E           L+  
Sbjct  8     VTLDSKLT-VVSSRPVSSGKSHKLTGVDHGMSYHTLHLIYYYKNEEKWFGSFELDPLRES  66

Query  295   MFRMLEDFYPAAGRI-RTSPEDGRPF-VKCNDSGVRIVEAKCSKTIDEWLDMSDQ-SEYD  465
             +  +L  +    GR+ R   EDG  + V+CND+GVRI++A    TIDEWL  S   S+  
Sbjct  67    LSEVLSIYPTITGRLGREKEEDGGNWEVRCNDAGVRIIKANVDSTIDEWLSSSATGSDEA  126

Query  466   HLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG  645
              L+  D +      +SP   IQI  FK GG++IG+S++H+L D    S F   +      
Sbjct  127   QLIAWDDMPHDPSTWSPFR-IQINSFKEGGVAIGLSYSHMLSDLTFASSFFKSWTQT---  182

Query  646   RRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDK  825
              R  P  +    T  N  +  P      P S  S+ P      +T++  +AT ++  +  
Sbjct  183   HRHSPISNSPFFTPINITTSSPLLNNNIPNS--SLKPQ----TITSSSNLATATFKFSSS  236

Query  826   QLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLP  1005
              +   +  +   K+     PF+ +SALFW  +  +K               H++ + L  
Sbjct  237   IIKHSLSIIQN-KKCLNATPFDFLSALFWTRVTHLK-----------PTKIHNQTHSLSI  284

Query  1006  CRN--------------GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETM---  1134
             CR+              G  +      +++ E +  EL ++         G+ D+ +   
Sbjct  285   CRDFRKLIKPSLPTGYFGNALHFSNLSLKMEEMENGELGDIASLIHTKLKGVTDKEIRSS  344

Query  1135  --------EEENGK-SADFFVYGANLTFVNLEEVKIYGFDMK-----GQKPIFANYTIGG  1272
                     E E GK      +YG  LTFV +EE +      +      +KP   +  +G 
Sbjct  345   IEWFESQKETEEGKFGTPKCMYGKELTFVCMEEEETESLLYESMFCDSEKPAHVSCRVGN  404

Query  1273  VGDEGAVLVLPGPENLKGKEGG--RIVNVILPEHLLGKLKNE  1392
             V  EG ++V+P        EGG  R V V+L E  L KL N+
Sbjct  405   VEGEGLIIVMP------SSEGGFARTVIVMLKEEELDKLCND  440



>gb|KFK26566.1| hypothetical protein AALP_AA8G265500 [Arabis alpina]
Length=425

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 113/440 (26%), Positives = 191/440 (43%), Gaps = 50/440 (11%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSP  294
             EN V    + + V +  +   RV   T  D AM  H +  V+ +        +   ++ P
Sbjct  6     ENRVEIKSMLTTVSSKPSASDRVHTFTALDSAMSPHTVHVVFYYARSPFGSFDLDSVRIP  65

Query  295   MFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLL  474
             +  +L  + P  GR+  +P DG   VKCND+G+RI+ AK    IDEWL  +D  E   L 
Sbjct  66    LSELLCLYPPVVGRVTKNP-DGIWEVKCNDAGLRILRAKVCVGIDEWLRSADGHEETDLT  124

Query  475   HHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRD  654
               +++      +SP   +QI  F+ GG+++G+S  H   D  +L+  L  +    A RR 
Sbjct  125   AWEEMPEDPTTWSPFR-LQINEFEGGGVALGLSCPHRQADPTTLTILLKSW--TEAQRRQ  181

Query  655   LPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWK-LTNTCKMATQSYHITDKQL  831
                  P                 + P  L  +  V  + K ++     AT ++  +D   
Sbjct  182   CIVHPPSF--------------SILPLDLTDINAVKPNAKPISTKTATATATFRFSDSAF  227

Query  832   NAL--IFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKN----GFHSRGN  993
                  ++ + G+   A   PF+  +ALFW  +A+ +    ++   ++ +    GF   GN
Sbjct  228   KRCLQVYSIDGIFPQA--SPFDVFAALFWTRVARDRVSICVDFRRLLPDPLPYGFF--GN  283

Query  994   GLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVY  1173
              L         S+++    V +  +  +A LI E        +++   + N   +   +Y
Sbjct  284   AL-------SFSSLEISDTVDKG-IGHVARLINEHVASLD--VEKIRFDLNRAGSQGLMY  333

Query  1174  GANLTFVNLEEVKIYGFDM-------KGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE  1332
             G +LT VN+E + + G  +        G +P   +Y IG  G EG + V+P PE    K 
Sbjct  334   GRDLTIVNMEHLIVEGEPLMYKAVFEDGVRPEHVSYRIGNHGGEGMITVMPSPE----KG  389

Query  1333  GGRIVNVILPEHLLGKLKNE  1392
              GR V V LPE  + KL ++
Sbjct  390   FGRTVAVSLPEVEMAKLLSD  409



>ref|XP_006382783.1| hypothetical protein POPTR_0005s05380g [Populus trichocarpa]
 gb|ERP60580.1| hypothetical protein POPTR_0005s05380g [Populus trichocarpa]
Length=450

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 120/447 (27%), Positives = 196/447 (44%), Gaps = 39/447 (9%)
 Frame = +1

Query  109   DVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLK  288
             ++ + V  H + + V +   G G+   L+  D AM LH L  V+ ++       +   LK
Sbjct  3     NINSRVSVHSMLTAVSSKPVGPGQTHPLSALDHAMALHTLHLVFYYKKNPFGIFDVDPLK  62

Query  289   SPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDH  468
               +  +L  +   AGR+ T  E G   VKCND+GVRI+ A    TIDEWL  +D SE   
Sbjct  63    VSLSEVLSLYPQVAGRL-TRGESGNWEVKCNDAGVRILRANVGVTIDEWLRSADVSEEKD  121

Query  469   LLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGR  648
             L   +++      +SP   IQ+  F+ GG++ G+S  H+  D  S++     +   +   
Sbjct  122   LTVWEEMPEDPSTWSPFR-IQVNEFEGGGVAFGLSCTHMNADPTSVTLLFKSW---IESH  177

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKL-TNTCKMATQSYHITDK  825
             R  P +HP +      NS     Q++   S  S     +     T + KM T ++  ++ 
Sbjct  178   RQEPIEHPPL-----FNSTPLHHQQVPDTSGKSTNYYANKANARTPSVKMVTATFRFSNS  232

Query  826   QLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTI-VKNGFHSRGNGLL  1002
              +N  + +V    Q  +  PF+ ++ALFW  L  +K        ++ V   F       +
Sbjct  233   AINKCLNEVH--DQCPQATPFDLLAALFWTRLVLLKAPKHDNKCSLSVCLDFRRLVQPPI  290

Query  1003  PC-RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGI--------ID--ETMEEENG  1149
             P    G  +      +   E D  +L +++       +G+        +D  E+ +EE G
Sbjct  291   PLGYFGNALHFSMLTLNEEEMDYGKLGHVVELVHRHVSGVETEEVWYAVDWLESQKEEGG  350

Query  1150  KSA-DFFVYGANLTFVNLEEVKIYGFDMKG-------QKPIFANYTIGGVGDEGAVLVLP  1305
             K A  F +YG  LT V++E + I    +         +KP+      G V  EG ++VLP
Sbjct  351   KHAPPFRMYGPELTCVSMEHMIIGNKSLMSSASFKSDEKPVHVACHFGNVVGEGLIVVLP  410

Query  1306  GPENLKGKEG-GRIVNVILPEHLLGKL  1383
               E     EG  R V V LPE  + +L
Sbjct  411   SVE-----EGLARTVIVTLPEEEMPQL  432



>ref|XP_002273086.1| PREDICTED: protein ECERIFERUM 26-like [Vitis vinifera]
Length=443

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 120/453 (26%), Positives = 194/453 (43%), Gaps = 62/453 (14%)
 Frame = +1

Query  118   NIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPM  297
              +  + RL+ VV +   G G    L+  D AM LH +  ++ + +      +    +  +
Sbjct  3     RVTVNSRLT-VVSSKPVGPGVTHKLSGLDHAMGLHTIHMIFYYGNNPATSFDLDPFRVSL  61

Query  298   FRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
               +L   YPA        EDG   V CND+GVR++ A    T+DEWL  +D +E      
Sbjct  62    SEVL-SMYPAVTGRLIRGEDGNWVVNCNDAGVRVLRATVRTTLDEWLRSADGAE-----E  115

Query  478   HDQVLGPDLGFSPLVF----IQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG  645
              D  +  D+   P ++    IQI  F+ GG++IG+S  H+  D    +  L  +  + A 
Sbjct  116   RDLTVWEDMAQDPTIWSPFRIQINEFEGGGIAIGLSCTHLHADPTCATLLLKSW--SEAH  173

Query  646   RRDLPPKHPHMPTADNHNSP----KPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYH  813
             RR+     P   ++     P    K ++   +     +  P         + KMA  ++ 
Sbjct  174   RREAIAHPPFFHSSALRGRPVLNTKTKSANYYAAKSKAKPP---------SVKMAATTFR  224

Query  814   ITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGS-----GLETVTIVKNGF  978
              +D  +   + +V   +      PF+ ++ALFW SLA +K  +      L      +   
Sbjct  225   FSDSSIKQCLEEVH--ESCPDATPFDLLAALFWTSLAPMKSPAPDHKHSLSICIDFRKLM  282

Query  979   HSR------GNGLLPCRNGQVISAVKAEM---RVSEAD--VLELANLIGEKAVDETGIID  1125
             H+       GN L    +  ++S  + E+   R+      V E  + I E+      +ID
Sbjct  283   HAPLPYGYFGNAL----HFSLLSRDREEIDNGRLGHVTGLVHEHVSSINEEECQ--SVID  336

Query  1126  --ETMEEENGK-SADFFVYGANLTFVNLEEVKI---YGFDMKGQKPIFANYTIGGVGDEG  1287
               E+ + E GK  A F +YG  LT V++E + I   Y    K  KP+     +G V  EG
Sbjct  337   WLESQKGEGGKFGAPFRMYGPELTCVSMEHMVIPRGYAGMFKDAKPVHIACHVGNVEGEG  396

Query  1288  AVLVLPGPENLKGKEG-GRIVNVILPEHLLGKL  1383
              ++VLP  E     EG  R V V LPE  + KL
Sbjct  397   LIMVLPSHE-----EGLARTVMVTLPEEQMAKL  424



>ref|XP_007013792.1| Transferase, putative [Theobroma cacao]
 gb|EOY31411.1| Transferase, putative [Theobroma cacao]
Length=452

 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 121/438 (28%), Positives = 194/438 (44%), Gaps = 43/438 (10%)
 Frame = +1

Query  145   SVVPATITGE-GRVLNLTNADLAMKLHYLRGVYLFRSE---AVDGLNTGDLKSPMFRMLE  312
             SVV +    E G+  +++  D  M+ + ++ VY + S    A  G     L+  +  +L 
Sbjct  13    SVVSSRWHAEPGKFCHVSVLDRLMEQNQVKIVYYYPSRGDHAEPGEWIKKLRDSLSCVLT  72

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVL  492
             +F    GR+  + ++G   VKCND GVR+VEAK   ++++WL   D+ +   LL+ +++ 
Sbjct  73    NFPILTGRLHKN-QEGHWMVKCNDGGVRMVEAKVKGSVEDWLKSVDREKELKLLYWEEMF  131

Query  493   GPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG-PAMAGRRDLPPKH  669
                  + P V++Q+T F+ GGL+IG+S  H+L D    + F   +    ++G    PP  
Sbjct  132   HKPYHW-PTVYVQVTEFEKGGLAIGLSCCHLLADPICATMFSKAWADTTLSGIMSTPPLF  190

Query  670   PHMPTADNHNSPKPRTQKL------FPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQL  831
               +P      S  P  +        + +S+  + P      LT   K AT +   TD  +
Sbjct  191   HSLPLTKADYSKNPNHESCTDLINYYKYSIERLTP------LTTNQKYATVTLSFTDSMV  244

Query  832   NALIFKVSGLKQSAK-VKP-FEAISALFWKSLAKVKEGSG----LETVTIVKNGFHSRGN  993
                I        S K   P FEA++ALFW  L+KVK   G    +     ++N       
Sbjct  245   RDCIAMAQATGASGKSCSPAFEALAALFWVCLSKVKATKGRLFNMSLCLDMRNCL-----  299

Query  994   GLLPCRNGQVISAVKAEMRVSEADVL-ELANLIGE--KAVDETGIIDETME-EENGKSAD  1161
             GL P   G  +   K  +  +   +L E    I E  K ++  GI D     + N     
Sbjct  300   GLDPGFFGNCMVCNKVHLESAGETMLPEATKAISEVVKKMNAEGIKDLIQWLKCNDNQTV  359

Query  1162  FFVYGANLTFVNLEEVKIYGFDMKGQ-KPIFANYTIGGVGDEGAVLV---LPGPENLKGK  1329
               + G +L  VNLE V  Y    K Q +P+  +Y +  +   G VL+    PG  +L   
Sbjct  360   PLMNGYDLICVNLEGVNPYLATFKDQLEPLQVSYYVEPMVGPGQVLISRSAPGEGSL---  416

Query  1330  EGGRIVNVILPEHLLGKL  1383
                R+V   LPE  + KL
Sbjct  417   --SRVVMATLPEDEVAKL  432



>ref|XP_009364516.1| PREDICTED: protein ECERIFERUM 26-like [Pyrus x bretschneideri]
Length=456

 Score =   112 bits (280),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 119/455 (26%), Positives = 198/455 (44%), Gaps = 46/455 (10%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M + D  + V  H   +VV +     G+    T  D AM LH L  V+ ++ +    ++ 
Sbjct  1     MPAADGRSRVVVHSKLTVVSSRPVVPGKAHTFTALDHAMGLHSLHVVFYYKEQLFGSIDL  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
               L+  +   L  +    GR+  +P DG   VKCND+GVR++ A+   T+DEWL   D S
Sbjct  61    DPLRVSLSETLSLYPQVTGRLDKNP-DGNWEVKCNDAGVRVLMARVGTTLDEWLRSGDGS  119

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
             E   L   D +      +SP   IQI  F+ GG++IG+S  H+  D  + +  L K    
Sbjct  120   EERLLTMWDDMPDDHSTWSP-CRIQINEFEGGGVAIGLSCTHMHADP-TCATLLIKSWAE  177

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHI  816
                R  +   HP      +    +P  Q +   S  +               +A+++  +
Sbjct  178   THCREAI--SHPLFVDESSALGGRPVDQVINKKSSAA---------YYEAKSVASKTTSL  226

Query  817   TDKQLNALIFKVSG------LKQSAKVKPFEAISALFWKSLAKVK--EGSGLETVTIV--  966
               K++    FK S       L       PF+ ++A+FW  +A++K  E     + ++   
Sbjct  227   PVKKMGTATFKFSNSTIKRELNSCPGATPFDLLAAMFWTQIARLKPSESKTKHSFSVCID  286

Query  967   ---KNGFHSRGNGL-LPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIID--E  1128
                K  F   GN L     +   +  ++ E  ++    +   ++  +K  D    +D  E
Sbjct  287   FRKKKSFGYYGNALHFSLLSVPDVEELEREDGLAHVVGVVHRHVSSQKEEDFWSGMDWFE  346

Query  1129  TMEEENGKSAD-FFVYGANLTFVNLEEV------KIYGFDM-KGQKPIFANYTIGGVGDE  1284
               + E GK  + F +YG  LT V++E +       +YG    K +KP+  +Y +G +  E
Sbjct  347   AQKGEGGKFGEPFKLYGPELTCVSMEHMLDECQPLMYGVMFEKEKKPVHVSYHVGNMEGE  406

Query  1285  GAVLVLPGPENLKGKEGG--RIVNVILPEHLLGKL  1383
             G ++V+P P      EGG  R V V LPE  L +L
Sbjct  407   GLIMVMPAP------EGGLARTVMVTLPEEELAQL  435



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 119/426 (28%), Positives = 178/426 (42%), Gaps = 69/426 (16%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSE-AVDGLNTGDLKSPMFRMLEDFYP  324
             V PA  T E + L ++NADL ++  +   VY FRS  + D  N   LK  + ++L  FYP
Sbjct  11    VRPAESTPE-QTLWISNADLVVRRSHTPIVYFFRSNGSADFFNLHLLKEALSKVLVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
              AGR+  + E GR  + CN  GV +VEA+   TID++ D S   E   L+       P +
Sbjct  70    VAGRLNGNNEGGRLEINCNGKGVLLVEAETGSTIDDFGDFSATQELRQLI-------PVV  122

Query  505   GFS------PLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PA  636
              +S      PL+ +Q+T F+CGG+S+G++  H L D  S+  F+N +           P+
Sbjct  123   DYSQHISSYPLLLLQVTRFRCGGVSLGVAMHHSLVDGASIIHFINSWSELTRGLQLKIPS  182

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHI  816
                R  L  +HP  P A +H    P      P S    GP            +A     I
Sbjct  183   SLDRSQLHARHPPTP-AFHHIEYLPPPSMKTPTS--QSGPT----------HVAVAKLKI  229

Query  817   TDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGL----ETVTIVKNGFHS  984
             T  Q+NAL  K      +     +E +    W+ + K +   GL    +T   +     S
Sbjct  230   TVDQINALKAKAEEDSNTLNYSSYEVLVGHVWRCVCKAR---GLCDDQDTKLYMAVDLRS  286

Query  985   RGNGLLP---CRNGQVISA---VKAEMRVSEADVLELANLIGEKAVDETGIIDETMEE--  1140
             R    LP     NG ++++   V  ++R        LA  +G        + DE +    
Sbjct  287   RLRPPLPQGYFGNGTLVTSPIGVAGDLRSK-----PLAYAVGRIHDQLMRMNDEYLRSAI  341

Query  1141  ---ENGKSADFFVYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAV  1293
                E        V GA      N+  VN  ++ IY  D    +PI+       V  EG  
Sbjct  342   DYLELQPDLTALVRGADTFRCPNMGIVNWTQLPIYDADFGWGRPIYMG--PATVLHEGMA  399

Query  1294  LVLPGP  1311
              +LP P
Sbjct  400   YILPSP  405



>ref|XP_008388670.1| PREDICTED: protein ECERIFERUM 26-like [Malus domestica]
Length=456

 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 116/455 (25%), Positives = 201/455 (44%), Gaps = 46/455 (10%)
 Frame = +1

Query  97    MESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNT  276
             M + D  + V  H   +VV +     G+    T  D AM LH L  V+ ++ +    ++ 
Sbjct  1     MPAADGRSRVVVHSKLTVVSSRPVVPGKTHTFTALDHAMGLHSLHVVFYYKEQLFGSIDL  60

Query  277   GDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQS  456
               L+  +   L  +    GR+  +P DG   VKCND+GVR++ A+   T+DEWL   D+S
Sbjct  61    DPLRVSLSETLSLYPQVTGRVDKNP-DGNWEVKCNDAGVRVLMARVGTTLDEWLRSGDRS  119

Query  457   EYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
             E   L   D +      +SP   IQI  F+ GG++IG+S  H+  D    +  +  +  A
Sbjct  120   EERLLTMWDDMPDDHSTWSPYR-IQINEFEGGGVAIGLSCTHMHADPTCATLLIKSW--A  176

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHI  816
                RR+    HP +    +    +P  Q +   S  +               +A+++  +
Sbjct  177   ETHRRE-AISHPLLVDGSSVLGGRPVDQVINKKSSAA---------YYEAKFVASKTTSL  226

Query  817   TDKQLNALIFKVSG------LKQSAKVKPFEAISALFWKSLAKVK--EGSGLETVTIV--  966
               +++    FK S       L       PF+ ++A+FW  +A++K  E     ++++   
Sbjct  227   PVRKMGTATFKFSNSTIKQELNSCPGATPFDLLAAMFWTQIARLKPSESKXKHSISVCID  286

Query  967   ---KNGFHSRGNGL-LPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIID--E  1128
                K  F   GN +     +   +  ++ E  ++    +   ++  +K  D    +D  E
Sbjct  287   FRKKKSFGYYGNAMHFSLLSVLDVEELEREDGLAHVVRVVHRHVSSQKEEDFWSGMDWFE  346

Query  1129  TMEEENGKSAD-FFVYGANLTFVNLEEV------KIYGFDM-KGQKPIFANYTIGGVGDE  1284
               + E  K  + F +YG  LT V++E +       +YG    K +KP+  +Y +G +  E
Sbjct  347   AQKGEGDKFGEPFKLYGPELTCVSMEHMLDDCQPLMYGVMFEKEEKPVHVSYHVGNMEGE  406

