BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79176_g1_i1 len=1726 path=[1:0-1725]

Length=1726
                                                                      Score     E

ref|XP_009627823.1|  PREDICTED: uncharacterized protein LOC104118307    691   0.0      
ref|XP_009791901.1|  PREDICTED: uncharacterized protein LOC104239067    688   0.0      
gb|KDP23255.1|  hypothetical protein JCGZ_23088                         685   0.0      
gb|ABB17002.1|  transaldolase-like protein                              673   0.0      Solanum tuberosum [potatoes]
ref|XP_011020897.1|  PREDICTED: uncharacterized protein LOC105123107    671   0.0      
ref|XP_008369618.1|  PREDICTED: uncharacterized protein LOC103433158    670   0.0      
ref|XP_007222221.1|  hypothetical protein PRUPE_ppa005845mg             669   0.0      
ref|XP_002304636.1|  transaldolase family protein                       668   0.0      Populus trichocarpa [western balsam poplar]
gb|AAB54016.1|  transaldolase                                           668   0.0      Solanum tuberosum [potatoes]
ref|XP_008222257.1|  PREDICTED: uncharacterized protein LOC103322152    667   0.0      
ref|XP_008390214.1|  PREDICTED: uncharacterized protein LOC103452497    667   0.0      
ref|XP_003621050.1|  Transaldolase                                      666   0.0      
ref|XP_009359868.1|  PREDICTED: uncharacterized protein LOC103950394    665   0.0      
ref|NP_001274983.1|  transaldolase-like protein                         664   0.0      
gb|ACJ86217.1|  unknown                                                 664   0.0      Medicago truncatula
ref|NP_001234354.1|  transaldolase                                      663   0.0      
ref|XP_009353506.1|  PREDICTED: uncharacterized protein LOC103944759    662   0.0      
ref|XP_008454148.1|  PREDICTED: uncharacterized protein LOC103494637    662   0.0      
gb|AAP83926.1|  transaldolase                                           661   0.0      Solanum lycopersicum
ref|XP_006487560.1|  PREDICTED: uncharacterized protein LOC102622193    661   0.0      
ref|XP_002297881.2|  transaldolase family protein                       660   0.0      Populus trichocarpa [western balsam poplar]
gb|AFK42792.1|  unknown                                                 660   0.0      
ref|XP_011036191.1|  PREDICTED: uncharacterized protein LOC105133779    660   0.0      
ref|XP_004152161.1|  PREDICTED: transaldolase-like                      660   0.0      
ref|XP_006420805.1|  hypothetical protein CICLE_v10004979mg             659   0.0      
ref|XP_004310146.1|  PREDICTED: transaldolase-like                      657   0.0      
emb|CDP18990.1|  unnamed protein product                                657   0.0      
ref|XP_002512678.1|  Transaldolase, putative                            656   0.0      Ricinus communis
ref|XP_004489137.1|  PREDICTED: transaldolase-like                      656   0.0      
ref|XP_007043770.1|  Aldolase-type TIM barrel family protein isof...    655   0.0      
gb|KHG16036.1|  Transaldolase                                           655   0.0      
ref|XP_002271514.1|  PREDICTED: uncharacterized protein LOC100247241    654   0.0      Vitis vinifera
ref|XP_003532330.1|  PREDICTED: uncharacterized protein LOC100807267    652   0.0      
ref|XP_010530754.1|  PREDICTED: uncharacterized protein LOC104807252    652   0.0      
ref|XP_010682632.1|  PREDICTED: uncharacterized protein LOC104897452    652   0.0      
gb|KHN24954.1|  Transaldolase                                           650   0.0      
ref|XP_010066468.1|  PREDICTED: uncharacterized protein LOC104453564    650   0.0      
gb|ACK56136.1|  transaldolase                                           650   0.0      Dimocarpus longan [longan]
ref|XP_011086894.1|  PREDICTED: uncharacterized protein LOC105168489    647   0.0      
ref|XP_010250505.1|  PREDICTED: uncharacterized protein LOC104592737    645   0.0      
gb|KHN12571.1|  Transaldolase                                           644   0.0      
ref|XP_007139126.1|  hypothetical protein PHAVU_008G003600g             643   0.0      
ref|XP_003552743.1|  PREDICTED: uncharacterized protein LOC100816075    643   0.0      
gb|AGV54320.1|  transaldolase-like protein                              641   0.0      
ref|XP_010089867.1|  hypothetical protein L484_001779                   641   0.0      
gb|ACU23896.1|  unknown                                                 640   0.0      Glycine max [soybeans]
ref|XP_006399833.1|  hypothetical protein EUTSA_v10013572mg             640   0.0      
gb|KFK25575.1|  hypothetical protein AALP_AA8G132700                    638   0.0      
ref|XP_009121766.1|  PREDICTED: uncharacterized protein LOC103846575    637   0.0      
emb|CDX69643.1|  BnaA10g19920D                                          636   0.0      
emb|CDY16492.1|  BnaA08g02750D                                          635   0.0      
emb|CDY09794.1|  BnaC09g43670D                                          634   0.0      
ref|NP_196846.1|  Aldolase-type TIM barrel family protein               634   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873611.1|  hypothetical protein ARALYDRAFT_488161             633   0.0      
emb|CDX70501.1|  BnaC03g05850D                                          629   0.0      
ref|XP_008778133.1|  PREDICTED: uncharacterized protein LOC103697961    628   0.0      
emb|CDX78519.1|  BnaA03g04310D                                          626   0.0      
ref|XP_006287760.1|  hypothetical protein CARUB_v10000972mg             627   0.0      
ref|XP_010492092.1|  PREDICTED: uncharacterized protein LOC104769560    626   0.0      
ref|XP_010419919.1|  PREDICTED: uncharacterized protein LOC104705593    626   0.0      
gb|EYU28482.1|  hypothetical protein MIMGU_mgv1a006041mg                626   0.0      
emb|CDX91124.1|  BnaC02g04730D                                          624   0.0      
ref|XP_009125910.1|  PREDICTED: uncharacterized protein LOC103850867    624   0.0      
ref|XP_010453414.1|  PREDICTED: uncharacterized protein LOC104735344    624   0.0      
ref|NP_001045261.1|  Os01g0926300                                       623   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010942358.1|  PREDICTED: uncharacterized protein LOC105060382    621   0.0      
emb|CDX85652.1|  BnaA02g01610D                                          619   0.0      
ref|XP_009131334.1|  PREDICTED: uncharacterized protein LOC103856014    618   0.0      
ref|XP_010909285.1|  PREDICTED: uncharacterized protein LOC105035433    617   0.0      
ref|XP_009390373.1|  PREDICTED: uncharacterized protein LOC103976773    617   0.0      
ref|XP_006646634.1|  PREDICTED: uncharacterized protein LOC102716002    614   0.0      
ref|XP_008776466.1|  PREDICTED: uncharacterized protein LOC103696573    612   0.0      
dbj|BAK03413.1|  predicted protein                                      611   0.0      
ref|XP_003564974.1|  PREDICTED: uncharacterized protein LOC100830...    610   0.0      
ref|XP_010911579.1|  PREDICTED: uncharacterized protein LOC105037637    609   0.0      
ref|NP_001150450.1|  LOC100284080                                       610   0.0      Zea mays [maize]
gb|ACN31756.1|  unknown                                                 610   0.0      Zea mays [maize]
gb|EMS53783.1|  Transaldolase 1                                         607   0.0      
gb|EMT17354.1|  Transaldolase 1                                         608   0.0      
ref|XP_010232767.1|  PREDICTED: uncharacterized protein LOC100830...    606   0.0      
emb|CDM85813.1|  unnamed protein product                                608   0.0      
dbj|BAJ96158.1|  predicted protein                                      606   0.0      
ref|XP_004971135.1|  PREDICTED: uncharacterized protein LOC101753964    605   0.0      
ref|NP_001150674.1|  transaldolase 2                                    605   0.0      Zea mays [maize]
dbj|BAB89667.1|  putative transaldolase                                 605   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008776974.1|  PREDICTED: uncharacterized protein LOC103696994    586   0.0      
ref|XP_006844452.1|  hypothetical protein AMTR_s00016p00076190          587   0.0      
gb|ABR16241.1|  unknown                                                 545   0.0      Picea sitchensis
gb|EPS63300.1|  hypothetical protein M569_11485                         508   2e-174   
ref|XP_006420806.1|  hypothetical protein CICLE_v10004979mg             498   1e-169   
ref|XP_003525168.1|  PREDICTED: uncharacterized protein LOC100811673    495   4e-168   
ref|XP_004503815.1|  PREDICTED: transaldolase-like                      494   2e-167   
ref|XP_007159949.1|  hypothetical protein PHAVU_002G281000g             493   8e-167   
gb|KEH20964.1|  transaldolase family protein                            489   3e-165   
ref|XP_008453653.1|  PREDICTED: uncharacterized protein LOC103494305    481   3e-162   
ref|XP_002960808.1|  hypothetical protein SELMODRAFT_74909              468   8e-158   
ref|XP_002983861.1|  hypothetical protein SELMODRAFT_271673             469   2e-157   
ref|XP_001773190.1|  predicted protein                                  468   8e-157   
ref|XP_007043771.1|  Aldolase-type TIM barrel family protein isof...    459   4e-155   
ref|XP_008674626.1|  PREDICTED: uncharacterized protein LOC103650820    402   5e-133   
gb|ACU21292.1|  unknown                                                 397   2e-131   Glycine max [soybeans]
ref|XP_003530596.1|  PREDICTED: uncharacterized protein LOC100806367    390   3e-128   
ref|XP_006598544.1|  PREDICTED: uncharacterized protein LOC100797142    387   1e-126   
ref|XP_010927795.1|  PREDICTED: uncharacterized protein LOC105049749    384   2e-126   
ref|WP_039701607.1|  transaldolase                                      380   2e-123   
ref|XP_006576021.1|  PREDICTED: uncharacterized protein LOC100813545    377   2e-122   
gb|KGA04566.1|  transaldolase                                           370   1e-119   
ref|WP_039703480.1|  transaldolase                                      370   2e-119   
gb|KGA04019.1|  transaldolase                                           362   2e-116   
ref|WP_038290153.1|  transaldolase                                      360   1e-115   
ref|WP_011751576.1|  transaldolase                                      361   8e-115   
ref|WP_038289289.1|  transaldolase                                      355   5e-114   
ref|WP_015442190.1|  transaldolase                                      353   7e-113   
gb|EEC72073.1|  hypothetical protein OsI_05007                          347   3e-112   Oryza sativa Indica Group [Indian rice]
ref|WP_012687332.1|  transaldolase                                      352   4e-112   
ref|WP_011599176.1|  transaldolase                                      348   9e-111   
ref|WP_006240966.1|  transaldolase                                      347   2e-110   
ref|WP_014208649.1|  transaldolase                                      341   3e-108   
gb|AAT08720.1|  transaldolase                                           330   1e-105   Hyacinthus orientalis [common hyacinth]
ref|WP_020509411.1|  hypothetical protein                               328   2e-103   
ref|WP_029538055.1|  transaldolase                                      323   1e-101   
ref|WP_007300319.1|  transaldolase                                      323   2e-101   
ref|WP_036564310.1|  transaldolase                                      321   7e-101   
ref|WP_005564233.1|  transaldolase                                      321   1e-100   
emb|CCH74595.1|  Transaldolase                                          321   2e-100   
ref|WP_005261837.1|  transaldolase                                      318   1e-99    
ref|WP_012228740.1|  Transaldolase                                      316   1e-98    
ref|WP_037561823.1|  transaldolase                                      316   2e-98    
gb|KHN17454.1|  Transaldolase                                           312   1e-97    
emb|CCH76529.1|  Transaldolase 2                                        313   2e-97    
ref|WP_013492521.1|  transaldolase                                      313   3e-97    
ref|WP_028962436.1|  transaldolase                                      328   5e-97    
ref|WP_034715710.1|  transaldolase                                      312   6e-97    
ref|WP_034804827.1|  transaldolase                                      311   1e-96    
gb|KGN65410.1|  hypothetical protein Csa_1G418760                       310   1e-96    
ref|WP_020374455.1|  hypothetical protein                               327   1e-96    
ref|WP_015166749.1|  transaldolase                                      311   2e-96    
ref|WP_015747528.1|  transaldolase                                      310   3e-96    
ref|WP_028785585.1|  transaldolase                                      310   4e-96    
gb|KCW57903.1|  hypothetical protein EUGRSUZ_H00650                     306   4e-96    
ref|WP_026863466.1|  transaldolase                                      309   7e-96    
ref|WP_030202159.1|  transaldolase                                      308   2e-95    
emb|CCI54568.1|  Transaldolase 2                                        308   2e-95    
ref|WP_007906483.1|  transaldolase                                      305   2e-94    
ref|WP_016455765.1|  MULTISPECIES: transaldolase                        305   2e-94    
ref|WP_038020223.1|  transaldolase                                      305   3e-94    
ref|WP_022921826.1|  transaldolase                                      305   3e-94    
ref|WP_038679905.1|  transaldolase                                      304   4e-94    
ref|WP_020110114.1|  transaldolase                                      303   1e-93    
ref|WP_019284791.1|  MULTISPECIES: hypothetical protein                 303   2e-93    
ref|WP_022924043.1|  transaldolase                                      303   2e-93    
ref|WP_005181151.1|  transaldolase                                      302   2e-93    
ref|WP_029536027.1|  transaldolase                                      302   3e-93    
ref|WP_028822354.1|  transaldolase                                      302   3e-93    
ref|WP_037113195.1|  transaldolase                                      302   4e-93    
gb|AHI03139.1|  transaldolase                                           302   4e-93    
ref|WP_010148530.1|  transaldolase                                      302   4e-93    
ref|WP_006591004.1|  transaldolase                                      302   6e-93    
ref|WP_034396277.1|  transaldolase                                      301   6e-93    
ref|WP_012834170.1|  transaldolase                                      301   7e-93    
ref|WP_019513103.1|  MULTISPECIES: transaldolase                        301   7e-93    
ref|WP_005241794.1|  transaldolase                                      301   8e-93    
ref|WP_030135669.1|  MULTISPECIES: transaldolase                        301   8e-93    
ref|WP_007295871.1|  transaldolase                                      301   9e-93    
ref|WP_007727941.1|  transaldolase                                      301   9e-93    
ref|WP_018623215.1|  hypothetical protein                               301   9e-93    
ref|WP_030536403.1|  transaldolase                                      301   9e-93    
ref|WP_030528398.1|  transaldolase                                      301   1e-92    
ref|WP_027505286.1|  transaldolase                                      301   1e-92    
ref|WP_003945000.1|  transaldolase                                      301   1e-92    
ref|WP_019666351.1|  MULTISPECIES: transaldolase                        300   2e-92    
ref|WP_005262260.1|  transaldolase                                      300   2e-92    
ref|WP_013806692.1|  transaldolase                                      300   2e-92    
ref|WP_010841007.1|  MULTISPECIES: transaldolase                        300   2e-92    
ref|WP_005627313.1|  transaldolase                                      300   2e-92    
ref|WP_037747386.1|  transaldolase                                      300   3e-92    
ref|WP_004021955.1|  transaldolase                                      300   3e-92    
ref|WP_018835692.1|  MULTISPECIES: transaldolase                        300   3e-92    
ref|WP_036467261.1|  transaldolase                                      300   4e-92    
ref|WP_037237803.1|  transaldolase                                      299   4e-92    
ref|WP_038568295.1|  transaldolase                                      299   5e-92    
ref|WP_006945373.1|  transaldolase                                      299   6e-92    
ref|WP_028326322.1|  transaldolase                                      299   6e-92    
ref|WP_005573327.1|  transaldolase                                      299   7e-92    
ref|WP_006866293.1|  transaldolase                                      298   9e-92    
ref|WP_037038734.1|  transaldolase                                      298   9e-92    
ref|WP_007927588.1|  transaldolase                                      298   1e-91    
ref|WP_020907723.1|  probable transaldolase                             298   1e-91    
ref|WP_037668542.1|  transaldolase                                      298   1e-91    
ref|WP_034976510.1|  transaldolase                                      298   2e-91    
ref|WP_029255341.1|  MULTISPECIES: transaldolase                        298   2e-91    
ref|WP_033440753.1|  transaldolase                                      298   2e-91    
ref|WP_020969597.1|  MULTISPECIES: transaldolase                        298   2e-91    
ref|WP_033232242.1|  transaldolase                                      298   2e-91    
gb|EQM32954.1|  transaldolase                                           298   2e-91    
ref|WP_027742954.1|  transaldolase                                      298   2e-91    
ref|WP_009480450.1|  transaldolase                                      297   3e-91    
ref|WP_029538101.1|  transaldolase                                      297   3e-91    
gb|KHN16892.1|  Transaldolase                                           292   4e-91    
ref|WP_011598880.1|  transaldolase                                      297   4e-91    
ref|WP_028644196.1|  transaldolase                                      296   4e-91    
ref|WP_024497112.1|  transaldolase                                      296   4e-91    
ref|WP_012087367.1|  transaldolase                                      296   4e-91    
ref|WP_028652247.1|  transaldolase                                      296   4e-91    
ref|WP_035008178.1|  transaldolase                                      296   5e-91    
ref|WP_002812891.1|  transaldolase                                      296   5e-91    
ref|WP_011330282.1|  transaldolase                                      296   5e-91    
ref|WP_021764447.1|  transaldolase                                      296   6e-91    
ref|WP_013985981.1|  transaldolase                                      311   6e-91    
ref|WP_026146027.1|  transaldolase                                      296   7e-91    
ref|WP_006902264.1|  transaldolase                                      296   7e-91    
ref|WP_007298765.1|  transaldolase                                      296   8e-91    
gb|KHL05203.1|  transaldolase                                           296   9e-91    
ref|WP_011894548.1|  transaldolase                                      296   1e-90    
ref|WP_012360246.1|  transaldolase                                      295   1e-90    
ref|WP_005194886.1|  transaldolase                                      295   1e-90    
ref|WP_035001870.1|  transaldolase                                      295   1e-90    
ref|WP_036468641.1|  transaldolase                                      295   2e-90    
ref|WP_030465180.1|  transaldolase                                      295   2e-90    
ref|WP_025159469.1|  transaldolase                                      295   2e-90    
ref|WP_019969510.1|  transaldolase                                      295   2e-90    
ref|WP_030431268.1|  transaldolase                                      295   2e-90    
ref|WP_014560819.1|  transaldolase                                      310   2e-90    
ref|WP_030014327.1|  transaldolase                                      295   2e-90    
gb|KGM11921.1|  transaldolase                                           295   2e-90    
ref|WP_039319782.1|  transaldolase                                      295   3e-90    
ref|WP_006357237.1|  transaldolase                                      295   3e-90    
ref|WP_030791284.1|  transaldolase                                      295   3e-90    
ref|WP_036443496.1|  transaldolase                                      295   3e-90    
ref|WP_034981959.1|  transaldolase                                      294   3e-90    
ref|WP_030028502.1|  transaldolase                                      294   3e-90    
ref|WP_011563047.1|  transaldolase                                      294   4e-90    
ref|WP_029107565.1|  transaldolase                                      294   4e-90    
ref|WP_031081953.1|  transaldolase                                      294   4e-90    
gb|KGI68100.1|  transaldolase                                           294   4e-90    
ref|WP_027753555.1|  transaldolase                                      294   5e-90    
ref|WP_014141855.1|  transaldolase                                      294   5e-90    
ref|WP_003923639.1|  transaldolase                                      294   5e-90    
ref|WP_034623560.1|  transaldolase                                      294   5e-90    
emb|CDO27145.1|  transaldolase                                          295   6e-90    
ref|WP_020601537.1|  hypothetical protein                               293   6e-90    
ref|WP_026533959.1|  transaldolase                                      294   6e-90    
ref|WP_034967964.1|  transaldolase                                      293   7e-90    
ref|WP_015890638.1|  transaldolase                                      294   7e-90    
ref|WP_037243117.1|  transaldolase                                      293   7e-90    
ref|WP_014213534.1|  transaldolase                                      294   7e-90    
ref|WP_027771347.1|  transaldolase                                      293   7e-90    
ref|WP_036498908.1|  transaldolase                                      293   8e-90    
ref|WP_006244788.1|  transaldolase                                      293   1e-89    
ref|WP_013032607.1|  transaldolase                                      309   1e-89    
ref|WP_019137225.1|  transaldolase                                      293   1e-89    
ref|WP_038548556.1|  transaldolase                                      293   1e-89    
ref|WP_034974407.1|  transaldolase                                      293   1e-89    
ref|WP_015329458.1|  transaldolase                                      293   1e-89    
ref|WP_011238453.1|  transaldolase                                      292   1e-89    
ref|WP_029721057.1|  transaldolase                                      293   2e-89    
ref|WP_033432498.1|  transaldolase                                      292   2e-89    
ref|WP_028932246.1|  transaldolase                                      292   2e-89    
ref|WP_003920221.1|  transaldolase                                      292   2e-89    
gb|EES53670.1|  transaldolase                                           293   2e-89    Leptospirillum ferrodiazotrophum
ref|WP_014815694.1|  transaldolase                                      292   2e-89    
ref|WP_029543636.1|  transaldolase                                      292   2e-89    
ref|WP_036337879.1|  transaldolase                                      292   2e-89    
ref|WP_006887116.1|  MULTISPECIES: transaldolase                        292   2e-89    
ref|WP_036444407.1|  transaldolase                                      292   2e-89    
ref|WP_030831313.1|  MULTISPECIES: transaldolase                        292   3e-89    
ref|WP_013425972.1|  transaldolase                                      292   3e-89    
ref|WP_029149661.1|  transaldolase                                      292   3e-89    
ref|WP_015306776.1|  transaldolase                                      292   3e-89    
ref|WP_029369226.1|  transaldolase                                      292   3e-89    
ref|WP_030766698.1|  transaldolase                                      292   3e-89    
ref|WP_013771028.1|  transaldolase                                      292   3e-89    
emb|CDZ88401.1|  Transaldolase                                          292   4e-89    
ref|WP_026138081.1|  MULTISPECIES: transaldolase                        292   4e-89    
ref|WP_036387644.1|  transaldolase                                      291   4e-89    
ref|WP_006936599.1|  Transaldolase                                      292   4e-89    
ref|WP_030963971.1|  transaldolase                                      291   4e-89    
ref|WP_010241757.1|  transaldolase                                      291   4e-89    
ref|WP_030846266.1|  transaldolase                                      291   4e-89    
ref|WP_037930090.1|  transaldolase                                      291   5e-89    
gb|ACU20245.1|  unknown                                                 287   5e-89    
ref|WP_018600231.1|  transaldolase                                      291   6e-89    
ref|WP_028048222.1|  transaldolase                                      291   6e-89    
ref|WP_018603501.1|  transaldolase                                      291   7e-89    
ref|WP_019973431.1|  transaldolase                                      291   7e-89    
gb|AJE40152.1|  transaldolase                                           291   7e-89    
ref|WP_030016634.1|  transaldolase                                      291   7e-89    
ref|WP_011559810.1|  MULTISPECIES: transaldolase                        290   1e-88    
ref|WP_036527670.1|  transaldolase                                      290   1e-88    
ref|WP_026818509.1|  transaldolase                                      290   1e-88    
ref|WP_018488127.1|  transaldolase                                      290   1e-88    
ref|WP_005939139.1|  transaldolase                                      290   1e-88    
ref|WP_022857529.1|  transaldolase                                      290   1e-88    
gb|ETZ28335.1|  transaldolase                                           290   1e-88    
ref|WP_024449323.1|  transaldolase                                      290   2e-88    
ref|WP_010851513.1|  Transaldolase                                      290   2e-88    
ref|WP_004951615.1|  transaldolase                                      290   2e-88    
ref|WP_020130547.1|  transaldolase                                      290   2e-88    
ref|WP_026643077.1|  transaldolase                                      290   2e-88    
ref|WP_026645327.1|  transaldolase                                      290   2e-88    
ref|WP_012245643.1|  transaldolase                                      290   2e-88    
ref|WP_036950293.1|  transaldolase                                      290   2e-88    
gb|KGI80718.1|  transaldolase                                           290   2e-88    
ref|WP_013829200.1|  transaldolase                                      290   2e-88    
ref|WP_026631082.1|  transaldolase                                      289   2e-88    
ref|WP_003939479.1|  transaldolase                                      290   2e-88    
ref|WP_015103620.1|  Transaldolase                                      290   2e-88    
ref|WP_036441566.1|  transaldolase                                      290   2e-88    
ref|WP_035287696.1|  transaldolase                                      289   3e-88    
ref|WP_028654068.1|  transaldolase                                      289   3e-88    
ref|WP_030762490.1|  MULTISPECIES: transaldolase                        289   3e-88    
ref|WP_031149111.1|  transaldolase                                      289   3e-88    
ref|WP_030816249.1|  transaldolase                                      290   3e-88    
ref|WP_007000559.1|  transaldolase                                      289   4e-88    
ref|WP_016934677.1|  transaldolase                                      289   4e-88    
ref|WP_029276542.1|  transaldolase                                      289   4e-88    
ref|WP_022866058.1|  transaldolase                                      289   4e-88    
ref|WP_008357144.1|  transaldolase                                      289   4e-88    
ref|WP_018104614.1|  MULTISPECIES: transaldolase                        289   4e-88    
ref|WP_030347973.1|  transaldolase                                      289   4e-88    
ref|WP_006436269.1|  transaldolase                                      289   4e-88    
ref|WP_007469802.1|  transaldolase                                      289   4e-88    
ref|WP_020277648.1|  putative Transaldolase 1                           289   4e-88    
ref|WP_009955767.1|  transaldolase                                      289   5e-88    
ref|WP_011719961.1|  transaldolase                                      289   5e-88    
ref|WP_030659955.1|  MULTISPECIES: transaldolase                        289   5e-88    
ref|WP_030366615.1|  transaldolase                                      288   6e-88    
ref|WP_036456047.1|  transaldolase                                      288   6e-88    
ref|WP_037273700.1|  transaldolase                                      288   6e-88    
ref|WP_008258113.1|  MULTISPECIES: transaldolase                        288   6e-88    
ref|WP_029371208.1|  transaldolase                                      288   6e-88    
ref|WP_005513382.1|  transaldolase                                      288   7e-88    
ref|WP_005318992.1|  transaldolase                                      288   8e-88    
ref|WP_029115485.1|  transaldolase                                      288   8e-88    
ref|WP_030388919.1|  transaldolase                                      288   8e-88    
ref|WP_028419309.1|  transaldolase                                      288   8e-88    
ref|WP_024453907.1|  MULTISPECIES: transaldolase                        288   8e-88    
ref|WP_025040134.1|  transaldolase                                      288   8e-88    
ref|WP_020441163.1|  transaldolase                                      288   8e-88    
ref|WP_030078763.1|  transaldolase                                      288   8e-88    
ref|WP_003840161.1|  MULTISPECIES: transaldolase                        288   9e-88    
ref|WP_010987714.1|  transaldolase                                      288   1e-87    
ref|WP_033220694.1|  transaldolase                                      288   1e-87    
ref|WP_014173471.1|  transaldolase                                      288   1e-87    
ref|WP_032778353.1|  transaldolase                                      288   1e-87    
ref|WP_030720383.1|  transaldolase                                      288   1e-87    
ref|WP_030617922.1|  transaldolase                                      288   1e-87    
ref|WP_014942453.1|  transaldolase                                      288   1e-87    
ref|WP_004222108.1|  MULTISPECIES: transaldolase                        288   1e-87    
ref|WP_030627492.1|  transaldolase                                      288   1e-87    
ref|WP_020939308.1|  transaldolase                                      288   1e-87    
gb|KFI56665.1|  transaldolase                                           287   1e-87    
ref|WP_037262677.1|  transaldolase                                      288   1e-87    
ref|WP_034875453.1|  transaldolase                                      287   1e-87    
ref|WP_015779296.1|  transaldolase                                      288   1e-87    
ref|WP_009357665.1|  transaldolase                                      288   1e-87    
ref|WP_037769460.1|  transaldolase                                      288   1e-87    
ref|WP_027762412.1|  transaldolase                                      288   1e-87    
ref|WP_005256386.1|  transaldolase                                      288   1e-87    
ref|WP_036545928.1|  transaldolase                                      288   1e-87    
ref|WP_022595781.1|  transaldolase                                      288   1e-87    
ref|WP_005266708.1|  transaldolase                                      287   1e-87    
ref|WP_005264287.1|  transaldolase                                      288   2e-87    
ref|WP_009399455.1|  transaldolase                                      287   2e-87    
ref|WP_013127146.1|  transaldolase                                      287   2e-87    
ref|WP_010118472.1|  transaldolase                                      287   2e-87    
ref|WP_004217932.1|  transaldolase                                      287   2e-87    
ref|WP_030292231.1|  transaldolase                                      287   2e-87    
ref|WP_034993990.1|  transaldolase                                      287   2e-87    
ref|WP_032784433.1|  transaldolase                                      287   2e-87    
ref|WP_030754207.1|  transaldolase                                      287   2e-87    
ref|WP_034526112.1|  transaldolase                                      287   2e-87    
ref|WP_003880844.1|  transaldolase                                      287   2e-87    
ref|WP_003834796.1|  MULTISPECIES: transaldolase                        287   2e-87    
ref|WP_006123672.1|  MULTISPECIES: transaldolase                        287   2e-87    
ref|WP_035949677.1|  transaldolase                                      287   2e-87    
ref|WP_018560684.1|  transaldolase                                      287   2e-87    
ref|WP_008741063.1|  transaldolase                                      287   2e-87    
ref|WP_037085285.1|  transaldolase                                      287   2e-87    
ref|WP_019737979.1|  transaldolase                                      287   3e-87    
ref|WP_034879627.1|  transaldolase                                      286   3e-87    
ref|WP_031183553.1|  transaldolase                                      287   3e-87    
ref|WP_014399528.1|  transaldolase                                      287   3e-87    
ref|WP_007272753.1|  putative transaldolase                             287   3e-87    
ref|WP_027366242.1|  transaldolase                                      286   3e-87    
ref|WP_005258032.1|  transaldolase                                      287   3e-87    
ref|WP_027465681.1|  transaldolase                                      286   3e-87    
ref|WP_033385772.1|  transaldolase                                      286   3e-87    
ref|WP_006294631.1|  transaldolase                                      286   3e-87    
ref|WP_019762849.1|  transaldolase                                      286   3e-87    
ref|WP_028065580.1|  transaldolase                                      286   3e-87    
ref|WP_010833042.1|  transaldolase                                      286   4e-87    
ref|WP_014441736.1|  transaldolase                                      286   4e-87    
ref|WP_030705105.1|  transaldolase                                      286   4e-87    
ref|WP_030045946.1|  transaldolase                                      286   4e-87    
ref|WP_022859428.1|  transaldolase                                      286   4e-87    
ref|WP_020822944.1|  transaldolase                                      286   5e-87    
ref|WP_031094514.1|  transaldolase                                      286   5e-87    
ref|WP_030936525.1|  transaldolase                                      286   5e-87    
ref|WP_033317916.1|  transaldolase                                      286   5e-87    
ref|WP_016691717.1|  transaldolase                                      286   5e-87    
ref|WP_035277135.1|  transaldolase                                      286   5e-87    
ref|WP_032761447.1|  transaldolase                                      286   5e-87    
ref|WP_030707012.1|  transaldolase                                      286   5e-87    
ref|WP_012381406.1|  transaldolase                                      286   5e-87    
ref|WP_037442654.1|  transaldolase                                      286   6e-87    
ref|WP_012866988.1|  transaldolase                                      286   6e-87    
ref|WP_030586642.1|  transaldolase                                      286   6e-87    
ref|WP_014385244.1|  transaldolase                                      285   6e-87    
ref|WP_018518824.1|  MULTISPECIES: transaldolase                        286   6e-87    
ref|WP_011380950.1|  transaldolase                                      286   7e-87    
ref|WP_014258517.1|  transaldolase                                      286   7e-87    
ref|WP_003885878.1|  transaldolase                                      286   7e-87    
ref|WP_005173332.1|  transaldolase                                      286   7e-87    
ref|WP_031112153.1|  transaldolase                                      286   7e-87    
ref|WP_018640366.1|  transaldolase                                      285   7e-87    
ref|WP_003802788.1|  transaldolase                                      286   8e-87    
gb|KEP74962.1|  transaldolase                                           285   8e-87    
ref|WP_005202750.1|  transaldolase                                      285   9e-87    
ref|WP_003969883.1|  transaldolase                                      285   9e-87    
ref|WP_006332345.1|  transaldolase                                      285   9e-87    
ref|WP_030753143.1|  transaldolase                                      285   9e-87    
gb|AIR97742.1|  Transaldolase 2                                         285   9e-87    
ref|WP_030713318.1|  transaldolase                                      285   1e-86    
ref|WP_005437567.1|  transaldolase                                      285   1e-86    
ref|WP_003996405.1|  putative Transaldolase 2                           286   1e-86    
ref|WP_028660765.1|  transaldolase                                      285   1e-86    
ref|WP_010061288.1|  transaldolase                                      285   1e-86    
ref|WP_024541315.1|  transaldolase                                      285   1e-86    
ref|WP_015803894.1|  transaldolase                                      285   1e-86    
ref|WP_030784176.1|  transaldolase                                      285   1e-86    
ref|WP_034624308.1|  transaldolase                                      285   1e-86    
ref|WP_005988189.1|  transaldolase                                      285   1e-86    
ref|WP_039825492.1|  transaldolase                                      285   1e-86    
ref|WP_005463727.1|  transaldolase                                      285   1e-86    
ref|WP_020100583.1|  MULTISPECIES: transaldolase                        285   1e-86    
ref|WP_033492192.1|  transaldolase                                      285   1e-86    
ref|WP_035915517.1|  transaldolase                                      285   1e-86    
ref|WP_033890859.1|  transaldolase                                      285   1e-86    
ref|WP_030564723.1|  transaldolase                                      285   1e-86    
ref|WP_004138175.1|  transaldolase                                      285   1e-86    
ref|WP_028265544.1|  transaldolase                                      285   1e-86    
ref|WP_036415638.1|  transaldolase                                      285   2e-86    
ref|WP_033086864.1|  transaldolase                                      285   2e-86    
ref|WP_028267340.1|  transaldolase                                      285   2e-86    
ref|WP_011779934.1|  MULTISPECIES: transaldolase                        285   2e-86    
ref|WP_031148113.1|  transaldolase                                      285   2e-86    
ref|WP_031506788.1|  transaldolase                                      285   2e-86    
ref|WP_005455739.1|  transaldolase                                      285   2e-86    
ref|WP_010043066.1|  transaldolase                                      285   2e-86    
ref|WP_017887262.1|  hypothetical protein                               285   2e-86    
ref|WP_010525053.1|  transaldolase                                      285   2e-86    
gb|AIS01524.1|  Transaldolase 1                                         285   2e-86    
gb|KIF02185.1|  transaldolase                                           285   2e-86    
ref|WP_007317526.1|  transaldolase                                      284   2e-86    
ref|WP_037673156.1|  transaldolase                                      285   2e-86    
ref|WP_030544632.1|  transaldolase                                      284   2e-86    
ref|WP_024819186.1|  transaldolase                                      284   2e-86    
ref|WP_028440320.1|  transaldolase                                      284   2e-86    
ref|WP_019853741.1|  transaldolase                                      284   3e-86    
ref|WP_013888445.1|  transaldolase                                      285   3e-86    
ref|WP_033303104.1|  transaldolase                                      284   3e-86    
ref|WP_011605691.1|  transaldolase                                      284   3e-86    
ref|WP_028059231.1|  transaldolase                                      284   3e-86    
ref|WP_014045262.1|  MULTISPECIES: transaldolase                        284   3e-86    
ref|WP_007239439.1|  transaldolase                                      284   3e-86    
ref|WP_030420031.1|  transaldolase                                      284   3e-86    
ref|WP_030353672.1|  transaldolase                                      284   3e-86    
ref|WP_016441680.1|  transaldolase                                      284   3e-86    
ref|WP_030662681.1|  transaldolase                                      284   3e-86    
gb|EPQ79871.1|  Transaldolase                                           284   3e-86    
ref|WP_016468198.1|  MULTISPECIES: transaldolase 2                      284   3e-86    
ref|WP_030702441.1|  MULTISPECIES: transaldolase                        284   3e-86    
ref|WP_030858969.1|  transaldolase                                      284   3e-86    
ref|WP_031480749.1|  transaldolase                                      284   3e-86    
ref|WP_030615215.1|  transaldolase                                      284   3e-86    
ref|WP_036455563.1|  transaldolase                                      284   3e-86    
ref|WP_022902303.1|  transaldolase                                      284   4e-86    
ref|WP_022899350.1|  transaldolase                                      284   4e-86    
ref|WP_030792258.1|  transaldolase                                      284   4e-86    
ref|WP_030336638.1|  transaldolase                                      284   4e-86    
ref|WP_008748583.1|  transaldolase                                      284   4e-86    
ref|WP_031058074.1|  transaldolase                                      284   4e-86    
ref|WP_017832797.1|  transaldolase                                      284   4e-86    
ref|WP_013137409.1|  transaldolase                                      284   4e-86    
ref|WP_003805578.1|  transaldolase                                      284   4e-86    
ref|WP_006236619.1|  transaldolase                                      284   4e-86    
ref|WP_030631478.1|  MULTISPECIES: transaldolase                        284   4e-86    
ref|WP_030692500.1|  transaldolase                                      284   4e-86    
ref|WP_031072624.1|  transaldolase                                      284   4e-86    
gb|KHD79102.1|  transaldolase                                           284   4e-86    
ref|WP_013178254.1|  transaldolase                                      284   4e-86    
ref|WP_014697685.1|  transaldolase                                      283   4e-86    
ref|WP_030814125.1|  transaldolase                                      283   5e-86    
ref|WP_018957637.1|  transaldolase                                      283   5e-86    
ref|WP_023542521.1|  transaldolase                                      283   5e-86    
ref|WP_024463791.1|  transaldolase                                      283   5e-86    
ref|WP_023589252.1|  transaldolase                                      283   5e-86    
ref|WP_016698142.1|  hypothetical protein                               284   5e-86    
ref|WP_030408643.1|  MULTISPECIES: transaldolase                        283   5e-86    