Query  1285  GAVLVLPGPENLKGKEGG--RIVNVILPEHLLGKL  1383
             G ++V+P P      EGG  R V V LPE  L +L
Sbjct  407   GLIMVMPAP------EGGLARTVMVTLPEGELAQL  435



>ref|XP_003588700.1| Taxadien-5-alpha-ol O-acetyltransferase [Medicago truncatula]
 gb|AES58951.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=448

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 119/441 (27%), Positives = 195/441 (44%), Gaps = 49/441 (11%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS--EAVDGLNTGDLKSPMFRMLEDF  318
             +VV       G+ L L+  D  M  +++R VY +++  +   G  T  L+  +  ML  F
Sbjct  12    TVVSTKAVEPGKYLPLSVLDRFMDKNHIRMVYYYQTSGDLELGQLTKKLRETLSEMLSHF  71

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
                 GR+    E G   +KCND+GVR+VEAK   +++EWL   D+ +   L++ + +L  
Sbjct  72    PIVTGRLLRD-EMGHWKIKCNDAGVRMVEAKAKGSVEEWLRSVDREKELKLVYWEDMLQK  130

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHM  678
                +S   ++Q+T F+ GGL+IG+S  H+L D+   + F+  +     G +   P     
Sbjct  131   PYYWSTF-YVQLTEFEEGGLAIGLSCTHLLADSICATKFMKAWADISLGNKITSP-----  184

Query  679   PTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNT------CKMATQSYHITDKQLNAL  840
             P    H  P  R Q   P +   +  +  +  L          K  T S   +D+ + A 
Sbjct  185   PIF--HPLPHQRPQNRKPNNNSYMSLISHYKSLIENPISIKEAKYTTISMGFSDQMVQAC  242

Query  841   IFKVS---GLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCR  1011
             I        L  ++   PFEA++ LFW +L+K+K   G++   +V    +     +L   
Sbjct  243   ISMAQPNDSLSPTSTPTPFEALAGLFWVTLSKIK---GIKN-GLVDTSLYLDVRKILGLD  298

Query  1012  NGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETME--------------EENG  1149
              G   ++    M  ++  + E  NL  +K    T  I   +               E N 
Sbjct  299   EGFFGNS----MLYNKVHLDENFNLDYDKFPQATKAIRNVVTKFGNEEIMGLIEWFENND  354

Query  1150  KSADFFVYGANLTFVNLEEVKIYGFDMKGQ-KPIFANYTIGGVGDEGAVLVLPGPENLKG  1326
              ++   + G +L F +LE V+ Y    + + KPI  +Y I  V  EG VL+LP   +   
Sbjct  355   INSSAMMNGHDLVFTSLENVEPYLAMFQDKFKPIHVSYYIEPVFGEGHVLILPTSND---  411

Query  1327  KEG--GRIVNVILPEHLLGKL  1383
              EG  GR+V V L E    KL
Sbjct  412   -EGPLGRVVMVTLQEEEAIKL  431



>ref|XP_002514352.1| transferase, putative [Ricinus communis]
 gb|EEF48306.1| transferase, putative [Ricinus communis]
Length=448

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 123/446 (28%), Positives = 201/446 (45%), Gaps = 37/446 (8%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEA--VDGLNTGDLKSPMFRMLEDF  318
             +VV       G+   L+     M+ ++LR VY F++      G  T  L+  +  +L  +
Sbjct  11    TVVSTKPVQPGKFFPLSVLGRLMERNHLRIVYYFQTPGGREAGEITKKLRESLSELLTCY  70

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
                 GR+    +DG+  VKCND+GVR+VEA+   +++EWL   D+ +   L+H +++   
Sbjct  71    PIVTGRLLKD-QDGQWMVKCNDAGVRVVEARAKGSVEEWLRSLDREKELTLIHWEEMFHK  129

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG-PAMAGRRDLPPK-HP  672
                +S   ++Q+T F+  G +IG+S  H L D    + F+  +     +G+   PP  HP
Sbjct  130   PYFWSTF-YVQLTEFEESGFAIGLSCFHPLADPTCATIFMKAWADTTFSGKMISPPLFHP  188

Query  673   HMPTADNHNSP--KPRTQKL--FPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNAL  840
               P    +  P  +P T  +  +  ++G    V      T     AT +   TD  + A 
Sbjct  189   LPPRRPGNKIPNHQPYTHLINHYKSTIGKTSSV----TATTGHAYATVALLFTDPMIRAC  244

Query  841   IF--KVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRG--NGLLP  1005
             +   + +         PF+A+S LFW  ++KVK + +GL  ++I  +     G  +G   
Sbjct  245   MAMSRTTRRPDQPNPSPFQALSGLFWACISKVKGKENGLIDMSICLDMRKVLGLDHGFF-  303

Query  1006  CRNGQVISAVKAEMRVSEADVLELANLIGEK---AVDETGIID--ETMEEENGKSADFFV  1170
                G  +   K + +    D +  A    E+    +D  GI+D  E +E  + ++    +
Sbjct  304   ---GNCMVYNKVQPKSLSNDKISSATWAIEEEMAKMDTEGIMDLIEWLESNDCQTPP-LM  359

Query  1171  YGANLTFVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGG--R  1341
              G +L   NLE V  Y      G  PI  +Y +  V   G VLVLP P      EG   +
Sbjct  360   NGCDLICANLEGVDPYLAIFEGGLAPIRVSYHVEPVSGAGQVLVLPSPPG----EGAMSK  415

Query  1342  IVNVILPEHLLGKLKNEISKELGTSP  1419
             +V V LPE  + KL  E    LG SP
Sbjct  416   VVMVTLPEDEVFKL-CEDDLILGFSP  440



>ref|XP_011081909.1| PREDICTED: protein ECERIFERUM 26-like [Sesamum indicum]
Length=446

 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 120/416 (29%), Positives = 192/416 (46%), Gaps = 37/416 (9%)
 Frame = +1

Query  175   GRVLNLTNADLAMKLHYLRGVYLF--RSEAVDGLNTGDLKSPMFRMLEDFYPAAGRI-RT  345
             G+   L+  D  M+ ++LR V+ +  ++    G  T  L+  +  ML  F    GR+ RT
Sbjct  21    GQFSPLSILDRVMEHNHLRVVFYYSLQTRRRAGELTKKLRESISAMLSAFPVVTGRLLRT  80

Query  346   SPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVF  525
             S  +G   +KCNDSGVR+VEA+   TIDEWL   D+ +   L+H + +      +S   +
Sbjct  81    S--EGDWTIKCNDSGVRMVEARVEGTIDEWLKNVDREKELKLVHWEDMFHRPYFWSTF-Y  137

Query  526   IQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPTADNHNSP  705
             +QIT F+ GGL+IG+S  H+L D    +  +  +        D+      +     H  P
Sbjct  138   VQITEFEGGGLAIGLSCTHLLSDPTCAAMMIKAWA-------DVTLHGEIIAPPFFHPLP  190

Query  706   KPRT-QKLFPF-SLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN---ALIFKVSGLKQS  870
              PRT +K   F S+       ++    +  K  T + +   + +    A+    +     
Sbjct  191   PPRTGKKNRNFHSINHYKSAKENSVQASETKQTTITLNFNQQMVKICIAMARATNAHNSE  250

Query  871   AKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRG--NGLLPCRNGQVISAVKA  1041
               + PFEA++ALFW  ++KVK   S L  +++  +     G   G     N  V + VK 
Sbjct  251   QSLTPFEALAALFWTRISKVKGMKSALVDMSLCLDVRKVLGLEKGFFG--NCMVYNRVKG  308

Query  1042  EMRVSEADVLELANLIGEKAV----DETGIIDETMEEENGKSADFFVYGANLTFVNLEEV  1209
             +  + E D+   A  I E       DE   + E +E+EN +     + G+ L   NLE V
Sbjct  309   D-GIQETDLSRAAGFIKEAVSKTDRDEVMDLIEWLEQENWEKNPSCMNGSCLICANLENV  367

Query  1210  KIYG--FDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGG--RIVNVILPE  1365
               Y   F+ +   P+  +Y I  V   G +L+LP P    G +G   R+V+V LPE
Sbjct  368   DSYSAIFE-ENSSPLRVSYYIEPVAGAGQILILPSP----GGDGACSRVVSVTLPE  418



>gb|AFK44549.1| unknown [Medicago truncatula]
Length=138

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 86/130 (66%), Gaps = 7/130 (5%)
 Frame = +1

Query  1012  NGQVISAVKA--EMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANL  1185
             N Q+I  V+A  E  + + D+  LA+++ ++ +DE   I + +E + G + DFFVYGANL
Sbjct  3     NDQLICKVEAGKECSIVDTDLKNLASMLVDQGIDERNQIKDIVENDQGVT-DFFVYGANL  61

Query  1186  TFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPE  1365
             TF++LE+V ++   +KGQKP F  YT+ G GDEG VLVLP   +++GK     V +ILPE
Sbjct  62    TFLDLEDVNVHDLKLKGQKPRFVYYTLQGAGDEGVVLVLPKVNDIEGK----FVTIILPE  117

Query  1366  HLLGKLKNEI  1395
               + KLK+E+
Sbjct  118   DEMVKLKSEL  127



>ref|XP_010942061.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Elaeis guineensis]
Length=434

 Score =   108 bits (269),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 114/434 (26%), Positives = 178/434 (41%), Gaps = 63/434 (15%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSE-AVDGLNTGDLKSPM  297
             I+ + R + V PA  T   R+ N +N DL +   +   VY +R + + D  +   L++ +
Sbjct  2     IISERRSTMVRPAEPTPRRRLWN-SNLDLVVPRFHTPSVYFYRPDGSADFFDAERLRAAL  60

Query  298   FRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
              + L  FYP AGR+    EDGR  + CN  GV  VEA   +T+D++ D +   E   L+ 
Sbjct  61    AKALVPFYPMAGRLGRD-EDGRIEIDCNGEGVLFVEAAAERTVDDFGDFAPTMELKQLIP  119

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKY----------  627
                V   D+   PL+ +Q+T+FKCGG+S+G+   H + D  S   F+N +          
Sbjct  120   K-VVYTDDISAFPLLVLQVTYFKCGGVSLGVGMQHHVADGTSGLHFINSWSDVARGLGIS  178

Query  628   GPAMAGR---RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSV---GPVGDHWKLTNTC  789
              P    R   R   P  P  P  +    P  +     P  + SV   GPV          
Sbjct  179   APPFIDRTLLRARDPPTPSFPHVEYQPPPSMKAAATPPAPVNSVKSGGPV----------  228

Query  790   KMATQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWK--SLAKVKEGSGLETVTI  963
               A   +  T  QL+ L  K     + ++   +   +A  W+  SLA+      L  + I
Sbjct  229   -TAVSLFKFTRAQLDLLKAKA---PKGSRYSTYALFAAHVWRCASLARELPPDQLSKLYI  284

Query  964   VKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIG-EKAVDETGIIDETMEE  1140
               +G       L     G VI         +   V E+  ++G E A          M++
Sbjct  285   ATDGRQRLRPQLPAGYFGNVI--------FTATPVAEMVEVVGSEGAAGRIQASLARMDD  336

Query  1141  ENGKSA-DF---------FVYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGG  1272
             E  +SA D+          V GA      N+   +   + I+  D    +P+F     GG
Sbjct  337   EYLRSALDYLEIQPDLAALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMG--PGG  394

Query  1273  VGDEGAVLVLPGPE  1314
             +  EG   VLP P+
Sbjct  395   IAYEGLAFVLPSPD  408



>gb|EYU30520.1| hypothetical protein MIMGU_mgv1a006319mg [Erythranthe guttata]
Length=448

 Score =   108 bits (269),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 124/454 (27%), Positives = 195/454 (43%), Gaps = 82/454 (18%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAV-DGLNTGDLKSPMFRM-----  306
             SVV +  T  G+V  L+  D +M  H +  V+ + S    DG  + DL++  FR+     
Sbjct  17    SVVSSNPTRPGKVHKLSLLDQSMGPHTIHIVFYYGSNPFSDGPMSSDLEN--FRVSLSDV  74

Query  307   LEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSD-QSEYDHLLHHD  483
             L+++    GR+   P+ G   VKCND+GVR+++A+   T+DEWL  +D   E D  +  D
Sbjct  75    LDEYPVVTGRLTRGPDGGGWQVKCNDAGVRVLQARVDATVDEWLRSADVDEERDLTVWED  134

Query  484   QVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPP  663
               L P   +SP   IQ+  FKCGGL+IG+S  H+  D  S +  +  +    + +    P
Sbjct  135   MPLDPSF-WSPF-RIQVNNFKCGGLAIGLSCTHMHADITSATLLIKSWADYHSTQTLTYP  192

Query  664   KHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
                 +PT   H  P+  T         +              KMAT+             
Sbjct  193   PIFTLPT---HTHPQNTTTPPPHSPTTN--------TTPPPTKMATKC------------  229

Query  844   FKVSGLK-QSAKVKPFEAISALFWKSLAKVKE----GSGLETVTIVKNGFHSRGNGL-LP  1005
               +SG + Q     PF+ + AL W  +A  +E         +++I  +   +RG    +P
Sbjct  230   --LSGARSQCPDATPFDVLVALLWSKIAHWQEPHTADDNKRSISICTDSRGNRGQKTKIP  287

Query  1006  CRNGQVISAVKAEMRVSEADVL------ELANLIGEKAVDET--GIIDETMEEENGKSAD  1161
                G   +A+   +   EAD L      ++   +    VD    G++D   E+       
Sbjct  288   L--GYFGNALSFSVLTVEADELSSGKLGQVCEYVHRHVVDRAGPGLVDGDGEDP------  339

Query  1162  FFVYGANLTFVNLE---------EVKIYG--FD---------MKGQKPIFANYTIGGVGD  1281
               VYG  +T V+ E         E  +Y   FD         +KG+KP+  +Y+ G V  
Sbjct  340   VRVYGPQITCVSTEHLVDAEKNGEAIMYSAVFDNNNNNNKNNIKGEKPLHVSYSYGNVVG  399

Query  1282  EGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKL  1383
             EG ++V+P  E       GR V V LPE  +  L
Sbjct  400   EGLIVVVPTAE----VGPGRAVTVTLPEEQIDML  429



>ref|XP_010102303.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB93246.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=459

 Score =   108 bits (269),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 118/471 (25%), Positives = 198/471 (42%), Gaps = 66/471 (14%)
 Frame = +1

Query  88    VTIMESPDVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDG  267
             +T++E     NI   H   + V +   G G+    T  D AM LH L  V+ +++     
Sbjct  1     MTMLERKSRVNI---HSKLTTVSSRPVGPGKAHPFTALDHAMGLHSLHVVFYYKANIFKD  57

Query  268   LNTGDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMS  447
              +    +  +   L  + P  GRI  +  DG   V CND+GVRIV A    T+DEWL  +
Sbjct  58    FDLDPSRVSLSDALSLYPPVTGRIVRN-GDGNWEVNCNDAGVRIVRASVGTTLDEWLRSA  116

Query  448   DQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKY  627
             D  E   L   D +    + +SP   IQ+  F+ GG++IG+S  H+  D    +     +
Sbjct  117   DGVEEKDLAVWDDMPEDPINWSPF-RIQVNEFEGGGVAIGLSCTHMHADPTCATLLYKSW  175

Query  628   GPAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS  807
                   R  + P  P    +     P P T+        +        +   + KMAT +
Sbjct  176   IDTHRSRSVVHP--PVFSRSVIQARPDPNTETSSAAYYAAKSAA----RAPPSEKMATAT  229

Query  808   YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSR  987
             +  +   +   + ++S  +      PF+ ++ALFW  +A++K          VK   +  
Sbjct  230   FKFSHAAIKRRLMEIS--ENCTSATPFDLLAALFWTRVARLK----------VKAEGNDY  277

Query  988   GNGLLPCRNGQVISAVKAE---------------MRVSEADVLELANLIGE-----KAVD  1107
              + L  C + +++S    +               + + + D   L +++ E     +++D
Sbjct  278   SHSLSVCTDARMVSKENGKPVPLGYYGNALHFSLLSLEQVDGCGLGHVVREVHCHVESID  337

Query  1108  ETGI---ID--ETMEEENGK-SADFFVYGANLTFVNLEEV--------KIYGFDMKGQKP  1245
             E  I   ID  E+ + E GK    F +YG  LT + ++ +           GF  + + P
Sbjct  338   EEWIRSSIDWLESRKGEGGKYGPPFRMYGPELTCIRMDHMIGPSGPLTYEAGFGEEAE-P  396

Query  1246  IFANYTIGGVGDEGAVLVLPGPENLKGKEGG--RIVNVILPEHLLGKLKNE  1392
             I  +Y +  V  EG +LV+P P      EGG  R V V LPE  L +L  +
Sbjct  397   IHVSYHVRSVEGEGLILVMPSP------EGGLARAVTVTLPEKELAELSKD  441



>emb|CAN80953.1| hypothetical protein VITISV_032203 [Vitis vinifera]
Length=417

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 115/425 (27%), Positives = 196/425 (46%), Gaps = 37/425 (9%)
 Frame = +1

Query  211   MKLHYLRGVYLFRSEAVD--GLNTGDLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCND  384
             M  + +R VY +R+      G  T  L+  +  ML  F    GR++ + E+G+  +KCND
Sbjct  1     MDHNRVRIVYYYRTPPGREVGEVTKRLRETISEMLTSFPMVTGRLQRN-EEGQWVLKCND  59

Query  385   SGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSI  564
             +GVR+VEA+   ++ EWL   D+ +   L+H + +    + F    ++Q+T F+ GGL+I
Sbjct  60    AGVRMVEARAKGSVGEWLKSVDREKELKLVHWEDMFH-KIYFWSTFYVQLTEFEEGGLAI  118

Query  565   GISWAHVLGDAFSLSDFLNKYG-PAMAGRRDLPPK-HPHMPTAD-----NHNSPKPRTQK  723
             G S  H+L D    +  +  +   ++ G+   PP  H  +P        NHN P      
Sbjct  119   GFSCTHLLADPICATMIIKAWADTSLLGQMPNPPLFHSSLPLIRPINRINHN-PYTHLIN  177

Query  724   LFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLKQSAKV----KPFE  891
              +  SL +  PV      TNT K  T +   T   + A +       ++        PFE
Sbjct  178   HYKSSLDNSTPV------TNT-KYTTIALLFTSPMVQACMEMARTHPEAHGTPIFPSPFE  230

Query  892   AISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLLPCRNGQVISAVKA----EMRVS  1056
             A++ LFW  ++ VK    GL  ++I  +     G       N  V + V+        +S
Sbjct  231   ALAGLFWTCISNVKGWREGLINMSICLDMRKVLGLDEGFFGNCMVYNXVRGGDFNRHEIS  290

Query  1057  EADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDM-K  1233
             +A  + +  ++ +   +E   + + +E ++ +S+       +L   NLE+V+ Y     +
Sbjct  291   KA-AMAIRGVMEKMDSEEIMDLIQWLECDSNRSSVLMGGCEHLICTNLEDVEPYSAKFEE  349

Query  1234  GQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GRIVNVILPEHLLGKLKNEISKEL  1407
             G  P+  +Y I  V  +G VL+LP P     +EG   R+V V LPE+   KL  ++ + L
Sbjct  350   GYAPVRVSYHIEPVSTKGQVLILPAPP----EEGPLSRVVMVTLPENEAVKLCKDV-RVL  404

Query  1408  GTSPN  1422
               SP 
Sbjct  405   SFSPT  409



>ref|XP_007147162.1| hypothetical protein PHAVU_006G101000g [Phaseolus vulgaris]
 gb|ESW19156.1| hypothetical protein PHAVU_006G101000g [Phaseolus vulgaris]
Length=431

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 118/441 (27%), Positives = 186/441 (42%), Gaps = 55/441 (12%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEA--VDGLNTGDLKSPMFRMLEDF  318
             +VV +     G+V  L+  D  M  H L  ++ + +E       + G L+  +  +L  +
Sbjct  13    TVVSSRPVTSGKVHTLSVLDRGMASHTLHVIFYYMNEDNWFKSFDLGPLRESLSEVLTMY  72

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
                 GR+    E+G   VKCND+GVR  +A    T+ EWL  +  SE   L   D +   
Sbjct  73    PVVTGRL-VRGENGEWQVKCNDAGVRTTKATVDATLHEWLKSASHSEEKLLFTWDDMPEE  131

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHP--  672
             D    P   IQI  FK GG++I +S +H++ D   L+ F   +       R  P  HP  
Sbjct  132   DPSTWPPFRIQINSFKEGGVAIVVSCSHMVTDLTFLASFFKSWAEL---HRHFPITHPSL  188

Query  673   --HMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIF  846
                +PT   H S  P T+   P  L                  AT ++  +   +   + 
Sbjct  189   IASLPT-RGHASSSPPTKTASPKDL------------------ATATFKFSSSTIKQCLS  229

Query  847   KVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPCRNGQVI  1026
             KV          PF+ ++ALFW  +A+VK     +    +     SR         G + 
Sbjct  230   KVH--DSCPNATPFDFLAALFWTRVARVKPPKTQDQTHSLCLCTDSRSLQKPSLPIGYLG  287

Query  1027  SAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSAD-FFVYGANLTFVNLE  1203
             +A+       +   +EL  ++   AV     ++E  EEE G   +   VYG+ LT V +E
Sbjct  288   NALHFSTLSKKVKDVELGGVVS--AVHRH--LEELSEEEIGAGNEGKRVYGSELTCVCME  343

Query  1204  EVKI--------YG--FDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGG--RIV  1347
             ++ +        YG  F    +KP+  +  +G V  EG ++V+P        EGG  R V
Sbjct  344   QLMVEEDEESLLYGAVFGRNEEKPVHVSCWVGNVEGEGLIMVMP------CSEGGLSRSV  397

Query  1348  NVILPEHLLGKL-KNEISKEL  1407
              V+L E  + +L K+E   EL
Sbjct  398   MVMLAEEEVAELSKDEAIMEL  418



>ref|XP_010051199.1| PREDICTED: protein ECERIFERUM 26-like [Eucalyptus grandis]
 gb|KCW81447.1| hypothetical protein EUGRSUZ_C02832 [Eucalyptus grandis]
Length=449

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 194/445 (44%), Gaps = 75/445 (17%)
 Frame = +1

Query  175   GRVLNLTNADLAMKLHYLRGVYLFRSEAVD---GLNTGDLKSPMFRMLEDFYPAAGRIRT  345
             G+ L L+  D  M+  +LR VY +RS+      G  T  L+  + R L  F  A GR++ 
Sbjct  21    GKRLPLSVLDRLMEPKHLRVVYYYRSDEPAREAGERTRTLRETLARTLTSFPKATGRLQR  80

Query  346   SPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVF  525
               E GR  + CND+GVR++EA+   ++++WL  + + +   L+H +++      +S   +
Sbjct  81    DGE-GRWEIDCNDAGVRVMEARARGSVEDWLRNAGREDELRLVHWEEMFDTPYFWSTF-Y  138

Query  526   IQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP-AMAGR--------RDLPPKHP-H  675
             +Q+T F+ GG +IG+S  H+L D    + F+  +    +  R        R LP + P H
Sbjct  139   VQMTEFEGGGFAIGLSCIHLLADPTCATLFIKAWADMTLNARPTAPPPSFRALPKRRPSH  198

Query  676   MPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVS  855
                 D HNS       L      S+        LT + K  T S   T+  + + I    
Sbjct  199   RNDPDRHNS-------LINHCKSSINTSS----LTPSAKFGTLSLAFTEPIVRSCIAMAQ  247

Query  856   GLK--QSAKVKPFEAISALFWKSLAKVK-EGSGLETVT--------------------IV  966
              +         PFEA++ LFW  ++KVK E  GL ++                     + 
Sbjct  248   PVDAPDGPGPSPFEALAGLFWACISKVKGEREGLVSMCLGLDVRKLLGLEREFFGNCMVY  307

Query  967   KNGFHSRGNGLLPCRNGQVISAVKA--EM--RVSEADVLELANLIGEKAVDETGIIDETM  1134
              N  H+R N      +  +  A KA  EM  ++ +  V++L   +  +  D+TG      
Sbjct  308   NNSLHARDNE----EDNSLPGAAKAIGEMMAKLDKNGVMDLIEWL--EINDDTG------  355

Query  1135  EEENGKSADFFVYGANLTFVNLE--EVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPG  1308
               +N +S +F    + L F+NLE  E     F+     PI  +        EG V++LP 
Sbjct  356   -PKNTRSLNF----SELLFLNLEGIEPDTARFE-DTHAPIRVSCFFEPPCKEGQVVILPS  409

Query  1309  PENLKGKEGGRIVNVILPEHLLGKL  1383
                 K     R+V V LPE  L KL
Sbjct  410   --TPKDGPMSRVVMVTLPEDELVKL  432



>ref|XP_004498644.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cicer 
arietinum]
Length=451

 Score =   105 bits (263),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 115/435 (26%), Positives = 195/435 (45%), Gaps = 38/435 (9%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS--EAVDGLNTGDLKSPMFRMLEDF  318
             +VV       G+ L L+  D  M+ + +R VY +++  +   G+ T  L+  +  ML  F
Sbjct  12    TVVSTKAVEAGKYLPLSVLDRLMEKNRIRMVYYYQTSGDLELGILTKKLRETLSEMLIHF  71

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
                 GR+    + G   +KCND+GVR+VE+K   +++ WL   D+ +   L++ + +   
Sbjct  72    PIVTGRLLRD-DVGHWRIKCNDAGVRMVESKAKGSVEGWLRNVDREKELKLVYWEDIPQK  130

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRR--DLPPKHP  672
                +S   ++Q+T F+ GGL+IG+S  H+L D+   + F+  +     G +   LP  HP
Sbjct  131   PYYWSTF-YVQLTEFEEGGLAIGLSCTHLLADSICATRFMKTWADISLGNKMISLPIFHP  189

Query  673   HMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLT-------NTCKMATQSYHITDKQL  831
              +P+  + N      Q      +G +     H+K +          +  T S   +D  +
Sbjct  190   -LPSQKSQNKKLNNNQ-----YMGLIA----HYKSSIEKPISIKEARYTTISMGFSDHMV  239

Query  832   NAL--IFKVSGLKQSAKVKPFEAISALFWKSLAKVKE-GSGLETVTIVKNGFHSRGNGLL  1002
              A   + + SG        PFEA++ LFW +L+K+K   +GL  ++I  +     G    
Sbjct  240   QACMSMAQPSGPSSPKPTTPFEALAGLFWVALSKIKGIKNGLVDMSICLDVRKILGLDKG  299

Query  1003  PCRNGQVISAVKAE--MRVSEADVLELANLIGE--KAVDETGIIDET-MEEENGKSADFF  1167
                N  + + V  E    + E         I +    +D  GI+D     E N  ++   
Sbjct  300   FFGNSMIYNKVHLEGNFNLDENKFPHATRAIRDVVATIDNEGIMDLIDWFENNDINSSPM  359

Query  1168  VYGANLTFVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--G  1338
             + G +L   +LE V  Y     +  KPI  +Y I  +  EG +L+ P P +    EG  G
Sbjct  360   MNGHDLVCTSLENVNPYLAMFEERLKPIRVSYYIEPIFGEGHILIFPTPHD----EGPLG  415

Query  1339  RIVNVILPEHLLGKL  1383
             R+V V L E    KL
Sbjct  416   RVVMVTLQEEEAIKL  430



>gb|ACG37219.1| transferase [Zea mays]
Length=455

 Score =   105 bits (262),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 115/424 (27%), Positives = 179/424 (42%), Gaps = 40/424 (9%)
 Frame = +1

Query  142   SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFY  321
             S+    T    G+   L+  D AM+ H +  V   R  A  GL+   LK  +  +L   Y
Sbjct  26    STAASVTPVRPGKTHALSPLDNAMERHTVHVVVYLR--AAPGLDREQLKESLSEVL-SLY  82

Query  322   PA-AGRIRTS--PEDGRP-----FVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
             PA  GR+       D  P      VKCND+GVR+V+A+ + T+DEWL  +   E   LL+
Sbjct  83    PAMTGRLTRGEGSADAEPAHRGWVVKCNDAGVRMVDARAAVTLDEWLATATGDEEMDLLY  142

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDL  657
             ++ +      +SP  ++Q+T F     ++G+S  H+  D  + + F + +  A       
Sbjct  143   YEPMGAEPYIWSPF-YVQLTEFTDKSYALGLSCIHIHNDPTAAALFFHAWAAAHRRTTST  201

Query  658   PPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNA  837
              P   H P      +  P    L      +  P            M++ ++H     + A
Sbjct  202   YPPFLHPPALAVSPTSPPPAPPLLAEKASAASPTST----DAAAAMSSATFHFPAAAVRA  257

Query  838   LIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC-RN  1014
             L+   S L+      PF A++ALFW  +    +G    T+ +    F  R    LP    
Sbjct  258   LL---SSLEPG--TTPFAALAALFWLRITGAADGERELTLAL---DFRKRMYAPLPWGYY  309

Query  1015  GQVISAVKAEM-------RVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVY  1173
             G  +   +A          V+ A    +A +  E+       +    ++EN   A F +Y
Sbjct  310   GSSVHFTRARADLASGLPAVAAALDRHVAGVPEEELWRALEWLHTRQQQEN---APFQMY  366

Query  1174  GANLTFVNLEEVKIYGFDMK-GQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVN  1350
             G  LT   L+ V +YG + + G  P   +  +GG   EG VLVLP PE   G+E  R V 
Sbjct  367   GPELTCAALDHVPMYGAEFEAGASPARVSCRVGGATGEGLVLVLPAPE---GRE-ARDVV  422

Query  1351  VILP  1362
             V LP
Sbjct  423   VTLP  426



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 120/459 (26%), Positives = 186/459 (41%), Gaps = 50/459 (11%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPM  297
             ++ + + S++V        R L  +N DL +   +   VY +R + A +  +   +K  +
Sbjct  1     MIINVKASTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRPTGAANFFDAEVMKQAL  60

Query  298   FRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
              + L  FYP AGR+R   EDGR  + CN  GV +VEA+    ID++ D +   E   L+ 
Sbjct  61    AKALVPFYPMAGRLRRD-EDGRVEIDCNGEGVLLVEAETIGVIDDFGDFAPTLELRQLIP  119

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG---------  630
                  G  +   PL+ +Q+T+FKCGG+S+G+   H   D FS   F+N +          
Sbjct  120   AVDYSG-GIETYPLLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGFDLT  178

Query  631   -PAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS  807
              P    R  L  + P  P  ++     P T K          PV    K  +    AT S
Sbjct  179   LPPFIDRTLLRARDPPQPVFEHIEYKPPPTMK------SPQNPVQSPTKPGSDPNTATVS  232

Query  808   -YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKE-GSGLETVTIVKNGFH  981
              + +T  QLNAL  K      +     +E ++   W+S  K +      ET   +     
Sbjct  233   IFKMTRAQLNALKAKSKEAGNTVNYSSYEMLAGHVWRSTCKARALPDDQETKLYIATDGR  292

Query  982   SRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSA-  1158
             SR    LP      +      M V+  D++          +         M+ E  +SA 
Sbjct  293   SRLQPPLPPGYFGNVIFTATPMAVA-GDLMSKPTWFAASRIHNAL---SRMDNEYLRSAL  348

Query  1159  DF---------FVYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAV  1293
             DF          V GA      NL   +   + I+  D    +PIF     GG+  EG  
Sbjct  349   DFLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMG--PGGIAYEGLS  406

Query  1294  LVLPGPENLKGKEGGRIVNVIL-PEHLLGKLKNEISKEL  1407
              +LP      G +G   V + L PEH+  K+  E+  E+
Sbjct  407   FILPS----SGNDGSLSVAIALQPEHM--KVFKEVLYEI  439



>ref|XP_010102806.1| Vinorine synthase [Morus notabilis]
 gb|EXB94134.1| Vinorine synthase [Morus notabilis]
Length=445

 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 115/443 (26%), Positives = 201/443 (45%), Gaps = 59/443 (13%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGD----LKSPMFRMLE  312
             +VV       G+   L+  D  M+ ++LR V+ +     D L +G     L+  +  +L 
Sbjct  12    TVVSTKPVPPGKFFPLSKIDQLMEKNHLRMVFYYPPIG-DMLESGQVTRRLRESLAELLT  70

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVL  492
              F    GR+  + + G+  +KCND+GVR++EA+   ++++W    ++ +   L++ +++ 
Sbjct  71    HFPAVTGRLLRN-DKGQWMIKCNDAGVRMIEARAKGSVEDWFKCVNREKEFKLVYWEEMY  129

Query  493   GPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNK------YGPAMAGR-R  651
                  +S   ++Q+T F+ GG ++G+S  H++GD    + F+N       YG  +A    
Sbjct  130   HKPYFWSTF-YVQLTEFEDGGFAVGLSCIHLVGDITCATMFINSWAQTTFYGKMVASYFH  188

Query  652   DLPPKHP------HMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYH  813
              LPP+ P      H P     N  K   +K       S+ P+ +        K  T S+ 
Sbjct  189   PLPPRKPGNKKPNHTPYISLINHYKSTIEK-----SNSIIPMVE-------TKYTTASFA  236

Query  814   ITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKE-GSGLETVTIVKN-----G  975
               D+ + A +   +  ++     PFEA++ LFW  ++KVK   +GL  +++  +     G
Sbjct  237   FADRAVRACM---ATTQRRHGPSPFEALAGLFWVCISKVKGLTNGLVDMSVCFDMRTVLG  293

Query  976   FHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGE--KAVDETGIID--ETMEEE  1143
                R  G     N  V ++V A+    E D+   AN I E    +D  GI+D  E ++  
Sbjct  294   VDKRFFG-----NCMVYNSVHAK-GFRENDLSGAANAIAEVVAKMDNEGIMDLIEWLQRR  347

Query  1144  NGKSADFFVYGANLTFVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENL  1320
             + +     + G +L   +L     Y      G +PI  +Y +  V   G VLV PGP   
Sbjct  348   DDEKLP-LMNGCDLVCASLGPADPYLAMFGGGVRPIRVSYYVEPVLGLGQVLVFPGPPG-  405

Query  1321  KGKEG--GRIVNVILPEHLLGKL  1383
                EG   R+V V LP   + +L
Sbjct  406   ---EGPLSRVVMVTLPHDEVVRL  425



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 110/422 (26%), Positives = 171/422 (41%), Gaps = 58/422 (14%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLEDFYP  324
             V PA  T    + N +N DL +   +   VY +R + A +  +   +K  + + L  FYP
Sbjct  11    VRPAEETPRQSLWN-SNVDLVVPRFHTPSVYFYRPTGASNFFDPQVMKEALSKALVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
               GR++   EDGR  + CN  GV +VEA+ +  ID++ D +   E   L+      G  +
Sbjct  70    MGGRLKRD-EDGRIEIDCNGEGVLLVEAETNSVIDDFGDFAPTLELRQLIPTVDYSG-GI  127

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGRRD  654
             G  PL+ +Q+T+FKCGG S+G+   H   D FS   F+N +           P    R  
Sbjct  128   GTYPLLVLQVTYFKCGGASLGVGMQHHAADGFSGLHFINTWSDMARGLDLTIPPFIDRTL  187

Query  655   LPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN  834
             L  + P  P   +     P      P S G                 A   + +T +QLN
Sbjct  188   LRARDPPQPVFHHIEYQPPPAMNTPPQSTGPE-------------STAVSIFKLTREQLN  234

Query  835   ALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLE--TVTIVKNGFHSRGNGLLPC  1008
             AL  K      +     +E +S   W+S+ K +  +G +   + I  +G       L P 
Sbjct  235   ALKAKSKEDGNTVNYSSYEMLSGHVWRSVCKARGLAGDQGTKLYIATDGRARLRPPLPPG  294

Query  1009  RNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDET---MEEENGKSA-DF----  1164
               G VI         +   +    +L+ +      G I +    M+++  +SA D+    
Sbjct  295   YFGNVI--------FTATPIAVAGDLLSKPTWYAAGTIHDALARMDDDYLRSALDYLELQ  346

Query  1165  -----FVYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGP  1311
                   V GA      NL   +   + I+  D    +PIF     GG+  EG   VLP P
Sbjct  347   PDLSALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMG--PGGIPYEGLSFVLPSP  404

Query  1312  EN  1317
              N
Sbjct  405   TN  406



>ref|NP_001140499.1| transferase [Zea mays]
 gb|ACF83946.1| unknown [Zea mays]
 tpg|DAA51300.1| TPA: transferase [Zea mays]
Length=456

 Score =   103 bits (258),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 112/424 (26%), Positives = 178/424 (42%), Gaps = 40/424 (9%)
 Frame = +1

Query  142   SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFY  321
             S+    T    G+   L+  D AM+ H +  V   R  A  GL+   LK  +  +L   Y
Sbjct  26    STAASVTPVRPGKTHALSPLDNAMERHTVHVVVYLR--AAPGLDREQLKESLSEVL-SLY  82

Query  322   PA-AGRIRTS--PEDGRP-----FVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
             PA  GR+       D  P      VKCND+GVR+V+A+ + T+DEWL  +   E   LL+
Sbjct  83    PAMTGRLTRGEGSADAEPAHRGWVVKCNDAGVRMVDARAAVTLDEWLATATGDEEMDLLY  142

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDL  657
             ++ +      +SP  ++Q+T F     ++G+S  H+  D  + + F + +  A       
Sbjct  143   YEPMGAEPYIWSPF-YVQLTEFTDKSYALGLSCIHIHNDPTAAALFFHAWAAAHRRTTST  201

Query  658   PPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNA  837
              P   H P      +  P    L      +  P            M++ ++H     + A
Sbjct  202   YPPFLHPPALAVSPTSPPPAPPLLAEKASAASPTSTD----AAAAMSSATFHFPASAVRA  257

Query  838   LIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIVKNGFHSRGNGLLPC-RN  1014
             L+   S L+      PF A++ALFW  +    +G    T+ +    F  R    LP    
Sbjct  258   LL---SSLEPG--TTPFAALAALFWLRITGAADGERELTLAL---DFRKRMYAPLPWGYY  309

Query  1015  GQVISAVKAEM-------RVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFVY  1173
             G  +   +A          V+ A    +A +  E+       +    ++EN   A F +Y
Sbjct  310   GSSVHFTRARADLASGLPAVAAALDRHVAGVPEEELWRALEWLHTRQQQEN---APFQMY  366

Query  1174  GANLTFVNLEEVKIYGFDMK-GQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVN  1350
             G  LT   L+ V +YG + + G  P   +  +GG   EG VLVLP PE  + ++    V 
Sbjct  367   GPELTCAALDHVPMYGAEFEAGASPARVSCRVGGATGEGLVLVLPAPEGGEARD----VV  422

Query  1351  VILP  1362
             V LP
Sbjct  423   VTLP  426



>ref|XP_004156459.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
Length=475

 Score =   103 bits (256),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 110/443 (25%), Positives = 195/443 (44%), Gaps = 52/443 (12%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFYP  324
             + V +  +  GRV  L+ AD A+  H    V  +            ++  + ++L  +  
Sbjct  16    TAVSSNPSVSGRVYPLSAADHALARHSAAVVMYYSENPFGSFILDPMRESLSKVLTLYPT  75

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
               GR+ T  E+G   VK ND+GVR+   K   ++DEWL  +D  E   L   D++     
Sbjct  76    VTGRL-TRTENGNWAVKGNDAGVRVTMTKVGSSLDEWLRSADSVEERDLAAFDEMPEDPY  134

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPT  684
              +SP   IQI  F+ GG++IG+S+ H++ D  S +  L  +  A  G    PP      +
Sbjct  135   IWSPFR-IQINEFEGGGVAIGVSFTHLIADPTSATFLLKTWADAHRGGPVSPPLFTKPSS  193

Query  685   -ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGL  861
               D    P   T+    ++  S   + +H  + +  KM++ ++  ++  +N  + K+   
Sbjct  194   LGDGEKIPNIATKSTSFYANKS--KLDNH--IVSPTKMSSVTFKFSNTTINQCLSKIK--  247

Query  862   KQSAKVKPFEAISALFWKSLAKVKEGSGLET-------------VTIVKNGFHSRGNGLL  1002
                    PF+ +++LFWK + K+K  S                  + ++N F S  +   
Sbjct  248   PHCPNATPFDFLASLFWKQILKIKSNSPNSEHNNNNNNNHSLSICSDIRNSFQSSNSQRC  307