>ref|XP_009627823.1| PREDICTED: uncharacterized protein LOC104118307 [Nicotiana tomentosiformis]
Length=443

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/436 (83%), Positives = 401/436 (92%), Gaps = 3/436 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspap-KCFVDIR-NKSS-FDARLSSSKLLAFAKPSLN  333
             MATISKLSNP    SSS +    S +  KCF+D+R NK++ FD + S+SKL     PS+ 
Sbjct  1     MATISKLSNPALNYSSSTSFTTRSSSAPKCFLDLRTNKTTTFDHKFSASKLSLVFNPSIR  60

Query  334   GSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNP  513
             GSL ++CSQ  GNGS +KRT+LHDLYE+QGQSPWYDNLCRPVTDL+PLIESGVRGVTSNP
Sbjct  61    GSLCVKCSQADGNGSTVKRTTLHDLYERQGQSPWYDNLCRPVTDLLPLIESGVRGVTSNP  120

Query  514   AIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYV  693
             AIFQKAISTSNAYN+QF+ELVQAGKDIES+YWELVVKDIQDACKLFE IYD+T+ GDGYV
Sbjct  121   AIFQKAISTSNAYNEQFRELVQAGKDIESVYWELVVKDIQDACKLFESIYDKTDGGDGYV  180

Query  694   SVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLI  873
             SVEVSPRLA+DTEGT+EAAKWLHKKV+R NVYIKIPATAPCIPSIKEVI+ GISVNVTLI
Sbjct  181   SVEVSPRLAEDTEGTVEAAKWLHKKVERSNVYIKIPATAPCIPSIKEVISLGISVNVTLI  240

Query  874   FSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrg  1053
             FS+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTLVDK+LEKIG+PEALDLRG
Sbjct  241   FSLARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLVDKMLEKIGTPEALDLRG  300

Query  1054  kaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGP  1233
             KAANAQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGP
Sbjct  301   KAANAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGP  360

Query  1234  DTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSF  1413
             DTVSTMPDQAL AFIDHGSVARTID+NVSEAEGIY+A++KLG+DW  VG+QLE EGVDSF
Sbjct  361   DTVSTMPDQALQAFIDHGSVARTIDSNVSEAEGIYSALEKLGIDWSFVGSQLELEGVDSF  420

Query  1414  KKSFDSLLDSLQEKAN  1461
             KKSFDSLLDSLQEKAN
Sbjct  421   KKSFDSLLDSLQEKAN  436



>ref|XP_009791901.1| PREDICTED: uncharacterized protein LOC104239067 [Nicotiana sylvestris]
 gb|AII99826.1| transaldolase [Nicotiana tabacum]
Length=443

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/436 (83%), Positives = 400/436 (92%), Gaps = 3/436 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspap-KCFVDIR-NKS-SFDARLSSSKLLAFAKPSLN  333
             MATISKLSNP    SSS +    S +  K F+D+R NK+ SFD R S+SKL     PS+ 
Sbjct  1     MATISKLSNPALNYSSSTSFTTRSSSAPKSFLDLRTNKTTSFDHRFSASKLSLVFNPSIR  60

Query  334   GSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNP  513
             GSL ++CSQ  GNGS +KRT+LHDLYE+QGQSPWYDNLCRPVTDL+PLIESGVRGVTSNP
Sbjct  61    GSLCVKCSQADGNGSTVKRTTLHDLYERQGQSPWYDNLCRPVTDLLPLIESGVRGVTSNP  120

Query  514   AIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYV  693
             AIFQKAISTSNAYN+QF+ELVQAGKDIES+YWELVVKDIQDACKLFE IYD+T+ GDGYV
Sbjct  121   AIFQKAISTSNAYNEQFRELVQAGKDIESVYWELVVKDIQDACKLFESIYDKTDGGDGYV  180

Query  694   SVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLI  873
             SVEVSPRLA+DTEGT++AAKWLHKKV+R NVYIKIPATAPCIPSIKEVI+ GISVNVTLI
Sbjct  181   SVEVSPRLAEDTEGTVDAAKWLHKKVERSNVYIKIPATAPCIPSIKEVISLGISVNVTLI  240

Query  874   FSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrg  1053
             FS+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTLVDK+LEKIG+PEALDLRG
Sbjct  241   FSLARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLVDKMLEKIGTPEALDLRG  300

Query  1054  kaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGP  1233
             KAANAQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGP
Sbjct  301   KAANAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGP  360

Query  1234  DTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSF  1413
             DTVSTMPDQAL AFIDHGSVARTID+NVSEAEGIY+A++KLG+DW  VG+QLE EGVDSF
Sbjct  361   DTVSTMPDQALQAFIDHGSVARTIDSNVSEAEGIYSALEKLGIDWSFVGSQLELEGVDSF  420

Query  1414  KKSFDSLLDSLQEKAN  1461
             KKSFDSLLDSLQEKAN
Sbjct  421   KKSFDSLLDSLQEKAN  436



>gb|KDP23255.1| hypothetical protein JCGZ_23088 [Jatropha curcas]
Length=440

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/434 (83%), Positives = 395/434 (91%), Gaps = 2/434 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapK-CFVDIRNKSSFDARLSSSKLLAFAKPSLNGS  339
             MATISKL+NP  ++S S +S +S      C VD + K++F AR +SSKL +  +    GS
Sbjct  1     MATISKLANPTPSASLSPSSFKSRSFMPLCHVDFQTKTAFLARAASSKL-SLLRNGQTGS  59

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
              V+RCSQ  GNGSPIK+T+LHDLYE++GQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI
Sbjct  60    FVVRCSQSSGNGSPIKKTTLHDLYEREGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  119

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+SNAYNDQF+ELVQ+GKDIES YWELVVKDIQDACKLFE IYD+T+ GDGYVSV
Sbjct  120   FQKAISSSNAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFESIYDQTDGGDGYVSV  179

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDT GT+EAAKWLHK VDR NVYIKIPATA CIPSIKEVI+NGISVNVTLIFS
Sbjct  180   EVSPRLADDTNGTVEAAKWLHKVVDRPNVYIKIPATASCIPSIKEVISNGISVNVTLIFS  239

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKA
Sbjct  240   LARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKA  299

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  300   AVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  359

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AFIDHGSVARTID+NVSEAEGIYNA++KLG+DWK VG QLEAEGVDSFKK
Sbjct  360   VSTMPDQALQAFIDHGSVARTIDSNVSEAEGIYNALEKLGIDWKFVGNQLEAEGVDSFKK  419

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  420   SFDSLLDTLQEKAN  433



>gb|ABB17002.1| transaldolase-like protein [Solanum tuberosum]
Length=438

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/434 (83%), Positives = 392/434 (90%), Gaps = 4/434 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSS-SKLLAFAKPSLNGS  339
             MA+I KLSNP    +S+    RSS  PK  V +R  S+F+ RLS+ SKL     PS+  S
Sbjct  1     MASICKLSNP--CFNSTSYGSRSSSTPKFVVHLRT-STFNHRLSAGSKLSLVINPSIRAS  57

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             L ++CSQ  GNGS +KRT+LH LYE QGQSPWYDNLCRPVTDLIPLI+SGVRGVTSNPAI
Sbjct  58    LCVKCSQADGNGSSVKRTTLHHLYETQGQSPWYDNLCRPVTDLIPLIDSGVRGVTSNPAI  117

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAISTSNAYNDQF+ELVQAGKDI+S+YWELVVKDIQDACKLFE IYD+T+ GDGYVSV
Sbjct  118   FQKAISTSNAYNDQFRELVQAGKDIDSVYWELVVKDIQDACKLFETIYDKTDGGDGYVSV  177

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDTEGT+EAAKWLHKKV+R NVYIKIPATAPCIPSIKEVI+ GISVNVTLIFS
Sbjct  178   EVSPRLADDTEGTVEAAKWLHKKVERSNVYIKIPATAPCIPSIKEVISLGISVNVTLIFS  237

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTLVDKLLEKIG+PEALDLRGK 
Sbjct  238   LSRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLVDKLLEKIGTPEALDLRGKX  297

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             ANAQAALA+ LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT
Sbjct  298   ANAQAALAYDLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  357

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AFIDHGSVARTIDAN+SEAEGIY+A++KLG+DW  VG+QLE EGVDSFKK
Sbjct  358   VSTMPDQALQAFIDHGSVARTIDANLSEAEGIYSALEKLGIDWVFVGSQLELEGVDSFKK  417

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLDSLQEKAN
Sbjct  418   SFDSLLDSLQEKAN  431



>ref|XP_011020897.1| PREDICTED: uncharacterized protein LOC105123107 [Populus euphratica]
Length=436

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/434 (83%), Positives = 390/434 (90%), Gaps = 6/434 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFD-ARLSSSKLLAFAKPSLNGS  339
             MATISKLSNP  A+S S  SR SS   K F+    K+S    RLS    L   +PS   S
Sbjct  1     MATISKLSNPSPAASLSAPSRSSSLP-KVFLGFSTKTSLSKVRLS----LTNTQPSPRTS  55

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             LV+RCSQ  GNGSPIKRT+LHDLYE++GQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI
Sbjct  56    LVVRCSQSSGNGSPIKRTTLHDLYEREGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  115

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+SNAYNDQF+ELVQ+GKDIE+ YWELVVKDIQDACKLFE IYD+T+ GDGYVSV
Sbjct  116   FQKAISSSNAYNDQFRELVQSGKDIETAYWELVVKDIQDACKLFESIYDQTDGGDGYVSV  175

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDT+GT+EAAKWLHK VDR NVYIKIPATAPCIPSIKEVI+ GISVNVTLIFS
Sbjct  176   EVSPRLADDTQGTVEAAKWLHKVVDRPNVYIKIPATAPCIPSIKEVISLGISVNVTLIFS  235

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALD+RGKA
Sbjct  236   LTRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDIRGKA  295

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  296   AVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  355

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AFIDHGSVARTID+NVSEAEGIYNA++KLG+DW  VG QLE EGVDSFKK
Sbjct  356   VSTMPDQALQAFIDHGSVARTIDSNVSEAEGIYNALEKLGIDWGYVGNQLEVEGVDSFKK  415

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  416   SFDSLLDTLQEKAN  429



>ref|XP_008369618.1| PREDICTED: uncharacterized protein LOC103433158 [Malus domestica]
Length=443

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/434 (82%), Positives = 396/434 (91%), Gaps = 2/434 (0%)
 Frame = +1

Query  166   ATISKLSNPGfassssftsrrsspapKCFVDIRNK--SSFDARLSSSKLLAFAKPSLNGS  339
             A++SKLSNP  ASS S T    +P P+C + +     S+F+++LSSSKL   +KPSL GS
Sbjct  3     ASVSKLSNPTPASSLSSTFSPRTPQPRCLIRLLTTPGSTFNSKLSSSKLSVRSKPSLRGS  62

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             LV+RCSQ  GNGSP+KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAI
Sbjct  63    LVVRCSQSDGNGSPVKRTYLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAI  122

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAISTSNAYNDQF+ELV +GKDIES YWELVVKDIQDACKLFE IYD+T+AGDGYVSV
Sbjct  123   FQKAISTSNAYNDQFRELVHSGKDIESAYWELVVKDIQDACKLFESIYDQTDAGDGYVSV  182

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDT+GT++AAKWLHK V R NVYIKIPATAPC+PSIKEVIANGISVNVTLIFS
Sbjct  183   EVSPRLADDTQGTVDAAKWLHKVVARPNVYIKIPATAPCVPSIKEVIANGISVNVTLIFS  242

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKA
Sbjct  243   LSRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKA  302

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  303   AVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  362

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AF+DHG+V+RTID+NVSEAEGIY+A++KLG+DW  VG QLE EGVDSFKK
Sbjct  363   VSTMPDQALQAFVDHGTVSRTIDSNVSEAEGIYSALEKLGIDWSYVGNQLEIEGVDSFKK  422

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  423   SFDSLLDTLQEKAN  436



>ref|XP_007222221.1| hypothetical protein PRUPE_ppa005845mg [Prunus persica]
 gb|EMJ23420.1| hypothetical protein PRUPE_ppa005845mg [Prunus persica]
Length=441

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/434 (83%), Positives = 393/434 (91%), Gaps = 1/434 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVD-IRNKSSFDARLSSSKLLAFAKPSLNGS  339
             MA+ISKLSNP  ASS S T    +  PKC +  +   ++F +++SSSKL   +K SL GS
Sbjct  1     MASISKLSNPSPASSLSSTFNPRASQPKCLIGFLTTTTNFSSKVSSSKLSIRSKSSLKGS  60

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             LV+RCSQG GNG+P KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAI
Sbjct  61    LVVRCSQGDGNGNPAKRTYLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAI  120

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAISTSNAYNDQF+ELVQ+GKDIES YWELVVKDIQDA KLFE IYD+T+AGDGYVSV
Sbjct  121   FQKAISTSNAYNDQFRELVQSGKDIESAYWELVVKDIQDASKLFESIYDQTDAGDGYVSV  180

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSP+LADDT+GTIEAAKWLHK V R NVYIKIPATAPCIPSIKEVIANGISVNVTLIFS
Sbjct  181   EVSPKLADDTQGTIEAAKWLHKVVARPNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  240

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTL+DKLLEKIG+PEALDLRGKA
Sbjct  241   LTRYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLIDKLLEKIGTPEALDLRGKA  300

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPDT
Sbjct  301   AVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDT  360

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AFIDHG+V+RTID+NVSEAEGIY+A++KLG+DW  VG QLE EGVDSFKK
Sbjct  361   VSTMPDQALQAFIDHGTVSRTIDSNVSEAEGIYSALEKLGIDWSYVGNQLEIEGVDSFKK  420

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  421   SFDSLLDTLQEKAN  434



>ref|XP_002304636.1| transaldolase family protein [Populus trichocarpa]
 gb|EEE79615.1| transaldolase family protein [Populus trichocarpa]
Length=436

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/434 (82%), Positives = 389/434 (90%), Gaps = 6/434 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFD-ARLSSSKLLAFAKPSLNGS  339
             MATISKLSNP  A+S S  SR SS   K F+    K+S    RLS    L   +PS   S
Sbjct  1     MATISKLSNPSPAASLSAPSRSSSLP-KVFLGFSTKTSLSKVRLS----LKNTQPSPRTS  55

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             LV+RCSQ  GNGSPIKRT+LHDLYE++GQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI
Sbjct  56    LVVRCSQSSGNGSPIKRTTLHDLYEREGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  115

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+SNAYNDQF+ELVQ+GKDIE+ YWELVVKDIQDACKLFE IYD+T+ GDGYVSV
Sbjct  116   FQKAISSSNAYNDQFRELVQSGKDIETAYWELVVKDIQDACKLFESIYDQTDGGDGYVSV  175

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDT+GT+EAAKWLHK VDR NVYIKIPATAPCIPSIKEVI+ GISVNVTLIFS
Sbjct  176   EVSPRLADDTQGTVEAAKWLHKVVDRPNVYIKIPATAPCIPSIKEVISLGISVNVTLIFS  235

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKA
Sbjct  236   LTRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKA  295

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  296   AVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  355

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AF+DHG VARTID+NVSEAEGIYNA++KLG+DW  VG QLE EGVDSFKK
Sbjct  356   VSTMPDQALQAFVDHGIVARTIDSNVSEAEGIYNALEKLGIDWGYVGNQLEVEGVDSFKK  415

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  416   SFDSLLDTLQEKAN  429



>gb|AAB54016.1| transaldolase [Solanum tuberosum]
Length=438

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/434 (83%), Positives = 392/434 (90%), Gaps = 4/434 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSS-SKLLAFAKPSLNGS  339
             MA+I KLSNP    +S+    RSS  PK  V +R  S+F+ RLS+ SKL     PS+  S
Sbjct  1     MASICKLSNP--CFNSTSYGSRSSSTPKFVVHLRT-STFNHRLSAGSKLSLVINPSIRAS  57

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             L ++CSQ  GNGS +KRT+LH LYE QGQSPWYDNLC PVTDLIPLI+SGVRGVTSNPAI
Sbjct  58    LCVKCSQADGNGSSVKRTTLHHLYETQGQSPWYDNLCLPVTDLIPLIDSGVRGVTSNPAI  117

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAISTSNAYNDQF+ELVQAGKDI+S+YWELVVKDIQDACKLFE IYD+T+ GDGYVSV
Sbjct  118   FQKAISTSNAYNDQFRELVQAGKDIDSVYWELVVKDIQDACKLFETIYDKTDGGDGYVSV  177

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDTEGT+EAAKWLHKKV+R NVYIKIPATAPCIPSIKEVI+ GISVNVTLIFS
Sbjct  178   EVSPRLADDTEGTVEAAKWLHKKVERSNVYIKIPATAPCIPSIKEVISLGISVNVTLIFS  237

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTLVDKLLEKIG+PEALDLRGKA
Sbjct  238   LSRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLVDKLLEKIGTPEALDLRGKA  297

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             ANAQAALA+ LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT
Sbjct  298   ANAQAALAYDLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  357

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AFIDHGSVARTIDAN+SEAEGIY+A++KLG+DW  VG+QLE EGVDSFKK
Sbjct  358   VSTMPDQALQAFIDHGSVARTIDANLSEAEGIYSALEKLGIDWVFVGSQLELEGVDSFKK  417

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLDSLQEKAN
Sbjct  418   SFDSLLDSLQEKAN  431



>ref|XP_008222257.1| PREDICTED: uncharacterized protein LOC103322152 [Prunus mume]
Length=440

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/434 (83%), Positives = 395/434 (91%), Gaps = 2/434 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVD-IRNKSSFDARLSSSKLLAFAKPSLNGS  339
             MA+ISKLSNP  AS SS  + R+S   KC +  +   ++F +++SSSKL   +K SL GS
Sbjct  1     MASISKLSNPSPASLSSTFNPRASQP-KCLIGFLTTTTNFSSKVSSSKLSIRSKSSLKGS  59

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             LV+RCSQG GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAI
Sbjct  60    LVVRCSQGDGNGSPAKRTYLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAI  119

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAISTSNAYNDQF+ELVQ+GKDIES YWELVVKDIQDA KLFE IYD+T+AGDGYVSV
Sbjct  120   FQKAISTSNAYNDQFRELVQSGKDIESAYWELVVKDIQDASKLFESIYDQTDAGDGYVSV  179

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSP+LADDT+GTIEAAKWLHK V R NVYIKIPATAPC+PSIKEVIANGISVNVTLIFS
Sbjct  180   EVSPKLADDTQGTIEAAKWLHKVVARPNVYIKIPATAPCVPSIKEVIANGISVNVTLIFS  239

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTL+DKLLEKIG+PEALDLRGKA
Sbjct  240   LTRYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLIDKLLEKIGTPEALDLRGKA  299

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  300   AVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  359

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AFIDHG+V+RTID+NVSEAEGIY+A++KLG+DW  VG QLE EGVDSFKK
Sbjct  360   VSTMPDQALQAFIDHGTVSRTIDSNVSEAEGIYSALEKLGIDWSYVGNQLEIEGVDSFKK  419

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  420   SFDSLLDTLQEKAN  433



>ref|XP_008390214.1| PREDICTED: uncharacterized protein LOC103452497 [Malus domestica]
Length=441

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/434 (82%), Positives = 390/434 (90%), Gaps = 1/434 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDI-RNKSSFDARLSSSKLLAFAKPSLNGS  339
             MA+ISKLSNP  ASS S T    +P PKC V +    ++      SSKL    KPSL GS
Sbjct  1     MASISKLSNPTPASSLSSTFSPRTPQPKCLVRLLATPAATXXSKLSSKLSVRTKPSLRGS  60

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             LV+RCSQ  GNG+P+KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAI
Sbjct  61    LVVRCSQSDGNGNPVKRTYLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAI  120

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAISTSNAYNDQF+ELVQ+GKDIES YWELVVKDIQDACKLFE IYD+T+AGDGYVSV
Sbjct  121   FQKAISTSNAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFEAIYDQTDAGDGYVSV  180

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDT+GT++AAKWLHK V R NVYIKIPATAPC+PSIKEVIANGISVNVTLIFS
Sbjct  181   EVSPRLADDTQGTVDAAKWLHKVVARPNVYIKIPATAPCVPSIKEVIANGISVNVTLIFS  240

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYE VIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DKLLEKIG+PEALDLRGKA
Sbjct  241   LSRYEEVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKLLEKIGNPEALDLRGKA  300

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  301   AVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  360

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AF+DHG+V+RTID+NVSEAEGIY+A++KLG+DW  VG QLE EGVDSFKK
Sbjct  361   VSTMPDQALQAFVDHGTVSRTIDSNVSEAEGIYSALEKLGIDWSYVGNQLELEGVDSFKK  420

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  421   SFDSLLDTLQEKAN  434



>ref|XP_003621050.1| Transaldolase [Medicago truncatula]
 gb|AES77268.1| transaldolase family protein [Medicago truncatula]
Length=443

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/430 (81%), Positives = 378/430 (88%), Gaps = 0/430 (0%)
 Frame = +1