Query  1003  PCRNGQVISAVK---AEMRVSE-ADVLELAN----LIGEKAVDETGIID--ETMEEENGK  1152
                N   IS +     EM  +E   ++EL +     +GE+  +    ++  E+ +E++GK
Sbjct  308   YFGNALHISQLTIDPKEMEQNELGQIVELVHNHLERLGEEEEETWSAMEWLESQKEKDGK  367

Query  1153  SA-DFFVYGANLTFVNLEE---VKIYGFD----------MKGQKPIFANYTIGGVGDEGA  1290
                 F +YG  L+ V++E    +   G D          +K  KP+  +Y IG V  EG 
Sbjct  368   YVMPFKMYGPELSCVSMEHMMMMMKKGNDNESLSYATKFVKDSKPVHVSYNIGNVEGEGL  427

Query  1291  VLVLPGPENLKGKEGGRIVNVIL  1359
             ++V+P        EGG   NV++
Sbjct  428   IIVMP------SNEGGVARNVVV  444



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score =   102 bits (254),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 91/310 (29%), Positives = 136/310 (44%), Gaps = 28/310 (9%)
 Frame = +1

Query  112   VENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLK  288
             VE +  D + S +V  +     R L  +N DL + + +++ VY ++         T  L 
Sbjct  6     VEKMKVDVKQSIMVRPSRDTPKRSLWSSNLDLLVPMFHVQTVYFYKPNGSSRFFETQVLT  65

Query  289   SPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDH  468
               +  +L  FYPAAGR+R   E GR  + CN  GV  VEA+ S   D+  D +D S+   
Sbjct  66    DALSDVLVPFYPAAGRMRKH-ESGRIEINCNGEGVLFVEAETSCFADDLGDFTDSSKLLP  124

Query  469   LLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG------  630
             L+      G    F PLV +Q+T FKCG +S+G+   H+L D  S   F+N +       
Sbjct  125   LVPEVDYAGGISSF-PLVVLQVTRFKCGAVSLGVGLHHILADGTSALHFINSWSDVARGL  183

Query  631   ----PAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMA  798
                 P    R  L  + P  PT  +     P T    P S           +   TC   
Sbjct  184   PVSTPPFIDRTLLRARDPPHPTFHHSEYDPPPTMNTPPRS-----------QPKTTC---  229

Query  799   TQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTI-VKNG  975
             T+   IT +QL +L  KV     +A+   +E I+A  W+S+ K +  S  +   + +   
Sbjct  230   TKILKITPEQLGSLKAKVRTEDGAARHSTYETITAHIWRSMCKARGLSDDQASKLYISTD  289

Query  976   FHSRGNGLLP  1005
               SR N  LP
Sbjct  290   GRSRLNPQLP  299



>gb|KGN60817.1| hypothetical protein Csa_2G011500 [Cucumis sativus]
Length=475

 Score =   102 bits (255),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 107/445 (24%), Positives = 192/445 (43%), Gaps = 56/445 (13%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFYP  324
             + V +  +  GRV  L+ AD A+  H    V  +            ++  + ++L  +  
Sbjct  16    TAVSSNPSVSGRVYPLSAADHALARHSAAVVMYYSENPFGSFILDPMRESLSKVLTLYPT  75

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
               GR+ T  E+G   VK ND+GVR+   K   ++DEWL  +D  E   L   D++     
Sbjct  76    VTGRL-TRTENGNWAVKGNDAGVRVTMTKVGSSLDEWLRSADSVEERDLAAFDEMPEDPY  134

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPT  684
              +SP   IQI  F+ GG++IG+S+ H++ D  S +  L  +  A  G    PP      +
Sbjct  135   IWSPFR-IQINEFEGGGVAIGVSFTHLIADPTSATFLLKTWADAHRGGPVSPPLFTKPSS  193

Query  685   -ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGL  861
               D    P   T+    ++  S   + +H  + +  KM++ ++  ++  +N  + K+   
Sbjct  194   LGDGEKIPNIATKSTSFYANKS--KLDNH--IVSPTKMSSVTFKFSNTTINQCLSKIK--  247

Query  862   KQSAKVKPFEAISALFWKSLAKVKEGSGLET-------------VTIVKNGFHSRGNGLL  1002
                    PF+ +++LFWK + K+K  S                  + ++N F S  +   
Sbjct  248   PHCPNATPFDFLASLFWKQILKIKSNSPNSEHNNNNNNNHSLSICSDIRNSFQSSNSQR-  306

Query  1003  PCRNGQVISAVKAEMRVSEADVLELANLI----------GEKAVDETGIID--ETMEEEN  1146
              C  G  +   +  +   E +  EL  ++          GE+  +    ++  E+ +E++
Sbjct  307   -CYFGNALHISQLTIDPKEMEQHELGQIVELVHNHLERLGEEEEETWSAMEWLESQKEKD  365

Query  1147  GKSA-DFFVYGANLTFVNLEE---VKIYGFD----------MKGQKPIFANYTIGGVGDE  1284
             GK    F +YG  L+ V++E    +   G D          +K  KP+  +Y IG V  E
Sbjct  366   GKYVMPFKMYGPELSCVSMEHMMMMMKKGNDNESLSYATKFVKDSKPVHVSYNIGNVEGE  425

Query  1285  GAVLVLPGPENLKGKEGGRIVNVIL  1359
             G ++V+P        EGG   NV++
Sbjct  426   GLIIVMP------SNEGGVARNVVV  444



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score =   102 bits (254),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 107/431 (25%), Positives = 182/431 (42%), Gaps = 62/431 (14%)
 Frame = +1

Query  178   RVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLKSPMFRMLEDFYPAAGRIRTSPE  354
             R L  +N DL +   +   VY +R   V    +   +K  + ++L  FYP A R+R   +
Sbjct  20    RALWNSNVDLVVPNFHTPSVYFYRPNGVSNFFDAKVMKEALSKVLVPFYPMAARLRRD-D  78

Query  355   DGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFS------P  516
             DGR  + C+  GV  VEA+ +  I+++ D S   E   L+       P + +S      P
Sbjct  79    DGRVEIYCDAQGVLFVEAETTAAIEDFGDFSPTLELRQLI-------PSVDYSAGIHSYP  131

Query  517   LVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGRRDLPPK  666
             L+ +Q+T+FKCGG+S+G+   H + D  S   F+N +           P    R  L  +
Sbjct  132   LLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINAWSDVARGLDISLPPFIDRTLLRAR  191

Query  667   HPHMPTADN-HNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
              P +P  D+    P P T+K  P  L    P+G     +++  +A  ++ +T  QL+ L 
Sbjct  192   DPPLPVFDHIEYKPPPATKKTTP--LQPSKPLG-----SDSTAVAVSTFKLTRDQLSTLK  244

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKE-GSGLETVTIVKNGFHSRGNGLLPCRNGQ  1020
              K      +     +E ++   W+S+ K +      ET   +     +R    LP  +G 
Sbjct  245   GKSREDGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLP--HGY  302

Query  1021  VISAVKAEMRVSEA-DVLELANLIGEKAVDETGIIDETMEEENGKSA-DF---------F  1167
               + +    R++ A D++          + +  I    M+ E  +SA D+          
Sbjct  303   FGNVIFTTTRIAVAGDLMSKPTWYAASRIHDALI---RMDNEYLRSALDYLELQPDLKSL  359

Query  1168  VYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGK  1329
             V GA      NL   +   + I+  D    +PIF     GG+  EG   ++P   N    
Sbjct  360   VRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMG--PGGIAYEGLSFIIPSSTN----  413

Query  1330  EGGRIVNVILP  1362
             +G   + + LP
Sbjct  414   DGSLSLAIALP  424



>ref|XP_003549253.1| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
 gb|KHN45205.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=440

 Score =   102 bits (254),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 114/434 (26%), Positives = 186/434 (43%), Gaps = 87/434 (20%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS--EAVDGLNTGDLKSPMFRMLEDF  318
             +VV       G+   L+  D  M+ +++R VY +++  E   G  T  L+  +  ML  F
Sbjct  12    TVVSTKAVEPGKYFPLSVLDRYMENNHIRMVYYYQTSREVELGKVTKKLRETLSEMLTHF  71

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
                +GR+    E G   +KCND+GVR+VEAK   ++  WL   D+ +   L+H + +   
Sbjct  72    PIVSGRLVRDDETGHWKIKCNDAGVRVVEAKAKGSVGGWLANLDREKELQLVHWEDMFHK  131

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGP-AMAGRRDLPP----  663
                +S   ++Q+T F+ GGL+IG+S  H+L D+   + F+  +   +M  +   PP    
Sbjct  132   PYYWSTF-YVQLTEFEEGGLAIGLSCFHLLVDSTCATLFMKAWADISMVNKMITPPLFHH  190

Query  664   ------------KHPHMPTADNHNS--PKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMAT  801
                          H HM    ++ S   KP + K   ++  S+G                
Sbjct  191   LPPRRPPNRNPNHHLHMELIHHYKSLIEKPNSTKETMYTTISMG----------------  234

Query  802   QSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK----------------  933
                  ++  + A +   S  + +  + PFEA++ALFW SL+KVK                
Sbjct  235   ----FSNPMVQACM---SMAQPNGPIPPFEALAALFWVSLSKVKGLRNRLVDMSICLDMR  287

Query  934   EGSGLETV----TIVKNGFHSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKA  1101
             +  GL+       +V N  +  GN     +  QV+ A+        +DV+          
Sbjct  288   KVLGLDCTFFGNCMVYNKVNVEGNNY---KFPQVVRAI--------SDVV--------AK  328

Query  1102  VDETGIIDET-MEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQ-KPIFANYTIGGV  1275
             +D   II+ T   E N  ++   +   NL   +LE +  Y        KPI  +Y I  V
Sbjct  329   MDTEAIINLTEWLENNDVNSPTMMNNHNLVCTSLEGMDPYLTVFPDLFKPIHVSYYIEPV  388

Query  1276  GDEGAVLVLPG-PE  1314
               EG VL+LPG PE
Sbjct  389   VGEGQVLILPGLPE  402



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score =   102 bits (255),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 116/435 (27%), Positives = 181/435 (42%), Gaps = 55/435 (13%)
 Frame = +1

Query  118   NIVYDHRLSSVVPATIT---GEGRVLNL--TNADLAMKLHYLRGVYLFRSE-AVDGLNTG  279
             NIV+   + SV  +T+    GE R+  L  +N DL +   +   VY +R   + D  +  
Sbjct  53    NIVWFDMIVSVRESTMVRPAGETRIHALWNSNVDLVVPSMHTPSVYFYRPNGSPDFFDPK  112

Query  280   DLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSE  459
              LK  + + L  FYP AGR+R   EDGR  + CN  GV  VEA+ S  +D++ D +   E
Sbjct  113   VLKEGLSKALVPFYPMAGRLRRD-EDGRIEIDCNAEGVLFVEAETSSAVDDFGDFAPTLE  171

Query  460   YDHLLHH-DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
                L+   D   G  L   PL+ +Q+T+FKCGG+S+G+   H + D FS   F+N +   
Sbjct  172   LRKLIPAVDYSAG--LSTYPLLVLQVTYFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDM  229

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS---  807
               G     P           + P+P+ +      +    P      L+ T K   +S   
Sbjct  230   ARGLDLTTPPFIDRTLLRARDPPQPQFKH-----IEYQPPPALKAPLSQTTKSGAESTAV  284

Query  808   --YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGS--GLETVTIVKNG  975
               + +T +QLN L  K      +     +E ++   W+S  K ++ +      + I  +G
Sbjct  285   SIFKMTREQLNKLKGKSKEDGNTVNYSSYEMLAGHVWRSACKARDLAVDQESKMYIATDG  344

Query  976   FHSRGNGLLPCRNGQVISAVK---------------AEMRVSEADVLELANLIGEKAVDE  1110
                    L P   G VI                   A  R+ +A ++ + N     A+D 
Sbjct  345   RSRLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDA-LVRMDNDYLRSALD-  402

Query  1111  TGIIDETMEEENGKSADFFVYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGG  1272
                    +E +   SA   V GA      NL   +   + I+  D    +PIF     GG
Sbjct  403   ------YLELQPDLSA--LVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG--PGG  452

Query  1273  VGDEGAVLVLPGPEN  1317
             +  EG   +LP P N
Sbjct  453   IAYEGLSFILPSPTN  467



>ref|XP_002964139.1| BAHD family acyltransferase [Selaginella moellendorffii]
 gb|EFJ34472.1| BAHD family acyltransferase [Selaginella moellendorffii]
Length=459

 Score =   102 bits (254),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 115/466 (25%), Positives = 197/466 (42%), Gaps = 46/466 (10%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADL-AMKLHYLRGVYLFRSEAVDGLNTGD-----  282
             +V    +S++VPA  T +   L L N  +  +  +YL+ VY + + A+D +++ D     
Sbjct  2     VVSVESVSTIVPAVPTPQPCTLWLCNFQIQVLAENYLKQVYYYPA-ALDHVSSFDSLVAS  60

Query  283   LKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEY  462
             LK  + R+L  +YP AGR R +  D RP ++CND G+  V A    +  +W D   Q   
Sbjct  61    LKDSLSRILVPYYPLAGRPRIAGLD-RPILECNDRGIEFVVAFADASFGDWGDSMKQCSI  119

Query  463   DHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMA  642
             +  L+  Q    D    P + +Q+T F+CGG+++G+   H L D  S+  FL  +     
Sbjct  120   EQELNPAQTAITDPENFPQLKVQVTKFRCGGIALGLVTTHTLLDGSSVFPFLKAWSQLHR  179

Query  643   GRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMA--TQSYHI  816
             G     P      +      P   T  +  F   +     +  K     K +   +++H+
Sbjct  180   GFPPPNPPPSFDSSLLKARDPPCVTVPVRDFVAVTPAIAEEMGKAAQDFKPSYHVRAFHM  239

Query  817   TDKQLNALIFKVSG--LKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIV--------  966
              ++QL  L  +++       +    FEA+S L WK + + ++     T T +        
Sbjct  240   NEQQLAELKHEIASGPFAYGSSPTSFEAVSGLVWKCITEARDFDDSVTNTYIYAVSTKVG  299

Query  967   KNGFH----------SRGNGLLPCRNGQVISA-VKAEMRVSEADVLELANLIGEKAVDET  1113
             +N +           S     LPC  G + +  V    R+   DV      +G++ +  T
Sbjct  300   RNRWQPPMPSEYCGTSSFTLCLPCAVGALKNKHVSHAARLFHEDVRN----VGQERIQST  355

Query  1114  GIIDETMEEENGKSADFFV------YGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGV  1275
               ID  MEE   K  D  +       G  +  VNL    +Y F+    +P   +  +   
Sbjct  356   --ID-WMEETLRKGHDIGLNVPPPSTGMGIYSVNLHSFPVYEFEFGWGRPAHFSMVLEPW  412

Query  1276  GDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISKELGT  1413
                G V++LP P+   G    RIV ++L E +   L++E+     T
Sbjct  413   YGNGVVVLLPTPQG--GMRERRIVVMLLEEQMKRLLQSELFARFTT  456



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
Length=499

 Score =   102 bits (255),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 110/412 (27%), Positives = 162/412 (39%), Gaps = 57/412 (14%)
 Frame = +1

Query  178   RVLNLTNADLAMKLHYLRGVYLFRSE-AVDGLNTGDLKSPMFRMLEDFYPAAGRIRTSPE  354
             R L   N DL +   +   VY +R   A +  +   +K  + + L  FYP AGR++   E
Sbjct  88    RSLWNANVDLVVPRFHTPSVYFYRPNGAANFFDPQVMKEALSKALVPFYPMAGRLKRD-E  146

Query  355   DGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVFIQI  534
             DGR  + CN  GV  VEA+ +  ID++ D +   E   L+      G  +   PL+ +Q+
Sbjct  147   DGRIEIDCNGEGVLFVEAETNSVIDDFGDFAPTLELRQLIPTVDYSG-GISTYPLLVLQV  205

Query  535   TWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGRRDLPPKHPHMPT  684
             T+FKCGG S+G+   H   D +S   F+N +           P    R  L  + P  P 
Sbjct  206   TYFKCGGASLGVGMQHHAADGYSGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPV  265

Query  685   ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLK  864
               +     P   K+ P S G                 A   + +T  QLNAL  K     
Sbjct  266   FHHVEYQPPPAMKIPPQSTGPE-------------STAISIFKLTRDQLNALKAKCKEDG  312

Query  865   QSAKVKPFEAISALFWKSLAKVKEGSGLE-----TVTIVKNGFHSRGNGLLPCRNGQVIS  1029
                    +E +S   W+S+ K +   GLE      + I  +G       L P   G VI 
Sbjct  313   NDVNYSSYEMLSGHVWRSVCKAR---GLEDDQGTKLYIATDGRARLRPPLPPGYFGNVI-  368

Query  1030  AVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSA-DF---------FVYGA  1179
                A       D+L          + +  +    M++E  +SA D+          V GA
Sbjct  369   -FTATPIAVAGDLLSKPTWYAASRIHDALV---RMDDEYLRSALDYLELQPDLSALVRGA  424

Query  1180  ------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
                   NL   +   + I+  D    +PIF     GG+  EG   VLP P N
Sbjct  425   HTFRCPNLGITSWVRLPIHDADFGWGRPIFMG--PGGIPYEGLSFVLPSPNN  474



>ref|XP_010525926.1| PREDICTED: protein ECERIFERUM 26-like [Tarenaya hassleriana]
Length=458

 Score =   102 bits (253),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 111/439 (25%), Positives = 177/439 (40%), Gaps = 41/439 (9%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVD--GLNTGDLKSPMFRMLEDF  318
             +VV       G+    +  D  M+ +++R V+ ++       G  T  L+  +   L  F
Sbjct  13    TVVSTKPVEPGKSYRFSVFDRVMEPNHIRLVFYYKCPNAKKPGETTKKLRESLAEALTCF  72

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVL-G  495
                 GR+     +    V+CND+GVR++EA+ S T++EWL   D  E   L+H +++  G
Sbjct  73    PMITGRLVKDEGERGWKVRCNDAGVRMIEARASGTVEEWLGNVDTEEELRLVHWEEIYHG  132

Query  496   PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA------MAGR---  648
                 F    ++QIT F+ GG +IG+S +H+L D    +  L  +  A      MA     
Sbjct  133   SSSYFWSTFYVQITEFEGGGFAIGLSSSHLLADPICATTLLGAWAEATLAPTTMAASPLV  192

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
               LP   P    AD    PKP    L    + S       +  TN     T +   TD  
Sbjct  193   HQLPSCRPRNEKAD----PKPYDNHLLKHYINSCSSQPSSFNPTNN-DFTTVTLLFTDPM  247

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK----EGSGLETVTIVKNGFHSRGNG  996
             + A+  + +G+    K+ PFEA   L W  +++ K    E  G+     V+   +   N 
Sbjct  248   IRAMA-RANGM----KISPFEATVGLIWTCMSRAKGMRDELMGMSLCLDVRMTLNVNENF  302

Query  997   LLPCRNGQVISAVKAEMRVSEADVLELANLIGE-----KAVDETGIIDETMEEENGKSAD  1161
                C     +   K     +  D+L  A  I E     K +D   ++D           D
Sbjct  303   FGNCMVYHKLQNTKRSSVTTTGDILSHA--IEEIRRTTKEIDYDSVMDLIEWLRIKDHID  360

Query  1162  FFVYGANLTFVNLEEVKIYG---FDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE  1332
                 G+++   NLE +   G   F+ +      + Y  G     G V VLP    L   E
Sbjct  361   PIRNGSDMVCTNLENLMDLGHTRFEEEMTLKHVSCYVEGPAVGGGRVTVLPP---LSTGE  417

Query  1333  G--GRIVNVILPEHLLGKL  1383
             G   R+  + LP  L+ K+
Sbjct  418   GPMSRVAMITLPRTLIAKV  436



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score =   102 bits (254),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 116/435 (27%), Positives = 181/435 (42%), Gaps = 55/435 (13%)
 Frame = +1

Query  118   NIVYDHRLSSVVPATIT---GEGRVLNL--TNADLAMKLHYLRGVYLFRSE-AVDGLNTG  279
             NIV+   + SV  +T+    GE R+  L  +N DL +   +   VY +R   + D  +  
Sbjct  58    NIVWFDMIVSVRESTMVRPAGETRIHALWNSNVDLVVPSMHTPSVYFYRPNGSPDFFDPK  117

Query  280   DLKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSE  459
              LK  + + L  FYP AGR+R   EDGR  + CN  GV  VEA+ S  +D++ D +   E
Sbjct  118   VLKEGLSKALVPFYPMAGRLRRD-EDGRIEIDCNAEGVLFVEAETSSAVDDFGDFAPTLE  176