Query  169   TISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSLVI  348
             ++SK++ P   S+S   S RS     CF+   N + F   LS+S L    +     SL I
Sbjct  6     SVSKITTPNTNSASLPESLRSRSIKTCFLPFNNTNHFKTNLSASSLTTTRENRFVTSLRI  65

Query  349   RCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQK  528
             RCSQ  GNG P KRT LHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQK
Sbjct  66    RCSQTDGNGVPAKRTVLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQK  125

Query  529   AISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVS  708
             AIS+S+AYNDQF+ELVQAGKDI+S YWELVVKDIQDACKLFE IYD+T+ GDGYVSVEVS
Sbjct  126   AISSSSAYNDQFRELVQAGKDIDSAYWELVVKDIQDACKLFESIYDQTDGGDGYVSVEVS  185

Query  709   PRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIER  888
             PRLA+DTEGTIEAAKWLHK V R NVYIKIPATA C+PSIKEVIANGISVNVTLIFS+ER
Sbjct  186   PRLAEDTEGTIEAAKWLHKVVSRPNVYIKIPATAACVPSIKEVIANGISVNVTLIFSLER  245

Query  889   YEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaana  1068
             YEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKAA A
Sbjct  246   YEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKAAVA  305

Query  1069  qaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVST  1248
             QAALA+QLYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDTVST
Sbjct  306   QAALAYQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDTVST  365

Query  1249  MPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFD  1428
             MPDQAL AFIDHG+VARTID+N SEAEGIYNAI KLG+DW  VG+QLE EGVDSFKK+FD
Sbjct  366   MPDQALQAFIDHGAVARTIDSNASEAEGIYNAIQKLGIDWSYVGSQLELEGVDSFKKAFD  425

Query  1429  SLLDSLQEKA  1458
             SLLDSLQEKA
Sbjct  426   SLLDSLQEKA  435



>ref|XP_009359868.1| PREDICTED: uncharacterized protein LOC103950394 [Pyrus x bretschneideri]
Length=443

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/434 (82%), Positives = 395/434 (91%), Gaps = 2/434 (0%)
 Frame = +1

Query  166   ATISKLSNPGfassssftsrrsspapKCFVDI--RNKSSFDARLSSSKLLAFAKPSLNGS  339
             A+ISKLSNP  ASS S T    +P PKC + +     ++F+++LSSSKL   +KPSL GS
Sbjct  3     ASISKLSNPTPASSLSSTFSPRTPQPKCLIRLLATPAATFNSKLSSSKLSVRSKPSLRGS  62

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             LV+RCSQ  GNGS +KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAI
Sbjct  63    LVVRCSQSDGNGSQVKRTYLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAI  122

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAISTSNAYNDQF+EL+ +GKDIES YWELVVKDIQDACKLFE IYD+T+AGDGYVSV
Sbjct  123   FQKAISTSNAYNDQFRELIHSGKDIESAYWELVVKDIQDACKLFESIYDQTDAGDGYVSV  182

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDT+GT++AAKWLHK V R NVYIKIPATAPC+PSIKEVIANGISVNVTLIFS
Sbjct  183   EVSPRLADDTQGTVDAAKWLHKVVARPNVYIKIPATAPCVPSIKEVIANGISVNVTLIFS  242

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAV+DAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKA
Sbjct  243   LSRYEAVMDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKA  302

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  303   AVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  362

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AF+DHG+V+RTID+NVSEAEGIY+A++KLG+DW  VG QLE EGVDSFKK
Sbjct  363   VSTMPDQALQAFVDHGTVSRTIDSNVSEAEGIYSALEKLGIDWSYVGNQLEIEGVDSFKK  422

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  423   SFDSLLDTLQEKAN  436



>ref|NP_001274983.1| transaldolase-like protein [Solanum tuberosum]
 gb|ABB55393.1| transaldolase-like [Solanum tuberosum]
Length=439

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/435 (83%), Positives = 392/435 (90%), Gaps = 5/435 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSS-SKLLAFAKPSLNGS  339
             MA+I KLSNP    +S+    RSS  PK  V +R  S+F+ RLS+ SKL     PS+  S
Sbjct  1     MASICKLSNP--CFNSTSYGSRSSSTPKFVVHLRT-STFNHRLSAGSKLSLVINPSIRAS  57

Query  340   LVIRCSQGGGNGSPIKRTSLHDL-YEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             L ++CSQ  GNGS +KRT+LH   YE QGQSPWYDNLCRPVTDLIPLI+SGVRGVTSNPA
Sbjct  58    LCVKCSQADGNGSSVKRTTLHHSSYETQGQSPWYDNLCRPVTDLIPLIDSGVRGVTSNPA  117

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSNAYNDQF+ELVQAGKDI+S+YWELVVKDIQDACKLFE IYD+T+ GDGYVS
Sbjct  118   IFQKAISTSNAYNDQFRELVQAGKDIDSVYWELVVKDIQDACKLFETIYDKTDGGDGYVS  177

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDTEGT+EAAKWLHKKV+R NVYIKIPATAPCIPSIKEVI+ GISVNVTLIF
Sbjct  178   VEVSPRLADDTEGTVEAAKWLHKKVERSNVYIKIPATAPCIPSIKEVISLGISVNVTLIF  237

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             S+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTLVDKLLEKIG+PEALDLRGK
Sbjct  238   SLSRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLVDKLLEKIGTPEALDLRGK  297

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AANAQAALA+ LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD
Sbjct  298   AANAQAALAYDLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  357

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHGSVARTIDAN+SEAEGIY+A++KLG+DW  VG+QLE EGVDSFK
Sbjct  358   TVSTMPDQALQAFIDHGSVARTIDANLSEAEGIYSALEKLGIDWVFVGSQLELEGVDSFK  417

Query  1417  KSFDSLLDSLQEKAN  1461
             KSFDSLLDSLQEKAN
Sbjct  418   KSFDSLLDSLQEKAN  432



>gb|ACJ86217.1| unknown [Medicago truncatula]
Length=443

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/430 (81%), Positives = 377/430 (88%), Gaps = 0/430 (0%)
 Frame = +1

Query  169   TISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSLVI  348
             ++SK++ P   S+S   S RS     CF+   N + F   LS+S L    +     SL I
Sbjct  6     SVSKITTPNTNSASLPESLRSRSIKTCFLPFNNTNHFKTNLSASSLTTTRENRFVTSLRI  65

Query  349   RCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQK  528
             RCSQ  GNG P KRT LHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQK
Sbjct  66    RCSQTDGNGVPAKRTVLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQK  125

Query  529   AISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVS  708
             AI +S+AYNDQF+ELVQAGKDI+S YWELVVKDIQDACKLFE IYD+T+ GDGYVSVEVS
Sbjct  126   AIPSSSAYNDQFRELVQAGKDIDSAYWELVVKDIQDACKLFESIYDQTDGGDGYVSVEVS  185

Query  709   PRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIER  888
             PRLA+DTEGTIEAAKWLHK V R NVYIKIPATA C+PSIKEVIANGISVNVTLIFS+ER
Sbjct  186   PRLAEDTEGTIEAAKWLHKVVSRPNVYIKIPATAACVPSIKEVIANGISVNVTLIFSLER  245

Query  889   YEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaana  1068
             YEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKAA A
Sbjct  246   YEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKAAVA  305

Query  1069  qaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVST  1248
             QAALA+QLYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDTVST
Sbjct  306   QAALAYQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDTVST  365

Query  1249  MPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFD  1428
             MPDQAL AFIDHG+VARTID+N SEAEGIYNAI KLG+DW  VG+QLE EGVDSFKK+FD
Sbjct  366   MPDQALQAFIDHGAVARTIDSNASEAEGIYNAIQKLGIDWSYVGSQLELEGVDSFKKAFD  425

Query  1429  SLLDSLQEKA  1458
             SLLDSLQEKA
Sbjct  426   SLLDSLQEKA  435



>ref|NP_001234354.1| transaldolase [Solanum lycopersicum]
 gb|AAG16981.1|AF184164_1 transaldolase [Solanum lycopersicum]
Length=437

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/433 (82%), Positives = 388/433 (90%), Gaps = 3/433 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             M +I KLSNP    SS+    RSS  PK  V +R  S+F+  LS SKL     PS+  SL
Sbjct  1     MTSICKLSNP--CFSSTSYGSRSSSTPKFVVHLRT-STFNHTLSGSKLSLVINPSIRASL  57

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
              ++CSQ  GNGS +K+T+LH LYE QGQSPWYDNLCRPVTDLIPLI+SGVRGVTSNPAIF
Sbjct  58    CVKCSQADGNGSSVKKTTLHHLYETQGQSPWYDNLCRPVTDLIPLIDSGVRGVTSNPAIF  117

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAISTSNAYNDQF+ELVQAGKDI+S+YWELVVKDIQDACKLFE IYD+T+ GDG VSVE
Sbjct  118   QKAISTSNAYNDQFRELVQAGKDIDSVYWELVVKDIQDACKLFETIYDKTDGGDGSVSVE  177

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLADDTEGT+EAAKWLHKKV+R NVYIKIPATAPCIPSIKEVI+ GISVNVTLIFS+
Sbjct  178   VSPRLADDTEGTVEAAKWLHKKVERSNVYIKIPATAPCIPSIKEVISLGISVNVTLIFSL  237

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DKLLEKIG+PEALDLRGKAA
Sbjct  238   SRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKLLEKIGTPEALDLRGKAA  297

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
             NAQAALA+ LYQKKFSGPRWEALVKKG +KQRLLWASTSVKNPAYPDTLYVDPLIGPDTV
Sbjct  298   NAQAALAYDLYQKKFSGPRWEALVKKGCQKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  357

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHGSVARTIDAN+SEAEGIY+A++KLG+DW  VG+QLE EGVDSFKKS
Sbjct  358   STMPDQALQAFIDHGSVARTIDANLSEAEGIYSALEKLGIDWGFVGSQLELEGVDSFKKS  417

Query  1423  FDSLLDSLQEKAN  1461
             FDSLLDSLQEKAN
Sbjct  418   FDSLLDSLQEKAN  430



>ref|XP_009353506.1| PREDICTED: uncharacterized protein LOC103944759 [Pyrus x bretschneideri]
Length=441

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/435 (82%), Positives = 395/435 (91%), Gaps = 3/435 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDI--RNKSSFDARLSSSKLLAFAKPSLNG  336
             MA+ISKLSNP  ASS S T    +P PKC + +     ++F+++LSSSKL    KPSL G
Sbjct  1     MASISKLSNPTPASSFSSTFSPRTPQPKCLIRLLATPAATFNSKLSSSKLSVRTKPSLRG  60

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SLV+RCSQ  GNG+P+KRT LHDLYE +GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPA
Sbjct  61    SLVVRCSQSDGNGNPVKRTYLHDLYE-EGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPA  119

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSNAYNDQF+ELVQ+GKDIES YWELVVKDIQDACKLFE IYD+T+AGDGYVS
Sbjct  120   IFQKAISTSNAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFEAIYDQTDAGDGYVS  179

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDT+GT++AAKWLHK V R NVYIKIPATAPC+PSIKEVIANGISVNVTLIF
Sbjct  180   VEVSPRLADDTQGTVDAAKWLHKVVARPNVYIKIPATAPCVPSIKEVIANGISVNVTLIF  239

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             S+ RYE VIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DKLLEKIG+PEALDLRGK
Sbjct  240   SLSRYEEVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKLLEKIGTPEALDLRGK  299

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPD
Sbjct  300   AAVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPD  359

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AF+DHG+V+RTID+NVSEAEGIY+A++K+G+DW  VG QLE EGVDSFK
Sbjct  360   TVSTMPDQALQAFVDHGTVSRTIDSNVSEAEGIYSALEKVGIDWSYVGNQLELEGVDSFK  419

Query  1417  KSFDSLLDSLQEKAN  1461
             KSFDSLLD+LQEKAN
Sbjct  420   KSFDSLLDTLQEKAN  434



>ref|XP_008454148.1| PREDICTED: uncharacterized protein LOC103494637 [Cucumis melo]
Length=441

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/406 (83%), Positives = 371/406 (91%), Gaps = 0/406 (0%)
 Frame = +1

Query  244   KCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQG  423
             K FV  R  S F  + S+S+L       L GSLV+RCSQG GNG P+KRT LHDLYEK+G
Sbjct  29    KSFVAFRPSSDFFTKFSASRLSVQRGSDLKGSLVVRCSQGDGNGIPVKRTVLHDLYEKEG  88

Query  424   QSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESL  603
             QSPWYDNLCRPVTDL+PLI  GVRGVTSNPAIFQKAIS+SNAYNDQF+ELVQ+GKDIES 
Sbjct  89    QSPWYDNLCRPVTDLLPLISKGVRGVTSNPAIFQKAISSSNAYNDQFRELVQSGKDIESA  148

Query  604   YWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRN  783
             YWELVVKDIQDACKLFEPIYD+T+AGDGYVSVEVSP+LADDTEGT+EAAKWLHK V R N
Sbjct  149   YWELVVKDIQDACKLFEPIYDQTDAGDGYVSVEVSPKLADDTEGTVEAAKWLHKVVSRPN  208

Query  784   VYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTS  963
             VYIKIPATA CIPSI++ IANGISVNVTLIFSI RYEAVIDAYLDGLEASGL+DLS+VTS
Sbjct  209   VYIKIPATAACIPSIRDTIANGISVNVTLIFSIARYEAVIDAYLDGLEASGLSDLSRVTS  268

Query  964   VASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKG  1143
             VASFFVSRVDTL+DKLLEKIG+PEALDLRGKAA AQAALA+QLYQKKFSGPRWEALVKKG
Sbjct  269   VASFFVSRVDTLIDKLLEKIGTPEALDLRGKAAVAQAALAYQLYQKKFSGPRWEALVKKG  328

Query  1144  AKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSE  1323
             AKKQRLLWASTSVKNPAYPDTLYV PLIGPDTVSTMPDQAL AF+DHG+V+RTID+NVSE
Sbjct  329   AKKQRLLWASTSVKNPAYPDTLYVAPLIGPDTVSTMPDQALDAFVDHGTVSRTIDSNVSE  388

Query  1324  AEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             AEGIY+A++KLG+DW +VG QLE EGVDSFKKSFDSLL++LQ+KAN
Sbjct  389   AEGIYSALEKLGIDWNEVGNQLEVEGVDSFKKSFDSLLNTLQDKAN  434



>gb|AAP83926.1| transaldolase [Solanum lycopersicum]
Length=437

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/433 (82%), Positives = 387/433 (89%), Gaps = 3/433 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             M +I KLSNP    SS+    RSS  PK  V +R  S+F+  LS SKL     PS+  SL
Sbjct  1     MTSICKLSNP--CFSSTSYGSRSSSTPKFVVHLRT-STFNHTLSGSKLSLVINPSIRASL  57

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
              ++CSQ  GNGS +K+T+LH  YE QGQSPWYDNLCRPVTDLIPLI+SGVRGVTSNPAIF
Sbjct  58    CVKCSQADGNGSSVKKTTLHHFYETQGQSPWYDNLCRPVTDLIPLIDSGVRGVTSNPAIF  117

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAISTSNAYNDQF+ELVQAGKDI+S+YWELVVKDIQDACKLFE IYD+T+ GDG VSVE
Sbjct  118   QKAISTSNAYNDQFRELVQAGKDIDSVYWELVVKDIQDACKLFETIYDKTDGGDGSVSVE  177

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLADDTEGT+EAAKWLHKKV+R NVYIKIPATAPCIPSIKEVI+ GISVNVTLIFS+
Sbjct  178   VSPRLADDTEGTVEAAKWLHKKVERSNVYIKIPATAPCIPSIKEVISLGISVNVTLIFSL  237

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DKLLEKIG+PEALDLRGKAA
Sbjct  238   SRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKLLEKIGTPEALDLRGKAA  297

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
             NAQAALA+ LYQKKFSGPRWEALVKKG +KQRLLWASTSVKNPAYPDTLYVDPLIGPDTV
Sbjct  298   NAQAALAYDLYQKKFSGPRWEALVKKGCQKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  357

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHGSVARTIDAN+SEAEGIY+A++KLG+DW  VG+QLE EGVDSFKKS
Sbjct  358   STMPDQALQAFIDHGSVARTIDANLSEAEGIYSALEKLGIDWGFVGSQLELEGVDSFKKS  417

Query  1423  FDSLLDSLQEKAN  1461
             FDSLLDSLQEKAN
Sbjct  418   FDSLLDSLQEKAN  430



>ref|XP_006487560.1| PREDICTED: uncharacterized protein LOC102622193 [Citrus sinensis]
 gb|KDO58144.1| hypothetical protein CISIN_1g036665mg [Citrus sinensis]
Length=440

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/433 (80%), Positives = 389/433 (90%), Gaps = 0/433 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             MATISKL+NP  +SSS      SS  PK  + ++ K+ F+++++SS+L       L  SL
Sbjct  1     MATISKLTNPAVSSSSLKPRSSSSSLPKSLISLQTKTGFNSKVASSQLTLRNNHPLKASL  60

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             V++CSQ GGNGS  KRT+LHDLYE++GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIF
Sbjct  61    VVKCSQSGGNGSSAKRTTLHDLYEQEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIF  120

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAIS+SNAYNDQF+ELVQ+GKDIE+ YWELV+KDIQDACKLFE IYDET  GDGYVSVE
Sbjct  121   QKAISSSNAYNDQFRELVQSGKDIEAAYWELVIKDIQDACKLFESIYDETNGGDGYVSVE  180

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLADDT+GT+EAAKWLHK V+R NVYIKIPATAPC+PSIKEVI+ GISVNVTLIFS+
Sbjct  181   VSPRLADDTQGTVEAAKWLHKVVNRPNVYIKIPATAPCVPSIKEVISQGISVNVTLIFSL  240

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYE VIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKAA
Sbjct  241   ARYEEVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKAA  300

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQAALA+QLYQKKFSGPRW+ALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDTV
Sbjct  301   VAQAALAYQLYQKKFSGPRWDALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDTV  360

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AF+DHG+V+RTID NVSEAEGIY+A++KLG+DW  VGTQLE EGVDSFKKS
Sbjct  361   STMPDQALQAFVDHGAVSRTIDLNVSEAEGIYSALEKLGIDWNYVGTQLELEGVDSFKKS  420

Query  1423  FDSLLDSLQEKAN  1461
             FDSLLD+LQEKAN
Sbjct  421   FDSLLDTLQEKAN  433



>ref|XP_002297881.2| transaldolase family protein [Populus trichocarpa]
 gb|EEE82686.2| transaldolase family protein [Populus trichocarpa]
Length=440

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/434 (81%), Positives = 385/434 (89%), Gaps = 2/434 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPS-LNGS  339
             MATISKLSN    ++S      SS  P+ F+    K+SF    SSS  L+         S
Sbjct  1     MATISKLSN-PSPAASLPAPSSSSSLPRVFLGFNTKTSFSKVASSSSGLSLTNTQPWRTS  59

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
              V+RCSQ  GNGSPIKRT+LHDLYE++GQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI
Sbjct  60    FVVRCSQSSGNGSPIKRTTLHDLYEREGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  119

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+SNAYNDQF+ELVQAGKDIE+ YWELVVKDIQDACKLFEPIYD+T+ GDGYVSV
Sbjct  120   FQKAISSSNAYNDQFRELVQAGKDIETAYWELVVKDIQDACKLFEPIYDQTDGGDGYVSV  179

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDT+GT+EAAKWLHK VDR NVYIKIPATAPCIPSIKEVI+ GISVNVTLIFS
Sbjct  180   EVSPRLADDTQGTVEAAKWLHKVVDRPNVYIKIPATAPCIPSIKEVISLGISVNVTLIFS  239

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKA
Sbjct  240   LTRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKA  299

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA LA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  300   AVAQAGLAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  359

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AF+DHGSVARTID+NVSEAEGIYNA++KLG+DW  VG QLE EGVDSFKK
Sbjct  360   VSTMPDQALQAFVDHGSVARTIDSNVSEAEGIYNALEKLGIDWGYVGDQLEVEGVDSFKK  419

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  420   SFDSLLDTLQEKAN  433



>gb|AFK42792.1| unknown [Medicago truncatula]
Length=443

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/430 (81%), Positives = 376/430 (87%), Gaps = 0/430 (0%)
 Frame = +1

Query  169   TISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSLVI  348
             ++SK++ P   S+S   S RS     CF+   N + F   LS+S L    +     SL I
Sbjct  6     SVSKITTPNTNSASLPESLRSRSIKTCFLPFNNTNHFKTNLSASSLTTTRENRFVTSLRI  65

Query  349   RCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQK  528
             RCSQ  GNG   KRT LHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQK
Sbjct  66    RCSQTDGNGVRAKRTVLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQK  125

Query  529   AISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVS  708
             AI +S+AYNDQF+ELVQAGKDI+S YWELVVKDIQDACKLFE IYD+T+ GDGYVSVEVS
Sbjct  126   AIPSSSAYNDQFRELVQAGKDIDSAYWELVVKDIQDACKLFESIYDQTDGGDGYVSVEVS  185

Query  709   PRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIER  888
             PRLA+DTEGTIEAAKWLHK V R NVYIKIPATA C+PSIKEVIANGISVNVTLIFS+ER
Sbjct  186   PRLAEDTEGTIEAAKWLHKVVSRPNVYIKIPATAACVPSIKEVIANGISVNVTLIFSLER  245

Query  889   YEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaana  1068
             YEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKAA A
Sbjct  246   YEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKAAVA  305

Query  1069  qaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVST  1248
             QAALA+QLYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDTVST
Sbjct  306   QAALAYQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDTVST  365

Query  1249  MPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFD  1428
             MPDQAL AFIDHG+VARTID+N SEAEGIYNAI KLG+DW  VG+QLE EGVDSFKK+FD
Sbjct  366   MPDQALQAFIDHGAVARTIDSNASEAEGIYNAIQKLGIDWSYVGSQLELEGVDSFKKAFD  425

Query  1429  SLLDSLQEKA  1458
             SLLDSLQEKA
Sbjct  426   SLLDSLQEKA  435



>ref|XP_011036191.1| PREDICTED: uncharacterized protein LOC105133779 [Populus euphratica]
Length=440

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/434 (81%), Positives = 385/434 (89%), Gaps = 2/434 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPS-LNGS  339
             MATISKLSN    ++S      SS  P+ F+    K+SF    SSS  L+         S
Sbjct  1     MATISKLSN-PSPAASLPAPSSSSSLPRVFLGFNTKTSFSKVASSSSRLSLTNTQPWRTS  59

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
              V+RCSQ  GNGSPIKRT+LHDLYE++GQSPWYDNLCRPVTDLIPLI+SGVRGVTSNPAI
Sbjct  60    FVVRCSQSSGNGSPIKRTTLHDLYEREGQSPWYDNLCRPVTDLIPLIDSGVRGVTSNPAI  119

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+SNAYNDQF+ELVQAGKDIE+ YWELVVKDIQDACKLFEPIYD+T+ GDGYVSV
Sbjct  120   FQKAISSSNAYNDQFRELVQAGKDIETAYWELVVKDIQDACKLFEPIYDQTDGGDGYVSV  179

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDT+GT+EAAKWLHK VDR NVYIKIPATAPCIPSIKEVI+ GISVNVTLIFS
Sbjct  180   EVSPRLADDTQGTVEAAKWLHKVVDRPNVYIKIPATAPCIPSIKEVISLGISVNVTLIFS  239

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKA
Sbjct  240   LTRYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKA  299

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA LA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  300   AVAQAGLAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  359

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AF+DHGSVARTID+NVSEAEGIYNA++KLG+DW  VG QLE EGVDSFKK
Sbjct  360   VSTMPDQALQAFVDHGSVARTIDSNVSEAEGIYNALEKLGIDWGYVGNQLEVEGVDSFKK  419

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLLD+LQEKAN
Sbjct  420   SFDSLLDTLQEKAN  433



>ref|XP_004152161.1| PREDICTED: transaldolase-like [Cucumis sativus]
 ref|XP_004168340.1| PREDICTED: transaldolase-like [Cucumis sativus]
 gb|KGN52962.1| hypothetical protein Csa_4G007670 [Cucumis sativus]
Length=441

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/434 (80%), Positives = 385/434 (89%), Gaps = 1/434 (0%)
 Frame = +1

Query  163   MATISKLSNP-GfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGS  339
             MA+ISKLS P    + SS  + RSS +   F+  R  S F  +LS+S+L       L GS
Sbjct  1     MASISKLSTPISSPTLSSSFNPRSSLSSNSFLAFRPSSDFFTKLSASRLSVQRGSDLKGS  60

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             L +RCSQG GNG P+KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI  GVRGVTSNPAI
Sbjct  61    LFVRCSQGDGNGIPVKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLISKGVRGVTSNPAI  120

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+SNAYNDQF+ELVQ+GKDIES YWELVVKDIQDACKLFEPIYD+T+AGDGYVSV
Sbjct  121   FQKAISSSNAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFEPIYDQTDAGDGYVSV  180

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSP+LADDTEGT+EAAKWLHK V R NVYIKIPATA CIPSI++ IANGISVNVTLIFS
Sbjct  181   EVSPKLADDTEGTVEAAKWLHKVVSRPNVYIKIPATAACIPSIRDTIANGISVNVTLIFS  240

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             I RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DKLLEKIG+PEALDLRGKA
Sbjct  241   IARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKLLEKIGTPEALDLRGKA  300

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  301   AVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  360

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AF+DHG V+RTID+NVSEAEGIY+A++KLG+DW +VG QLE EGVDSFKK
Sbjct  361   VSTMPDQALEAFVDHGIVSRTIDSNVSEAEGIYSALEKLGIDWNEVGNQLEIEGVDSFKK  420

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLL++LQ+K N
Sbjct  421   SFDSLLNTLQDKGN  434



>ref|XP_006420805.1| hypothetical protein CICLE_v10004979mg [Citrus clementina]
 gb|ESR34045.1| hypothetical protein CICLE_v10004979mg [Citrus clementina]
Length=440

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/433 (79%), Positives = 389/433 (90%), Gaps = 0/433 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             MATI KL+NP  +SSS      SS  PK  + ++ K+ F+++++SS+L       L  SL
Sbjct  1     MATILKLTNPAVSSSSLKPRSSSSSLPKSLISLQTKTGFNSKVASSQLTLRNNHPLKASL  60

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             V++CSQ GGNGS  KRT+LHDLYE++GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIF
Sbjct  61    VVKCSQSGGNGSSAKRTTLHDLYEQEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIF  120

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAIS+SNAYNDQF+ELVQ+GKDIE+ YWELV+KDIQDACKLFE IYDET+ GDGYVSVE
Sbjct  121   QKAISSSNAYNDQFRELVQSGKDIEAAYWELVIKDIQDACKLFESIYDETDGGDGYVSVE  180

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLADDT+GT+EAAKWLHK V+R NVYIKIPATAPC+PSIKEVI+ GISVNVTLIFS+
Sbjct  181   VSPRLADDTQGTVEAAKWLHKVVNRPNVYIKIPATAPCVPSIKEVISQGISVNVTLIFSL  240

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYE VIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKAA
Sbjct  241   ARYEEVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKAA  300

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQAALA+QLYQKKFSGPRW+ALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDTV
Sbjct  301   VAQAALAYQLYQKKFSGPRWDALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDTV  360

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AF+DHG+V+RTID NVSEAEGIY+A++KLG+DW  VGTQLE EGVDSFKKS
Sbjct  361   STMPDQALQAFVDHGAVSRTIDLNVSEAEGIYSALEKLGIDWNYVGTQLELEGVDSFKKS  420

Query  1423  FDSLLDSLQEKAN  1461
             FDSLLD+LQEKAN
Sbjct  421   FDSLLDTLQEKAN  433



>ref|XP_004310146.1| PREDICTED: transaldolase-like [Fragaria vesca subsp. vesca]
Length=443

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/436 (81%), Positives = 391/436 (90%), Gaps = 3/436 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspap-KCFVDIRNKS--SFDARLSSSKLLAFAKPSLN  333
             M +ISKLS+P  ASS S T      +  KC + +   S  +F ++LSSSKL   +KPSL 
Sbjct  1     MGSISKLSHPCPASSLSSTFNNPKASNPKCLIGLLTTSNNTFTSKLSSSKLSLRSKPSLR  60

Query  334   GSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNP  513
             GSL++RC+QG GNGSP K+T LHDLY+K+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNP
Sbjct  61    GSLIVRCAQGEGNGSPTKKTYLHDLYDKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNP  120

Query  514   AIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYV  693
             AIFQKAISTSNAYNDQF+ELVQ+GKDIE+ YWELVVKDIQDA KLFE IYD+T+A DGYV
Sbjct  121   AIFQKAISTSNAYNDQFRELVQSGKDIETAYWELVVKDIQDASKLFESIYDQTDAADGYV  180

Query  694   SVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLI  873
             SVEVSPRLADDTEGT+EAAKWLHK V R NVYIKIPATAPCIPSIKEVIANGISVNVTLI
Sbjct  181   SVEVSPRLADDTEGTVEAAKWLHKVVSRPNVYIKIPATAPCIPSIKEVIANGISVNVTLI  240

Query  874   FSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrg  1053
             FS+ RYEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DKLLEKIG+PEALDLRG
Sbjct  241   FSLSRYEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKLLEKIGTPEALDLRG  300

Query  1054  kaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGP  1233
             KAA AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGP
Sbjct  301   KAAVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGP  360

Query  1234  DTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSF  1413
             DTVSTMPDQAL AF+DHG+V+RTID+NVSEAEGIY+A++ LG+DW  VG QLE EGVDSF
Sbjct  361   DTVSTMPDQALQAFLDHGTVSRTIDSNVSEAEGIYSALEHLGIDWSYVGDQLELEGVDSF  420