Query  460   YDHLLHH-DQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPA  636
                L+   D   G  L   PL+ +Q+T+FKCGG+S+G+   H + D FS   F+N +   
Sbjct  177   LRKLIPAVDYSAG--LSTYPLLVLQVTYFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDM  234

Query  637   MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQS---  807
               G     P           + P+P+ +      +    P      L+ T K   +S   
Sbjct  235   ARGLDLTTPPFIDRTLLRARDPPQPQFKH-----IEYQPPPALKAPLSQTTKSGAESTAV  289

Query  808   --YHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGS--GLETVTIVKNG  975
               + +T +QLN L  K      +     +E ++   W+S  K ++ +      + I  +G
Sbjct  290   SIFKMTREQLNKLKGKSKEDGNTVNYSSYEMLAGHVWRSACKARDLAVDQESKMYIATDG  349

Query  976   FHSRGNGLLPCRNGQVISAVK---------------AEMRVSEADVLELANLIGEKAVDE  1110
                    L P   G VI                   A  R+ +A ++ + N     A+D 
Sbjct  350   RSRLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDA-LVRMDNDYLRSALD-  407

Query  1111  TGIIDETMEEENGKSADFFVYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGG  1272
                    +E +   SA   V GA      NL   +   + I+  D    +PIF     GG
Sbjct  408   ------YLELQPDLSA--LVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG--PGG  457

Query  1273  VGDEGAVLVLPGPEN  1317
             +  EG   +LP P N
Sbjct  458   IAYEGLSFILPSPTN  472



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 112/451 (25%), Positives = 190/451 (42%), Gaps = 58/451 (13%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSE-AVDGLNTGDLKSPM  297
             I+   R   V PA  T + ++L  +N D   KL  +  VY +R + + +  +   +K  +
Sbjct  2     IIKVRREEIVEPAEETPK-KILWTSNIDQLFKL-LIPSVYFYRPDGSTNFFDVKAMKESL  59

Query  298   FRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
              + L  FYP AGR++ + EDGR    CN  GV +VEA+   ++D+  D    +E   L+ 
Sbjct  60    SKALVSFYPMAGRLKRN-EDGRVETDCNGKGVLLVEAETETSLDDLGDFRPTTELRQLI-  117

Query  478   HDQVLGP-DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG--------  630
               +V  P D+   PL+ +Q+T+FKCGG+S+G+   H   D  S + F+N +         
Sbjct  118   -PRVDNPMDISPYPLLLLQVTYFKCGGVSVGVGMEHTATDGASGTHFINSWSEIARGLDI  176

Query  631   --PAMAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQ  804
               P    R  L  + P  P   +     P T K    +LG+ G +        +  + T 
Sbjct  177   TIPPFIDRTLLRSRDPPTPLFPHSEHDPPPTMKA---ALGN-GTLESKVHPKPSPSVVTM  232

Query  805   SYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKE--GSGLETVTIVKNGF  978
              + ++  Q++ L  K            FE I+   W+ + K ++        V+I  +G 
Sbjct  233   -FKLSRDQISVLKAKCKDGPDIVSFSSFEVIAGHIWRCICKARQLPDDQESKVSIAVDGR  291

Query  979   HSRGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGK--  1152
                   L P   G  I  +   M  S        +++ +  +   G + E+++  N +  
Sbjct  292   SRLNPKLPPGYFGNAIFHI-TPMAAS-------GDILSKPLIYAVGKLHESLQRANDEYL  343

Query  1153  --SADFF---------------VYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGD  1281
               + DF                    NL   +  ++ I+  D    +PIF     G +  
Sbjct  344   RSAIDFLELHPNKSSLVRGPHTFRSPNLGITSWCQMPIHEADFGWGRPIFMG--PGSIIY  401

Query  1282  EGAVLVLPGPENLKGKEGGRIVNV-ILPEHL  1371
             EG   VLP PE    K+G R + V +LP+H+
Sbjct  402   EGLAYVLPTPE----KDGSRFLAVSLLPDHM  428



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 106/414 (26%), Positives = 173/414 (42%), Gaps = 40/414 (10%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLEDFYP  324
             V PA  T +  + N +N DL +   +   VY +R + + D  +   L+  + ++L  FYP
Sbjct  11    VRPAAPTPQRDLWN-SNVDLVVPRIHTASVYFYRPTGSPDFFSMNILRDALSKLLVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
              AGR++  P DGR  + CN  GV +VEA     ID++ D +   E   L+        D+
Sbjct  70    MAGRLKRDP-DGRIEINCNGEGVLLVEAITDSVIDDFGDFAPTMELKQLIPKVN-YSEDI  127

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPT  684
                PL+ +Q+T+FKCGG+S+G+   H + D ++   F+N +     G     P       
Sbjct  128   SSYPLLVLQVTFFKCGGVSLGVGMQHHVADGYAGIHFINTWSDVARGLDITLPPFIDRTL  187

Query  685   ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCK--MATQSYHITDKQLNALIFKVSG  858
                 N P P+ Q +         P+ D   + N  K  ++   + +T +QL  L  K   
Sbjct  188   LRARNPPTPKFQHI---EYQQPPPLKDTSGIMNGEKTDISVAIFKLTKEQLEILKGKARE  244

Query  859   LKQSAKVKPFEAISALFWKSLAKVKE-GSGLET-VTIVKNGFHSRGNGLLPCRNGQVISA  1032
                +     +E +S   W+   K +      ET + I  +G +     + P   G VI  
Sbjct  245   NGNNIAYSSYEMLSGHIWRCACKARNLAEDQETKLYIATDGRNRLRPSIPPGYFGNVIFT  304

Query  1033  VKAEMRVSEADVLELANLIGEKAVDETGIIDET---MEEENGKSA-DF---------FVY  1173
                 M V+        ++I +       +I E    M++E  +SA D+          V 
Sbjct  305   T-TPMAVT-------GDIISKPTYYAASVIHEALGRMDDEYLRSALDYLELQPDLTALVR  356

Query  1174  GA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
             GA      N+   +   + I+  D    +PIF     GG+  EG   VLP   N
Sbjct  357   GAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMG--PGGIAYEGLAFVLPSSVN  408



>ref|XP_009393051.1| PREDICTED: protein ECERIFERUM 26-like [Musa acuminata subsp. 
malaccensis]
Length=452

 Score =   102 bits (253),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 111/442 (25%), Positives = 184/442 (42%), Gaps = 48/442 (11%)
 Frame = +1

Query  142   SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFY  321
             ++VV  T   +G+   L+  D AM  H LR V+ +R      ++   LK  +  +L  + 
Sbjct  14    TTVVSMTPVRQGKTYPLSALDHAMGRHTLRLVFYYRPGPT--MDKFKLKESLSEVLSQYP  71

Query  322   PAAGRIRTSPEDGRP----FVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQV  489
                GR+    E+G       VKCND+GVR+ EA+ S T+DEWL  +D  E   L + + +
Sbjct  72    AVTGRLAREEEEGGGHGGWVVKCNDAGVRLAEARASVTLDEWLRSADDEEEMELAYWEPM  131

Query  490   LGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKH  669
                   +SP  ++QIT F+   ++IG+S  H+  D       +  +  A      + P  
Sbjct  132   DADPFIWSPF-YVQITEFEDKAIAIGLSCPHMHADPTCAILLVRAWSDAHRRACVVYPPF  190

Query  670   PHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFK  849
              H P       P P +  L   S  S      H K     +M++ ++  +D  + + +  
Sbjct  191   LHAPAFFPRPQPNPSSPLL---SFKSSSTPATHTK----GRMSSATFVFSDAAVKSCLAD  243

Query  850   VSGLKQSAKVKPFEAISALFWKSLAKVKEGS-----GLETVTI-----------VKNGFH  981
              +GL   +   PF+A++ALFW  +A+          GL  +T+           + +GF+
Sbjct  244   -AGLPLDS--SPFDALAALFWTRIARASTPEPDAPLGLADLTLCIDFRKHMHAPLPHGFY  300

Query  982   SRGNGLLPCRN--GQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKS  1155
                      R   G  +  V AE+R   A + E      E   +    + E         
Sbjct  301   GNAFHFYRTRADLGSGLEHVAAELRRHAAAIRE------EDFWEAVEWVHERRPGRREAD  354

Query  1156  ADFFVYGANLTFVNLEEVKI-YG--FDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKG  1326
               F +YG  LT + ++     YG  F+  G +P      + GV   G VLV+   E    
Sbjct  355   PPFQMYGPELTCMQMDHQPFAYGAAFEKDGGRPAHVTCRVRGVEGAGLVLVMTAAE----  410

Query  1327  KEGGRIVNVILPEHLLGKLKNE  1392
             +   R V V LPE +  ++  +
Sbjct  411   EGAARQVVVTLPEEVADRICQD  432



>ref|XP_002993165.1| hypothetical protein SELMODRAFT_431276 [Selaginella moellendorffii]
 gb|EFJ05805.1| hypothetical protein SELMODRAFT_431276 [Selaginella moellendorffii]
Length=459

 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 116/466 (25%), Positives = 196/466 (42%), Gaps = 46/466 (10%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADL-AMKLHYLRGVYLFRSEAVDGLNTGD-----  282
             +V    +S+VVPA  T +   L L N  +  +  +YL+ VY + + A+D +++ D     
Sbjct  2     VVRVESVSTVVPAVPTPQPCTLWLCNFQIQVLAENYLKQVYYYPA-ALDHVSSFDSLVAS  60

Query  283   LKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEY  462
             LK  + R+L  +YP AGR R    D RP ++CND G+  V A    +  +W D   Q   
Sbjct  61    LKDSLSRILVPYYPLAGRPRIGGLD-RPILECNDRGIEFVVAFADASFGDWGDSMKQCSI  119

Query  463   DHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMA  642
             +  L+  Q    D    P + +Q+T F+CGG+++G+   H L D  S+  FL  +     
Sbjct  120   EQELNPAQTAITDPENFPQLKVQVTKFRCGGIALGLVTTHTLLDGSSVFPFLKAWSELHR  179

Query  643   GRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMA--TQSYHI  816
             G     P      +      P   T  +  F   +     +  K     K +   +++H+
Sbjct  180   GFPPPNPPPSFDSSLLKARDPPCVTVPVRDFVAVTPAIAEEMGKAAQDFKPSYNVRAFHM  239

Query  817   TDKQLNALIFKVSG--LKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIV--------  966
              ++QL  L  +++       +    FEA+S L WK + + ++     T T +        
Sbjct  240   NEQQLAELKHEIASGPFAYGSGPTSFEAVSGLVWKCITEARDFDDSVTNTYIYAVSTKVG  299

Query  967   KNGFH----------SRGNGLLPCRNGQVISA-VKAEMRVSEADVLELANLIGEKAVDET  1113
             +N +           S     LPC  G + +  V    R+   DV      +G++ +  T
Sbjct  300   RNRWQPPMPSEYCGTSSFTLCLPCAVGDLKNKHVSHAARLFHEDVRN----VGQERIQST  355

Query  1114  GIIDETMEEENGKSADFFV------YGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGV  1275
               ID  MEE   K  D  +       G  +  VNL    +Y F+    +P   +  +   
Sbjct  356   --ID-WMEETLRKGHDIGLNVPPPSTGMGIYSVNLHSFPVYEFEFGWGRPAHFSMVLEPW  412

Query  1276  GDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISKELGT  1413
                G V++LP P+   G    RIV ++L E +   L++E+     T
Sbjct  413   YGNGVVVLLPTPQG--GMRERRIVVMLLEEQMKRLLQSELFARFTT  456



>gb|EPS67739.1| hypothetical protein M569_07035, partial [Genlisea aurea]
Length=428

 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 108/209 (52%), Gaps = 7/209 (3%)
 Frame = +1

Query  142  SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLEDF  318
            + V+PA  T  G  L ++N DL +   ++  VY +R + A D  ++G LK+ + + L+ F
Sbjct  10   TKVLPAAETPRGS-LRISNVDLVVPNAHMSTVYFYRPTGASDFFDSGVLKAALAKTLDAF  68

Query  319  YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
            YP AGR++   EDGR  + CN  G   V A+    +D+  D +  SE+  L+ +      
Sbjct  69   YPVAGRLKRE-EDGRVVIDCNCEGALFVVAESDGVVDDLCDFTATSEFHRLVPNVDYFSE  127

Query  499  DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG--RRDLPP-KH  669
            D+  SP++  Q+T+FKCGG+S+G+   H + D F+    +N +     G     +PP   
Sbjct  128  DISASPILVSQVTYFKCGGVSVGVGTDHRVADGFAGLHLVNTWSDFARGCHATSIPPFLD  187

Query  670  PHMPTADNHNSPK-PRTQKLFPFSLGSVG  753
              +  A +H +PK P  + L P  + S  
Sbjct  188  RTLLRARDHPNPKFPHVEYLPPPQMKSAA  216



>ref|XP_010670732.1| PREDICTED: protein ECERIFERUM 26-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 192/419 (46%), Gaps = 42/419 (10%)
 Frame = +1

Query  175   GRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLED---FYPAAGRIRT  345
             G+ + L++ DL M+ H++R VY +++    GL  G+L   +  +L +   ++PA      
Sbjct  22    GKKIQLSSLDLLMEKHHIRMVYYYKTPK--GLLIGELTRKLRIILSEVTSYFPATTGRLV  79

Query  346   SPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVF  525
               E+G+  + CND+GVRI+EA    +++ WL   D  +   L+H +        ++  V+
Sbjct  80    RNEEGKWMINCNDAGVRIIEAIAKGSVETWLQNVDVEKEKKLIHWEDWYHIPYYWAT-VY  138

Query  526   IQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG-PAMAGRRDLPPKHPHMP--TADNH  696
             + +T F+ GG++IG+S +H++ D  S +  +  +    + G   +PP    +P  T   H
Sbjct  139   VMVTEFEEGGMAIGLSCSHLVCDPSSATLLIRAWADQVLWGNISIPPFLHPLPKRTLGFH  198

Query  697   NSPKPRTQKLFPFSLGSVGPVGDHWKLT----NTC---KMATQSYHITDKQLNALI--FK  849
              +       L            +H+K      ++C   K  T +   TD  + + I    
Sbjct  199   KAQNQPNNHLI-----------NHYKTLLESPSSCTAQKSTTIALAFTDNMVQSCINLAH  247

Query  850   VSGLKQSAKVKPFEAISALFWKSLAKVKEGS-GLETVTIVKNGFHSRGN-GLLPCRNGQV  1023
             ++G        PF A++ L W  ++K+KE + GL  ++I   G   R   GL     G  
Sbjct  248   LNGPNNGPDPSPFVALAGLLWVCISKLKECTNGLVDMSI---GLDMRKVLGLDKGFFGNC  304

Query  1024  ISAVKAEMRVSEADVLELANLIGE---KAVDETGIID--ETMEEENGKSADFFVYGANLT  1188
                 + +    + D L+LA  + E   K V++  IID  E +E  N  S    +   NL 
Sbjct  305   TVHTQVKGNDIKMDDLQLATKVIEESIKKVNKEEIIDLVEWLENYNNFSPPSSLDKDNLV  364

Query  1189  FVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILP  1362
              +NL+ +  Y    +KG +PI   Y      ++G +LVLP   +    +  RIV V LP
Sbjct  365   ILNLDHLDPYSSVFIKGYEPIKIAYYNESHINKGKILVLPC--HPSAGKFSRIVIVTLP  421



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 103/416 (25%), Positives = 167/416 (40%), Gaps = 43/416 (10%)
 Frame = +1

Query  142   SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLKSPMFRMLEDF  318
             S V PA  T E ++ N +N DL +   ++  VY +RS           LK  +  +L  F
Sbjct  18    SMVQPAKNTPEKKLWN-SNLDLVVGRIHILTVYFYRSNGSQNFFEPRVLKEALSNVLVSF  76

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
             YP AGR+    ++GR  + CN  GV  VEA+    +D++ D +  +E   L       G 
Sbjct  77    YPMAGRLGKD-DEGRVEINCNGEGVLFVEAESDCCVDDFGDFTPSTEMRRLTPTVDYSG-  134

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGR  648
             D+   PL+ +Q+T+FKCGG+S+G+   H L D  S   F+N +           P    R
Sbjct  135   DISSYPLIILQVTYFKCGGVSLGVGVHHTLSDGVSSLHFINTWSDMARGLSIAIPPFIDR  194

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
               L P+ P  PT D+     P +    P S    GP G          ++T    ++  Q
Sbjct  195   TLLRPRTPPTPTFDHVEYHPPPSMITKPLS----GPKG----------VSTAILKLSLDQ  240

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLET--VTIVKNGFHSRGNGLL  1002
             L  L  K            +E ++A  W+   K ++ S  +T  + I  +G       L 
Sbjct  241   LTTLKAKAKNEGNGKDHSTYEILAAHLWRCACKARDLSANQTSKLYIATDGRSRLCPPLP  300

Query  1003  PCRNGQVISA---------VKAEMRVSEADVLE--LANLIGEKAVDETGIIDETMEEENG  1149
             P   G V+           ++AE   S A  +   L  +  E        ++ T + +  
Sbjct  301   PGYLGNVVFTATPMADSGDLQAEPVTSTAKRIHNSLTRMDNEYLRSALDFLETTPDLKTL  360

Query  1150  KSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
                  +    NL   +   + ++  D    +PIF       +  EG + ++P   N
Sbjct  361   VRGPNYFASPNLNINSWTRLPVHDADFGWGRPIFMG--PASILYEGTIYIIPSTTN  414



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score =   100 bits (249),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 109/412 (26%), Positives = 163/412 (40%), Gaps = 57/412 (14%)
 Frame = +1

Query  178   RVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLEDFYPAAGRIRTSPE  354
             R L   N DL +   +   VY +R + A +  +   +K  + + L  FYP AGR++   E
Sbjct  20    RSLWNANVDLVVPRFHTPSVYFYRPTGAANFFDPQVMKEALSKALVPFYPMAGRLKRD-E  78

Query  355   DGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVFIQI  534
             DGR  + CN  GV  VEA+ +  ID++ D +   E   L+      G  +   PL+ +Q+
Sbjct  79    DGRIEIDCNAEGVLFVEAETTSVIDDFGDFAPTLELRQLIPTVDYSG-GISTYPLLVLQV  137

Query  535   TWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGRRDLPPKHPHMPT  684
             T+FKCGG S+G+   H   D +S   F+N +           P    R  L  + P  P 
Sbjct  138   TYFKCGGASLGVGMQHHAADGYSGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPA  197

Query  685   ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLK  864
               +     P      P S G                 A   + +T +QLNAL  K     
Sbjct  198   FHHIEYQPPPALNTPPQSTGPE-------------STAVSIFKLTREQLNALKAKSKEDG  244

Query  865   QSAKVKPFEAISALFWKSLAKVK-----EGSGLETVTIVKNGFHSRGNGLLPCRNGQVIS  1029
              S     +E +S   W+S+ K +     +G+ L    I  +G       L P   G VI 
Sbjct  245   NSVNYSSYEMLSGHVWRSVCKARGLTDDQGTKL---YIATDGRSRLRPPLPPGYFGNVI-  300

Query  1030  AVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSA-DF---------FVYGA  1179
                A       D++          + +  +    M++E  +SA DF          V GA
Sbjct  301   -FTATPIAVAGDLMLKPTWYAASRIHDALV---RMDDEYLRSALDFLELQPDLSALVRGA  356

Query  1180  ------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
                   NL   +   + I+  D    +PIF     GG+  EG   VLP P N
Sbjct  357   HTFKCPNLGITSWARLPIHDADFGWGRPIFMG--PGGIPYEGLSFVLPSPNN  406



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score =   100 bits (249),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 104/414 (25%), Positives = 170/414 (41%), Gaps = 40/414 (10%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLEDFYP  324
             V PA  T +  + N +N DL +   +   VY +R + + D  +   L+  + ++L  FYP
Sbjct  11    VRPAAPTPQRDLWN-SNVDLVVPRIHTASVYFYRPTGSPDFFSMNILRDALSKLLVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
              AGR++  P DGR  + CN  GV +VEA     ID++ D +   E   L+        D+
Sbjct  70    MAGRLKRDP-DGRIEINCNGEGVLLVEAITDSVIDDFGDFAPTMELKQLIPKVN-YSEDI  127

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPT  684
                PL+ +Q+T+FKCGG+S+G+   H + D ++   F+N +     G     P       
Sbjct  128   SSYPLLVLQVTFFKCGGVSLGVGMQHHVADGYAGIHFINTWSDVARGLDITLPPFIDRTL  187

Query  685   ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCK--MATQSYHITDKQLNALIFKVSG  858
                 N P P+ Q +         P+ D   + N  K   +   + +T +QL  L  K   
Sbjct  188   LRARNPPTPKFQHI---EYQQPPPLKDTSGIMNGEKNGFSVAIFKLTKEQLEILKGKARE  244

Query  859   LKQSAKVKPFEAISALFWKSLAKVKE-GSGLET-VTIVKNGFHSRGNGLLPCRNGQVISA  1032
                +     +E +S   W+   K +      ET + I  +G +     + P   G VI  
Sbjct  245   NGNNIAYSSYEMLSGHIWRCACKARNLAEDQETKLYIATDGRNRLRPSIPPGYFGNVIFT  304

Query  1033  VKAEMRVSEADVLELANLIGEKAVDETGIIDET---MEEENGKSA-DFFVYGANLT----  1188
                 M V+        ++I +       +I E    M++E  +SA D+     +LT    
Sbjct  305   T-TPMAVA-------GDIISKPTYYAASVIHEALGRMDDEYLRSALDYLELQPDLTALVR  356

Query  1189  -----------FVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
                          +   + I+  D    +PIF     GG+  EG   VLP   N
Sbjct  357   GSHTFRCPNIGITSWSRLPIHDADFGWGRPIFMG--PGGIAYEGLAFVLPSSAN  408



>ref|XP_007223985.1| hypothetical protein PRUPE_ppa014744mg [Prunus persica]
 gb|EMJ25184.1| hypothetical protein PRUPE_ppa014744mg [Prunus persica]
Length=448

 Score =   100 bits (249),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 122/433 (28%), Positives = 196/433 (45%), Gaps = 36/433 (8%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVD---GLNTGDLKSPMFRMLED  315
             +VV       G+   L+  D  M+ ++LR V  + S       G  TG L+  +  ML  
Sbjct  12    TVVSTKPVQAGKSYPLSVLDRHMEHNHLRMVLYYPSMGAPTEPGEITGRLRESLAVMLTH  71

Query  316   FYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLG  495
             F    GR++ +  D +  +KCND+GVR++EAK   +++EWL   D+ +   L++ +++  
Sbjct  72    FPIVTGRLQKNDND-QWMIKCNDAGVRMLEAKAKGSLEEWLRNVDRDKELMLVYWEEMYH  130

Query  496   PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG-PAMAGR-RDLP---  660
                 +S   ++QIT F+ GGL+IG+S  H+L D    + F+  +      G+   LP   
Sbjct  131   KPYFWSTF-YVQITEFEDGGLAIGLSCTHLLADPTCATMFIKAWADTTFPGKMMSLPFFY  189

Query  661   --PKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN  834
               P+     T  NHN+       L      S+    D   L +  K  T S+  +D  + 
Sbjct  190   PLPRRSPGNTRPNHNT----YNSLITHYKASINESID---LVDK-KHTTVSFGFSDDMVR  241

Query  835   AL--IFKVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLLP  1005
             A   + +  G    +   PFEA++ LFW  ++KVK   +GL  ++I  +     G     
Sbjct  242   ACMEMAQPDGANDKSSPSPFEALAGLFWVCISKVKGVRNGLIDMSISIDVRQVLGLDKGF  301

Query  1006  CRNGQVISAVKAEMRVSEADVLELANLIGE--KAVDETGIID--ETMEEENGKSADFFVY  1173
               N  V + V  E    E  + + A  IGE    +D  GI+D  E ++  + +S    + 
Sbjct  302   FGNSMVYNKVHLE-SFQENSLSQAATSIGEVVAKMDNEGIMDLIEWLQCNDDQSPS-LMN  359

Query  1174  GANLTFVNLEEVKIYGFDMK-GQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GRI  1344
             G +L   +LE V  +    + G  PI  +  I  V   G VL+LP     K K+G   R 
Sbjct  360   GCDLICASLEAVDPFSAIFEDGIAPIHVSCYIEPVLGLGKVLILPA----KPKDGQLSRA  415

Query  1345  VNVILPEHLLGKL  1383
             V V LP   + KL
Sbjct  416   VMVTLPRDEVTKL  428



>ref|XP_007099550.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY20478.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=339

 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 130/277 (47%), Gaps = 27/277 (10%)
 Frame = +1

Query  148  VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSE-AVDGLNTGDLKSPMFRMLEDFYP  324
            V PA  T   R L L+N DL + ++++  VY ++   + D  +T  LK  + ++L  FYP
Sbjct  11   VCPAEETPNQR-LWLSNLDLVVTVYHMSTVYFYKPNGSSDFFDTKVLKESLSKILVPFYP  69

Query  325  AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWL-DMSDQSEYDHLLHHDQVLGPD  501
             AGR+    E+GR  + CN  GV  + A+ +  +D+ + D +D S+   LL      G  
Sbjct  70   VAGRLGYD-ENGRLEIICNAKGVLFIVAETTSIMDDLVQDFTDGSKVPQLLPKIDYSG-G  127

Query  502  LGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG----------RR  651
            +   PL+ +Q+T FKCGG+S+G+S+ H L D  S   F+N +   + G          R 
Sbjct  128  ISSYPLLGLQVTTFKCGGISLGVSFEHTLADGSSGLHFINSWANTVRGLSPSIAPFLDRT  187

Query  652  DLPPKHPHMPTADN-HNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
             L  ++P +    +    P PR Q +F      V P                ++ IT  Q
Sbjct  188  LLRARNPLILKFRHVEFEPSPRLQTMFSTLESQVSPKPS----------IVSAFKITADQ  237

Query  829  LNALIFKVSGLKQS-AKVKPFEAISALFWKSLAKVKE  936
            LNAL  K++    S  K   +  +SA  W+   K ++
Sbjct  238  LNALKAKINENSNSNTKYSTYRILSAHIWRCATKARD  274



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score = 99.8 bits (247),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 86/288 (30%), Positives = 127/288 (44%), Gaps = 28/288 (10%)
 Frame = +1

Query  178   RVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLKSPMFRMLEDFYPAAGRIRTSPE  354
             R L  +N DL + + +++ VY ++         T  L   +  +L  FYPAAGR+R   E
Sbjct  20    RSLWSSNLDLLVPMFHVQTVYFYKPNGSSRFFETQVLTDALSDVLVPFYPAAGRMRKH-E  78

Query  355   DGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFSPLVFIQI  534
              GR  + CN  GV  VEA+ S   D+  D +D S+   L+      G    F PLV +Q+
Sbjct  79    SGRIEINCNGEGVLFVEAETSCFADDLGDFTDSSKLLPLVPEVDYAGGISSF-PLVVLQV  137

Query  535   TWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGRRDLPPKHPHMPT  684
             T FKCG +S+G+   H+L D  S   F+N +           P    R  L  + P  PT
Sbjct  138   TRFKCGAVSLGVGLHHILADGTSALHFINSWSDVARGLPVSTPPFIDRTLLRARDPPHPT  197

Query  685   ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLK  864
               +     P T    P S           +   TC   T+   IT +QL +L  KV    
Sbjct  198   FHHSEYDPPPTMNTPPRS-----------QPKTTC---TKILKITPEQLGSLKAKVRTED  243

Query  865   QSAKVKPFEAISALFWKSLAKVKEGSGLETVTI-VKNGFHSRGNGLLP  1005
              +A+   +E I+A  W+S+ K +  S  +   + +     SR N  LP
Sbjct  244   GAARHSTYETITAHIWRSMCKARGLSDDQASKLYISTDGRSRLNPQLP  291



>ref|XP_003532115.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Glycine 
max]
 gb|KHM99604.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=452

 Score = 99.4 bits (246),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 113/441 (26%), Positives = 195/441 (44%), Gaps = 61/441 (14%)
 Frame = +1

Query  112   VENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKS  291
             V  IV  H    VVP   T + R L L+++D  ++L +   +Y+++++  +      +K+
Sbjct  2     VVTIVASH---CVVPNQETPKVR-LWLSDSDQVVRLGHTPTIYVYKAKH-NTKTIERMKT  56

Query  292   PMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMS-DQSEYDH  468
              + ++L  +YP AGR+  S + GR  + CN  GV ++EA+ +K++ ++ D S  +S  + 
Sbjct  57    SLGKILVYYYPVAGRLNLS-DSGRMELDCNAKGVTLLEAETTKSLGDYGDFSPSESIKEE  115

Query  469   LLHHDQVLGPDLGFSPLVFIQITWFKCG-GLSIGISWAHVLGDAFSLSDFLNKYGPAMAG  645
             L+       P L   PL+F+Q+T FK G   +IG++ +H L D  S   F+N +     G
Sbjct  116   LVPQIDYTQP-LEELPLLFVQLTRFKDGESFAIGVACSHTLADGLSAIQFINSWAKVARG  174

Query  646   RRDLPPKHP----------HMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKM  795
                 P + P          H P+A   + P+    K  P  LGS   + +  K   TC +
Sbjct  175   ETLEPHEVPFLDRTVLKLQHSPSAPCFDHPE---LKPLPLKLGSSDSIAEENK--KTCAV  229

Query  796   ATQSYHITDKQLNALIFKVSG--LKQSAKVKP---FEAISALFWKSLAKVKEGSGLETVT  960
               +   +T +Q+  L  K +   +K+ ++V+P   FEAI+A  W+   K +E    +   
Sbjct  230   LLK---LTPEQVGKLKKKANDQPMKEGSRVRPYSRFEAIAAHIWRCACKARELDEKQPTL  286

Query  961   IVKNG-FHSR----------GNGLLP-----CRNGQVIS------AVKA----EMRVSEA  1062
             +  NG   SR          GN L       C  G+ +S      A K     EM  +E 
Sbjct  287   VRFNGDIRSRLIPPLPRTYFGNALAATVTPRCYVGETLSKPLSYAAQKVREAIEMLTNEY  346

Query  1063  DVLELANLIGEKAVDETGIIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQK  1242
                +L  ++GE+ +D    I      +  +    F    NL   +   + +Y  D    K
Sbjct  347   IRSQLDIVLGEEQLD---CIKALFSGQGERRNAPFAGNPNLQITSWMSMPVYEADFGWGK  403

Query  1243  PIFANYTIGGVGDEGAVLVLP  1305
             P++         D   +L+ P
Sbjct  404   PMYFGLAYVSAQDRAVILLSP  424



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score = 99.0 bits (245),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 115/424 (27%), Positives = 177/424 (42%), Gaps = 62/424 (15%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLEDFYP  324
             V PA  T    + N +N DL +   +   VY +R + A +  +   LK  + + L  FYP
Sbjct  11    VQPAEETPRRGLWN-SNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSKALVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
              AGR+R   EDGR  + CN  GV  VEA+ +  ID++ D +   E   L+      G  +
Sbjct  70    MAGRLRRD-EDGRIEINCNAEGVLFVEAETTSVIDDFADFAPTLELKQLIPTVDYSG-GI  127

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGRRD  654
                PL+ +Q+T+FKCGG+S+G+   H   D FS   F+N +           P    R  
Sbjct  128   STYPLLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRTL  187

Query  655   LPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN  834
             L  + P  P   +H   +P      P S+ +V       + +     A   + ++  QL+
Sbjct  188   LRARDPPQPVF-HHVEYQP------PPSMKTV------LETSKPESTAVSIFKLSRDQLS  234

Query  835   ALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKE-GSGLETVTIVKNGFHSRGNGLLPC-  1008
              L  K      +     +E ++A  W+S  K +E     ET   +     SR    LP  
Sbjct  235   TLKAKAKEDGNNISYSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSRWQPQLPPG  294

Query  1009  RNGQVI-----SAVKAEM----------RVSEADVLELANLIGEKAVDETGIIDETMEEE  1143
               G VI      AV  EM          ++ +A ++ + N   + A+D        +E +
Sbjct  295   YFGNVIFTATPIAVAGEMQSKPTWYAAGKIHDA-LVRMDNDYLKSALD-------YLELQ  346

Query  1144  NGKSADFFVYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLP  1305
                SA   V GA      NL   +   + I+  D    +PIF     GG+  EG   +LP
Sbjct  347   PDLSA--LVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMG--PGGIAYEGLSFILP  402

Query  1306  GPEN  1317
              P N
Sbjct  403   SPTN  406



>ref|XP_006432968.1| hypothetical protein CICLE_v10001131mg [Citrus clementina]
 ref|XP_006471653.1| PREDICTED: protein ECERIFERUM 1-like [Citrus sinensis]
 gb|ESR46208.1| hypothetical protein CICLE_v10001131mg [Citrus clementina]
Length=450

 Score = 99.4 bits (246),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 111/462 (24%), Positives = 189/462 (41%), Gaps = 59/462 (13%)
 Frame = +1

Query  109   DVENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLK  288
             D ++ V  H + + V +  +       LT  D AM  H +  ++ +        +   ++
Sbjct  3     DQKSRVNVHSVLTQVSSRPSASDETYPLTRLDHAMGHHTIHVIFYYEKSPFGSFDMDPIR  62

Query  289   SPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSD-QSEYD  465
               +  +L  + P  GR+ T  + G   VKCND+GVR++ A+   T+DEWL  +D   E D
Sbjct  63    VTLSEVLSSYPPVTGRL-TRDDAGNWAVKCNDAGVRVLRARVGITLDEWLRSADGNEERD  121

Query  466   HLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG  645
               +  D    P+  +SP   IQ+  F+ GG++IG+S  H+ GD  SL      +  A  G
Sbjct  122   LTVWEDMPEVPN-TWSPFR-IQLNDFEGGGVAIGLSCTHMHGDLTSLILLFKAFSEAHHG  179

Query  646   R-------RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQ  804
             +          P       + +N  S      KL               K T + KM+T 
Sbjct  180   QAITFPPFFKPPAPPDRKFSVNNSKSTSYLEAKL--------------QKQTPSVKMSTA  225

Query  805   SYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKV---KEGSGLETVTIVKN-  972
             ++  +D  +   + ++    +     PF+ ++ALFW  +  +   K      ++++  + 
Sbjct  226   TFKFSDSVVKQCLSEIH--DKCPDASPFDLLAALFWIRVVHLKGPKHDDHTHSLSLCVDF  283

Query  973   --------GFHSRGNGLLPCRNGQVISAVKAEM------RVSEADVLELANLIGEKAVDE  1110
                      +   GN L    N  ++S  + EM      RV+E     ++ L  E+    
Sbjct  284   RRLLQEPLPYGYFGNAL----NFSLLSLNEEEMDCSMLGRVAELVHCHVSGLKEEEFWAT  339

Query  1111  TGIIDETMEEENGKSADFFVYGANLTFVNLEEVKI------YGFDMKGQKPIFANYTIGG  1272
                +D   EE    +  F +YG   T V++E + I      Y  +    KP+  +  +G 
Sbjct  340   LHWLDLQKEEGGKYAPPFAMYGPEFTCVSMEHMIIGDQPVMYSMNFDSAKPVHVSCHVGN  399

Query  1273  VGDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEIS  1398
                EG +LV+P  E        R V V LPE    KL  + S
Sbjct  400   AEGEGLILVMPSAE----AGLARTVMVTLPEEETAKLCEDQS  437



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score = 99.0 bits (245),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 181/435 (42%), Gaps = 47/435 (11%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLEDFYP  324
             V PA  T +  + N +N DL +   +   VY +R S + D  +   L+  + ++L  FYP
Sbjct  11    VRPAAPTPQRDLWN-SNVDLVVPRIHTASVYFYRPSGSPDFFSMHILRDALSKVLVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
              AGR++  P DGR  + CN  GV +VEA     ID++ D +   E   L+        D+
Sbjct  70    MAGRLKRDP-DGRIEINCNGEGVLLVEATTDSVIDDFGDFAPTMELKQLIPKVN-YSEDI  127

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPT  684
                 L+ +Q+T+FKCGG+S+G+   H + D ++   F+N +     G     P       
Sbjct  128   SSYALLVLQVTFFKCGGVSLGVGMQHHVADGYAGLHFINTWSDVARGLDIALPPFIDRTL  187

Query  685   ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCK--MATQSYHITDKQLNALIFKVSG  858
                 N P P+ Q +         P+ D   + N  K   +   + +T +QL+ L  K   
Sbjct  188   LRARNPPTPKFQHI---EYQQPPPLKDTSGIMNGEKNDFSVAIFKLTKEQLDILKGKARE  244

Query  859   LKQSAKVKPFEAISALFWKSLAKVK---EGSGLETVTIVKNGFHSRGNGLLPCRNGQVIS  1029
                      +E +S   W+   K +   E  G + + I  +G       L P   G VI 
Sbjct  245   NGNKVSYSSYEMLSGHIWRCACKARNLTEDQGTK-LYIATDGRSRLRPSLPPGYFGNVIF  303

Query  1030  AVKAEMRVSEADVLELANLIGEKAVDETGIIDET---MEEENGKSA-DF---------FV  1170
                  M V+        +++ +       +I E    M++E  +SA D+          V
Sbjct  304   TT-TPMAVA-------GDIVSKPTYYAASVIHEALGRMDDEYLRSALDYLELQPDLTALV  355

Query  1171  YGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKE  1332
              GA      N+   +   + I+  D    +PIF     GG+  EG   +LP       K+
Sbjct  356   RGAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMG--PGGIAYEGLAFILPS----SAKD  409

Query  1333  GGRIVNVIL-PEHLL  1374
             G   V + L P+H++
Sbjct  410   GSLSVALGLQPDHMV  424



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 125/279 (45%), Gaps = 27/279 (10%)
 Frame = +1

Query  130  DHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLKSPMFRM  306
            D + S++V  +     R L  +N DL + + +++ VY ++         T  LK  +  +
Sbjct  4    DVKQSTMVRPSRETPNRSLWSSNLDLLVPMFHVQTVYFYKPNGSSRFFETQVLKDALSDV  63

Query  307  LEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQ  486
            L  FYPAAGR+    E GR  + CN  G+  VEA+ S  ID+  D +D S+   L+    
Sbjct  64   LVPFYPAAGRMGKH-ESGRTEIHCNGEGILFVEAETSCFIDDLGDFTDSSKLLPLVPEVD  122

Query  487  VLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PA  636
              G    F PLV +Q+T FKCG +S+G+   H+L D  S   F+N +           P 
Sbjct  123  YSGGISSF-PLVVLQVTHFKCGAVSLGVGLHHILADGTSALHFINSWSDVARGLPVSTPP  181

Query  637  MAGRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHI  816
               R  L  + P  PT  +     P T    P S           +   TC   T+   I
Sbjct  182  FIDRTLLRARDPPNPTFHHVEYDPPPTMNTPPQS-----------QPKTTC---TKILKI  227

Query  817  TDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK  933
            T +QL +L  KV     + +   +E I+A  W+S+ K +
Sbjct  228  TPEQLGSLKAKVRTEDGAVRHSTYETITAHIWRSMCKAR  266



>ref|XP_008219914.1| PREDICTED: protein ECERIFERUM 26-like [Prunus mume]
Length=448

 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 117/436 (27%), Positives = 194/436 (44%), Gaps = 42/436 (10%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVD---GLNTGDLKSPMFRMLED  315
             +VV       G+   L+  D  M+ ++LR V  + S       G  TG L+  +   L  
Sbjct  12    TVVSTKPVQAGKSYPLSVLDRHMEHNHLRMVLYYPSMGAPTKPGEITGRLRESLAVTLTH  71

Query  316   FYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLG  495
             F    GR++ +  D +  +KCND+GVR++EAK   +++EWL   D+ +   L++ +++  
Sbjct  72    FPIVTGRLQKNDND-QWMIKCNDAGVRMLEAKAKGSLEEWLRNVDRDKELMLVYWEEMYH  130

Query  496   PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG-PAMAGRR-------  651
                 +S   ++QIT F+ GGL+IG+S  H+L D    + F+  +   +  G+        
Sbjct  131   KPYFWSTF-YVQITEFEDGGLAIGLSCTHLLADPTCATMFIKAWADTSFLGKMMSPLFFY  189

Query  652   DLPPKHP--HMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDK  825
              LPP+ P    P  + +NS     +     S+  V             K  T S+  +D 
Sbjct  190   QLPPRRPGNTRPNYEPYNSLINHYKASINKSIDLVDK-----------KHTTVSFSFSDD  238

Query  826   QLNAL--IFKVSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNG  996
              + A   + + +G        PFEA++ LFW  ++KVK   +GL  ++I  +     G  
Sbjct  239   MVRACMEMAQPNGANDKLSPSPFEALAGLFWVCISKVKGVRNGLIDMSISLDARKVLGLD  298