Query  1414  KKSFDSLLDSLQEKAN  1461
             KKSFDSLLD+LQEKAN
Sbjct  421   KKSFDSLLDTLQEKAN  436



>emb|CDP18990.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/437 (81%), Positives = 386/437 (88%), Gaps = 4/437 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrssp---apKCFVDIRNKSSFDARLSSSKL-LAFAKPSL  330
             MA+ISKLS P  AS  S +S           C     N ++    LSSS L +   +P +
Sbjct  1     MASISKLSTPPTASHFSTSSSSQPSPTIRSLCLFLPNNTNTNALCLSSSNLSIRPTRPII  60

Query  331   NGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSN  510
               SL++RCSQ  GNGS +K T+LHDLYEKQGQSPWYDNLCRPVTDL+PLIESGVRGVTSN
Sbjct  61    APSLLVRCSQIDGNGSHVKGTTLHDLYEKQGQSPWYDNLCRPVTDLLPLIESGVRGVTSN  120

Query  511   PAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGY  690
             PAIFQKAISTSNAYN+QF+ELVQAGKDIES YWELVVKDIQDACKLFEPIYDET+ GDGY
Sbjct  121   PAIFQKAISTSNAYNEQFRELVQAGKDIESAYWELVVKDIQDACKLFEPIYDETDGGDGY  180

Query  691   VSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTL  870
             VSVEVSP LADDT+GTIEAAKWLHKKV R NVYIKIPATAPCIPSIKEVIA+GISVNVTL
Sbjct  181   VSVEVSPGLADDTQGTIEAAKWLHKKVQRPNVYIKIPATAPCIPSIKEVIASGISVNVTL  240

Query  871   IFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlr  1050
             IFS+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTLVDK+LEKIG+PEALDLR
Sbjct  241   IFSLARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLVDKMLEKIGTPEALDLR  300

Query  1051  gkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIG  1230
             GKAANAQAALA+Q+YQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIG
Sbjct  301   GKAANAQAALAYQVYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIG  360

Query  1231  PDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDS  1410
             PDTVSTMPDQAL AFIDHG+V RTIDANVSEAEGIY+A++KLG++W  VG+QLE EGVDS
Sbjct  361   PDTVSTMPDQALQAFIDHGTVGRTIDANVSEAEGIYSALEKLGIEWSYVGSQLELEGVDS  420

Query  1411  FKKSFDSLLDSLQEKAN  1461
             FKKSFDSLLDSLQEKAN
Sbjct  421   FKKSFDSLLDSLQEKAN  437



>ref|XP_002512678.1| Transaldolase, putative [Ricinus communis]
 gb|EEF50130.1| Transaldolase, putative [Ricinus communis]
Length=441

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/406 (84%), Positives = 372/406 (92%), Gaps = 3/406 (1%)
 Frame = +1

Query  247   CFVDIRNKSSFDARLSSSKL-LAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQG  423
             CF+D + K++    L+SSKL LA  +P      ++RCSQ  GNGSP K+T+LHDLYE +G
Sbjct  31    CFLDFKTKNALLPTLASSKLSLANIQP-FRAPFLVRCSQASGNGSPAKKTTLHDLYE-EG  88

Query  424   QSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESL  603
             QSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAIS+SNAYNDQF+EL+Q+GK+IES 
Sbjct  89    QSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISSSNAYNDQFRELIQSGKEIESA  148

Query  604   YWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRN  783
             YWELVVKDIQDACKLFEPIYD+T+  DGYVSVEVSPRLADDT+GT+EAAKWLHK VDR N
Sbjct  149   YWELVVKDIQDACKLFEPIYDQTDGADGYVSVEVSPRLADDTKGTVEAAKWLHKVVDRPN  208

Query  784   VYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTS  963
             VYIKIPATAPCIPSIKEVIANGISVNVTLIFS+ RYEAVIDAYLDGLEASGL+DLS+VTS
Sbjct  209   VYIKIPATAPCIPSIKEVIANGISVNVTLIFSLSRYEAVIDAYLDGLEASGLSDLSRVTS  268

Query  964   VASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKG  1143
             VASFFVSRVDTL+DK+LEKIG+PEALDLRGKAA AQAALAFQLYQKKFSGPRWEALVKKG
Sbjct  269   VASFFVSRVDTLIDKMLEKIGTPEALDLRGKAAVAQAALAFQLYQKKFSGPRWEALVKKG  328

Query  1144  AKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSE  1323
             AK+QRLLWASTSVKNPAY DTLYV PLIGPDTVSTMPDQAL AFIDHGSV RTID+NVSE
Sbjct  329   AKRQRLLWASTSVKNPAYSDTLYVAPLIGPDTVSTMPDQALQAFIDHGSVGRTIDSNVSE  388

Query  1324  AEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             AEGIY+A++KLGVDW  VG QLE EGVDSFKKSFDSLLDSLQEKAN
Sbjct  389   AEGIYSALEKLGVDWGYVGNQLEVEGVDSFKKSFDSLLDSLQEKAN  434



>ref|XP_004489137.1| PREDICTED: transaldolase-like [Cicer arietinum]
Length=442

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/410 (83%), Positives = 367/410 (90%), Gaps = 10/410 (2%)
 Frame = +1

Query  247   CFVDI-----RNKSSFDARLSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLY  411
             CF+ +       K +  A L ++ L AF       SL IRCSQ  GNGSP KRT LHDLY
Sbjct  31    CFLALVPSVTNYKINLSASLRTTHLNAF-----QSSLRIRCSQADGNGSPAKRTVLHDLY  85

Query  412   EKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKD  591
             EKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAIS+S+AYNDQF+ELVQAGKD
Sbjct  86    EKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISSSSAYNDQFRELVQAGKD  145

Query  592   IESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKV  771
             IES YWELVVKDIQDACKLFEPIYDET+ GDGYVSVEVSPRLADDT+GTIE AKWLHK V
Sbjct  146   IESAYWELVVKDIQDACKLFEPIYDETDGGDGYVSVEVSPRLADDTQGTIEDAKWLHKVV  205

Query  772   DRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLS  951
              R NVYIKIPATA C+PSIKEVIANGISVNVTLIFS+ERYEAVIDAYLDGLEASGLNDLS
Sbjct  206   SRPNVYIKIPATAACVPSIKEVIANGISVNVTLIFSLERYEAVIDAYLDGLEASGLNDLS  265

Query  952   KVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEAL  1131
             +VTSVASFFVSRVDTL+DK LEKIG+PEAL+LRGKAA AQAALA+QLYQ+KFSGPRWEAL
Sbjct  266   RVTSVASFFVSRVDTLIDKNLEKIGTPEALNLRGKAAVAQAALAYQLYQRKFSGPRWEAL  325

Query  1132  VKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDA  1311
             VKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDTVSTMPDQAL AFIDHG VARTID+
Sbjct  326   VKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDTVSTMPDQALQAFIDHGIVARTIDS  385

Query  1312  NVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             N SEAEGIYNA+ KLG+DW+ VG+QLE EGVDSFKKSF+SLLD+LQEKAN
Sbjct  386   NASEAEGIYNALQKLGIDWRSVGSQLELEGVDSFKKSFESLLDTLQEKAN  435



>ref|XP_007043770.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 gb|EOX99601.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
Length=442

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/435 (82%), Positives = 390/435 (90%), Gaps = 2/435 (0%)
 Frame = +1

Query  163   MATISKLSNPG-fassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSL-NG  336
             MATISKLSNP   AS SS    RSS + KCFV  R   SF ++L SS  L+     L  G
Sbjct  1     MATISKLSNPNPAASLSSSFKPRSSSSLKCFVGFRATGSFGSKLVSSSSLSLTNNHLLKG  60

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SLV+RCS   GNGS +KRT+LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPA
Sbjct  61    SLVLRCSLADGNGSSVKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPA  120

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAIS+SNAYNDQF+ELVQ+GKDIES YWELVVKDIQDACKLFEPIYD+T+ GDGYVS
Sbjct  121   IFQKAISSSNAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFEPIYDQTDGGDGYVS  180

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDTEGTIEAAK+LHK VD  NVYIKIPATAPCIPSIKEVI+ GISVNVTLIF
Sbjct  181   VEVSPRLADDTEGTIEAAKYLHKVVDCPNVYIKIPATAPCIPSIKEVISKGISVNVTLIF  240

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             S+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGK
Sbjct  241   SLARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGK  300

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPD
Sbjct  301   AAVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPD  360

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AF+DHG+V+RTID NVSEAEGIY+A++KLG+DW  VG+QLE EGV++FK
Sbjct  361   TVSTMPDQALQAFVDHGTVSRTIDTNVSEAEGIYSALEKLGIDWGYVGSQLEDEGVEAFK  420

Query  1417  KSFDSLLDSLQEKAN  1461
             KSFDSLLD+LQEKAN
Sbjct  421   KSFDSLLDTLQEKAN  435



>gb|KHG16036.1| Transaldolase [Gossypium arboreum]
Length=442

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/435 (81%), Positives = 389/435 (89%), Gaps = 2/435 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspap-KCFVDIRNKSSFDARLSSSKLLAFAKPS-LNG  336
             MATISKLSNP   +S S + +  S +  KCFV    + +F ++L SS  L+        G
Sbjct  1     MATISKLSNPNPVASLSSSFKPRSSSSPKCFVGFPTRPAFSSKLVSSSSLSSINTHPFRG  60

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SLV+RCS   GNGS +K T+LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPA
Sbjct  61    SLVVRCSLADGNGSSVKTTTLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPA  120

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAIS+SNAYNDQF+ELVQ+GKDIES YWELVVKDIQDACKLFEPIYD+T+ GDGYVS
Sbjct  121   IFQKAISSSNAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFEPIYDQTDGGDGYVS  180

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDT GTIEAAK+LHK VDR NVYIKIPATAPCIPSIKEVIANGISVNVTLIF
Sbjct  181   VEVSPRLADDTNGTIEAAKYLHKVVDRPNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  240

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             S+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LE IG+PEALDLRGK
Sbjct  241   SLARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEMIGTPEALDLRGK  300

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPD
Sbjct  301   AAVAQAALAYRLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPD  360

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V+RTIDANVSEAEGIY+A++KLG+DW +VG+QLE EGV+SFK
Sbjct  361   TVSTMPDQALQAFIDHGTVSRTIDANVSEAEGIYSALEKLGIDWGKVGSQLEDEGVESFK  420

Query  1417  KSFDSLLDSLQEKAN  1461
             KSFDSLLD+LQEKAN
Sbjct  421   KSFDSLLDTLQEKAN  435



>ref|XP_002271514.1| PREDICTED: uncharacterized protein LOC100247241 [Vitis vinifera]
 emb|CBI29267.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/406 (83%), Positives = 374/406 (92%), Gaps = 1/406 (0%)
 Frame = +1

Query  244   KCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQG  423
             KC +D  ++  F+AR+SSS+L +     + GSL++RCSQ  GNGS IKRT+LHDLYE+ G
Sbjct  30    KCLIDFHSRDVFNARVSSSRL-SVRNDVVRGSLIVRCSQLEGNGSQIKRTTLHDLYEQGG  88

Query  424   QSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESL  603
             QSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIFQKAIS+SNAYN+QF+ELV AGKDIES 
Sbjct  89    QSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIFQKAISSSNAYNEQFRELVLAGKDIESA  148

Query  604   YWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRN  783
             YWELVVKDIQDAC+LFEPIYDET+ GDGYVSVEVSP+LADDT GT+EAAKWL+K VDR N
Sbjct  149   YWELVVKDIQDACRLFEPIYDETDGGDGYVSVEVSPKLADDTVGTVEAAKWLYKVVDRPN  208

Query  784   VYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTS  963
             VYIKIPATAPC+PSIKEVI+ GISVNVTLIFS+ RYEAVIDAYLDGLEASGL+DLS+VTS
Sbjct  209   VYIKIPATAPCVPSIKEVISLGISVNVTLIFSLPRYEAVIDAYLDGLEASGLSDLSRVTS  268

Query  964   VASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKG  1143
             VASFFVSRVDTL+DKLLEKIG+PEALDLRGKAA AQAALA+QLYQKKFSGPRWEALVKKG
Sbjct  269   VASFFVSRVDTLIDKLLEKIGTPEALDLRGKAAVAQAALAYQLYQKKFSGPRWEALVKKG  328

Query  1144  AKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSE  1323
             AKKQRLLWASTSVKNPAYPDTLYV PLIGPDTVSTMPDQAL AF+DHG V+RTID+NVSE
Sbjct  329   AKKQRLLWASTSVKNPAYPDTLYVSPLIGPDTVSTMPDQALQAFVDHGVVSRTIDSNVSE  388

Query  1324  AEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             AEGIY+A++KLG+DW  VG+QLE EGV+SFKKSFDSLLDSLQEKAN
Sbjct  389   AEGIYSALEKLGIDWGYVGSQLELEGVESFKKSFDSLLDSLQEKAN  434



>ref|XP_003532330.1| PREDICTED: uncharacterized protein LOC100807267 [Glycine max]
Length=439

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/433 (81%), Positives = 376/433 (87%), Gaps = 1/433 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             MA+I KLS P  A+S S   R        F    N  ++   LS+S L +     L  SL
Sbjct  1     MASIFKLSTPSPAASLSEALRPRDSRFLSFNPSSNAINYKINLSAS-LRSIHSLPLKTSL  59

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
              I+CSQ  GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIF
Sbjct  60    RIKCSQTDGNGSPAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIF  119

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAIS+SNAYNDQF+ELVQAGKDIES YWELVVKDIQDACKLFEPIYD+T+ GDGYVSVE
Sbjct  120   QKAISSSNAYNDQFRELVQAGKDIESAYWELVVKDIQDACKLFEPIYDQTDGGDGYVSVE  179

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLADDTEGTIEAAKWLHK VDR NVYIKIPAT  C+PSIKEVIANGISVNVTLIFS+
Sbjct  180   VSPRLADDTEGTIEAAKWLHKVVDRPNVYIKIPATEACVPSIKEVIANGISVNVTLIFSL  239

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DK LEKIG+PEAL+LRGKAA
Sbjct  240   ARYEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKALEKIGTPEALNLRGKAA  299

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQAALA+QLYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPDTV
Sbjct  300   VAQAALAYQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTV  359

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHG+V+RTID+N SEAEGIYNA+ KLG+DW  VG+QLE EGVDSFKKS
Sbjct  360   STMPDQALQAFIDHGTVSRTIDSNASEAEGIYNALQKLGIDWSFVGSQLELEGVDSFKKS  419

Query  1423  FDSLLDSLQEKAN  1461
             FDSLLDSLQEKAN
Sbjct  420   FDSLLDSLQEKAN  432



>ref|XP_010530754.1| PREDICTED: uncharacterized protein LOC104807252 [Tarenaya hassleriana]
Length=441

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/434 (80%), Positives = 384/434 (88%), Gaps = 1/434 (0%)
 Frame = +1

Query  163   MATISKLSNPGf-assssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGS  339
             MATISKL+NP    +S    S  SS  P+ FV    +S F+ +L SS+L          S
Sbjct  1     MATISKLANPSCPVASVKPRSSSSSFLPRSFVGFNGRSDFNVKLLSSQLRLRYDQQSRAS  60

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             L++RCS  GGNGS  KRT+LHDLYEK+GQSPWYDNLCRPVTDL+PLI++GVRGVTSNPAI
Sbjct  61    LIVRCSASGGNGSATKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPLIDNGVRGVTSNPAI  120

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+SNAYNDQF+ELVQ+GKDIES YWELVVKDIQDACKLFEPIYDET+ GDGYVSV
Sbjct  121   FQKAISSSNAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFEPIYDETDGGDGYVSV  180

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLADDT+GT+EAAKWLHK V R NVYIKIPATA CIPSI++VIA+GISVNVTLIFS
Sbjct  181   EVSPRLADDTQGTVEAAKWLHKIVSRPNVYIKIPATASCIPSIRDVIASGISVNVTLIFS  240

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             I RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKA
Sbjct  241   IARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKA  300

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDT
Sbjct  301   AVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT  360

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AF+DHG V RTIDANVSEAEGIY+A++KLG+DW +VG QLE EGVDSFKK
Sbjct  361   VSTMPDQALEAFVDHGKVGRTIDANVSEAEGIYSALEKLGIDWNKVGDQLEDEGVDSFKK  420

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLL +LQ+KAN
Sbjct  421   SFDSLLGTLQDKAN  434



>ref|XP_010682632.1| PREDICTED: uncharacterized protein LOC104897452 [Beta vulgaris 
subsp. vulgaris]
Length=438

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/433 (78%), Positives = 382/433 (88%), Gaps = 2/433 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             M TISK+SNP   ++SS +        K       + S  +  +SS+L      + +   
Sbjct  1     MTTISKISNP--IAASSSSPSLDWTNTKSSFSQLTRRSLKSNFASSRLSLPTNRASSFPF  58

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             +++C+Q  GNG PIKRT+LHDLYEKQGQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIF
Sbjct  59    LVKCAQSSGNGIPIKRTTLHDLYEKQGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIF  118

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAIS+S+AYNDQF+EL+++GKDIES YWELV+KDIQDA KLFEPIYD+T+AGDGYVSVE
Sbjct  119   QKAISSSDAYNDQFRELIKSGKDIESAYWELVIKDIQDASKLFEPIYDQTDAGDGYVSVE  178

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLADDTEGTIEAAKWLHK V+R NVYIKIPATAPCIPSIKE IANGISVNVTLIFS+
Sbjct  179   VSPRLADDTEGTIEAAKWLHKVVNRPNVYIKIPATAPCIPSIKETIANGISVNVTLIFSL  238

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAV+DAYLDGLEASGL+DLS+VTSVASFFVSRVD+L+DKLLEKIG+PEALDLRGKAA
Sbjct  239   SRYEAVMDAYLDGLEASGLSDLSRVTSVASFFVSRVDSLIDKLLEKIGTPEALDLRGKAA  298

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQA LA+QLYQKKFSGPRWEALVKKGAKKQR+LWASTSVKNP+YPDTLYVDPLIGPD+V
Sbjct  299   VAQAILAYQLYQKKFSGPRWEALVKKGAKKQRVLWASTSVKNPSYPDTLYVDPLIGPDSV  358

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHG+V+RTIDAN SEAEGIY+A++KLG+DW QVG+QLE EGVDSFKKS
Sbjct  359   STMPDQALQAFIDHGTVSRTIDANFSEAEGIYSALEKLGIDWNQVGSQLEIEGVDSFKKS  418

Query  1423  FDSLLDSLQEKAN  1461
             FDSLLD+LQEKAN
Sbjct  419   FDSLLDTLQEKAN  431



>gb|KHN24954.1| Transaldolase [Glycine soja]
Length=439

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/433 (80%), Positives = 376/433 (87%), Gaps = 1/433 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             MA+I KLS P  A+S S   R        F    N  ++   LS+S L +     L  SL
Sbjct  1     MASIFKLSTPSPAASLSEALRPRDSRFLSFNPSSNAINYKINLSAS-LRSIHSLPLKTSL  59

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
              I+CS+  GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIF
Sbjct  60    RIKCSKTDGNGSPAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIF  119

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAIS+SNAYNDQF+ELVQAGKDIES YWELVVKDIQDACKLFEPIYD+T+ GDGYVSVE
Sbjct  120   QKAISSSNAYNDQFRELVQAGKDIESAYWELVVKDIQDACKLFEPIYDQTDGGDGYVSVE  179

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLADDTEGTIEAAKWLHK VDR NVYIKIPAT  C+PSIKEVIANGISVNVTLIFS+
Sbjct  180   VSPRLADDTEGTIEAAKWLHKVVDRPNVYIKIPATEACVPSIKEVIANGISVNVTLIFSL  239

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DK LEKIG+PEAL+LRGKAA
Sbjct  240   ARYEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKALEKIGTPEALNLRGKAA  299

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQAALA+QLYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPDTV
Sbjct  300   VAQAALAYQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTV  359

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHG+V+RTID+N SEAEGIYNA+ KLG+DW  VG+QLE EGVDSFKKS
Sbjct  360   STMPDQALQAFIDHGTVSRTIDSNASEAEGIYNALQKLGIDWSFVGSQLELEGVDSFKKS  419

Query  1423  FDSLLDSLQEKAN  1461
             FDSLLDSLQEKAN
Sbjct  420   FDSLLDSLQEKAN  432



>ref|XP_010066468.1| PREDICTED: uncharacterized protein LOC104453564 [Eucalyptus grandis]
 gb|KCW64351.1| hypothetical protein EUGRSUZ_G01978 [Eucalyptus grandis]
Length=442

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/379 (87%), Positives = 360/379 (95%), Gaps = 0/379 (0%)
 Frame = +1

Query  325   SLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVT  504
             S   SLV++CSQ G NG  +KRT+LHDLYE++GQSPWYDNLCRPVTDLIPLIESGVRGVT
Sbjct  57    SSRSSLVVKCSQNGANGGVVKRTTLHDLYEREGQSPWYDNLCRPVTDLIPLIESGVRGVT  116

Query  505   SNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGD  684
             SNPAIFQKAIS+SNAYNDQF+ELVQ+GKDIES YWELVVKDIQDACKLFE IYD+T+ GD
Sbjct  117   SNPAIFQKAISSSNAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFETIYDQTDGGD  176

Query  685   GYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNV  864
             GYVSVEVSPRLADDTEGT+EAAK+LHK V+RRNVYIKIPATAPC+PSIK+VI+NGISVNV
Sbjct  177   GYVSVEVSPRLADDTEGTVEAAKYLHKVVNRRNVYIKIPATAPCVPSIKQVISNGISVNV  236

Query  865   TLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALD  1044
             TLIFS+ RYEAVIDAYLDGLEASGL+DLSKVTSVASFFVSRVDTL+DK+LEKIG+PEALD
Sbjct  237   TLIFSVARYEAVIDAYLDGLEASGLDDLSKVTSVASFFVSRVDTLIDKMLEKIGTPEALD  296

Query  1045  lrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPL  1224
             LRGKAA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PL
Sbjct  297   LRGKAAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPL  356

Query  1225  IGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGV  1404
             IGPDTVSTMPDQAL AF+DHG V+RTID+NVSEAEGIY+A++KLG+DW  VGTQLE EGV
Sbjct  357   IGPDTVSTMPDQALQAFVDHGIVSRTIDSNVSEAEGIYSALEKLGIDWNHVGTQLEVEGV  416

Query  1405  DSFKKSFDSLLDSLQEKAN  1461
             DSFKKSFDSLLD+LQEKAN
Sbjct  417   DSFKKSFDSLLDTLQEKAN  435



>gb|ACK56136.1| transaldolase [Dimocarpus longan]
Length=440

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/433 (78%), Positives = 381/433 (88%), Gaps = 0/433 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             MAT+SKLSNP   + S  +   SS  P+ F+   +++    + +SS L      +L    
Sbjct  1     MATVSKLSNPTTPALSLQSRSSSSSLPRTFIGFNSRTGSAFKFASSHLFLRKNHALRHPF  60

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             V++CS  GGNG+  KRT+LHDLYE++GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIF
Sbjct  61    VVKCSAPGGNGNAAKRTTLHDLYEREGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIF  120

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAIS+SNAYNDQFKELVQ+GKDIE+ YWELV+KDIQ+ACKLFEPIYDET+ GDGYVSVE
Sbjct  121   QKAISSSNAYNDQFKELVQSGKDIEAAYWELVIKDIQNACKLFEPIYDETDGGDGYVSVE  180

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSP+LADDT GT+EAAKWLHK V++ NVYIKIPATAPC+PSIKEVIA GISVNVTLIFS+
Sbjct  181   VSPKLADDTNGTVEAAKWLHKVVNQPNVYIKIPATAPCVPSIKEVIAQGISVNVTLIFSL  240

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLD LEASGL+DLS+VTSVASFFVSRVDTLVDK+LEKIG+PEALDLRGKAA
Sbjct  241   ARYEAVIDAYLDDLEASGLSDLSRVTSVASFFVSRVDTLVDKMLEKIGTPEALDLRGKAA  300

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDTV
Sbjct  301   VAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDTV  360

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHG+V+RTID+NVS+AEGIY+A++KLG+DW  VG QLE EGVDSF KS
Sbjct  361   STMPDQALQAFIDHGTVSRTIDSNVSDAEGIYSALEKLGIDWSYVGNQLEVEGVDSFMKS  420

Query  1423  FDSLLDSLQEKAN  1461
             FDSLLD+LQEKAN
Sbjct  421   FDSLLDTLQEKAN  433



>ref|XP_011086894.1| PREDICTED: uncharacterized protein LOC105168489 [Sesamum indicum]
Length=443

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/436 (82%), Positives = 389/436 (89%), Gaps = 3/436 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapK--CFVDIRNK-SSFDARLSSSKLLAFAKPSLN  333
             MA+ISKLS P FA S S  S  S  +    C VD+  + ++    LSSSKL   +   + 
Sbjct  1     MASISKLSTPNFAPSVSDFSASSRSSQHAVCCVDLSKRPAASRNLLSSSKLSLRSNHPVR  60

Query  334   GSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNP  513
              SLV+RCS+  GNGS +KRT+LHDLYEK+GQSPWYDNLCRPVTDLIPLIESGVRGVTSNP
Sbjct  61    VSLVVRCSKVDGNGSSVKRTTLHDLYEKEGQSPWYDNLCRPVTDLIPLIESGVRGVTSNP  120

Query  514   AIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYV  693
             AIFQKAISTS+AYNDQF+ELVQ+GKDIES YWELVVKDIQDACKLFEPIYD+T+  DGYV
Sbjct  121   AIFQKAISTSSAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFEPIYDQTDGADGYV  180

Query  694   SVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLI  873
             SVEVSP+LADDTE TIEAAKWLH+ VDR NVYIKIPATAPCIPSIKEVIA GISVNVTLI
Sbjct  181   SVEVSPKLADDTENTIEAAKWLHQWVDRPNVYIKIPATAPCIPSIKEVIARGISVNVTLI  240

Query  874   FSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrg  1053
             FS+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTLVDKLLEKIG+PEALDLRG
Sbjct  241   FSLARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLVDKLLEKIGTPEALDLRG  300

Query  1054  kaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGP  1233
             KAANAQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGP
Sbjct  301   KAANAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGP  360

Query  1234  DTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSF  1413
             DTVSTMPDQAL AF+DHG VARTID+NVSEAEGIY+A++KLG+DW  VG+QLE EGV+SF
Sbjct  361   DTVSTMPDQALQAFVDHGKVARTIDSNVSEAEGIYSALEKLGIDWSYVGSQLELEGVESF  420

Query  1414  KKSFDSLLDSLQEKAN  1461
             KKSFDSLLDSLQEKAN
Sbjct  421   KKSFDSLLDSLQEKAN  436



>ref|XP_010250505.1| PREDICTED: uncharacterized protein LOC104592737 [Nelumbo nucifera]
Length=439

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/433 (79%), Positives = 383/433 (88%), Gaps = 1/433 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             MA+ISKL+NP   +SSS + R  S   +  V    +S  +   SSSKL           L
Sbjct  1     MASISKLANP-TFASSSSSPRFRSSESRPLVAFHARSLVNRGFSSSKLTIRRDHVERRPL  59

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             V+RCSQ  GNG+ IKRT+LHDLYE QGQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIF
Sbjct  60    VVRCSQIDGNGAQIKRTTLHDLYELQGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIF  119

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAISTSNAYN+QF+ELVQAGKDIES YWELVVKDIQDACKLFEPIYD+T+A DGYVSVE
Sbjct  120   QKAISTSNAYNEQFRELVQAGKDIESAYWELVVKDIQDACKLFEPIYDQTDAADGYVSVE  179

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSP+LADDT+GT+EAAKWLHK VDR NVYIKIPATA C+PS+KEVI+ GISVNVTLIFS+
Sbjct  180   VSPKLADDTKGTVEAAKWLHKVVDRPNVYIKIPATAECVPSVKEVISLGISVNVTLIFSL  239

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLE+SGL+DLS+VTSVASFFVSRVDTLVDKLLEKIG+PEAL+LRGKAA
Sbjct  240   SRYEAVIDAYLDGLESSGLSDLSRVTSVASFFVSRVDTLVDKLLEKIGTPEALNLRGKAA  299

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQA LA++LYQKKFSGPRWEALVKKGAKKQR+LWASTSVKNPAYPDTLYVDPLIGPDTV
Sbjct  300   VAQAVLAYKLYQKKFSGPRWEALVKKGAKKQRVLWASTSVKNPAYPDTLYVDPLIGPDTV  359

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHG+ +RTID+N+SEAEGIY+A++KLG+DW +VG+QLE EGV+SFKKS
Sbjct  360   STMPDQALQAFIDHGTASRTIDSNISEAEGIYSALEKLGIDWNEVGSQLELEGVESFKKS  419

Query  1423  FDSLLDSLQEKAN  1461
             FDSLL++LQEKAN
Sbjct  420   FDSLLNTLQEKAN  432



>gb|KHN12571.1| Transaldolase [Glycine soja]
Length=439

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/437 (79%), Positives = 374/437 (86%), Gaps = 9/437 (2%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCF----VDIRNKSSFDARLSSSKLLAFAKPSL  330
             MA++SKLS P   +S S   R        F    +   +K++  A L S   L      L
Sbjct  1     MASVSKLSTPNPVASLSEALRPRDSRFLTFKPSSIAFNHKTNLFASLRSIHSLP-----L  55

Query  331   NGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSN  510
               SL I+CSQ  GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSN
Sbjct  56    KTSLRIKCSQTDGNGSPAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSN  115