Query  997   LLPCRNGQVISAVKAEMRVSEADVLELANLIGE--KAVDETGIID--ETMEEENGKSADF  1164
                  N  V + V  E    E  + + A  IGE    +D  GI+D  E +   + +S   
Sbjct  299   KGFFGNSTVYNKVHLE-SFQENSLSQAATSIGEVVAKMDNKGIMDLIEWLRCNDDQSPS-  356

Query  1165  FVYGANLTFVNLEEVKIY-GFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--  1335
              +   +L   +LE V ++      G  PI  +  I  V   G VL+LP     K ++G  
Sbjct  357   LMNNCDLICASLEVVDLFLAIFEDGIAPIHVSCYIEPVLGLGKVLILPA----KPRDGQL  412

Query  1336  GRIVNVILPEHLLGKL  1383
              R+V V LP   + KL
Sbjct  413   SRVVMVTLPRDEVTKL  428



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 116/424 (27%), Positives = 178/424 (42%), Gaps = 62/424 (15%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLEDFYP  324
             V PA  T    + N +N DL +   +   VY +R + A +  +   LK  + + L  FYP
Sbjct  11    VQPAEETPRRGLWN-SNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSKALVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
              AGR+R   EDGR  + CN  GV  VEA+ +  ID++ D +  SE   L+      G  +
Sbjct  70    MAGRLRRD-EDGRIEINCNAEGVLFVEAETTSVIDDFADFAPTSELKQLIPTVDYSG-GI  127

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGRRD  654
                 L+ +Q+T+FKCGG+S+G+   H   D FS   F+N +           P    R  
Sbjct  128   STYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRTL  187

Query  655   LPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN  834
             L  + P  P A  H   +P      P S+ +V       + +     A   + ++  QL+
Sbjct  188   LRARDPPQP-AFYHVEYQP------PPSMKTV------LETSKPESTAVSIFKLSRDQLS  234

Query  835   ALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKE-GSGLETVTIVKNGFHSRGNGLLPC-  1008
              L  K +    +     +E ++A  W+S  K +E     ET   +     SR    LP  
Sbjct  235   TLKAKANEDGNNISYSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSRWQPQLPPG  294

Query  1009  RNGQVI-----SAVKAEM----------RVSEADVLELANLIGEKAVDETGIIDETMEEE  1143
               G VI      AV  EM          ++ +A ++ + N   + A+D        +E +
Sbjct  295   YFGNVIFTATPIAVAGEMQSKPTCYAAGKIHDA-LVRMDNDYLKSALD-------YLELQ  346

Query  1144  NGKSADFFVYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLP  1305
                SA   V GA      NL   +   + I+  D    +PIF     GG+  EG   +LP
Sbjct  347   PDLSA--LVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMG--PGGIAYEGLSFILP  402

Query  1306  GPEN  1317
              P N
Sbjct  403   SPTN  406



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 115/424 (27%), Positives = 178/424 (42%), Gaps = 62/424 (15%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFR-SEAVDGLNTGDLKSPMFRMLEDFYP  324
             V PA  T    + N +N DL +   +   VY +R + A +  +   LK  + + L  FYP
Sbjct  11    VQPAEETPRRGLWN-SNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSKALVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
              AGR+R   EDGR  + CN  GV  VEA+ +  ID++ D +   E   L+      G  +
Sbjct  70    MAGRLRRD-EDGRIEINCNAEGVLFVEAETTSVIDDFADFAPTLELKQLIPTVDYSG-GI  127

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGRRD  654
                PL+ +Q+T+FKCGG+S+G+   H   D FS   F+N +           P    R  
Sbjct  128   STYPLLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRTL  187

Query  655   LPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN  834
             L  + P  P   +H   +P      P S+ +V       + +     A   + ++  QL+
Sbjct  188   LRARDPPQPVF-HHVEYQP------PPSMKTV------LETSKPESTAVSIFKLSRDQLS  234

Query  835   ALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKE-GSGLET-VTIVKNGFHSRGNGLLPC  1008
              L  K      +     +E ++A  W+S  K +E     ET + I  +G       L P 
Sbjct  235   TLKAKAKEDGNNISYSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSRLRPQLPPG  294

Query  1009  RNGQVI-----SAVKAEM----------RVSEADVLELANLIGEKAVDETGIIDETMEEE  1143
               G VI      AV  EM          ++ +A ++ + N   + A+D        +E +
Sbjct  295   YFGNVIFTATPIAVAGEMQSKPTWYAAGKIHDA-LVRMDNDYLKSALD-------YLELQ  346

Query  1144  NGKSADFFVYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLP  1305
                SA   V GA      NL   +   + I+  D    +PIF     GG+  EG   +LP
Sbjct  347   PDLSA--LVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMG--PGGIAYEGLSFILP  402

Query  1306  GPEN  1317
              P N
Sbjct  403   SPTN  406



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 106/431 (25%), Positives = 180/431 (42%), Gaps = 62/431 (14%)
 Frame = +1

Query  178   RVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLKSPMFRMLEDFYPAAGRIRTSPE  354
             R L  +N DL +   +   VY +R   V    +   +K  + + L  FYP A R+R   +
Sbjct  20    RALWNSNVDLVVPNFHTPSVYFYRPNGVSNFFDAKVMKEALSKALVPFYPMAARLRRD-D  78

Query  355   DGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDLGFS------P  516
             DGR  + C+  GV  VEA+ +  I+++ D S   E   L+       P + +S      P
Sbjct  79    DGRVEIYCDAQGVLFVEAETTAAIEDFGDFSPTLELRQLI-------PSVDYSAGIHSYP  131

Query  517   LVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGRRDLPPK  666
             L+ +Q+T+FKCGG+S+G+   H + D  S   F+N +           P    R  L  +
Sbjct  132   LLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINAWSDVARGLDISLPPFIDRTLLRAR  191

Query  667   HPHMPTADN-HNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALI  843
              P +P  D+    P P T+K  P  L    P+G     +++  +A  ++ +T  QL+ L 
Sbjct  192   DPPLPVFDHIEYKPPPATKKTTP--LQPSKPLG-----SDSTAVAVSTFKLTRDQLSTLK  244

Query  844   FKVSGLKQSAKVKPFEAISALFWKSLAKVKE-GSGLETVTIVKNGFHSRGNGLLPCRNGQ  1020
              K      +     +E ++   W+S+ K +      ET   +     +R    LP  +G 
Sbjct  245   GKSREDGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLP--HGY  302

Query  1021  VISAVKAEMRVSEA-DVLELANLIGEKAVDETGIIDETMEEENGKSA-DF---------F  1167
               + +     ++ A D++          + +  I    M+ E  +SA D+          
Sbjct  303   FGNVIFTTTPIAVAGDLMSKPTWYAASRIHDALI---RMDNEYLRSALDYLELQPDLKSL  359

Query  1168  VYGA------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGK  1329
             V GA      NL   +   + I+  D    +PIF     GG+  EG   ++P   N    
Sbjct  360   VRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMG--PGGIAYEGLSFIIPSSTN----  413

Query  1330  EGGRIVNVILP  1362
             +G   + + LP
Sbjct  414   DGSLSLAIALP  424



>ref|XP_007027321.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07823.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score = 98.2 bits (243),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 113/423 (27%), Positives = 184/423 (43%), Gaps = 58/423 (14%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSE-AVDGLNTGDLKSPMFRMLEDFYP  324
             V PA  T   R L ++N DL M ++++  VY ++   + +  +T  LK  + ++L  FYP
Sbjct  11    VCPAEETPNRR-LWVSNFDLVMIMYHISTVYFYKPNGSTNIFDTKVLKESLSKILVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWL-DMSDQSEYDHLLHHDQVLGPD  501
              AGR+    E+GR  + CN  GV   EA+ S  +D+ + D +D S+   L+      G  
Sbjct  70    IAGRLGYD-ENGRLEIICNAKGVLFTEAESSSIMDDLVQDFTDGSKVPQLVPKIDYSG-G  127

Query  502   LGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG----------RR  651
             +   PL+ +Q+T FKCGG+S+G++  H L D  S   F+N +   + G          R 
Sbjct  128   ISSYPLLGLQVTTFKCGGISLGVAVQHTLLDGSSGLHFINSWANTVGGLSPSISPFLDRT  187

Query  652   DLPPKHPHMPTADNHN---SPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITD  822
              L  ++P  PT   H+    P P  Q +F  S     P                 + IT 
Sbjct  188   LLRARNP--PTPKFHHVEFEPSPSLQTMFSTSESQQSPKPS----------IVSVFKITT  235

Query  823   KQLNALIFKVSGLKQS-AKVKPFEAISALFWKSLAKVK---EGSGLETVTIVKNGFHSRG  990
              QLN L  KV+    S  K   +  ++A  W+   K +   E   L+ +T+  +G +   
Sbjct  236   DQLNTLKAKVNESSNSNTKYSTYSILTAHIWRCATKARDLLEDQQLK-LTMPVDGRNRLH  294

Query  991   NGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEEENGKSADFFV  1170
               L P   G VI  V A +     D+L  + +   K + +   I + M++E  +S+  ++
Sbjct  295   PPLPPGYFGNVI--VMAALVALSGDLLSESFIDTVKRIHK---ILKEMDDEYLRSSIDYI  349

Query  1171  YGA----------------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVL  1302
               A                NL+  +   + I+  D    +PIF       +  EG V +L
Sbjct  350   EKAPDINVIRRGPQTMRCPNLSVNSWIWLPIHDADFGWGRPIFMR--PANIVHEGKVYIL  407

Query  1303  PGP  1311
             P P
Sbjct  408   PSP  410



>ref|XP_010546595.1| PREDICTED: protein ECERIFERUM 26-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010546596.1| PREDICTED: protein ECERIFERUM 26-like isoform X2 [Tarenaya hassleriana]
Length=435

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 119/445 (27%), Positives = 182/445 (41%), Gaps = 79/445 (18%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFYP  324
             + V +  TG GR+  LT+ D AM  H +  ++ +R       +   ++  +  +L  + P
Sbjct  17    TAVSSKPTGPGRIHPLTDIDHAMDQHTVHVIFYYRRSPFSSFDLDSVRVSLSELLSFYPP  76

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
               GR+  +PE  +  VKCND+GVRI++A+    +DEWL  +D +E   L   + +     
Sbjct  77    VTGRVARNPETRKWEVKCNDAGVRILKARVGVGLDEWLRSADGNEERDLTVWEAMPEDPS  136

Query  505   GFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMPT  684
              +SP   IQI  F+ GG +IG+S +H   D  SL      +  A   +R  P  HP  P+
Sbjct  137   IWSPFR-IQINEFEGGGAAIGLSCSHKQADPTSLIFLFKSWTEA---QRRQPISHP--PS  190

Query  685   ADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGLK  864
                  SP   T  +   SL +          T T + +  ++    ++  A IF      
Sbjct  191   F----SPLINTNAVNSPSLETPTTATA--TATATFRFSAYAFRRCLEESVAGIF------  238

Query  865   QSAKVKPFEAISALFWKSLAKVKE--GSGLETVTI-----------VKNGFHSRGNGLL-  1002
                   PF+  +ALF   +A  K        +VTI           V  GF   GN L  
Sbjct  239   --PDASPFDVFAALFSSRIANAKRDHSRNRSSVTICVDIRRLLPDPVPYGFF--GNALHF  294

Query  1003  ---------PCRNGQVISAVKAEMRVSEAD-VLELANLIGEKAVDETGIIDETMEEENGK  1152
                        R G V   +   +   + D +L     +G +AV   G            
Sbjct  295   SSLELSHTDDTRIGHVARMINRHVANLDGDQILSGLKRLGPEAVQMYG------------  342

Query  1153  SADFFVYGANLTFVNLEEVKIYG--------FDMKGQKPIFANYTIGGVGDEGAVLVLPG  1308
                     ++LT V++E + + G        FD  G++P   +  IG  G EG ++V P 
Sbjct  343   --------SDLTVVSMEHMVVEGEPSMYEAVFD-GGERPSHVSCMIGNSGREGVIVVTPS  393

Query  1309  PENLKGKEGGRIVNVILPEHLLGKL  1383
             PE    K  GR V V LPE    KL
Sbjct  394   PE----KGFGRTVTVTLPEEETKKL  414



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score = 97.4 bits (241),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 107/413 (26%), Positives = 168/413 (41%), Gaps = 39/413 (9%)
 Frame = +1

Query  148   VVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLKSPMFRMLEDFYP  324
             V PA  T    + N +N DL +   +   VY +R  A D   + G LK+ + R L  FYP
Sbjct  11    VRPAAATPMVSLWN-SNIDLVVPNFHTPSVYFYRPTAADNFFDAGVLKAALGRALVPFYP  69

Query  325   AAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPDL  504
              AGR++   EDGR  + CN  GV  VEA+    +D++ D +   E   L+       P +
Sbjct  70    MAGRLKRD-EDGRVEIDCNAEGVLFVEAESDGVVDDFGDFAPTLELRRLI-------PAV  121

Query  505   GFS------PLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPK  666
              +S      PL+ +Q+T FKCGG+S+G+   H + D FS   F+N +     G     P 
Sbjct  122   DYSQGISTYPLLVLQVTHFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMARGLDLTIPP  181

Query  667   HPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIF  846
                       + P+P+ + +      ++  +    K     + A   + +T  QLNAL  
Sbjct  182   FIDRTLLRARDPPQPQFKHIEYQPAPAMKTLAS--KDAEAPETAVSIFKLTRDQLNALKA  239

Query  847   KVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGL-----ETVTIVKNGFHSRGNGLLPCR  1011
             K      +     +E ++   W+S+   +   GL       + I  +G       L P  
Sbjct  240   KSKEGGNTVTYSSYEMLAGHVWRSVCMAR---GLPEDQDTKLYIATDGRSRLQPPLPPGY  296

Query  1012  NGQVI---SAVKAEMRVSEADVLELANLIGE--KAVDETGIIDETMEEENGKSADFFVYG  1176
              G VI   + +     ++   V   A+ I +    +D   +       E        V G
Sbjct  297   FGNVIFTATPIAVSGDLTSKPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRG  356

Query  1177  A------NLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
             A      NL   +   + I+  D    +PIF     GG+  EG   VLP P N
Sbjct  357   AHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG--PGGIAYEGLSFVLPSPTN  407



>ref|XP_002964534.1| hypothetical protein SELMODRAFT_405848 [Selaginella moellendorffii]
 gb|EFJ34867.1| hypothetical protein SELMODRAFT_405848 [Selaginella moellendorffii]
Length=459

 Score = 97.4 bits (241),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 111/466 (24%), Positives = 198/466 (42%), Gaps = 46/466 (10%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADL-AMKLHYLRGVYLFRSEAVDGLNTGD-----  282
             +V+   +S++VPA  T +   L L N  +  +  +Y++ VY + + A+D +++ D     
Sbjct  2     VVHVESVSTIVPAVPTPQPCTLWLCNFQIQVLGDNYIKQVYYYPA-ALDHVSSFDSLVAS  60

Query  283   LKSPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEY  462
             LK  + R+L  +YP AGR R +  D RP ++CND G+  V A    +  +W +   Q   
Sbjct  61    LKDSLSRILVPYYPLAGRPRIAGLD-RPILECNDRGIEFVVAFADASFGDWGNSMKQCSI  119

Query  463   DHLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMA  642
             +  L+  Q    D    P + +Q+T F+CGG+++G+  +H L D  S   FL  +     
Sbjct  120   EQELNPAQTAITDPENFPQLKVQVTKFRCGGIALGLVTSHTLLDGSSFFPFLKAWSELHR  179

Query  643   GRRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMA--TQSYHI  816
             G     P      +      P   T  +  F   +     +  K     K +   +++H+
Sbjct  180   GFPPPNPPPSFDSSLLKARDPPSVTVPVRDFVAVTPAIAEEMDKAAQDFKPSYHVRAFHM  239

Query  817   TDKQLNALIFKVSG--LKQSAKVKPFEAISALFWKSLAKVKEGSGLETVTIV--------  966
              ++QL  L  +++       +    FEA+S L WK + + ++     T T +        
Sbjct  240   NEQQLAELKHEIASGPFAYGSSPTSFEAVSGLVWKCITEARDFDDSVTNTYIYAVSTKVG  299

Query  967   KNGFH----------SRGNGLLPCRNGQVISA-VKAEMRVSEADVLELANLIGEKAVDET  1113
             +N +           S     LPC  G + +  V    R+   DV      +G++ +  T
Sbjct  300   RNRWQPPMPSEYCGTSSFTLCLPCAVGDLKNKHVSHAARLFHEDVRN----VGQERIQST  355

Query  1114  GIIDETMEEENGKSADFFV------YGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGV  1275
               ID  MEE   K  D  +       G  +  ++L    +Y F+    +P   +  +   
Sbjct  356   --ID-WMEETLRKGHDIGLNVSPPSTGMGIFSISLHSFPVYEFEFGWGRPAHFSMVLEPW  412

Query  1276  GDEGAVLVLPGPENLKGKEGGRIVNVILPEHLLGKLKNEISKELGT  1413
                G V++LP P+   G    RIV ++L E +   L++E+     T
Sbjct  413   YGNGVVVLLPTPQG--GMRERRIVVMLLEEQMKRLLQSELFARFTT  456



>ref|XP_008790160.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790161.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790163.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=434

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 110/426 (26%), Positives = 169/426 (40%), Gaps = 47/426 (11%)
 Frame = +1

Query  121   IVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSE-AVDGLNTGDLKSPM  297
             I+ + R + V PA  T   R+ N ++ DL +   +   VY +R + + D  +   L++ +
Sbjct  2     IITERRSTLVGPAEPTPRRRLWN-SSLDLVVPRFHTPSVYFYRPDGSPDFFDAERLRAAL  60

Query  298   FRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLH  477
              + L  FYP AGR+    EDGR  + CN  GV  VEA     +D++ D +   E   L+ 
Sbjct  61    AKALVPFYPMAGRLGRD-EDGRIEIDCNGEGVLFVEAVADGMVDDFGDFAPTMELKRLIP  119

Query  478   HDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG----  645
               +    D+   PL+ +Q+T+FKCGG+S+G+   H   D  S   F+N +    +G    
Sbjct  120   KVEYTD-DISAFPLLVLQVTYFKCGGVSLGVGMQHHAADGTSGLHFINSWSDVASGLGIS  178

Query  646   ---------RRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMA  798
                       R   P  P  P  +    P  +     P SL +V   GD     N  K  
Sbjct  179   APPFIDRTLLRARDPPTPSFPHVEYQPPPSMKAAATSPPSLSAVK-SGDPVTAVNLFKF-  236

Query  799   TQSYHITDKQLNALIFKVSGLKQSAKVKPFEAISALFWK--SLAKVKEGSGLETVTIVKN  972
                   T  QL+ L  K     + +    +   SA  W+  SLA+      L  + I  +
Sbjct  237   ------TRAQLDLLKAKT---PKGSSYSTYALFSAHVWRCASLARELPPDQLTKLYIATD  287

Query  973   GFHSRGNGLLPCRNGQVI-----SAVKAEMRVSE-------ADVLELANLIGEKAVDETG  1116
             G       L     G VI      A  AE+  SE       A +  + +     AVD   
Sbjct  288   GRQRLRPPLPAGYFGNVIFTATPVAAAAEVVSSEGAAGRIQASLARMDDQYLRSAVDYLE  347

Query  1117  IIDETMEEENGKSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVL  1296
             I  +      G          N+   +   + I+  D    +P+F     GG+  EG   
Sbjct  348   IQPDLRALVRGAHT---FRCPNIGLTSWVRLPIHDADFGWGRPVFMG--PGGIAYEGLAF  402

Query  1297  VLPGPE  1314
             VLP P+
Sbjct  403   VLPSPD  408



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 97.1 bits (240),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 103/409 (25%), Positives = 163/409 (40%), Gaps = 27/409 (7%)
 Frame = +1

Query  142   SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLKSPMFRMLEDF  318
             ++V PA  T E R L ++NAD  ++  ++  VY F S+   G  N   LK  + ++L  F
Sbjct  17    TTVGPAEPTPE-RTLWISNADQLVRRAHIPTVYFFTSDGSTGFFNLHLLKQALSKVLVPF  75

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
             YP AGR+  + +DGR  + CN  GV  VEA+ +  ID++ D +       L+        
Sbjct  76    YPTAGRLNRNDQDGRLEINCNGEGVLFVEAETNSVIDDFGDFTPSPVLRQLIPAVD-YSK  134

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHM  678
             D+   PL+ +Q+T F+CGG+ +G+   H L D  S   F+N +   MA  R L PK P  
Sbjct  135   DISSYPLLLLQVTRFRCGGVCLGVGMHHSLVDGTSDIHFINSWS-DMA--RGLQPKIPPF  191

Query  679   PTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSG  858
                 +  + +P T             +      +    +A   + IT  Q+N L      
Sbjct  192   LDRSSLRARQPPTPMFHHIEFLPPPSIKTPKSQSGPTDVAVAKFKITVDQINTLKTNAKE  251

Query  859   LKQSAKVKPFEAISALFWKSLAKVKEGSGLE-----TVTIVKNGFHSRGNGLLPCRNGQV  1023
                +     +  ++   W+ ++K +   GL       + I  +G       L P   G  
Sbjct  252   NDNTLNYSTYAVLAGHVWRCVSKAR---GLRDDQDTNLFITVDGRSRLRPPLPPGYFGNG  308

Query  1024  ISAVKAEMRVSEADVLELANLIGEKAVDETGIIDETMEE-----ENGKSADFFVYG----  1176
             I    +     E     L   +G      T + DE +       E       FV G    
Sbjct  309   ILLTTSNALCGELRSKPLGYAVGRVHDVVTRMNDEYVRSAIDYLELQPDLTPFVRGPHMF  368

Query  1177  --ANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
                N   V+   + +Y  D    +PI     +  V  EG   +LP P N
Sbjct  369   RSPNFWMVSWARLPLYDADFGWGRPIHVGPAV--VYSEGLSYILPSPTN  415



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score = 97.1 bits (240),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 106/421 (25%), Positives = 166/421 (39%), Gaps = 47/421 (11%)
 Frame = +1

Query  142   SSVVPAT--ITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLKSPMFRMLE  312
             SS+VP +  I    + L  +N DL +   ++  VY +R        +   +K  +  +L 
Sbjct  16    SSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRPNGSSKFFDPNVMKKALADVLV  75

Query  313   DFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVL  492
              FYP AGR+    E  R  + CN+ GV  VEA+   T+D++ ++     +  L       
Sbjct  76    SFYPMAGRLGRD-ETDRIVINCNNEGVLFVEAESDSTLDDFGELKPSPVFRQLTPSVDYS  134

Query  493   GPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMA  642
             G D+   PL+F Q+T FKCGG+++G    H L D  SL  F+N +           P   
Sbjct  135   G-DISSYPLLFAQVTHFKCGGVALGCGVHHTLSDGLSLLHFINTWSDMARGLSVAIPPFI  193

Query  643   GRRDLPPKHPHMPTADN---HNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYH  813
              R  L  + P  PT D+   H+ P   T    P S GS+             K +T    
Sbjct  194   ERTLLRAREPPTPTYDHVEYHSPPSMNTTAQKPGS-GSLS------------KSSTTMLK  240

Query  814   ITDKQLNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVK--EGSGLETVTIVKNGFHSR  987
             +T  QLN+L  K      S     +E ++A  W+   K +      L  + +  +G    
Sbjct  241   LTLDQLNSLKAKAKSESGSTH-STYEILAAHIWRCACKARGLPDDQLSKLYVATDGRSRL  299

Query  988   GNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGEKAVDETGIID-------ETMEEEN  1146
                L P   G V+       +  +     L+N         T + D       + +E + 
Sbjct  300   SPRLPPGYLGNVVFTATPVAKSGDLTSKSLSNTAKLIHTTLTKMDDDYLRSAIDYLESQP  359

Query  1147  GKSADF----FVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPE  1314
               SA      +    NL       + +Y  D+   +PIF       +  EG + VLP P 
Sbjct  360   DLSALIRGPSYFASPNLNINAWTRLPVYDADLGWGRPIFMG--PACILYEGTIYVLPSPN  417

Query  1315  N  1317
             N
Sbjct  418   N  418



>gb|KDO79585.1| hypothetical protein CISIN_1g045312mg [Citrus sinensis]
Length=441

 Score = 96.7 bits (239),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 116/433 (27%), Positives = 200/433 (46%), Gaps = 34/433 (8%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS--EAVDGLNTGDLKSPMFRMLEDF  318
             +VV       G+   L+  D  M+ +++R VY F S      G+ T  L+  +  +L  F
Sbjct  13    TVVSTKPAQAGKCNPLSVFDRLMEKNHIRIVYYFPSTRNGEPGVVTKKLRESLSHVLTCF  72

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWL-DMSDQSEYDHLLHHDQVLG  495
                 GR++   +DG   +KCND+GVR+VEA+   +++EWL +++   E   +   D    
Sbjct  73    PIVTGRLQKK-DDGHWMIKCNDAGVRMVEARTQGSVEEWLKNVNRDKELMLVTWEDMFHK  131

Query  496   PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPH  675
             P   F    ++Q+T F+ GGL+IG S +H+L D  S + F+  +         L P   H
Sbjct  132   P--YFWATFYVQLTEFEEGGLAIGFSCSHLLADPTSATMFVKAWADTTLAGTMLAPPFFH  189

Query  676   MPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFK--  849
                     +  P      P++      + +H+K T   +    + +IT+     L F   
Sbjct  190   PLPPPRLGNKNPNHN---PYT-----DLINHYKSTIDDRSPAFTNNITNYVTATLAFSGP  241

Query  850   --VSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLLPCRNGQ  1020
                + +  +++  PFEA++ L W  ++KVK    GL +++I  +     G       N  
Sbjct  242   MVQACMLDTSRPSPFEAMAGLLWVCVSKVKGMKQGLISMSICLDMRKQLGLDKGFFGNCL  301

Query  1021  VISAV-KAEMRVSEADVLELANLIGEKA--VDETGIID--ETMEEENGKSADFFVYGANL  1185
             V + V  AE  + ++++ E A  +GE    ++   I+D  E +E  + +     + G +L
Sbjct  302   VYNKVHHAESLLDKSELSEAARAVGESVTKMNNERIMDLIEWLEHHDYEFPP-LMNGHDL  360

Query  1186  TFVNLEEVKIYG--FDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GRIVNV  1353
                NLE++  Y   F+ +G  PI  +Y +  V   G +LVL  P +    EG   R+V V
Sbjct  361   ICANLEDLDPYATLFE-EGFVPIRVSYYVEPVFGIGQILVLQSPPS----EGPLSRMVMV  415

Query  1354  ILPEHLLGKLKNE  1392
              LP   L KL ++
Sbjct  416   TLPADELSKLCDD  428



>ref|XP_006476225.1| PREDICTED: protein ECERIFERUM 26-like [Citrus sinensis]
Length=437

 Score = 96.7 bits (239),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 116/433 (27%), Positives = 200/433 (46%), Gaps = 34/433 (8%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS--EAVDGLNTGDLKSPMFRMLEDF  318
             +VV       G+   L+  D  M+ +++R VY F S      G+ T  L+  +  +L  F
Sbjct  9     TVVSTKPAQAGKCNPLSVFDRLMEKNHIRIVYYFPSTRNGEPGVVTKKLRESLSHVLTCF  68

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWL-DMSDQSEYDHLLHHDQVLG  495
                 GR++   +DG   +KCND+GVR+VEA+   +++EWL +++   E   +   D    
Sbjct  69    PIVTGRLQKK-DDGHWMIKCNDAGVRMVEARTQGSVEEWLKNVNRDKELMLVTWEDMFHK  127

Query  496   PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPH  675
             P   F    ++Q+T F+ GGL+IG S +H+L D  S + F+  +         L P   H
Sbjct  128   P--YFWATFYVQLTEFEEGGLAIGFSCSHLLADPTSATMFVKAWADTTLAGTMLAPPFFH  185

Query  676   MPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFK--  849
                     +  P      P++      + +H+K T   +    + +IT+     L F   
Sbjct  186   PLPPPRLGNKNPNHN---PYT-----DLINHYKSTIDDRSPAFTNNITNYVTATLAFSGP  237

Query  850   --VSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRGNGLLPCRNGQ  1020
                + +  +++  PFEA++ L W  ++KVK    GL +++I  +     G       N  
Sbjct  238   MVQACMLDTSRPSPFEAMAGLLWVCVSKVKGMKQGLISMSICLDMRKQLGLDKGFFGNCL  297

Query  1021  VISAV-KAEMRVSEADVLELANLIGEKA--VDETGIID--ETMEEENGKSADFFVYGANL  1185
             V + V  AE  + ++++ E A  +GE    ++   I+D  E +E  + +     + G +L
Sbjct  298   VYNKVHHAESLLDKSELSEAARAVGESVTKMNNERIMDLIEWLEHHDYEFPP-LMNGHDL  356

Query  1186  TFVNLEEVKIYG--FDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGKEG--GRIVNV  1353
                NLE++  Y   F+ +G  PI  +Y +  V   G +LVL  P +    EG   R+V V
Sbjct  357   ICANLEDLDPYATLFE-EGFVPIRVSYYVEPVFGIGQILVLQSPPS----EGPLSRMVMV  411

Query  1354  ILPEHLLGKLKNE  1392
              LP   L KL ++
Sbjct  412   TLPADELSKLCDD  424



>ref|XP_008811612.1| PREDICTED: protein ECERIFERUM 26-like [Phoenix dactylifera]
Length=434

 Score = 96.3 bits (238),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 108/422 (26%), Positives = 179/422 (42%), Gaps = 36/422 (9%)
 Frame = +1

Query  142   SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGLNTGDLKSPMFRMLEDFY  321
             S+ V  +    G+   L+  D  M  H L  V+ +R      L+   LK  +  +L  + 
Sbjct  14    STAVSVSPVRPGKTYPLSALDELMGRHTLHLVFYYRPGPT--LDREGLKESLSEVLSHYP  71

Query  322   PAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGPD  501
                GR+    EDG   VKCND+GVR+++A+ S T++EWL  S  +E +  L   + +G D
Sbjct  72    AVTGRLGRG-EDGGWTVKCNDAGVRLLDARASVTLEEWLG-SATAEEEMELACWEPMGED  129

Query  502   LGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAGRRDLPPKHPHMP  681
                    +IQIT F+    +IG+S  H+  D       +  +  +         +   + 
Sbjct  130   PSIWSPYYIQITEFEDKAFAIGLSCTHMHADPTCAILLVRAWADSH--------RRASIA  181

Query  682   TADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLNALIFKVSGL  861
              A   + P    +         +        L    KM++ ++  +D  + +L+  +   
Sbjct  182   YAPFFHPPAFLPRPDPRPDHPLLSLKSSSSALAAAPKMSSATFRFSDLAVKSLLADL---  238

Query  862   KQSAKVKPFEAISALFWKSLAK---VKEGSGLETVTIVKNGFHSRGNGLLP---CRNGQV  1023
                A   PF A++ALFW  +A+   V  G G  T+ +    F  R +  LP     N   
Sbjct  239   --QADASPFSALAALFWSRIARASGVPPGPGELTLFV---DFRKRMHAPLPHGFYGNALH  293

Query  1024  ISAVKAEMRVSEADVLE-LANLIGEKAVDETGIIDETMEEENGKSADFF-VYGANLTFVN  1197
              S  +A++    A V + L   +     +E     E   E   +  + F +YG  LT + 
Sbjct  294   FSRARADLADGVAHVADHLGRHVAGLQEEEFWAAAEWAYERRRRGEEAFQMYGPELTCLA  353

Query  1198  LEEVKIYG--FDMKGQ--KPIFANYTIGGVGDEGAVLVLPGPENLKGKEGGRIVNVILPE  1365
             L+ V  YG  F+ +G+  +P   +  +GG   EG V+VLP  E    +   R V V LPE
Sbjct  354   LDHVTAYGAAFEKEGEGGRPAHVSCRVGGADGEGVVVVLPAAE----EGAARTVVVTLPE  409

Query  1366  HL  1371
              +
Sbjct  410   EV  411



>ref|XP_006450533.1| hypothetical protein CICLE_v10008314mg [Citrus clementina]
 gb|ESR63773.1| hypothetical protein CICLE_v10008314mg [Citrus clementina]
Length=441

 Score = 96.7 bits (239),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 119/443 (27%), Positives = 201/443 (45%), Gaps = 35/443 (8%)
 Frame = +1

Query  115   ENIVYDHRLSSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRS--EAVDGLNTGDLK  288
             E I Y  +  +VV       G+   L+  D  M+ +++R VY F S      G+ T  L+
Sbjct  4     EMITYICK-QTVVSTKPAQAGKCNPLSVFDRLMEKNHIRIVYYFPSTRNGEPGVVTKKLR  62

Query  289   SPMFRMLEDFYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWL-DMSDQSEYD  465
               +  +L  F    GR++   +DG   +KCND+GVR+VEA+   +++EWL +++   E  
Sbjct  63    ESLSHVLTCFPIVTGRLQKK-DDGHWMIKCNDAGVRMVEARAQGSVEEWLKNVNRDKELM  121

Query  466   HLLHHDQVLGPDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYGPAMAG  645
              +   D    P   F    ++Q+T F+ GGL+IG S +H+L D  S + F+  +      
Sbjct  122   LVTWEDMFHKP--YFWATFYVQLTEFEEGGLAIGFSCSHLLADPTSATMFVKAWADTTLA  179

Query  646   RRDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDK  825
                L P   H        +  P      P++      + +H+K T   +    + +IT+ 
Sbjct  180   GTMLAPPFFHPLPPPRLGNKNPNHN---PYT-----DLINHYKSTIDDRSPAFTNNITNY  231

Query  826   QLNALIFK----VSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHSRG  990
                 L F      + +  ++   PFEA++ L W  ++KVK    GL +++I  +     G
Sbjct  232   ATATLAFSGPMVQACMLDTSSPSPFEAMAGLLWVCVSKVKGMKQGLLSMSICLDMRKQLG  291

Query  991   NGLLPCRNGQVISAV-KAEMRVSEADVLELANLIGEKA--VDETGIID--ETMEEENGKS  1155
                    N  V + V  AE  + +  + E A  +GE    ++  GI+D  E +E  + + 
Sbjct  292   LDKGFFGNCMVYNKVHHAESLLDKRKLSEAARAVGESVTKMNNEGIMDLIEWLEHHDYEF  351

Query  1156  ADFFVYGANLTFVNLEEVKIYG--FDMKGQKPIFANYTIGGVGDEGAVLVLPGPENLKGK  1329
                 +   +L   NLE++  Y   F+ +G  PI  +Y +  V   G +LVL  P +    
Sbjct  352   PP-LMNCHDLICANLEDLDPYATLFE-EGFVPIRVSYYVEPVFGIGQILVLQSPPS----  405

Query  1330  EG--GRIVNVILPEHLLGKLKNE  1392
             EG   R+V V LP   L KL ++
Sbjct  406   EGPLSRMVTVTLPADELSKLCDD  428



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score = 96.3 bits (238),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 102/416 (25%), Positives = 165/416 (40%), Gaps = 43/416 (10%)
 Frame = +1

Query  142   SSVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVDGL-NTGDLKSPMFRMLEDF  318
             S V PA  T E ++ N +N DL +   ++  VY +RS           LK  +  +L  F
Sbjct  18    SMVQPAKNTPEKKLWN-SNLDLVVGRIHILTVYFYRSNGSQNFFEPRVLKEALSNVLVSF  76

Query  319   YPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLGP  498
             YP AGR+    ++GR  + CN  GV  VEA+    +D++ D +  SE   L       G 
Sbjct  77    YPMAGRLGKD-DEGRVEINCNGEGVLFVEAESDCCVDDFGDFTPSSEMRRLTPTVDYSGA  135

Query  499   DLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG----------PAMAGR  648
                + PL+ +Q+T+FKCGG+S+G+   H L D  S   F+N +           P    R
Sbjct  136   ISSY-PLIILQVTYFKCGGVSLGVGVHHTLSDGVSSLHFINTWSDMARGLSIAIPPFIDR  194

Query  649   RDLPPKHPHMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQ  828
               L P+ P  PT D+     P +    P S    GP G          ++T    ++  Q
Sbjct  195   TLLRPRIPPTPTFDHVEYHPPPSMITKPLS----GPKG----------VSTAILKLSLDQ  240

Query  829   LNALIFKVSGLKQSAKVKPFEAISALFWKSLAKVKEGSGLET--VTIVKNGFHSRGNGLL  1002
             L  L  K            +E ++A  W+   K ++ S  +T  + I  +G       L 
Sbjct  241   LTTLKAKAKNEGNGKDHSTYEILAAHLWRCACKARDLSPNQTSKLYIATDGRSRLCPPLP  300

Query  1003  PCRNGQVISA---------VKAEMRVSEADVLE--LANLIGEKAVDETGIIDETMEEENG  1149
             P   G V+           ++ E   S A  +   L  +  E        ++ T + +  
Sbjct  301   PGYLGNVVFTATPMAESGDLQVEPVTSTAKRIHNSLTRMDNEYLRSALDFLETTPDLKTL  360

Query  1150  KSADFFVYGANLTFVNLEEVKIYGFDMKGQKPIFANYTIGGVGDEGAVLVLPGPEN  1317
                  +    NL   +   + ++  D    +PIF       +  EG + ++P   N
Sbjct  361   VRGPNYFASPNLNINSWTRLPVHDADFGWGRPIFMG--PASILYEGTIYIIPSTTN  414



>ref|XP_008392130.1| PREDICTED: protein ECERIFERUM 26-like [Malus domestica]
Length=448

 Score = 96.7 bits (239),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 111/432 (26%), Positives = 199/432 (46%), Gaps = 46/432 (11%)
 Frame = +1

Query  145   SVVPATITGEGRVLNLTNADLAMKLHYLRGVYLFRSEAVD---GLNTGDLKSPMFRMLED  315
             +VV       G+   L+  D  M++++LR V  + S  +    G  T  L+  +   L +
Sbjct  12    TVVSTKPVQAGKTYPLSVLDRHMEVNHLRMVLYYPSTGLPTKPGEITTKLRESLAVTLTN  71

Query  316   FYPAAGRIRTSPEDGRPFVKCNDSGVRIVEAKCSKTIDEWLDMSDQSEYDHLLHHDQVLG  495
             +    GR++ + ++ +  +KCND+GVR++EAK   +++EWL   D+ +   L++ +++  
Sbjct  72    YPIITGRLQKNDKE-QWMIKCNDAGVRMIEAKARGSLEEWLRNVDREKELMLVYWEEMYH  130

Query  496   PDLGFSPLVFIQITWFKCGGLSIGISWAHVLGDAFSLSDFLNKYG-PAMAGRRDLPPKHP  672
                 +S   ++Q+T F+ GGL+IG+S  H+L D    + F+  +    +  +   PP   
Sbjct  131   KPYFWSTF-YVQLTEFEDGGLAIGLSCTHLLADQTCATMFIKAWANTTLFSKMMHPPFFY  189

Query  673   HMPTADNHNSPKPRTQKLFPFSLGSVGPVGDHWKLTNTCKMATQSYHITDKQLN--ALIF  846
              +P       P  R     P++      + +H+K +      ++S HI D +     L+F
Sbjct  190   PLP----QRRPGNRKLNQKPYT-----ALINHYKTS-----ISKSIHIVDAKHTTVTLVF  235

Query  847   K-------------VSGLKQSAKVKPFEAISALFWKSLAKVK-EGSGLETVTIVKNGFHS  984
                           + G  +S+   PFEA+S LFW  ++KVK   +GL  ++I  +    
Sbjct  236   SDDMVRACIAMAQPIDGTDKSSPT-PFEALSGLFWVCISKVKGVRNGLVDMSIRMDMRKV  294

Query  985   RGNGLLPCRNGQVISAVKAEMRVSEADVLELANLIGE--KAVDETGIID--ETMEEENGK  1152
              G       N  V + V  E    E ++ + A+ IGE    +D  GI+D  E +  ++ +
Sbjct  295   LGLDKGFFGNCMVYNKVHLE-GFQEDNLSQAASSIGEVVAKMDREGIMDLIEWLVCKDDR  353

Query  1153  SADFFVYGANLTFVNLEEVKIYGFDMKGQ-KPIFANYTIGGVGDEGAVLVLPGPENLKGK  1329
             S   F+ G +L   +LE V ++    +    PI  +  +  V   G VL+LP        
Sbjct  354   SQS-FMNGCDLICASLEGVDLFSIIFEDVIVPIRVSCYVEPVSGLGQVLILPAKPG--DG  410

Query  1330  EGGRIVNVILPE  1365
             E  R+V V LP 
Sbjct  411   ELSRVVMVTLPR  422



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5191934777694