Query  511   PAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGY  690
             PAIFQKAIS+SNAYNDQF+ELVQ GKDIES YWELVVKDIQDAC+LFEPIYD+T+ GDGY
Sbjct  116   PAIFQKAISSSNAYNDQFRELVQTGKDIESAYWELVVKDIQDACRLFEPIYDQTDGGDGY  175

Query  691   VSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTL  870
             VSVEVSPRLADDTEGTIEAAKWLHK VDR NVYIKIPAT  C+PSIKEVIANGISVNVTL
Sbjct  176   VSVEVSPRLADDTEGTIEAAKWLHKVVDRPNVYIKIPATEACVPSIKEVIANGISVNVTL  235

Query  871   IFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlr  1050
             IFS+ RYEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DK LEKIG+P AL+LR
Sbjct  236   IFSLARYEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKALEKIGTPVALNLR  295

Query  1051  gkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIG  1230
             GKAA AQAALA+QLY++KFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIG
Sbjct  296   GKAAVAQAALAYQLYRRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIG  355

Query  1231  PDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDS  1410
             PDTVSTMPDQAL AFIDHG+V+RTID+N SEAEGIYNA+ KLG+DW  VG+QLE EGVDS
Sbjct  356   PDTVSTMPDQALQAFIDHGTVSRTIDSNASEAEGIYNALQKLGIDWSFVGSQLELEGVDS  415

Query  1411  FKKSFDSLLDSLQEKAN  1461
             FKKSFDSLLDSLQEKAN
Sbjct  416   FKKSFDSLLDSLQEKAN  432



>ref|XP_007139126.1| hypothetical protein PHAVU_008G003600g [Phaseolus vulgaris]
 gb|ESW11120.1| hypothetical protein PHAVU_008G003600g [Phaseolus vulgaris]
Length=443

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/375 (88%), Positives = 351/375 (94%), Gaps = 0/375 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL I+CSQ  GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPA
Sbjct  62    SLRIKCSQTDGNGSPAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPA  121

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAIS+S+AYNDQF+ELVQAGKDIES YWELVVKDIQDACKLFEPIYD+T+ GDGYVS
Sbjct  122   IFQKAISSSDAYNDQFRELVQAGKDIESAYWELVVKDIQDACKLFEPIYDQTDGGDGYVS  181

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDTEGTIEAAKWLHK VDR NVYIKIPAT PC+PSIKEVIANGISVNVTLIF
Sbjct  182   VEVSPRLADDTEGTIEAAKWLHKVVDRPNVYIKIPATEPCVPSIKEVIANGISVNVTLIF  241

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             S+ RYEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DK LEKIG+ EAL+LRGK
Sbjct  242   SLARYEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKTLEKIGTSEALNLRGK  301

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA+QLYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPD
Sbjct  302   AAVAQAALAYQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPD  361

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V RTID+N SEAEGIYNA+ KLG+DW  VG QLE EGVDSFK
Sbjct  362   TVSTMPDQALEAFIDHGTVHRTIDSNASEAEGIYNALQKLGIDWGFVGNQLEFEGVDSFK  421

Query  1417  KSFDSLLDSLQEKAN  1461
             KSFDSLLDSLQEKAN
Sbjct  422   KSFDSLLDSLQEKAN  436



>ref|XP_003552743.1| PREDICTED: uncharacterized protein LOC100816075 [Glycine max]
Length=439

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/437 (79%), Positives = 373/437 (85%), Gaps = 9/437 (2%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCF----VDIRNKSSFDARLSSSKLLAFAKPSL  330
             MA++SKLS P   +S S   R        F    +   +K++  A L S   L      L
Sbjct  1     MASVSKLSTPNPLASLSEALRPRDSRFLTFKPSSIAFNHKTNLSASLRSIHSLP-----L  55

Query  331   NGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSN  510
               SL I+CSQ  GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSN
Sbjct  56    KTSLRIKCSQTDGNGSPAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSN  115

Query  511   PAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGY  690
             PAIFQKAIS+SNAYNDQF+ELVQ GKDIES YWELVVKDIQDAC+LFEPIYD+T+ GDGY
Sbjct  116   PAIFQKAISSSNAYNDQFRELVQTGKDIESAYWELVVKDIQDACRLFEPIYDQTDGGDGY  175

Query  691   VSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTL  870
             VSVEVSPRLADDTEGTIEAAKWLHK VDR NVYIKIPAT  C+PSIKEVIANGISVNVTL
Sbjct  176   VSVEVSPRLADDTEGTIEAAKWLHKVVDRPNVYIKIPATEACVPSIKEVIANGISVNVTL  235

Query  871   IFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlr  1050
             IFS+ RYEAVIDAYLDGLEAS LNDLS+VTSVASFFVSRVDTL+DK LEKIG+P AL+LR
Sbjct  236   IFSLARYEAVIDAYLDGLEASELNDLSRVTSVASFFVSRVDTLIDKALEKIGTPVALNLR  295

Query  1051  gkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIG  1230
             GKAA AQAALA+QLYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIG
Sbjct  296   GKAAVAQAALAYQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIG  355

Query  1231  PDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDS  1410
             PDTVSTMPDQAL AFIDHG+V+RTID+N SEAEGIYNA+ KLG+DW  VG+QLE EGVDS
Sbjct  356   PDTVSTMPDQALQAFIDHGTVSRTIDSNASEAEGIYNALQKLGIDWSFVGSQLELEGVDS  415

Query  1411  FKKSFDSLLDSLQEKAN  1461
             FKKSFDSLLDSLQEKAN
Sbjct  416   FKKSFDSLLDSLQEKAN  432



>gb|AGV54320.1| transaldolase-like protein [Phaseolus vulgaris]
Length=443

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/375 (88%), Positives = 351/375 (94%), Gaps = 0/375 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL I+CSQ  GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPA
Sbjct  62    SLRIKCSQTDGNGSPAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPA  121

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAIS+S+AYNDQF+ELVQAGKDIES YWELVVKDIQDACKLFEPIYD+T+ GDGYVS
Sbjct  122   IFQKAISSSDAYNDQFRELVQAGKDIESAYWELVVKDIQDACKLFEPIYDQTDGGDGYVS  181

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDTEGTIEAAKWLHK VDR NVYIKIPAT PC+PSIKEVIA+GISVNVTLIF
Sbjct  182   VEVSPRLADDTEGTIEAAKWLHKVVDRPNVYIKIPATEPCVPSIKEVIADGISVNVTLIF  241

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             S+ RYEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DK LEKIG+ EAL+LRGK
Sbjct  242   SLARYEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKTLEKIGTSEALNLRGK  301

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA+QLYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPD
Sbjct  302   AAVAQAALAYQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPD  361

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V RTID+N SEAEGIYNA+ KLG+DW  VG QLE EGVDSFK
Sbjct  362   TVSTMPDQALEAFIDHGTVHRTIDSNASEAEGIYNALQKLGIDWGFVGNQLEFEGVDSFK  421

Query  1417  KSFDSLLDSLQEKAN  1461
             KSFDSLLDSLQEKAN
Sbjct  422   KSFDSLLDSLQEKAN  436



>ref|XP_010089867.1| hypothetical protein L484_001779 [Morus notabilis]
 gb|EXB38497.1| hypothetical protein L484_001779 [Morus notabilis]
Length=447

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/379 (87%), Positives = 356/379 (94%), Gaps = 1/379 (0%)
 Frame = +1

Query  325   SLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVT  504
             S+N SLV+RCS   GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVT
Sbjct  63    SVNASLVVRCS-SSGNGSPAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVT  121

Query  505   SNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGD  684
             SNPAIFQKAIS+SNAYNDQF+ELVQ+GK IE  YWELVVKDIQDACKLFEPIYDET A D
Sbjct  122   SNPAIFQKAISSSNAYNDQFRELVQSGKGIEDAYWELVVKDIQDACKLFEPIYDETNAAD  181

Query  685   GYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNV  864
             GYVSVEVSP LADDT+GT+EAAKWLHK VDR NVYIKIPATAPCIPSIK+VI+ GISVNV
Sbjct  182   GYVSVEVSPELADDTQGTVEAAKWLHKVVDRPNVYIKIPATAPCIPSIKQVISQGISVNV  241

Query  865   TLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALD  1044
             TLIFS+ RYEAVIDAYLDGLEASGLNDLS+VTSVASFFVSRVDTL+DKLLEKIG+PEALD
Sbjct  242   TLIFSLARYEAVIDAYLDGLEASGLNDLSRVTSVASFFVSRVDTLIDKLLEKIGTPEALD  301

Query  1045  lrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPL  1224
             LRGKAA AQAALA++LYQKKFSGPRW+ALVKKGAKKQR+LWASTSVKNPAYPDTLYV PL
Sbjct  302   LRGKAAVAQAALAYKLYQKKFSGPRWDALVKKGAKKQRVLWASTSVKNPAYPDTLYVAPL  361

Query  1225  IGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGV  1404
             IGPDTVSTMPDQAL AFIDHGSV+RTID+NVSEAEGIY+A++KLG+DW  VG+QLE EGV
Sbjct  362   IGPDTVSTMPDQALQAFIDHGSVSRTIDSNVSEAEGIYSALEKLGIDWSYVGSQLELEGV  421

Query  1405  DSFKKSFDSLLDSLQEKAN  1461
             D+FKKSFDSLLD+LQEKAN
Sbjct  422   DAFKKSFDSLLDTLQEKAN  440



>gb|ACU23896.1| unknown [Glycine max]
Length=439

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/437 (78%), Positives = 372/437 (85%), Gaps = 9/437 (2%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCF----VDIRNKSSFDARLSSSKLLAFAKPSL  330
             MA++SKLS P   +S S   R        F    +   +K++  A L S   L      L
Sbjct  1     MASVSKLSTPNPLASLSEALRPRDSRFLTFKPSSIAFNHKTNLSASLRSIHSLP-----L  55

Query  331   NGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSN  510
               SL I+CSQ  GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSN
Sbjct  56    KTSLRIKCSQTDGNGSPAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSN  115

Query  511   PAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGY  690
             PAIFQKAIS+SNAYNDQF+ELVQ GKDIES YWELVVKDIQDAC+LFEPIYD+T+ GDGY
Sbjct  116   PAIFQKAISSSNAYNDQFRELVQTGKDIESAYWELVVKDIQDACRLFEPIYDQTDGGDGY  175

Query  691   VSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTL  870
             VSVEVSPRLADDTEGTIEAAKWLHK VDR NVYIKIPAT  C+PSIKEVIANGISVNVTL
Sbjct  176   VSVEVSPRLADDTEGTIEAAKWLHKVVDRPNVYIKIPATEACVPSIKEVIANGISVNVTL  235

Query  871   IFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlr  1050
             IFS+ RYEAVIDAYLDGLEAS LNDLS+VTSVASFFVSRVDTL+DK LEKIG+P AL+LR
Sbjct  236   IFSLARYEAVIDAYLDGLEASELNDLSRVTSVASFFVSRVDTLIDKALEKIGTPVALNLR  295

Query  1051  gkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIG  1230
             GKAA AQAALA+QLYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIG
Sbjct  296   GKAAVAQAALAYQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIG  355

Query  1231  PDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDS  1410
             PDTVSTMPDQAL AFIDHG+V+RTID+N SEAEGIYNA+ KLG+DW  VG+QLE EGVDS
Sbjct  356   PDTVSTMPDQALQAFIDHGTVSRTIDSNASEAEGIYNALQKLGIDWSFVGSQLELEGVDS  415

Query  1411  FKKSFDSLLDSLQEKAN  1461
             FKKSFDSLLD LQEKAN
Sbjct  416   FKKSFDSLLDFLQEKAN  432



>ref|XP_006399833.1| hypothetical protein EUTSA_v10013572mg [Eutrema salsugineum]
 gb|ESQ41286.1| hypothetical protein EUTSA_v10013572mg [Eutrema salsugineum]
Length=439

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/435 (78%), Positives = 381/435 (88%), Gaps = 5/435 (1%)
 Frame = +1

Query  163   MATISKLSN--PGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNG  336
             MA+IS L+N  P     S  +S  SS  P+ FV++R   S +A+LSSS+L          
Sbjct  1     MASISNLANLTPATCVDSRSSSSSSSVLPRSFVNLR---SLNAKLSSSQLSLRYNQQSRP  57

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL +RCS  GGNGS  KRT+LHDLYEK+GQSPWYDNLCRPVTDL+P I  GVRGVTSNPA
Sbjct  58    SLFVRCSASGGNGSAAKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPA  117

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSN+YNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TE  DGYVS
Sbjct  118   IFQKAISTSNSYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEGADGYVS  177

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDT GT+EAAK+LHK V+RRNVYIKIPATAPCIPSI++VIA+GISVNVTLIF
Sbjct  178   VEVSPRLADDTNGTVEAAKFLHKVVNRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIF  237

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LE+IG+PEALDLRGK
Sbjct  238   SIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEQIGTPEALDLRGK  297

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPD
Sbjct  298   AAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPD  357

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AF+DHG V RTIDANVSEAEGIY+A++K+G+DW +VG QLE EGVDSFK
Sbjct  358   TVSTMPDQALEAFVDHGIVKRTIDANVSEAEGIYSALEKMGIDWNKVGEQLEEEGVDSFK  417

Query  1417  KSFDSLLDSLQEKAN  1461
             KSF+SLL +LQ+KAN
Sbjct  418   KSFESLLGTLQDKAN  432



>gb|KFK25575.1| hypothetical protein AALP_AA8G132700 [Arabis alpina]
Length=439

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/435 (78%), Positives = 382/435 (88%), Gaps = 5/435 (1%)
 Frame = +1

Query  163   MATISKLSN--PGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNG  336
             MATIS L+N     + +S  +S  SS  P+ FV++R   S +A+LSSS+L          
Sbjct  1     MATISNLANLTTATSINSRSSSYSSSVLPRSFVNLR---SLNAKLSSSQLSLRYNHQSRP  57

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL +RCS  GGNGS  KRT+LHDLYEK+GQSPWYDNLCRPVTDL+P I  GVRGVTSNPA
Sbjct  58    SLFVRCSVSGGNGSAAKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPA  117

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TE  DGYVS
Sbjct  118   IFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEGADGYVS  177

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDT+GT+EA+K+LHK V+RRNVYIKIPATAPCIPSI++VIA+GISVNVTLIF
Sbjct  178   VEVSPRLADDTQGTVEASKYLHKVVNRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIF  237

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LE+IG+PEAL+LRGK
Sbjct  238   SIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEQIGTPEALELRGK  297

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPD
Sbjct  298   AAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPD  357

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V RTIDANVSEAEGIY+A++KLG+DW +VG QLE EGVDSFK
Sbjct  358   TVSTMPDQALEAFIDHGTVKRTIDANVSEAEGIYSALEKLGIDWNKVGQQLEEEGVDSFK  417

Query  1417  KSFDSLLDSLQEKAN  1461
               F+SLL +LQ+KAN
Sbjct  418   NCFESLLGTLQDKAN  432



>ref|XP_009121766.1| PREDICTED: uncharacterized protein LOC103846575 [Brassica rapa]
Length=439

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/375 (86%), Positives = 352/375 (94%), Gaps = 0/375 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL +RCS  GGNGS  KRT+LHDLYEK+GQSPWYDNLCRPVTDL+P I  GVRGVTSNPA
Sbjct  58    SLFVRCSASGGNGSAAKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPA  117

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TEA DGYVS
Sbjct  118   IFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGYVS  177

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDT GT+EAAK+LHK VDRRNVYIKIPATAPCIPSI++VIA+GISVNVTLIF
Sbjct  178   VEVSPRLADDTNGTVEAAKYLHKVVDRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIF  237

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGK
Sbjct  238   SIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGK  297

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPD
Sbjct  298   AAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPD  357

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V RTIDANVSEAEGIY+A++KLG+DW +VG QLE EGVDSFK
Sbjct  358   TVSTMPDQALEAFIDHGTVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEEEGVDSFK  417

Query  1417  KSFDSLLDSLQEKAN  1461
             KSF+SLL +LQEKAN
Sbjct  418   KSFESLLGTLQEKAN  432



>emb|CDX69643.1| BnaA10g19920D [Brassica napus]
Length=440

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/436 (78%), Positives = 381/436 (87%), Gaps = 8/436 (2%)
 Frame = +1

Query  163   MATISKLSN--PGfassssftsrrsspapKCFVDIR--NKSSFDARLSSSKLLAFAKPSL  330
             MA+IS L+N  P  +++S  +S  S   P+ FV++R  N     +   S +    ++PSL
Sbjct  1     MASISNLANLTPATSTNSRSSSSSSVLVPRSFVNLRSLNAKLSSSSHLSLRHNQTSRPSL  60

Query  331   NGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSN  510
                  +RCS  GGNGS  KRT+LHDLYEK+GQSPWYDNLCRPVTDL+P I  GVRGVTSN
Sbjct  61    ----FVRCSASGGNGSAAKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSN  116

Query  511   PAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGY  690
             PAIFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TEA DGY
Sbjct  117   PAIFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGY  176

Query  691   VSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTL  870
             VSVEVSPRLADDT GT+EAAK+LHK VDRRNVYIKIPATAPCIPSI++VIA+GISVNVTL
Sbjct  177   VSVEVSPRLADDTNGTVEAAKYLHKVVDRRNVYIKIPATAPCIPSIRDVIASGISVNVTL  236

Query  871   IFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlr  1050
             IFSI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLR
Sbjct  237   IFSIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLR  296

Query  1051  gkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIG  1230
             GKAA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIG
Sbjct  297   GKAAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIG  356

Query  1231  PDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDS  1410
             PDTVSTMPDQAL AFIDHG+V RTIDANVSEAEGIY+A++KLG+DW +VG QLE EGVDS
Sbjct  357   PDTVSTMPDQALEAFIDHGTVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEEEGVDS  416

Query  1411  FKKSFDSLLDSLQEKA  1458
             FKKSF+SLL +LQEKA
Sbjct  417   FKKSFESLLGTLQEKA  432



>emb|CDY16492.1| BnaA08g02750D [Brassica napus]
Length=440

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/436 (78%), Positives = 381/436 (87%), Gaps = 8/436 (2%)
 Frame = +1

Query  163   MATISKLSN--PGfassssftsrrsspapKCFVDIR--NKSSFDARLSSSKLLAFAKPSL  330
             MA+IS L+N  P  +++S  +S  S   P+ FV++R  N     +   S +    ++PSL
Sbjct  1     MASISNLANLTPATSTNSRSSSSSSVLVPRSFVNLRSLNAKLSSSSHLSLRHHQTSRPSL  60

Query  331   NGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSN  510
                  +RCS  GGNGS  KRT+LHDLYEK+GQSPWYDNLCRPVTDL+P I  GVRGVTSN
Sbjct  61    ----FVRCSASGGNGSAAKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSN  116

Query  511   PAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGY  690
             PAIFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TEA DGY
Sbjct  117   PAIFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGY  176

Query  691   VSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTL  870
             VSVEVSPRLADDT GT+EAAK+LHK VDRRNVYIKIPATAPCIPSI++VIA+GISVNVTL
Sbjct  177   VSVEVSPRLADDTNGTVEAAKYLHKVVDRRNVYIKIPATAPCIPSIRDVIASGISVNVTL  236

Query  871   IFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlr  1050
             IFSI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLR
Sbjct  237   IFSIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLR  296

Query  1051  gkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIG  1230
             GKAA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIG
Sbjct  297   GKAAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIG  356

Query  1231  PDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDS  1410
             PDTVSTMPDQAL AFIDHG+V RTIDANVSEAEGIY+A++KLG+DW +VG QLE EGVDS
Sbjct  357   PDTVSTMPDQALEAFIDHGTVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEEEGVDS  416

Query  1411  FKKSFDSLLDSLQEKA  1458
             FKKSF+SLL +LQEKA
Sbjct  417   FKKSFESLLGTLQEKA  432



>emb|CDY09794.1| BnaC09g43670D [Brassica napus]
Length=439

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/375 (86%), Positives = 352/375 (94%), Gaps = 0/375 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL +RCS  GGNGS  KRT+LHDLY+K+GQSPWYDNLCRPVTDL+P I  GVRGVTSNPA
Sbjct  58    SLFVRCSASGGNGSAAKRTTLHDLYDKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPA  117

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TEA DGYVS
Sbjct  118   IFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGYVS  177

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDT GT+EAAK+LHK VDRRNVYIKIPATAPCIPSI++VIA+GISVNVTLIF
Sbjct  178   VEVSPRLADDTNGTVEAAKYLHKVVDRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIF  237

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGK
Sbjct  238   SIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGK  297

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPD
Sbjct  298   AAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPD  357

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V RTIDANVSEAEGIY+A++KLG+DW +VG QLE EGVDSFK
Sbjct  358   TVSTMPDQALEAFIDHGTVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEEEGVDSFK  417

Query  1417  KSFDSLLDSLQEKAN  1461
             KSF+SLL +LQ+KAN
Sbjct  418   KSFESLLGTLQDKAN  432



>ref|NP_196846.1| Aldolase-type TIM barrel family protein [Arabidopsis thaliana]
 emb|CAB87149.1| transaldolase-like protein [Arabidopsis thaliana]
 gb|AAL07145.1| putative transaldolase [Arabidopsis thaliana]
 gb|AAM45123.1| putative transaldolase [Arabidopsis thaliana]
 gb|AAM64693.1| transaldolase-like protein [Arabidopsis thaliana]
 gb|AED91892.1| Aldolase-type TIM barrel family protein [Arabidopsis thaliana]
Length=438

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/435 (78%), Positives = 384/435 (88%), Gaps = 6/435 (1%)
 Frame = +1

Query  163   MATISKLSN-PGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKL-LAFAKPSLNG  336
             MATIS L+N P      S +S  SS  P+ FV+ R   + +A+LSSS+L L + + S+  
Sbjct  1     MATISNLANLPRATCVDSKSSSSSSVLPRSFVNFR---ALNAKLSSSQLSLRYNQRSIP-  56

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL +RCS  GGNG+  KRT+LHDLYEK+GQSPWYDNLCRPVTDL+PLI  GVRGVTSNPA
Sbjct  57    SLSVRCSVSGGNGTAGKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPLIARGVRGVTSNPA  116

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TE  DGYVS
Sbjct  117   IFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEGADGYVS  176

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLADDT+GT+EAAK+L K V+RRNVYIKIPATAPCIPSI++VIA GISVNVTLIF
Sbjct  177   VEVSPRLADDTQGTVEAAKYLSKVVNRRNVYIKIPATAPCIPSIRDVIAAGISVNVTLIF  236

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LE+IG+PEALDLRGK
Sbjct  237   SIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEQIGTPEALDLRGK  296

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA++LYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPD
Sbjct  297   AAVAQAALAYKLYQQKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPD  356

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AF DHG V RTIDANVSEAEGIY+A++KLG+DW +VG QLE EGVDSFK
Sbjct  357   TVSTMPDQALEAFADHGIVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEDEGVDSFK  416

Query  1417  KSFDSLLDSLQEKAN  1461
             KSF+SLL +LQ+KAN
Sbjct  417   KSFESLLGTLQDKAN  431



>ref|XP_002873611.1| hypothetical protein ARALYDRAFT_488161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49870.1| hypothetical protein ARALYDRAFT_488161 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/433 (77%), Positives = 378/433 (87%), Gaps = 4/433 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             MATIS L+N    ++   +   SS  P+ FV+ R     +A+LSSS+L          +L
Sbjct  1     MATISNLANL-PRATCVDSKSSSSVLPRSFVNFRG---LNAKLSSSQLSLRCNQRSRSTL  56

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
              +RCS  GGNG+  KRT+LHDLYEK+GQSPWYDNLCRPVTDL+PLI  GVRGVTSNPAIF
Sbjct  57    SVRCSVSGGNGTAGKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPLIARGVRGVTSNPAIF  116

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TE  DGYVSVE
Sbjct  117   QKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEGADGYVSVE  176

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLADDT+GT+EAAK+L K V+RRNVYIKIPATAPCIPSI++VIA+GISVNVTLIFSI
Sbjct  177   VSPRLADDTQGTVEAAKYLSKVVNRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIFSI  236

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LE+IG+PEALDLRGKAA
Sbjct  237   ARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEQIGTPEALDLRGKAA  296

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQAALA++LYQ+KFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPDTV
Sbjct  297   VAQAALAYKLYQQKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDTV  356

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AF DHG V RTIDANVSEAEGIY+A++KLG+DW +VG QLE EGVDSFKKS
Sbjct  357   STMPDQALEAFADHGIVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEDEGVDSFKKS  416

Query  1423  FDSLLDSLQEKAN  1461
             F+SLL +LQ+KAN
Sbjct  417   FESLLGTLQDKAN  429



>emb|CDX70501.1| BnaC03g05850D [Brassica napus]
Length=437

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/400 (82%), Positives = 360/400 (90%), Gaps = 1/400 (0%)
 Frame = +1

Query  265   NKSSFDARLSSSKLLAFA-KPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYD  441
             N  SF+A+LSS+  L+    P    SL +RCS  GGNGS  KRT+LHDLYEK+GQSPWYD
Sbjct  31    NLRSFNAKLSSASHLSLRYNPQYRPSLFVRCSASGGNGSTAKRTTLHDLYEKEGQSPWYD  90

Query  442   NLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVV  621
             NLCRPVTDLIP I  GVRGVTSNPAIFQKAISTS+AYNDQF+ LV++G  I+  YWELVV
Sbjct  91    NLCRPVTDLIPFIARGVRGVTSNPAIFQKAISTSDAYNDQFRTLVESGSAIKKAYWELVV  150

Query  622   KDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIP  801
             KDIQDACKLFEPIYD+TEA DGYVSVEVSP LADDT+ TI+AAK LHK V+RRNVYIKIP
Sbjct  151   KDIQDACKLFEPIYDQTEAEDGYVSVEVSPLLADDTKTTIKAAKLLHKSVNRRNVYIKIP  210

Query  802   ATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFV  981
             ATAPCIPSI++VIA+GISVNVTLIFSI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFV
Sbjct  211   ATAPCIPSIRDVIASGISVNVTLIFSIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFV  270

Query  982   SRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRL  1161
             SRVDTL+DK+LEKIG+PEALDLRGKAA AQAALA+QLYQKKFSGPRWEALVKKGAKKQRL
Sbjct  271   SRVDTLMDKMLEKIGTPEALDLRGKAAVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRL  330

Query  1162  LWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYN  1341
             LWASTSVKNPAY DTLYV PLIGPDTVSTMPDQAL AFIDHG+V RTIDANVSEAEG+Y+
Sbjct  331   LWASTSVKNPAYSDTLYVAPLIGPDTVSTMPDQALEAFIDHGTVKRTIDANVSEAEGVYS  390

Query  1342  AIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             AI+KLG+DW +VG QLE EGVDSFKKSF+SLL +LQ+KAN
Sbjct  391   AIEKLGIDWNKVGEQLEEEGVDSFKKSFESLLATLQDKAN  430



>ref|XP_008778133.1| PREDICTED: uncharacterized protein LOC103697961 [Phoenix dactylifera]
Length=439

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/433 (76%), Positives = 379/433 (88%), Gaps = 1/433 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             MA+ISKLSNP  A+SS  +S      PK  +  R       R+S  +L +     +  S 
Sbjct  1     MASISKLSNPPLAASSPRSSSALRSEPKLSLSFRTGVPIQRRVSPLRL-SIRTDRVERSF  59

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             ++RCSQ   NG+P K T+LHDLYE+QGQSPWYDNLCRPVTDL+PLI SGVRGVTSNP IF
Sbjct  60    LVRCSQQDRNGAPAKSTTLHDLYEQQGQSPWYDNLCRPVTDLLPLITSGVRGVTSNPTIF  119

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAIS+S+AY++QF++LV AGKDIES+YW LV+KDIQDACKLFEPIYD+T+ GDGYVSVE
Sbjct  120   QKAISSSSAYDEQFRQLVSAGKDIESVYWALVIKDIQDACKLFEPIYDQTDGGDGYVSVE  179

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLA+DT GTIEAAKWLHK V+R NVYIKIPATA C+PSIKEVI+NGISVNVTLIFS+
Sbjct  180   VSPRLANDTSGTIEAAKWLHKVVNRPNVYIKIPATAECVPSIKEVISNGISVNVTLIFSL  239

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLE+SGL+DLS++TSVASFFVSRVDTL+DK+LEKIG+PEAL+LRGKAA
Sbjct  240   PRYEAVIDAYLDGLESSGLDDLSRITSVASFFVSRVDTLIDKMLEKIGTPEALELRGKAA  299

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV
Sbjct  300   VAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  359

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHG+V+RTID+N+SEAEG+Y+A+ KLG+DW +VG+QLE EGVDSFKKS
Sbjct  360   STMPDQALQAFIDHGTVSRTIDSNLSEAEGVYSALQKLGIDWNKVGSQLEVEGVDSFKKS  419

Query  1423  FDSLLDSLQEKAN  1461
             FDSLL SLQEK +
Sbjct  420   FDSLLVSLQEKGD  432



>emb|CDX78519.1| BnaA03g04310D [Brassica napus]
Length=436

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/434 (78%), Positives = 379/434 (87%), Gaps = 6/434 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFA-KPSLNGS  339
             MA+IS L+N     ++S   R SS  P+ FV+IR   SF+A+LSS+  L+         S
Sbjct  1     MASISNLTN--LTPATSTCPRSSSVIPRSFVNIR---SFNAKLSSASHLSIRYNKQTRPS  55

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             L +RCS  GGNGS  KRT+LHDLYEK+GQSPWYDNLCRPVTDLIP I  GVRGVTSNPAI
Sbjct  56    LFVRCSASGGNGSTAKRTTLHDLYEKEGQSPWYDNLCRPVTDLIPFIARGVRGVTSNPAI  115

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAISTS+AYNDQF+ LV++G  I+  YWELVVKDIQDACKLFEPIYD+T+A DGYVSV
Sbjct  116   FQKAISTSDAYNDQFRTLVESGTAIKKAYWELVVKDIQDACKLFEPIYDQTDAEDGYVSV  175

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSP LADDT+ T++AAK LHK V+RRNVYIKIPATAPCIPSI++VIA+GISVNVTLIFS
Sbjct  176   EVSPLLADDTKTTVKAAKLLHKSVNRRNVYIKIPATAPCIPSIRDVIASGISVNVTLIFS  235

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             I RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKA
Sbjct  236   IARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGKA  295

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPDT
Sbjct  296   AVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPDT  355

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AFIDHG+V RTIDANVSEAEGIY+A++KLG+DW +VG QLE EGVDSFKK
Sbjct  356   VSTMPDQALEAFIDHGTVKRTIDANVSEAEGIYSALEKLGIDWNKVGEQLEEEGVDSFKK  415

Query  1420  SFDSLLDSLQEKAN  1461
             SF+SLL +LQ+KAN
Sbjct  416   SFESLLGTLQDKAN  429



>ref|XP_006287760.1| hypothetical protein CARUB_v10000972mg [Capsella rubella]
 gb|EOA20658.1| hypothetical protein CARUB_v10000972mg [Capsella rubella]
Length=441

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/396 (82%), Positives = 358/396 (90%), Gaps = 0/396 (0%)
 Frame = +1

Query  274   SFDARLSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCR  453
             + +A+LSSS L          SL ++CS  GGNG+  KRT+LHDLYEK+GQSPWYDNLCR
Sbjct  39    TLNAKLSSSHLSLRYNQQSRPSLFVKCSVSGGNGTAGKRTTLHDLYEKEGQSPWYDNLCR  98

Query  454   PVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQ  633
             PVTDL+PLI  GVRGVTSNPAIFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQ
Sbjct  99    PVTDLLPLIARGVRGVTSNPAIFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQ  158

Query  634   DACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAP  813
             DACKLFE IYD+T+  DGYVSVEVSPRLADDT+GT+EAAK+L K VDRRNVYIKIPATAP
Sbjct  159   DACKLFESIYDQTDGADGYVSVEVSPRLADDTQGTVEAAKYLQKVVDRRNVYIKIPATAP  218

Query  814   CIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVD  993
             CIPSI++VIA+GISVNVTLIFSI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVD
Sbjct  219   CIPSIRDVIASGISVNVTLIFSIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVD  278

Query  994   TLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWAS  1173
             TL+DK+LE+IG+PEALDLRGKAA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWAS
Sbjct  279   TLMDKMLEQIGTPEALDLRGKAAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWAS  338

Query  1174  TSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDK  1353
             TSVKNPAY DTLYV PLIGPDTVSTMPDQAL AF DHG V RTIDANVSEAEGIY+A++K
Sbjct  339   TSVKNPAYSDTLYVAPLIGPDTVSTMPDQALEAFADHGIVKRTIDANVSEAEGIYSALEK  398

Query  1354  LGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             LG+DW +VG QLE EGVDSFKKSF+SLL +LQEKAN
Sbjct  399   LGIDWNKVGDQLEDEGVDSFKKSFESLLGTLQEKAN  434



>ref|XP_010492092.1| PREDICTED: uncharacterized protein LOC104769560 [Camelina sativa]
Length=438

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/396 (82%), Positives = 356/396 (90%), Gaps = 0/396 (0%)
 Frame = +1

Query  274   SFDARLSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCR  453
             + +A+LSSS L          SL +RCS  GGNG+  KRT LHDLYEK+GQSPWYDNLCR
Sbjct  36    TLNAKLSSSHLSLRYNQQSTPSLFVRCSVSGGNGTAGKRTPLHDLYEKEGQSPWYDNLCR  95

Query  454   PVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQ  633
             PVTDL+PLI  GVRGVTSNPAIFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQ
Sbjct  96    PVTDLLPLIARGVRGVTSNPAIFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQ  155

Query  634   DACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAP  813
             DACKLFE IYDET+  DGYVSVEVSPRLADDT+GT+EAAK+L K VDRRNVYIKIPATAP
Sbjct  156   DACKLFESIYDETDGADGYVSVEVSPRLADDTQGTVEAAKYLQKVVDRRNVYIKIPATAP  215

Query  814   CIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVD  993
             CIPSI++VIA GISVNVTLIFSI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVD
Sbjct  216   CIPSIRDVIAAGISVNVTLIFSIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVD  275

Query  994   TLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWAS  1173
             TL+DK+LE+IG+PEALDLRGKAA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWAS
Sbjct  276   TLMDKMLEQIGTPEALDLRGKAAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWAS  335

Query  1174  TSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDK  1353
             TSVKNPAY DTLYV PLIGPDTVSTMPDQAL AF DHG V RTIDANVSEAEG+Y+A++K
Sbjct  336   TSVKNPAYSDTLYVAPLIGPDTVSTMPDQALEAFADHGIVKRTIDANVSEAEGVYSALEK  395

Query  1354  LGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             LG+DW +VG QLE EGVDSFKKSF+SLL +LQEKAN
Sbjct  396   LGIDWNKVGEQLEDEGVDSFKKSFESLLGTLQEKAN  431



>ref|XP_010419919.1| PREDICTED: uncharacterized protein LOC104705593 [Camelina sativa]
Length=438

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/396 (82%), Positives = 356/396 (90%), Gaps = 0/396 (0%)
 Frame = +1

Query  274   SFDARLSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCR  453
             + +A+LSSS L          SL +RCS  GGNG+  KRT LHDLYEK+GQSPWYDNLCR
Sbjct  36    TLNAKLSSSHLSLRYNQQSRPSLFVRCSVSGGNGTAGKRTPLHDLYEKEGQSPWYDNLCR  95

Query  454   PVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQ  633
             PVTDL+PLI  GVRGVTSNPAIFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQ
Sbjct  96    PVTDLLPLIARGVRGVTSNPAIFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQ  155

Query  634   DACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAP  813
             DACKLFE IYDET+  DGYVSVEVSPRLADDT+GT+EAAK+L K VDRRNVYIKIPATAP
Sbjct  156   DACKLFESIYDETDGADGYVSVEVSPRLADDTQGTVEAAKYLQKVVDRRNVYIKIPATAP  215

Query  814   CIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVD  993
             CIPSI++VIA GISVNVTLIFSI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVD
Sbjct  216   CIPSIRDVIAAGISVNVTLIFSIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVD  275

Query  994   TLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWAS  1173
             TL+DK+LE+IG+PEALDLRGKAA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWAS
Sbjct  276   TLMDKMLEQIGTPEALDLRGKAAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWAS  335

Query  1174  TSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDK  1353
             TSVKNPAY DTLYV PLIGPDTVSTMPDQAL AF DHG V RTIDANVSEAEG+Y+A++K
Sbjct  336   TSVKNPAYSDTLYVAPLIGPDTVSTMPDQALEAFADHGIVKRTIDANVSEAEGVYSALEK  395

Query  1354  LGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             LG+DW +VG QLE EGVDSFKKSF+SLL +LQEKAN
Sbjct  396   LGIDWNKVGEQLEDEGVDSFKKSFESLLGTLQEKAN  431



>gb|EYU28482.1| hypothetical protein MIMGU_mgv1a006041mg [Erythranthe guttata]
Length=460

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/453 (75%), Positives = 384/453 (85%), Gaps = 20/453 (4%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapK--CFVDIRNKSS-FDARLSSSKLLAFAKPSLN  333
             M++ISKLS  GFA+S++ +   +  + +  C VD+R +++ F   +SSSKL       + 
Sbjct  1     MSSISKLSASGFANSATNSRPTTRSSQQPMCCVDLRKRTAGFGNPISSSKLTVGTNHPIK  60

Query  334   GSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNP  513
              SLV+RCS+  GNGS +K+T+LHDLYEK+GQSPWYDNLCRPVTDLIPLIESGVRGVTSNP
Sbjct  61    ASLVVRCSKNDGNGSTVKKTTLHDLYEKEGQSPWYDNLCRPVTDLIPLIESGVRGVTSNP  120

Query  514   A-------------IFQKAISTSNA----YNDQFKELVQAGKDIESLYWELVVKDIQDAC  642
             A             + ++ +   N      N  FKELVQ+GKDIES YWELVVKDIQDAC
Sbjct  121   ARKMLHVPTFCWLSLIEQFLFCMNTNIPESNINFKELVQSGKDIESAYWELVVKDIQDAC  180

Query  643   KLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIP  822
             KLFE IYDET+  DGYVSVEVSPRLADDTE TIEAAKWLHK V+R NVYIKIPATAPCIP
Sbjct  181   KLFEAIYDETDGADGYVSVEVSPRLADDTENTIEAAKWLHKWVNRSNVYIKIPATAPCIP  240

Query  823   SIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLV  1002
             SIKEVIA GISVNVTLIFS+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVD+LV
Sbjct  241   SIKEVIALGISVNVTLIFSLARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDSLV  300

Query  1003  DKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSV  1182
             DK+LEKIG+PEALDLRGKAANAQA LA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSV
Sbjct  301   DKMLEKIGTPEALDLRGKAANAQAGLAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSV  360

Query  1183  KNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGV  1362
             KNPAYPDTLYV PLIGPDTVSTMPDQALLAF+DHGSVARTID+NVSEAEGIY+A++KLG+
Sbjct  361   KNPAYPDTLYVAPLIGPDTVSTMPDQALLAFLDHGSVARTIDSNVSEAEGIYSALEKLGI  420

Query  1363  DWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             DW  VG+QLE EGVDSFKKSFDSLLDSLQEKAN
Sbjct  421   DWGYVGSQLELEGVDSFKKSFDSLLDSLQEKAN  453



>emb|CDX91124.1| BnaC02g04730D [Brassica napus]
Length=440

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/375 (84%), Positives = 351/375 (94%), Gaps = 0/375 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL +RCS  GGNGS  +RT+LHDLYEK+GQSPWYDNLCRPVTDL+P I  GVRGVTSNPA
Sbjct  59    SLFVRCSASGGNGSTAERTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPA  118

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TEA DGYVS
Sbjct  119   IFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGYVS  178

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSP LADDT+GT+EAAK+LHK V+RRNVYIKIPATAPC+PSI++VIA+GISVNVTLIF
Sbjct  179   VEVSPMLADDTKGTVEAAKYLHKVVNRRNVYIKIPATAPCVPSIRDVIASGISVNVTLIF  238

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGK
Sbjct  239   SIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGK  298

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PLIGPD
Sbjct  299   AAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPLIGPD  358

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V RTID NVSEAEG+Y+A++KLG++W +VG QLE EGVDSFK
Sbjct  359   TVSTMPDQALEAFIDHGTVKRTIDENVSEAEGVYSALEKLGIEWNKVGEQLEEEGVDSFK  418

Query  1417  KSFDSLLDSLQEKAN  1461
             KSF+SLL +LQ+KAN
Sbjct  419   KSFESLLGTLQDKAN  433



>ref|XP_009125910.1| PREDICTED: uncharacterized protein LOC103850867 [Brassica rapa]
Length=440

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/375 (84%), Positives = 349/375 (93%), Gaps = 0/375 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL +RCS  GGNGS  KRT+LHDLYEK+GQSPWYDNLCRPVTDL+P I  GVRGVTSNPA
Sbjct  59    SLFVRCSASGGNGSTTKRTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPA  118

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQDACKLFEPIYD+TEA DGYVS
Sbjct  119   IFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGYVS  178

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSP LA DT GT+EAAK+LHK V+RRNVYIKIPATAPC+PSI++VIA+GISVNVTLIF
Sbjct  179   VEVSPMLAADTNGTVEAAKYLHKVVNRRNVYIKIPATAPCVPSIRDVIASGISVNVTLIF  238

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGK
Sbjct  239   SIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGK  298

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA++LYQKKFSGPRWEALVKKGAK+QRLLWASTSVKNPAY DTLYV PLIGPD
Sbjct  299   AAVAQAALAYKLYQKKFSGPRWEALVKKGAKRQRLLWASTSVKNPAYSDTLYVAPLIGPD  358

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V RTID NVSEAEGIY+A++KLG++W +VG QLE EGVDSFK
Sbjct  359   TVSTMPDQALEAFIDHGTVKRTIDENVSEAEGIYSALEKLGIEWTKVGEQLEEEGVDSFK  418

Query  1417  KSFDSLLDSLQEKAN  1461
             KSF+SLL +LQ+KAN
Sbjct  419   KSFESLLGTLQDKAN  433



>ref|XP_010453414.1| PREDICTED: uncharacterized protein LOC104735344 [Camelina sativa]
Length=438

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/396 (81%), Positives = 356/396 (90%), Gaps = 0/396 (0%)
 Frame = +1

Query  274   SFDARLSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCR  453
             + +A+LSSS L          SL +RCS  GGNG+  KRT LHDLYEK+GQSPWYDNLCR
Sbjct  36    TLNAKLSSSHLSLRYNQQSRPSLFVRCSVSGGNGTAGKRTPLHDLYEKEGQSPWYDNLCR  95

Query  454   PVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQ  633
             PVTDL+PLI  GVRGVTSNPAIFQKAISTSNAYNDQF+ LV++GKDIES YWELVVKDIQ
Sbjct  96    PVTDLLPLIARGVRGVTSNPAIFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQ  155

Query  634   DACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAP  813
             DACKLFE IYD+T+  DGYVSVEVSPRLADDT+GT+EAAK+L K VDRRNVYIKIPATAP
Sbjct  156   DACKLFESIYDQTDGADGYVSVEVSPRLADDTQGTVEAAKYLQKVVDRRNVYIKIPATAP  215

Query  814   CIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVD  993
             CIPSI++VIA GISVNVTL+FSI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVD
Sbjct  216   CIPSIRDVIAAGISVNVTLVFSIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVD  275

Query  994   TLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWAS  1173
             TL+DK+LE+IG+PEALDLRGKAA AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWAS
Sbjct  276   TLMDKMLEQIGTPEALDLRGKAAVAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWAS  335

Query  1174  TSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDK  1353
             TSVKNPAY DTLYV PLIGPDTVSTMPDQAL AF DHG V RTIDANVSEAEG+Y+A++K
Sbjct  336   TSVKNPAYSDTLYVAPLIGPDTVSTMPDQALEAFADHGIVKRTIDANVSEAEGVYSALEK  395

Query  1354  LGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             LG+DW +VG QLE EGVDSFKKSF+SLL +LQEKAN
Sbjct  396   LGIDWNKVGEQLEDEGVDSFKKSFESLLGTLQEKAN  431



>ref|NP_001045261.1| Os01g0926300 [Oryza sativa Japonica Group]
 dbj|BAD88191.1| putative transaldolase [Oryza sativa Japonica Group]
 dbj|BAF07175.1| Os01g0926300 [Oryza sativa Japonica Group]
 dbj|BAG93104.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97373.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72076.1| hypothetical protein OsI_05010 [Oryza sativa Indica Group]
 gb|EEE55929.1| hypothetical protein OsJ_04614 [Oryza sativa Japonica Group]
Length=432

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/374 (84%), Positives = 347/374 (93%), Gaps = 0/374 (0%)
 Frame = +1

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             ++   S   GNG+P KRT+LHDLY+ QGQSPWYDNLCRPVTDL+PLI SGVRGVTSNP+I
Sbjct  51    IIAMASAKEGNGAPTKRTTLHDLYDLQGQSPWYDNLCRPVTDLLPLIGSGVRGVTSNPSI  110

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAISTSNAY+DQFK+L+ AGKD ES YWELV+KDIQDACKLFEPIYD+T+  DGYVSV
Sbjct  111   FQKAISTSNAYDDQFKQLILAGKDAESAYWELVIKDIQDACKLFEPIYDQTDGADGYVSV  170

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLA+DT+GT+EAAKWLHK VDR NVYIKIPATA C+PSIKEVIANGISVNVTLIFS
Sbjct  171   EVSPRLANDTQGTVEAAKWLHKVVDRPNVYIKIPATAECVPSIKEVIANGISVNVTLIFS  230

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             I RYEAVIDAY+DGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEAL LRGKA
Sbjct  231   IARYEAVIDAYIDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALALRGKA  290

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA LA QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT
Sbjct  291   AVAQAKLANQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  350

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQALLAFIDHG+V+RTIDANVS+AEG+Y+A++KLG+DW +VG QLE EGVDSFKK
Sbjct  351   VSTMPDQALLAFIDHGTVSRTIDANVSDAEGVYSALEKLGIDWDEVGKQLELEGVDSFKK  410

Query  1420  SFDSLLDSLQEKAN  1461
             +FDSLL SL+EK N
Sbjct  411   AFDSLLGSLEEKGN  424



>ref|XP_010942358.1| PREDICTED: uncharacterized protein LOC105060382 [Elaeis guineensis]
Length=441

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/434 (75%), Positives = 378/434 (87%), Gaps = 1/434 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspap-KCFVDIRNKSSFDARLSSSKLLAFAKPSLNGS  339
             MA+ISKL+NP FA+S +  S  +     K  V+  + S     +S  +L          S
Sbjct  1     MASISKLANPSFAASGAPHSSPTLLCDPKLSVNFHSGSPVRRGISPPRLTIRRDRLERSS  60

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             LV+RCS+  GNG+P KRT+LHDLYEKQGQSPWYDNLCRPVTDL+PLI SGVRGVTSNP I
Sbjct  61    LVVRCSKQDGNGAPNKRTTLHDLYEKQGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPTI  120

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+S+AY++QF++L+  GKDIES YWELV+KDIQDAC+LFEPIYD+T+ GDGYVSV
Sbjct  121   FQKAISSSSAYDEQFRQLISEGKDIESAYWELVIKDIQDACRLFEPIYDQTDGGDGYVSV  180

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLA+DT GT+EAAKWLH+ VDR NVYIKIPATA CIPSIK+VI+ GISVNVTLIFS
Sbjct  181   EVSPRLANDTNGTVEAAKWLHRLVDRPNVYIKIPATAECIPSIKQVISLGISVNVTLIFS  240

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             ++RYEAVIDAYLDGLE+SGL+DLS++TSVASFFVSRVDTLVDK+LEKIG+PEALDLRGKA
Sbjct  241   LQRYEAVIDAYLDGLESSGLSDLSRLTSVASFFVSRVDTLVDKMLEKIGTPEALDLRGKA  300

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA LA++LYQKKFSGPRWEAL KKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT
Sbjct  301   AVAQAVLAYKLYQKKFSGPRWEALAKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  360

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AFIDHG V+RTID+NVSEAEGIY+A++K+G+DW +VG+QLE EGV+SFKK
Sbjct  361   VSTMPDQALQAFIDHGVVSRTIDSNVSEAEGIYSALEKIGIDWIEVGSQLEVEGVESFKK  420

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLL +L+EK +
Sbjct  421   SFDSLLVTLKEKGD  434



>emb|CDX85652.1| BnaA02g01610D [Brassica napus]
Length=440

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/375 (83%), Positives = 349/375 (93%), Gaps = 0/375 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             SL +RCS  G NGS  K+T+LHDLYEK+GQSPWYDNLCRPVTDL+P I  GVRGVTSNPA
Sbjct  59    SLFVRCSASGENGSTTKKTTLHDLYEKEGQSPWYDNLCRPVTDLLPFIARGVRGVTSNPA  118

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAISTSNAYNDQF+ LV++G DIES YWELVVKDIQDACKLFEPIYD+TEA DGYVS
Sbjct  119   IFQKAISTSNAYNDQFRSLVESGNDIESAYWELVVKDIQDACKLFEPIYDQTEAEDGYVS  178

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSP LADDT GT+EAAK+LHK V+RRNVYIKIPATAPC+PSI++VIA+GISVNVTLIF
Sbjct  179   VEVSPMLADDTNGTVEAAKYLHKVVNRRNVYIKIPATAPCVPSIRDVIASGISVNVTLIF  238

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGK
Sbjct  239   SIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLMDKMLEKIGTPEALDLRGK  298

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA++LYQKKFSGPRWEALVKKGAK+QRLLWASTSVKNPAY DTLYV PLIGPD
Sbjct  299   AAVAQAALAYKLYQKKFSGPRWEALVKKGAKRQRLLWASTSVKNPAYSDTLYVAPLIGPD  358

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V RTID NVSEAEGIY+A++KLG++W++VG QLE EGVDSFK
Sbjct  359   TVSTMPDQALEAFIDHGTVKRTIDENVSEAEGIYSALEKLGIEWRKVGEQLEEEGVDSFK  418

Query  1417  KSFDSLLDSLQEKAN  1461
             KSF+SLL +LQ+KA+
Sbjct  419   KSFESLLGTLQDKAS  433



>ref|XP_009131334.1| PREDICTED: uncharacterized protein LOC103856014 [Brassica rapa]
Length=437

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/400 (80%), Positives = 358/400 (90%), Gaps = 1/400 (0%)
 Frame = +1

Query  265   NKSSFDARLSSSKLLAFA-KPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYD  441
             N  SF+A+LSS+  L+         SL +RCS  GGNGS  KRT+LHDLYEK+GQSPWYD
Sbjct  31    NLRSFNAKLSSASHLSIRYNQQTRPSLFVRCSASGGNGSTTKRTTLHDLYEKEGQSPWYD  90

Query  442   NLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVV  621
             NLCRPVTDLIP I  GVRGVTSNPAIFQKAISTS+AYNDQF+ LV++G  I+  YWELVV
Sbjct  91    NLCRPVTDLIPFIARGVRGVTSNPAIFQKAISTSDAYNDQFRTLVESGTAIKKAYWELVV  150

Query  622   KDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIP  801
             KDIQDACKLFEPIYD+T+A DGYVSVEVSP LADDT+ T++AAK LHK V+R NVYIKIP
Sbjct  151   KDIQDACKLFEPIYDQTDAEDGYVSVEVSPLLADDTKTTVKAAKLLHKSVNRPNVYIKIP  210

Query  802   ATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFV  981
             AT+PCIPSI++VIA+GISVNVTLIFSI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFV
Sbjct  211   ATSPCIPSIRDVIASGISVNVTLIFSIARYEAVIDAYLDGLEASGLDDLSRVTSVASFFV  270

Query  982   SRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRL  1161
             SRVDTL+DK+LEKIG+PEALDLRGKAA AQAALA+QLYQKKFSGPRWEALVKKGAKKQRL
Sbjct  271   SRVDTLMDKMLEKIGTPEALDLRGKAAVAQAALAYQLYQKKFSGPRWEALVKKGAKKQRL  330

Query  1162  LWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYN  1341
             LWASTSVKNPAY DTLYV PLIGPDTVSTMPDQAL AFIDHG+V RTIDANVSEAEG+Y+
Sbjct  331   LWASTSVKNPAYSDTLYVAPLIGPDTVSTMPDQALEAFIDHGTVKRTIDANVSEAEGVYS  390

Query  1342  AIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             A++KLG+DW +VG QLE EGVDSFKKSF+SLL +LQ+KAN
Sbjct  391   ALEKLGIDWNKVGEQLEEEGVDSFKKSFESLLGTLQDKAN  430



>ref|XP_010909285.1| PREDICTED: uncharacterized protein LOC105035433 [Elaeis guineensis]
Length=439

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/433 (76%), Positives = 374/433 (86%), Gaps = 1/433 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
             MA+ISKLSNP  A++S  +S    P PK  +  R       R S  +L +     +  S 
Sbjct  1     MASISKLSNPNLAAASPRSSSALRPEPKLSLSFRTGGRIQRRASLLRL-STRSDRVERSF  59

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             ++RCSQ  GN +P  RT+LHDLYE Q QSPWYDNLCRPVTDL+PLI SGVRGVTSNP IF
Sbjct  60    LVRCSQQDGNHAPANRTTLHDLYELQRQSPWYDNLCRPVTDLLPLIASGVRGVTSNPTIF  119

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAIS+SNAY++QF++LV AGKDIES+YWELV+KDIQDACKLFEPIYD+T+ GDGYVSVE
Sbjct  120   QKAISSSNAYDEQFRQLVSAGKDIESVYWELVIKDIQDACKLFEPIYDQTDGGDGYVSVE  179

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLA+DT GTIEAAKWLHK V+  NVYIKIPATA C+PSIKEVI+NGISVNVTLIFS+
Sbjct  180   VSPRLANDTNGTIEAAKWLHKLVNCPNVYIKIPATAECVPSIKEVISNGISVNVTLIFSL  239

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLE+SGL+DLS++TSVASFFVSRVDTLVDK+LEKIG+PEAL+L+GKAA
Sbjct  240   SRYEAVIDAYLDGLESSGLDDLSRLTSVASFFVSRVDTLVDKMLEKIGTPEALELQGKAA  299

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQAALA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV
Sbjct  300   VAQAALAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  359

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHG+V+RTID+N+SEAE  Y A+ KLG+DW +VG+QLE EGV+SFKKS
Sbjct  360   STMPDQALQAFIDHGTVSRTIDSNLSEAERAYAALQKLGIDWNKVGSQLEVEGVESFKKS  419

Query  1423  FDSLLDSLQEKAN  1461
             FDSLL SLQEK +
Sbjct  420   FDSLLVSLQEKGD  432



>ref|XP_009390373.1| PREDICTED: uncharacterized protein LOC103976773 [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/434 (75%), Positives = 376/434 (87%), Gaps = 4/434 (1%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspapKCFVDIRNKSS-FDARLSSSKLLAFAKPSLNGS  339
             MA+ISKLS+P F + SS   R      K  VD R +S    + ++  +L      S   +
Sbjct  1     MASISKLSSPAFTAVSSPPLRSEP---KLSVDFRRRSGPVRSPIAPLRLSIRRDRSGRSA  57

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             LV++ S   GNG P KRT+LHDLYE+QGQSPWYDNLCRPVTDL+PLI SGVRGVTSNP I
Sbjct  58    LVVKSSLQDGNGVPSKRTTLHDLYEQQGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPTI  117

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+S+AY++QF++LV AGKDIES YWELVVKDIQDACKLFEPIYD+T+  DGYVSV
Sbjct  118   FQKAISSSSAYDEQFRQLVTAGKDIESAYWELVVKDIQDACKLFEPIYDQTDGADGYVSV  177

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLA+DT GT+EAAK+LHK VDR NVYIKIPATA C+PS+K+VI+ GISVNVTLIFS
Sbjct  178   EVSPRLANDTNGTVEAAKYLHKVVDRPNVYIKIPATAECVPSVKQVISLGISVNVTLIFS  237

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLE+SGL+DLSKVTSVASFFVSRVDTLVDK+LEKIG+PEALDLRGKA
Sbjct  238   LPRYEAVIDAYLDGLESSGLSDLSKVTSVASFFVSRVDTLVDKMLEKIGTPEALDLRGKA  297

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA LA++LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT
Sbjct  298   AVAQATLAYKLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  357

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AF+DHG V+RTID+N+SEAEGIY+A++KLG+DW +VG QLEAEGV+SFKK
Sbjct  358   VSTMPDQALEAFMDHGVVSRTIDSNISEAEGIYSALEKLGIDWDEVGAQLEAEGVESFKK  417

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLL SL++K +
Sbjct  418   SFDSLLVSLKQKGD  431



>ref|XP_006646634.1| PREDICTED: uncharacterized protein LOC102716002, partial [Oryza 
brachyantha]
Length=399

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/374 (83%), Positives = 346/374 (93%), Gaps = 0/374 (0%)
 Frame = +1

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             ++   S   GNG+P KRT+LHDLY+ QGQSPWYDNLCRPVTDL+PLI +GVRGVTSNP+I
Sbjct  18    IIAMASAKEGNGAPTKRTTLHDLYDLQGQSPWYDNLCRPVTDLLPLIANGVRGVTSNPSI  77

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+SNAY+DQFK+L+ AGKD E+ YWELV+KDIQDACKLFEPIY++T+  DGYVSV
Sbjct  78    FQKAISSSNAYDDQFKQLILAGKDAENAYWELVIKDIQDACKLFEPIYNQTDGADGYVSV  137

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLA+DT+GT+EAAKWLHK V+R NVYIKIPATA C+PSIKEVIANGISVNVTLIFS
Sbjct  138   EVSPRLANDTQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIKEVIANGISVNVTLIFS  197

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             I RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEAL LRGKA
Sbjct  198   IARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALALRGKA  257

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA LA QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT
Sbjct  258   AVAQAKLANQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  317

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQALLAFIDHG+V+RTIDANVS+AEG+Y+A++KLG+DW  VG QLE EGVDSFKK
Sbjct  318   VSTMPDQALLAFIDHGTVSRTIDANVSDAEGVYSALEKLGIDWDGVGKQLELEGVDSFKK  377

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLL SL+EK N
Sbjct  378   SFDSLLVSLEEKGN  391



>ref|XP_008776466.1| PREDICTED: uncharacterized protein LOC103696573 [Phoenix dactylifera]
Length=441

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/434 (74%), Positives = 374/434 (86%), Gaps = 1/434 (0%)
 Frame = +1

Query  163   MATISKLSNPGfassssftsrrsspap-KCFVDIRNKSSFDARLSSSKLLAFAKPSLNGS  339
             MA+ISKL+NP F +S +  S  +  +  K  V+  +       +S  +L          S
Sbjct  1     MASISKLANPSFTASGASRSSPTLRSDPKLSVNFHSGFPIRRGISPPRLSIRRDRVERIS  60

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             L++RCS+  GNG+P KRT+LHDLYE+QGQSPWYDNLCRPVTDL+PLI SG+RGVTSNP I
Sbjct  61    LIVRCSKQDGNGAPNKRTTLHDLYEQQGQSPWYDNLCRPVTDLLPLIASGIRGVTSNPTI  120

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+S+AY++QF++L+  GKDIES YWELV+KDIQDACKLFEPIYD+T+ GDGYVSV
Sbjct  121   FQKAISSSSAYDEQFRQLISEGKDIESAYWELVIKDIQDACKLFEPIYDQTDGGDGYVSV  180

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLA+DT GT+EAAKWLH  VD  NVYIKIPATA CIPSIK+VI+ GISVNVTLIFS
Sbjct  181   EVSPRLANDTNGTVEAAKWLHGSVDSPNVYIKIPATAECIPSIKQVISLGISVNVTLIFS  240

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             ++RYEAVIDAYLDGLE+SGL+DLS++TSVASFFVSRVDTLVDK+LEKIG+PEALDLRGKA
Sbjct  241   LQRYEAVIDAYLDGLESSGLSDLSRLTSVASFFVSRVDTLVDKMLEKIGTPEALDLRGKA  300

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA LA++LYQKKFSGPRWEAL KKGAK+QRLLWASTSVKNPAYPDTLYVDPLIGPDT
Sbjct  301   AVAQAVLAYKLYQKKFSGPRWEALAKKGAKRQRLLWASTSVKNPAYPDTLYVDPLIGPDT  360

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL A IDHG V+RTID+NVSEAEGIY+A++KLG+DW +VG+QLE EGV+SFKK
Sbjct  361   VSTMPDQALQAVIDHGVVSRTIDSNVSEAEGIYSALEKLGIDWSEVGSQLEVEGVESFKK  420

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLL +L+EK +
Sbjct  421   SFDSLLVTLKEKGD  434



>dbj|BAK03413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/398 (79%), Positives = 349/398 (88%), Gaps = 10/398 (3%)
 Frame = +1

Query  298   SKLLAFA------KPSLNGS----LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNL  447
             S  LAFA      + SL G     ++   S   GNG+  KRT+LHDLYE+QGQSPWYDNL
Sbjct  26    SAALAFAPSARRFRVSLAGRARSPVIAMASAKEGNGAVTKRTTLHDLYEQQGQSPWYDNL  85

Query  448   CRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKD  627
             CRPVTDL+P I +GVRGVTSNP IFQKAIS+SNAY+ QFKEL+ AGKD ES YWELV+KD
Sbjct  86    CRPVTDLLPYIANGVRGVTSNPTIFQKAISSSNAYDGQFKELISAGKDAESAYWELVIKD  145

Query  628   IQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPAT  807
             IQDACKLFEPIYDET+  DGYVSVEVSPRLA+DT+GT+EAAKWLHK V+R NVYIKIPAT
Sbjct  146   IQDACKLFEPIYDETDGADGYVSVEVSPRLANDTQGTVEAAKWLHKVVNRPNVYIKIPAT  205

Query  808   APCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSR  987
             A C+PSIKEVIANGISVNVTLIFS+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSR
Sbjct  206   AECVPSIKEVIANGISVNVTLIFSVARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSR  265

Query  988   VDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLW  1167
             VD+L+DK+LEKIG+PEAL LRGKAA AQA +A QLY KKFSGPRWEALVKKGAKKQRLLW
Sbjct  266   VDSLIDKMLEKIGTPEALALRGKAAVAQAKIANQLYLKKFSGPRWEALVKKGAKKQRLLW  325

Query  1168  ASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAI  1347
             ASTSVKNPAY DTLYVDPLIGPDTVSTMPDQAL AFIDHG+VARTIDANVSEAEGIY+A+
Sbjct  326   ASTSVKNPAYSDTLYVDPLIGPDTVSTMPDQALDAFIDHGTVARTIDANVSEAEGIYSAL  385

Query  1348  DKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             +KLG+DW++VG QLE EGV SFK SFDSLL SL+EK N
Sbjct  386   EKLGIDWEEVGKQLEHEGVSSFKGSFDSLLTSLEEKGN  423



>ref|XP_003564974.1| PREDICTED: uncharacterized protein LOC100830710 isoform X1 [Brachypodium 
distachyon]
Length=429

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/398 (80%), Positives = 351/398 (88%), Gaps = 10/398 (3%)
 Frame = +1

Query  298   SKLLAFA------KPSLNG---SLVIRCSQGG-GNGSPIKRTSLHDLYEKQGQSPWYDNL  447
             S  LAFA      + SL+G   S VI  + G  GNG+  KRT+LHDLYE QGQSPWYDNL
Sbjct  25    STALAFAPSARRFRVSLSGRARSPVIAMASGKEGNGAATKRTTLHDLYELQGQSPWYDNL  84

Query  448   CRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKD  627
             CRPVTDL+P I +GVRGVTSNP IFQKAIS+SNAY+DQFK+L+ AGKD ES YWELV+KD
Sbjct  85    CRPVTDLLPYIANGVRGVTSNPTIFQKAISSSNAYDDQFKQLISAGKDAESAYWELVIKD  144

Query  628   IQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPAT  807
             IQDACKLFEPIYD+T+  DGYVSVEVSPRLA+DT+GT+EAAKWLHK V+R NVYIKIPAT
Sbjct  145   IQDACKLFEPIYDQTDGADGYVSVEVSPRLANDTQGTVEAAKWLHKVVNRPNVYIKIPAT  204

Query  808   APCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSR  987
             A C+PSI+EVIANGISVNVTLIFSI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSR
Sbjct  205   AECVPSIREVIANGISVNVTLIFSIARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSR  264

Query  988   VDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLW  1167
             VD+L+DK+LEK G+PEAL LRGKAA AQA LA QLY KKFSGPRWEALVKKGAKKQRLLW
Sbjct  265   VDSLIDKMLEKTGTPEALALRGKAAVAQAKLANQLYLKKFSGPRWEALVKKGAKKQRLLW  324

Query  1168  ASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAI  1347
             ASTSVKNPAY DTLYVDPLIGPDTVSTMPDQAL AFIDHG+V+RTIDANVSEAEGIY+A+
Sbjct  325   ASTSVKNPAYADTLYVDPLIGPDTVSTMPDQALEAFIDHGTVSRTIDANVSEAEGIYSAL  384

Query  1348  DKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
              KLG++W +VGTQLE EGVDSFK SFDSLL SLQEK N
Sbjct  385   GKLGINWDEVGTQLELEGVDSFKGSFDSLLTSLQEKGN  422



>ref|XP_010911579.1| PREDICTED: uncharacterized protein LOC105037637, partial [Elaeis 
guineensis]
Length=408

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/373 (82%), Positives = 348/373 (93%), Gaps = 0/373 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             S ++RCSQ  GN +P  RT+LHDLYE Q QSPWYDNLCRPVTDL+PLI SGVRGVTSNP 
Sbjct  27    SFLVRCSQQDGNHAPANRTTLHDLYELQRQSPWYDNLCRPVTDLLPLIASGVRGVTSNPT  86

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAIS+S+AY++QF++LV AGKDIES+YWELV+ DIQDACKLFEPIYD+T+ GDGYVS
Sbjct  87    IFQKAISSSSAYDEQFRQLVSAGKDIESIYWELVINDIQDACKLFEPIYDQTDGGDGYVS  146

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLA+DT GTIEAAKWLH+ V+R NVYIKIPATA C+PSIKEVI+NGI VNVTLIF
Sbjct  147   VEVSPRLANDTNGTIEAAKWLHQVVNRPNVYIKIPATAECVPSIKEVISNGICVNVTLIF  206

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             S+ RYEAVIDAYLDGLE+SGL+DLS++TSVASFFVSRVDTL+DK+LE+IG+ EALDLRGK
Sbjct  207   SLSRYEAVIDAYLDGLESSGLDDLSRLTSVASFFVSRVDTLIDKMLEEIGTTEALDLRGK  266

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQAALA+ LYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD
Sbjct  267   AAVAQAALAYSLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  326

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TVSTMPDQAL AFIDHG+V+RTID+N+SEAEGIY+A++KLG+DW +VG+QLEAEGVDSF+
Sbjct  327   TVSTMPDQALQAFIDHGTVSRTIDSNLSEAEGIYSALEKLGIDWNKVGSQLEAEGVDSFR  386

Query  1417  KSFDSLLDSLQEK  1455
             KSFDSLL SLQ+K
Sbjct  387   KSFDSLLVSLQKK  399



>ref|NP_001150450.1| LOC100284080 [Zea mays]
 gb|ACF84672.1| unknown [Zea mays]
 gb|ACG39146.1| transaldolase 2 [Zea mays]
 gb|AFW84085.1| transaldolase 2 [Zea mays]
Length=429

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/374 (82%), Positives = 342/374 (91%), Gaps = 0/374 (0%)
 Frame = +1

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             ++   S   GNG+P KRT+LHDLYE QG SPWYDNLCRPVTDL+P+I SGVRGVTSNP I
Sbjct  49    IIAMASAKEGNGAPTKRTALHDLYELQGLSPWYDNLCRPVTDLLPIIASGVRGVTSNPTI  108

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+S+AY+DQFK+L+ AGKD ES YWELV+KDIQDACKLFEPIYDET+  DGYVSV
Sbjct  109   FQKAISSSSAYDDQFKQLISAGKDAESAYWELVIKDIQDACKLFEPIYDETDGADGYVSV  168

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLA+DT+GT+EAAKWLHK V+R NVYIKIPATA C+PSI+EVIANGISVNVTLIFS
Sbjct  169   EVSPRLANDTQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIQEVIANGISVNVTLIFS  228

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             I RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+L+KIG+PEAL LRGKA
Sbjct  229   IARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLDKIGTPEALALRGKA  288

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA LA +LYQKKFSGPRWEAL KKGAKKQRLLWAST VKNPAYPDTLYVD LIGPDT
Sbjct  289   AVAQAKLANRLYQKKFSGPRWEALAKKGAKKQRLLWASTGVKNPAYPDTLYVDSLIGPDT  348

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             V+TMPDQAL AFIDHG+V+RT+DANVSEAEG+Y+A++KLG+DW++VG QLE EGVDSFKK
Sbjct  349   VNTMPDQALQAFIDHGTVSRTVDANVSEAEGVYSALEKLGIDWEEVGKQLELEGVDSFKK  408

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLL SLQEK N
Sbjct  409   SFDSLLVSLQEKGN  422



>gb|ACN31756.1| unknown [Zea mays]
Length=430

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/375 (82%), Positives = 341/375 (91%), Gaps = 0/375 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             S++   S   GNG+P K+TSLHDLYE QG SPWYDNLCRPVTDL+PLI SGVRGVTSNPA
Sbjct  49    SVIAMASAKEGNGAPTKKTSLHDLYELQGLSPWYDNLCRPVTDLLPLIASGVRGVTSNPA  108

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAIS+S+AY+DQFK+L+  GKD ES YWELV+KDIQDAC LFEPIYDET+  DGYVS
Sbjct  109   IFQKAISSSSAYDDQFKQLISGGKDAESAYWELVIKDIQDACSLFEPIYDETDGADGYVS  168

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLA+DT+GT+EAAKWLHK V+R NVYIKIPATA C+PSI+EVIANGISVNVTLIF
Sbjct  169   VEVSPRLANDTQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIREVIANGISVNVTLIF  228

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEAL LRGK
Sbjct  229   SIARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALALRGK  288

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQA LA +LYQKKFSGPRWEAL KKGAKKQRLLWAST VKNPAYPDTLY+D LIGPD
Sbjct  289   AAVAQAKLANRLYQKKFSGPRWEALAKKGAKKQRLLWASTGVKNPAYPDTLYIDSLIGPD  348

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TV+TMPDQAL AFIDHG+V+RT+DANVSEAEG+Y+A++KLG+DW +VG QLE EGVDSFK
Sbjct  349   TVNTMPDQALHAFIDHGTVSRTVDANVSEAEGVYSALEKLGIDWGEVGKQLELEGVDSFK  408

Query  1417  KSFDSLLDSLQEKAN  1461
             KSFDSLL SLQEK N
Sbjct  409   KSFDSLLVSLQEKGN  423



>gb|EMS53783.1| Transaldolase 1 [Triticum urartu]
Length=379

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/365 (84%), Positives = 337/365 (92%), Gaps = 0/365 (0%)
 Frame = +1

Query  367   GNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSN  546
             GNG+  KRT+LHDLYE+QGQSPWYDNLCRPVTDL+P I +GVRGVTSNP IFQKAIS+SN
Sbjct  7     GNGAVTKRTTLHDLYEQQGQSPWYDNLCRPVTDLLPYIANGVRGVTSNPTIFQKAISSSN  66

Query  547   AYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADD  726
             AY+ QFKEL+ AGKD ES YWELV+KDIQDACKLFEPIYDET+  DGYVSVEVSPRLA+D
Sbjct  67    AYDGQFKELISAGKDAESAYWELVIKDIQDACKLFEPIYDETDGADGYVSVEVSPRLAND  126

Query  727   TEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVID  906
             T+GT+EAAKWLHK V+R NVYIKIPATA C+PSIKEVIANGISVNVTLIFS+ RYEAVID
Sbjct  127   TQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIKEVIANGISVNVTLIFSVARYEAVID  186

Query  907   AYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalaf  1086
             AYLDGLEASGL+DLS+VTSVASFFVSRVD+L+DK+LEKIG+PEAL LRGKAA AQA +A 
Sbjct  187   AYLDGLEASGLSDLSRVTSVASFFVSRVDSLIDKMLEKIGTPEALALRGKAAVAQAKIAN  246

Query  1087  qlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQAL  1266
             QLY KKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYVDPLIGPDTVSTMPDQAL
Sbjct  247   QLYLKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYLDTLYVDPLIGPDTVSTMPDQAL  306

Query  1267  LAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              AFIDHG+VARTIDANVSEAEGIY+A++KLG+DW++VG QLE EGV SFK SFDSLL SL
Sbjct  307   DAFIDHGTVARTIDANVSEAEGIYSALEKLGIDWEEVGKQLEHEGVSSFKGSFDSLLTSL  366

Query  1447  QEKAN  1461
             +EK N
Sbjct  367   EEKGN  371



>gb|EMT17354.1| Transaldolase 1 [Aegilops tauschii]
Length=412

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/365 (84%), Positives = 337/365 (92%), Gaps = 0/365 (0%)
 Frame = +1

Query  367   GNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSN  546
             GNG+  KRT+LHDLYE+QGQSPWYDNLCRPVTDL+P I +GVRGVTSNP IFQKAIS+SN
Sbjct  40    GNGAVTKRTTLHDLYEQQGQSPWYDNLCRPVTDLLPYIANGVRGVTSNPTIFQKAISSSN  99

Query  547   AYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADD  726
             AY+ QFKEL+ AGKD ES YWELV+KDIQDACKLFEPIYDET+  DGYVSVEVSPRLA+D
Sbjct  100   AYDGQFKELISAGKDAESAYWELVIKDIQDACKLFEPIYDETDGADGYVSVEVSPRLAND  159

Query  727   TEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVID  906
             T+GT+EAAKWLHK V+R NVYIKIPATA C+PSIKEVIANGISVNVTLIFS+ RYEAVID
Sbjct  160   TQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIKEVIANGISVNVTLIFSVARYEAVID  219

Query  907   AYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalaf  1086
             AYLDGLEASGL+DLS+VTSVASFFVSRVD+L+DK+LEKIG+PEAL LRGKAA AQA +A 
Sbjct  220   AYLDGLEASGLSDLSRVTSVASFFVSRVDSLIDKMLEKIGTPEALALRGKAAVAQAKIAN  279

Query  1087  qlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQAL  1266
             QLY KKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYVDPLIGPDTVSTMPDQAL
Sbjct  280   QLYLKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYLDTLYVDPLIGPDTVSTMPDQAL  339

Query  1267  LAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              AFIDHG+VARTIDANVSEAEGIY+A++KLG+DW++VG QLE EGV SFK SFDSLL SL
Sbjct  340   DAFIDHGTVARTIDANVSEAEGIYSALEKLGIDWEEVGKQLEHEGVSSFKGSFDSLLTSL  399

Query  1447  QEKAN  1461
             +EK N
Sbjct  400   EEKGN  404



>ref|XP_010232767.1| PREDICTED: uncharacterized protein LOC100830710 isoform X2 [Brachypodium 
distachyon]
Length=378

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/365 (84%), Positives = 336/365 (92%), Gaps = 0/365 (0%)
 Frame = +1

Query  367   GNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSN  546
             GNG+  KRT+LHDLYE QGQSPWYDNLCRPVTDL+P I +GVRGVTSNP IFQKAIS+SN
Sbjct  7     GNGAATKRTTLHDLYELQGQSPWYDNLCRPVTDLLPYIANGVRGVTSNPTIFQKAISSSN  66

Query  547   AYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADD  726
             AY+DQFK+L+ AGKD ES YWELV+KDIQDACKLFEPIYD+T+  DGYVSVEVSPRLA+D
Sbjct  67    AYDDQFKQLISAGKDAESAYWELVIKDIQDACKLFEPIYDQTDGADGYVSVEVSPRLAND  126

Query  727   TEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVID  906
             T+GT+EAAKWLHK V+R NVYIKIPATA C+PSI+EVIANGISVNVTLIFSI RYEAVID
Sbjct  127   TQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIREVIANGISVNVTLIFSIARYEAVID  186

Query  907   AYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalaf  1086
             AYLDGLEASGL+DLS+VTSVASFFVSRVD+L+DK+LEK G+PEAL LRGKAA AQA LA 
Sbjct  187   AYLDGLEASGLSDLSRVTSVASFFVSRVDSLIDKMLEKTGTPEALALRGKAAVAQAKLAN  246

Query  1087  qlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQAL  1266
             QLY KKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYVDPLIGPDTVSTMPDQAL
Sbjct  247   QLYLKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYADTLYVDPLIGPDTVSTMPDQAL  306

Query  1267  LAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              AFIDHG+V+RTIDANVSEAEGIY+A+ KLG++W +VGTQLE EGVDSFK SFDSLL SL
Sbjct  307   EAFIDHGTVSRTIDANVSEAEGIYSALGKLGINWDEVGTQLELEGVDSFKGSFDSLLTSL  366

Query  1447  QEKAN  1461
             QEK N
Sbjct  367   QEKGN  371



>emb|CDM85813.1| unnamed protein product [Triticum aestivum]
Length=431

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/374 (82%), Positives = 339/374 (91%), Gaps = 0/374 (0%)
 Frame = +1

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             ++   S   GNG+  KRT+LHDLYE+QGQSPWYDNLCRPVTDL+P I +GVRGVTSNP I
Sbjct  50    VIAMASAKEGNGAVTKRTTLHDLYEQQGQSPWYDNLCRPVTDLLPYIANGVRGVTSNPTI  109

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+SNAY+ QFKEL+ AGKD ES YWELV+KDIQDACKLFEPIYDET+  DGYVSV
Sbjct  110   FQKAISSSNAYDGQFKELISAGKDAESAYWELVIKDIQDACKLFEPIYDETDGADGYVSV  169

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLA+DT+GT+EAAKWLHK V+R NVYIKIPATA C+PSIKEVIANGISVNVTLIFS
Sbjct  170   EVSPRLANDTQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIKEVIANGISVNVTLIFS  229

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             + RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVD+L+DK+LEKIG+PEAL  RGKA
Sbjct  230   VARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDSLIDKMLEKIGTPEALAPRGKA  289

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA +A QLY KKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYVDPLIGPDT
Sbjct  290   AVAQAKIANQLYLKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYLDTLYVDPLIGPDT  349

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             VSTMPDQAL AFIDHG+VARTIDANVSEAEGIY+A++KLG+DW++VG QLE EGV SFK 
Sbjct  350   VSTMPDQALDAFIDHGTVARTIDANVSEAEGIYSALEKLGIDWEEVGKQLEHEGVSSFKG  409

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLL SL+EK N
Sbjct  410   SFDSLLTSLEEKGN  423



>dbj|BAJ96158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/398 (79%), Positives = 348/398 (87%), Gaps = 10/398 (3%)
 Frame = +1

Query  298   SKLLAFA------KPSLNGS----LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNL  447
             S  LAFA      + SL G     ++   S   GNG+  KRT+LHDLYE+QGQSPWYDNL
Sbjct  26    SAALAFAPSARRFRVSLAGRARSPVIAMASAKEGNGAVTKRTTLHDLYEQQGQSPWYDNL  85

Query  448   CRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKD  627
             CRPVTDL+P I +GVRGVTSNP IFQKA+S+SNAY+ QFKEL+ AGKD ES YWELV+KD
Sbjct  86    CRPVTDLLPYIANGVRGVTSNPTIFQKAVSSSNAYDGQFKELISAGKDAESAYWELVIKD  145

Query  628   IQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPAT  807
             IQDACKLFEPIYDET+  DGYVSVEVSPRLA+DT+GT+EAAKWLHK V+R NVYIKIPAT
Sbjct  146   IQDACKLFEPIYDETDGADGYVSVEVSPRLANDTQGTVEAAKWLHKVVNRPNVYIKIPAT  205

Query  808   APCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSR  987
             A  +PSIKEVIANGISVNVTLIFS+ RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSR
Sbjct  206   AERVPSIKEVIANGISVNVTLIFSVARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSR  265

Query  988   VDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLW  1167
             VD+L+DK+LEKIG+PEAL LRGKAA AQA +A QLY KKFSGPRWEALVKKGAKKQRLLW
Sbjct  266   VDSLIDKMLEKIGTPEALALRGKAAVAQAKIANQLYLKKFSGPRWEALVKKGAKKQRLLW  325

Query  1168  ASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAI  1347
             ASTSVKNPAY DTLYVDPLIGPDTVSTMPDQAL AFIDHG+VARTIDANVSEAEGIY+A+
Sbjct  326   ASTSVKNPAYSDTLYVDPLIGPDTVSTMPDQALDAFIDHGTVARTIDANVSEAEGIYSAL  385

Query  1348  DKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             +KLG+DW++VG QLE EGV SFK SFDSLL SL+EK N
Sbjct  386   EKLGIDWEEVGKQLEHEGVSSFKGSFDSLLTSLEEKGN  423



>ref|XP_004971135.1| PREDICTED: uncharacterized protein LOC101753964 [Setaria italica]
Length=429

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/374 (82%), Positives = 340/374 (91%), Gaps = 0/374 (0%)
 Frame = +1

Query  340   LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
             ++   S   GNG+P KRTSLHDLYE QG SPWYDNLCRPVTDL+P I SGVRGVTSNP I
Sbjct  49    IIAMASAEEGNGAPTKRTSLHDLYELQGLSPWYDNLCRPVTDLLPFIASGVRGVTSNPTI  108

Query  520   FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
             FQKAIS+S+AY+DQFK+L+ AGKD ES YWELV+KDIQDACKLFEPIY+ET+  DGYVSV
Sbjct  109   FQKAISSSSAYDDQFKQLISAGKDAESAYWELVIKDIQDACKLFEPIYNETDGADGYVSV  168

Query  700   EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
             EVSPRLA+DT+GT+EAAKWLHK V+R NVYIKIPATA C+PSI+EVI+NGISVNVTLIFS
Sbjct  169   EVSPRLANDTQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIREVISNGISVNVTLIFS  228

Query  880   IERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgka  1059
             I RYEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVD+L+DK+LEKIG+PEAL LRGKA
Sbjct  229   IARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDSLIDKMLEKIGTPEALALRGKA  288

Query  1060  anaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDT  1239
             A AQA LA QLYQKKFSGPRWEAL KKGAKKQRLLWAST VKNPAYPDTLYVD LIGPDT
Sbjct  289   AVAQAKLANQLYQKKFSGPRWEALAKKGAKKQRLLWASTGVKNPAYPDTLYVDSLIGPDT  348

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             V+TMPDQAL AFIDHG+V+RT+DANVSEAEG+Y+A++KLG+DW +VG QLE EGVDSFKK
Sbjct  349   VNTMPDQALQAFIDHGTVSRTVDANVSEAEGVYSALEKLGIDWDEVGKQLELEGVDSFKK  408

Query  1420  SFDSLLDSLQEKAN  1461
             SFDSLL SLQEK N
Sbjct  409   SFDSLLVSLQEKGN  422



>ref|NP_001150674.1| transaldolase 2 [Zea mays]
 gb|ACG39967.1| transaldolase 2 [Zea mays]
Length=430

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/375 (81%), Positives = 339/375 (90%), Gaps = 0/375 (0%)
 Frame = +1

Query  337   SLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA  516
             S++   S   GNG+P K+TSLHDLYE QG SPWYDNLCRPVTDL+PLI SGVRGVTSNP 
Sbjct  49    SVIAMASAKEGNGAPTKKTSLHDLYELQGLSPWYDNLCRPVTDLLPLIASGVRGVTSNPT  108

Query  517   IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVS  696
             IFQKAIS+S+AY+DQFK+L+  GKD ES YWELV+KDIQDAC LFEPIYDET+  DGYVS
Sbjct  109   IFQKAISSSSAYDDQFKQLISGGKDAESAYWELVIKDIQDACSLFEPIYDETDGADGYVS  168

Query  697   VEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIF  876
             VEVSPRLA+DT+GT+EAAKWLHK V+R NVYIKIPATA C+PSI+EVIANGISVNVTLIF
Sbjct  169   VEVSPRLANDTQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIREVIANGISVNVTLIF  228

Query  877   SIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgk  1056
             SI  YEAVIDAYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEAL LRGK
Sbjct  229   SIATYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALALRGK  288

Query  1057  aanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPD  1236
             AA AQA LA +LYQKKFSGPRWEAL KKGAKKQRLLWAST VKNPAYPDTLY+D LIGPD
Sbjct  289   AAVAQAKLANRLYQKKFSGPRWEALAKKGAKKQRLLWASTGVKNPAYPDTLYIDSLIGPD  348

Query  1237  TVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFK  1416
             TV+TMPDQAL AFIDHG+V+RT+DANVSEAEG+Y+A++KLG+DW +VG QLE EGVDSFK
Sbjct  349   TVNTMPDQALQAFIDHGTVSRTVDANVSEAEGVYSALEKLGIDWAEVGKQLELEGVDSFK  408

Query  1417  KSFDSLLDSLQEKAN  1461
             KSFDSLL SLQEK N
Sbjct  409   KSFDSLLVSLQEKGN  423



>dbj|BAB89667.1| putative transaldolase [Oryza sativa Japonica Group]
Length=517

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/395 (79%), Positives = 344/395 (87%), Gaps = 30/395 (8%)
 Frame = +1

Query  367   GNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPA----------  516
             GNG+P KRT+LHDLY+ QGQSPWYDNLCRPVTDL+PLI SGVRGVTSNP+          
Sbjct  115   GNGAPTKRTTLHDLYDLQGQSPWYDNLCRPVTDLLPLIGSGVRGVTSNPSVRYTTYFFCS  174

Query  517   --------------------IFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQD  636
                                 IFQKAISTSNAY+DQFK+L+ AGKD ES YWELV+KDIQD
Sbjct  175   LAPCSESAILIADCVPMAMQIFQKAISTSNAYDDQFKQLILAGKDAESAYWELVIKDIQD  234

Query  637   ACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPC  816
             ACKLFEPIYD+T+  DGYVSVEVSPRLA+DT+GT+EAAKWLHK VDR NVYIKIPATA C
Sbjct  235   ACKLFEPIYDQTDGADGYVSVEVSPRLANDTQGTVEAAKWLHKVVDRPNVYIKIPATAEC  294

Query  817   IPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDT  996
             +PSIKEVIANGISVNVTLIFSI RYEAVIDAY+DGLEASGL+DLS+VTSVASFFVSRVDT
Sbjct  295   VPSIKEVIANGISVNVTLIFSIARYEAVIDAYIDGLEASGLSDLSRVTSVASFFVSRVDT  354

Query  997   LVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWAST  1176
             L+DK+LEKIG+PEAL LRGKAA AQA LA QLYQKKFSGPRWEALVKKGAKKQRLLWAST
Sbjct  355   LIDKMLEKIGTPEALALRGKAAVAQAKLANQLYQKKFSGPRWEALVKKGAKKQRLLWAST  414

Query  1177  SVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKL  1356
             SVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHG+V+RTIDANVS+AEG+Y+A++KL
Sbjct  415   SVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGTVSRTIDANVSDAEGVYSALEKL  474

Query  1357  GVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             G+DW +VG QLE EGVDSFKK+FDSLL SL+EK N
Sbjct  475   GIDWDEVGKQLELEGVDSFKKAFDSLLGSLEEKGN  509



>ref|XP_008776974.1| PREDICTED: uncharacterized protein LOC103696994 [Phoenix dactylifera]
Length=382

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/373 (79%), Positives = 339/373 (91%), Gaps = 0/373 (0%)
 Frame = +1

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             V+RCS+  GNG+P KRT+LHDLYE+QGQSPWYDNLCRPVTDL+PLI SGVRGVTSNP IF
Sbjct  3     VVRCSEQDGNGAPAKRTALHDLYEQQGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPTIF  62

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             QKAIS+S+AY++QF++LV AGKDIES+YWELV+ DIQDACKLFEPIY++T+ GDGYVSVE
Sbjct  63    QKAISSSSAYDEQFRQLVTAGKDIESIYWELVINDIQDACKLFEPIYEQTDGGDGYVSVE  122

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSPRLA+DT GTIEAAKWLHK V+R NVYIKIPATA C+PS+KEVI+NGISVNVTLIFS+
Sbjct  123   VSPRLANDTNGTIEAAKWLHKVVNRPNVYIKIPATAECVPSVKEVISNGISVNVTLIFSL  182

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLE+SG +DLS++TSVASFFVSRVDTL+DK+LE+IG+PEALDLRGKAA
Sbjct  183   SRYEAVIDAYLDGLESSGHDDLSRITSVASFFVSRVDTLIDKMLEEIGTPEALDLRGKAA  242

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQAALA++LY             KKGAKKQRLLWAST VKNPAYPDTLYVDPLIGPDTV
Sbjct  243   VAQAALAYKLYXXXXXXXXXXXXXKKGAKKQRLLWASTGVKNPAYPDTLYVDPLIGPDTV  302

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPDQAL AFIDHG+V+RTID+N+SEAEGIY+A++KLG+DW +VG+QLE EGVDSF+KS
Sbjct  303   STMPDQALQAFIDHGTVSRTIDSNLSEAEGIYSALEKLGIDWNKVGSQLEVEGVDSFRKS  362

Query  1423  FDSLLDSLQEKAN  1461
             FDSLL SLQ+K +
Sbjct  363   FDSLLVSLQKKCD  375



>ref|XP_006844452.1| hypothetical protein AMTR_s00016p00076190 [Amborella trichopoda]
 gb|ERN06127.1| hypothetical protein AMTR_s00016p00076190 [Amborella trichopoda]
Length=433

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/373 (79%), Positives = 343/373 (92%), Gaps = 1/373 (0%)
 Frame = +1

Query  343   VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             +++CS+  GNG+P K T+LHDLYEKQGQSPWYDNLCRPVTDL PLI SGVRGVTSNP IF
Sbjct  55    IVKCSKMDGNGAPTK-TTLHDLYEKQGQSPWYDNLCRPVTDLKPLIASGVRGVTSNPTIF  113

Query  523   QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
             Q AIS+S+AY+DQF++L +AGKDIES YWELV+KDIQDACKLFEPIYD T+  DGYVSVE
Sbjct  114   QNAISSSSAYDDQFRQLNEAGKDIESAYWELVIKDIQDACKLFEPIYDGTDGADGYVSVE  173

Query  703   VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
             VSP+LA +TEGTIEAAKWL+K VDR NVYIKIPATA C+PSIKEVI+NGISVNVTLIFS+
Sbjct  174   VSPKLAHETEGTIEAAKWLYKVVDRPNVYIKIPATADCVPSIKEVISNGISVNVTLIFSL  233

Query  883   ERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaa  1062
              RYEAVIDAYLDGLE+SGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEAL LRGKAA
Sbjct  234   PRYEAVIDAYLDGLESSGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALALRGKAA  293

Query  1063  naqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTV  1242
              AQA LA++LYQ+KFSGPRWE+LVKKGAKKQRLLWASTSVKNPAYPDTLYV+PLIGPDTV
Sbjct  294   VAQATLAYKLYQEKFSGPRWESLVKKGAKKQRLLWASTSVKNPAYPDTLYVNPLIGPDTV  353

Query  1243  STMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKS  1422
             STMPD+AL AF+DHG V+RTID+NV +A+ +Y+A++KLG+DW +VG+QLE +GV SF KS
Sbjct  354   STMPDKALQAFLDHGVVSRTIDSNVEQAKAVYSALEKLGIDWSEVGSQLEDDGVSSFMKS  413

Query  1423  FDSLLDSLQEKAN  1461
             FDSLL +LQ+KA+
Sbjct  414   FDSLLLTLQDKAD  426



>gb|ABR16241.1| unknown [Picea sitchensis]
Length=444

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/372 (74%), Positives = 327/372 (88%), Gaps = 0/372 (0%)
 Frame = +1

Query  346   IRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQ  525
             +RC+         K+T LH+LYE+QGQSPWYDNL RPVTDLIPLIESGVRG+TSNP IF+
Sbjct  66    LRCALAEPKTKVEKKTILHELYEQQGQSPWYDNLRRPVTDLIPLIESGVRGITSNPTIFE  125

Query  526   KAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEV  705
             +AI +S+AY+DQF++L+  GK +E  YWELV+KDIQDAC+LFEPIYD TE  DGYVSVEV
Sbjct  126   RAIISSDAYDDQFRQLINEGKGVEDTYWELVIKDIQDACELFEPIYDATEGADGYVSVEV  185

Query  706   SPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIE  885
             SPRLA +TEGT+EAAKWLHK+V+RRNVYIKIPATA CIPSIK+VI+ GISVNVTLIFS+ 
Sbjct  186   SPRLALETEGTVEAAKWLHKRVNRRNVYIKIPATAECIPSIKQVISLGISVNVTLIFSLP  245

Query  886   RYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaan  1065
             RYEAVIDAY++GLE+   +DLSK+TSVASFFVSRVDTLVDK LEKIG+ +AL LRGKAA 
Sbjct  246   RYEAVIDAYMEGLESFKGDDLSKITSVASFFVSRVDTLVDKKLEKIGTDDALALRGKAAT  305

Query  1066  aqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVS  1245
             AQA LA++LYQ+KFSGPRWEAL K+GA+KQR+LWASTSVKNPAYPDTLYV+PLIGPD+V+
Sbjct  306   AQAVLAYKLYQEKFSGPRWEALEKRGARKQRVLWASTSVKNPAYPDTLYVNPLIGPDSVT  365

Query  1246  TMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSF  1425
             TMPDQAL AF+DHG+V+RTIDAN  EA+  YNAI+K+G+DW +VG+ LE EGV+SFKKSF
Sbjct  366   TMPDQALQAFMDHGNVSRTIDANFEEAKNAYNAIEKIGIDWAEVGSLLELEGVESFKKSF  425

Query  1426  DSLLDSLQEKAN  1461
             DSLL SL  KA+
Sbjct  426   DSLLVSLDGKAD  437



>gb|EPS63300.1| hypothetical protein M569_11485, partial [Genlisea aurea]
Length=321

 Score =   508 bits (1309),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 271/319 (85%), Positives = 293/319 (92%), Gaps = 0/319 (0%)
 Frame = +1

Query  505   SNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGD  684
             SN  IFQKAISTS AYNDQF+ELV +GKDIE+ YWELVVKDIQDACKLFE IYDET+  D
Sbjct  1     SNSQIFQKAISTSTAYNDQFRELVLSGKDIETAYWELVVKDIQDACKLFEQIYDETDGAD  60

Query  685   GYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNV  864
             GYVSVEVSP+LADDTE T+EAAKWLHK V+R NVYIKIPATA CIPSIKEVIA GISVNV
Sbjct  61    GYVSVEVSPQLADDTEKTVEAAKWLHKWVNRPNVYIKIPATAACIPSIKEVIAQGISVNV  120

Query  865   TLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALD  1044
             TLIFS+ RYEAVIDAY+DGLEASGL+DLS+VTSVASFFVSRVDTL+DKLLEKIG+ EALD
Sbjct  121   TLIFSLARYEAVIDAYIDGLEASGLSDLSRVTSVASFFVSRVDTLIDKLLEKIGTREALD  180

Query  1045  lrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPL  1224
             LRGKAANAQAALA+QLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAY DTLYV PL
Sbjct  181   LRGKAANAQAALAYQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYSDTLYVAPL  240

Query  1225  IGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGV  1404
             IGPDTVSTMPDQAL AF+DHG V RTID+NVSEAEGIYNA+ K+G+DW  VG+QLE EGV
Sbjct  241   IGPDTVSTMPDQALQAFLDHGIVGRTIDSNVSEAEGIYNALKKVGIDWGYVGSQLEVEGV  300

Query  1405  DSFKKSFDSLLDSLQEKAN  1461
             DSFKKSF+SLL SLQ+KA 
Sbjct  301   DSFKKSFESLLSSLQDKAT  319



>ref|XP_006420806.1| hypothetical protein CICLE_v10004979mg [Citrus clementina]
 gb|ESR34046.1| hypothetical protein CICLE_v10004979mg [Citrus clementina]
Length=354

 Score =   498 bits (1281),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 284/300 (95%), Gaps = 0/300 (0%)
 Frame = +1

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
              +ELVQ+GKDIE+ YWELV+KDIQDACKLFE IYDET+ GDGYVSVEVSPRLADDT+GT+
Sbjct  48    LRELVQSGKDIEAAYWELVIKDIQDACKLFESIYDETDGGDGYVSVEVSPRLADDTQGTV  107

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
             EAAKWLHK V+R NVYIKIPATAPC+PSIKEVI+ GISVNVTLIFS+ RYE VIDAYLDG
Sbjct  108   EAAKWLHKVVNRPNVYIKIPATAPCVPSIKEVISQGISVNVTLIFSLARYEEVIDAYLDG  167

Query  922   LEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqk  1101
             LEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEALDLRGKAA AQAALA+QLYQK
Sbjct  168   LEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEALDLRGKAAVAQAALAYQLYQK  227

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
             KFSGPRW+ALVKKGAKKQRLLWASTSVKNPAYPDTLYV PLIGPDTVSTMPDQAL AF+D
Sbjct  228   KFSGPRWDALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDTVSTMPDQALQAFVD  287

Query  1282  HGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             HG+V+RTID NVSEAEGIY+A++KLG+DW  VGTQLE EGVDSFKKSFDSLLD+LQEKAN
Sbjct  288   HGAVSRTIDLNVSEAEGIYSALEKLGIDWNYVGTQLELEGVDSFKKSFDSLLDTLQEKAN  347



>ref|XP_003525168.1| PREDICTED: uncharacterized protein LOC100811673 [Glycine max]
Length=382

 Score =   495 bits (1274),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 251/363 (69%), Positives = 307/363 (85%), Gaps = 0/363 (0%)
 Frame = +1

Query  370   NGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNA  549
             NG  IK T LH LYEKQ QSP+YDNLCRPV+DL+P I +G+RGVT+NPAIF++AIS+SNA
Sbjct  4     NGPKIKSTILHHLYEKQRQSPYYDNLCRPVSDLLPFIANGIRGVTTNPAIFERAISSSNA  63

Query  550   YNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDT  729
             Y+DQ +ELV AGKDIES YWELVVKDIQD CKL EPIY+ET+  DG+VS+ VSP+LA+DT
Sbjct  64    YDDQLRELVGAGKDIESAYWELVVKDIQDTCKLLEPIYNETDGEDGHVSLAVSPKLANDT  123

Query  730   EGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDA  909
             +GTIEAAKWLH  V    VY+KIPAT   I S+KEVI+ GISVN TLIF + +YEAVIDA
Sbjct  124   KGTIEAAKWLHNMVGSPCVYMKIPATDESISSMKEVISLGISVNATLIFCLPKYEAVIDA  183

Query  910   YLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafq  1089
             YLDGLE+ G+ DLSKV+S A+F++SRVD  +DK LE+IG+ EALDL+GK A AQA LA+Q
Sbjct  184   YLDGLESCGMTDLSKVSSAAAFYISRVDVTLDKKLEQIGTTEALDLKGKGAVAQAVLAYQ  243

Query  1090  lyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALL  1269
             LYQKKFSGPRWE L  +GAKKQRL+WAST+VKNP+YPDT YV+ LIGPDT+ST+P QAL 
Sbjct  244   LYQKKFSGPRWERLENRGAKKQRLMWASTNVKNPSYPDTFYVNSLIGPDTISTLPVQALQ  303

Query  1270  AFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             AF+DHG ++RT+DA VSEA+ IYNAI+KLG+DW  VG++LE E +DSF KSFD++L+ +Q
Sbjct  304   AFMDHGILSRTLDAKVSEAQDIYNAIEKLGIDWSSVGSELEHEVLDSFTKSFDNVLECMQ  363

Query  1450  EKA  1458
             +KA
Sbjct  364   KKA  366



>ref|XP_004503815.1| PREDICTED: transaldolase-like [Cicer arietinum]
Length=411

 Score =   494 bits (1273),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 254/403 (63%), Positives = 318/403 (79%), Gaps = 0/403 (0%)
 Frame = +1

Query  253   VDIRNKSSFDARLSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSP  432
             + I+NK+ +    S   LL +    L+   +        N   ++ + L DLYEK  QSP
Sbjct  7     IPIKNKAVYFKFHSRPSLLQYYYKPLSFKCLYAKMNDSNNTVTMRSSILKDLYEKHRQSP  66

Query  433   WYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWE  612
             +YDNLCRP++DLIP I+SG+RGVT+NPAIF+KAIS+S+AYN Q +ELV AGK IE+ YWE
Sbjct  67    YYDNLCRPISDLIPFIDSGIRGVTTNPAIFEKAISSSSAYNQQLRELVDAGKGIENAYWE  126

Query  613   LVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYI  792
             LVVKDI D CKL +PIY+E ++ DG+VS+ VSP+LA+DT+GTI+AA WLHK V   NV+I
Sbjct  127   LVVKDIHDTCKLLDPIYNEKDSLDGHVSIAVSPKLANDTKGTIDAAIWLHKMVGCPNVFI  186

Query  793   KIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVAS  972
             K+PAT   IPSIKEVI+ GISVNVTLIFS+ RYE VI+AYLDGLEA  +NDLSKV S A+
Sbjct  187   KLPATDESIPSIKEVISLGISVNVTLIFSLPRYEEVINAYLDGLEACSMNDLSKVRSAAA  246

Query  973   FFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKK  1152
             F++SRVDT +DK LE+IG+ EALDL GK A AQA LA+Q+YQK FSGPRW++L K+GAKK
Sbjct  247   FYISRVDTTIDKKLEQIGTVEALDLTGKGAVAQAVLAYQIYQKTFSGPRWKSLEKRGAKK  306

Query  1153  QRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEG  1332
             QRL+WAST+VKN +YPDT YVD LIGPDT+ST+P+ AL AF+DHG V+RTID+ VSEAE 
Sbjct  307   QRLMWASTNVKNSSYPDTFYVDSLIGPDTISTLPEHALKAFMDHGIVSRTIDSKVSEAEH  366

Query  1333  IYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             IYNAI+KLGVDW  VG+QL+ E +DSF KS+D++L  LQ KAN
Sbjct  367   IYNAIEKLGVDWSYVGSQLQHEVLDSFTKSYDNVLQCLQNKAN  409



>ref|XP_007159949.1| hypothetical protein PHAVU_002G281000g [Phaseolus vulgaris]
 gb|ESW31943.1| hypothetical protein PHAVU_002G281000g [Phaseolus vulgaris]
Length=423

 Score =   493 bits (1270),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 252/379 (66%), Positives = 308/379 (81%), Gaps = 4/379 (1%)
 Frame = +1

Query  331   NGSLVIRCSQG----GGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRG  498
             N    +RC +G      NG+ IK T LH L+ KQ QSP+YDNLC PV+DL+P I++G+RG
Sbjct  40    NRPFRLRCLRGTMEHNSNGAKIKSTILHHLFHKQRQSPYYDNLCHPVSDLLPFIDNGIRG  99

Query  499   VTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEA  678
             VT+NPAIF++AIS+SNAYN+Q ++LV AGKDIES YWELVV+DI D CKL EPIY++++ 
Sbjct  100   VTTNPAIFERAISSSNAYNEQLRKLVGAGKDIESAYWELVVQDIHDTCKLLEPIYNDSDG  159

Query  679   GDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISV  858
              DGYVSV VSP+LA+DT+GTIE AKWLHK +   NVYIKIPAT   I S+KEVI+ GISV
Sbjct  160   VDGYVSVAVSPKLANDTKGTIEEAKWLHKMIGCSNVYIKIPATDESILSMKEVISLGISV  219

Query  859   NVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEA  1038
             N TLIF ++RYEAVIDAYLDGLEA G  DLSKV+S A+F++SRVD+++DK LE+IG+ EA
Sbjct  220   NATLIFCLQRYEAVIDAYLDGLEACGRTDLSKVSSAAAFYISRVDSILDKKLEQIGTSEA  279

Query  1039  LDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVD  1218
             LDL+GK A AQA LA+QLYQKKFSG RWE L KKGAKKQRL+WAST+VK PAY DT YVD
Sbjct  280   LDLKGKGAIAQAVLAYQLYQKKFSGARWEHLEKKGAKKQRLMWASTNVKTPAYLDTFYVD  339

Query  1219  PLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAE  1398
              LIGPDT+ST+PDQAL AF+DHG ++RT+DA VSEA+ IYNAI KLG+DW  VG+QLE E
Sbjct  340   SLIGPDTISTIPDQALKAFMDHGILSRTLDARVSEAQDIYNAIQKLGIDWGSVGSQLEHE  399

Query  1399  GVDSFKKSFDSLLDSLQEK  1455
              +DSF KSF ++L  +  K
Sbjct  400   VLDSFTKSFHNVLQCIHNK  418



>gb|KEH20964.1| transaldolase family protein [Medicago truncatula]
Length=415

 Score =   489 bits (1259),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 253/370 (68%), Positives = 306/370 (83%), Gaps = 1/370 (0%)
 Frame = +1

Query  352   CSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKA  531
             C++   +     RT LHDLYEKQ QSP+YDNLCRPV+DL+P I SG+RGVT+NPAIF+KA
Sbjct  39    CAKMNNSNVTFTRTILHDLYEKQRQSPYYDNLCRPVSDLVPFIASGIRGVTTNPAIFEKA  98

Query  532   ISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSP  711
             IS+SNAYN Q +ELV+AGKD ES YWELVVKDI D CKL EPIY+E++  DGYVS+ VSP
Sbjct  99    ISSSNAYNHQLRELVEAGKDTESAYWELVVKDIHDTCKLLEPIYNESDGIDGYVSIAVSP  158

Query  712   RLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERY  891
              LA+DT+GTIEAAK LHK V   NVYIKIPAT   IPSIKEVI+ GISVNVTLIFS+  Y
Sbjct  159   ELANDTKGTIEAAKCLHKMVGCPNVYIKIPATHESIPSIKEVISLGISVNVTLIFSLPIY  218

Query  892   EAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaq  1071
             EAVI+AYLDGLEAS   DLSKV+S A+F++SRVD  ++K LE+IG+ EALDL+GKAA AQ
Sbjct  219   EAVINAYLDGLEASSNTDLSKVSSAAAFYISRVDVTIEKKLEQIGTAEALDLKGKAAVAQ  278

Query  1072  aalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTM  1251
             A LA+QLYQK FSGPRWE L K+GAKKQRL+WAST+VKN AY DT YV+ LIGPDT+STM
Sbjct  279   AVLAYQLYQKMFSGPRWERLEKRGAKKQRLMWASTNVKNSAYSDTFYVNSLIGPDTISTM  338

Query  1252  PDQ-ALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFD  1428
             P + AL AF+DHG ++RT+DA VSEA+ IYN I+KLG+DW  VG+QLE E +DSF +SFD
Sbjct  339   PPEPALKAFMDHGILSRTLDAKVSEAQSIYNEIEKLGIDWSGVGSQLEHEILDSFTRSFD  398

Query  1429  SLLDSLQEKA  1458
             ++++ L++KA
Sbjct  399   NVIECLRKKA  408



>ref|XP_008453653.1| PREDICTED: uncharacterized protein LOC103494305 [Cucumis melo]
Length=398

 Score =   481 bits (1237),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 239/396 (60%), Positives = 321/396 (81%), Gaps = 5/396 (1%)
 Frame = +1

Query  271   SSFDARLSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLC  450
             S  +  +S + + +F+   +N S  + CS+ G     ++++ LHDL+E+QGQSP+YD +C
Sbjct  5     SLLNINISQAVMASFSNLLMNQSCFVACSKNG-----LRKSILHDLHERQGQSPYYDKIC  59

Query  451   RPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDI  630
             RP T+L+PL+ SG++GVTSNP IF+++I +S AY++QF+EL + GKD+ES YWELV KDI
Sbjct  60    RPATELLPLLASGIKGVTSNPKIFERSILSSKAYDEQFRELAKEGKDVESAYWELVTKDI  119

Query  631   QDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATA  810
             +D   + EPIY ET   DGYVSV+VSP LAD+TE T+EAAKWLHKK+ R NVYIKIPATA
Sbjct  120   RDTSVILEPIYKETAGLDGYVSVQVSPWLADNTEETVEAAKWLHKKLGRPNVYIKIPATA  179

Query  811   PCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRV  990
               IP+IK+VI+ GISVN TLIF I  YE VI+AYL+GLE+SGL+DLS ++S A+F++SRV
Sbjct  180   ESIPAIKQVISQGISVNATLIFCISTYEKVIEAYLNGLESSGLSDLSAISSAAAFYISRV  239

Query  991   DTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWA  1170
             D +VD  LEKI + +AL+LRGKAA AQAA+A++++++KFSGPRWEAL K+GAKKQRL+WA
Sbjct  240   DAVVDAELEKIATHQALELRGKAARAQAAIAYKIFREKFSGPRWEALAKRGAKKQRLMWA  299

Query  1171  STSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAID  1350
             ST+VKNPAYPDT YVD LIGP+T+ST+P++AL AF+DHG V+RT+D+N+ EAE +Y  I+
Sbjct  300   STNVKNPAYPDTYYVDLLIGPETISTIPEEALGAFMDHGIVSRTLDSNMEEAESVYKGIE  359

Query  1351  KLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
             KLG+DWK +G QLE + +D FKKS+D++L SLQ KA
Sbjct  360   KLGIDWKGIGWQLEDQVLDLFKKSYDTVLYSLQHKA  395



>ref|XP_002960808.1| hypothetical protein SELMODRAFT_74909 [Selaginella moellendorffii]
 gb|EFJ38347.1| hypothetical protein SELMODRAFT_74909 [Selaginella moellendorffii]
Length=372

 Score =   468 bits (1205),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 252/358 (70%), Positives = 297/358 (83%), Gaps = 1/358 (0%)
 Frame = +1

Query  385   KRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQF  564
             K T LH+LY K  QSPWYDNL RPVTDL PLI+SGVRGVTSNP IFQKAIS+S+AY+ QF
Sbjct  11    KLTLLHELYSKHQQSPWYDNLRRPVTDLQPLIDSGVRGVTSNPTIFQKAISSSDAYDPQF  70

Query  565   KELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIE  744
             + LVQ G  +E  YW++V+KDIQDAC LF  ++  ++  DGYVSVEVSP LA +T+ T+ 
Sbjct  71    RFLVQGGSKVEDAYWQMVIKDIQDACDLFLGVFSSSKGEDGYVSVEVSPLLAHETDETLN  130

Query  745   AAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGL  924
             AAKWLHK+V+R NVY+KIPATA C+PSI+  I+ GISVNVTLIFS+ RYEAVIDAYLDGL
Sbjct  131   AAKWLHKEVNRPNVYVKIPATAECVPSIRSAISLGISVNVTLIFSLPRYEAVIDAYLDGL  190

Query  925   EASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkk  1104
             EA    DLS V+SVASFFVSRVDTLVDK L +IG+ EAL LRGKAA AQAALAFQLY+KK
Sbjct  191   EARE-GDLSGVSSVASFFVSRVDTLVDKRLNEIGTDEALQLRGKAAVAQAALAFQLYEKK  249

Query  1105  FSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDH  1284
             FSGPRWEAL K+GA+KQRLLWASTSVKNPAY DTLY+D LIGPDTV+TMP  AL AF+DH
Sbjct  250   FSGPRWEALKKRGARKQRLLWASTSVKNPAYSDTLYIDTLIGPDTVNTMPGNALEAFVDH  309

Query  1285  GSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
             G++ART+D++V  A+ IY+ I+ LG+ W  VG+ LE EGVDSFKKSF+ LL SL+ KA
Sbjct  310   GTLARTLDSDVDGAQKIYDKIEALGIRWDDVGSLLEIEGVDSFKKSFEDLLVSLKLKA  367



>ref|XP_002983861.1| hypothetical protein SELMODRAFT_271673 [Selaginella moellendorffii]
 gb|EFJ14873.1| hypothetical protein SELMODRAFT_271673 [Selaginella moellendorffii]
Length=422

 Score =   469 bits (1208),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 298/358 (83%), Gaps = 1/358 (0%)
 Frame = +1

Query  385   KRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQF  564
             K T LH+LY K  QSPWYDNL RPVTDL PLI+SGVRGVTSNP IFQKAIS+S+AY+ QF
Sbjct  61    KLTLLHELYSKHQQSPWYDNLRRPVTDLQPLIDSGVRGVTSNPTIFQKAISSSDAYDPQF  120

Query  565   KELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIE  744
             ++LV+ G  +E  YW++V+KDIQDAC LF  ++  ++  DGYVSVEVSP LA +T+ T+ 
Sbjct  121   RQLVKGGSKVEDAYWQMVIKDIQDACDLFLGVFSSSKGEDGYVSVEVSPLLAHETDETLN  180

Query  745   AAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGL  924
             AAKWLHK+V+R NVY+KIPATA C+PSI+  I+ GISVNVTLIFS+ RYEAVIDAYLDGL
Sbjct  181   AAKWLHKEVNRPNVYVKIPATAECVPSIRSAISLGISVNVTLIFSLPRYEAVIDAYLDGL  240

Query  925   EASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkk  1104
             EA    DLS V+SVASFFVSRVDTLVDK L +IG+ EAL LRGKAA AQAALAFQLY+KK
Sbjct  241   EARE-GDLSGVSSVASFFVSRVDTLVDKRLNEIGTDEALQLRGKAAVAQAALAFQLYEKK  299

Query  1105  FSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDH  1284
             FSGPRWEAL K+GA+KQRLLWASTSVKNPAY DTLY+D LIGPDTV+TMP  AL AF+DH
Sbjct  300   FSGPRWEALKKRGARKQRLLWASTSVKNPAYSDTLYIDTLIGPDTVNTMPGNALEAFVDH  359

Query  1285  GSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
             G++ART+D++V  A+ IY+ I+ LG+ W  VG+ LE EGVDSFKKSF+ LL SL+ KA
Sbjct  360   GTLARTLDSDVDGAQKIYDKIEALGIRWDDVGSLLEIEGVDSFKKSFEDLLVSLKLKA  417



>ref|XP_001773190.1| predicted protein [Physcomitrella patens]
 gb|EDQ62043.1| predicted protein [Physcomitrella patens]
Length=438

 Score =   468 bits (1205),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 244/359 (68%), Positives = 302/359 (84%), Gaps = 1/359 (0%)
 Frame = +1

Query  385   KRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQF  564
             K+T LHD+Y++Q QSPWYDNL RPVT L P I+SGVRGVTSNP IF+KAI+ S  Y+DQF
Sbjct  75    KKTLLHDMYDQQKQSPWYDNLRRPVTMLEPFIKSGVRGVTSNPTIFEKAITGSAEYDDQF  134

Query  565   KELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIE  744
             ++ ++ GK++E  YWELV+KDIQDAC LF P+Y+++  GDGY+SVEVSP LA++T+ TI+
Sbjct  135   RQCIKEGKNVEEAYWELVIKDIQDACDLFLPLYEKSAGGDGYISVEVSPLLANETQATID  194

Query  745   AAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGL  924
             +AK+LHK+V+R NV IKIPAT  CI SIK+VIA+ ISVNVTLIFS+ RYE VIDAY+ GL
Sbjct  195   SAKYLHKRVNRPNVLIKIPATLECIESIKQVIASSISVNVTLIFSLARYEKVIDAYIAGL  254

Query  925   EASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkk  1104
             EA    DLSK+ SVASFFVSRVD+LVDK L  IG+ EAL+L+GKAANAQAALAF+LYQ+K
Sbjct  255   EAVQ-GDLSKIASVASFFVSRVDSLVDKKLNAIGTKEALELKGKAANAQAALAFKLYQEK  313

Query  1105  FSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDH  1284
             FSGPRWEAL K+GA+KQR+LWAST VK+P+YPDTLYV+PLIGPDTV+TMPD AL AF+DH
Sbjct  314   FSGPRWEALAKRGAQKQRVLWASTGVKDPSYPDTLYVNPLIGPDTVTTMPDGALNAFVDH  373

Query  1285  GSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             G VARTIDA++  AE IY+ +++LG+ W+ VG QLE EGV SFKKSF  L+ +L  KA+
Sbjct  374   GVVARTIDADLPGAERIYDKVEELGIRWEDVGNQLEHEGVASFKKSFTDLVQNLTAKAD  432



>ref|XP_007043771.1| Aldolase-type TIM barrel family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX99602.1| Aldolase-type TIM barrel family protein isoform 2, partial [Theobroma 
cacao]
Length=320

 Score =   459 bits (1182),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 250/301 (83%), Positives = 272/301 (90%), Gaps = 1/301 (0%)
 Frame = +1

Query  244   KCFVDIRNKSSFDARLSSSKLLAFAKPSL-NGSLVIRCSQGGGNGSPIKRTSLHDLYEKQ  420
             KCFV  R   SF ++L SS  L+     L  GSLV+RCS   GNGS +KRT+LHDLYEK+
Sbjct  20    KCFVGFRATGSFGSKLVSSSSLSLTNNHLLKGSLVLRCSLADGNGSSVKRTTLHDLYEKE  79

Query  421   GQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIES  600
             GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIFQKAIS+SNAYNDQF+ELVQ+GKDIES
Sbjct  80    GQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIFQKAISSSNAYNDQFRELVQSGKDIES  139

Query  601   LYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRR  780
              YWELVVKDIQDACKLFEPIYD+T+ GDGYVSVEVSPRLADDTEGTIEAAK+LHK VD  
Sbjct  140   AYWELVVKDIQDACKLFEPIYDQTDGGDGYVSVEVSPRLADDTEGTIEAAKYLHKVVDCP  199

Query  781   NVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVT  960
             NVYIKIPATAPCIPSIKEVI+ GISVNVTLIFS+ RYEAVIDAYLDGLEASGL+DLS+VT
Sbjct  200   NVYIKIPATAPCIPSIKEVISKGISVNVTLIFSLARYEAVIDAYLDGLEASGLSDLSRVT  259

Query  961   SVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKK  1140
             SVASFFVSRVDTL+DK+LEKIG+PEALDLRGKAA AQAALA+QLYQKKFSGPRWEALVKK
Sbjct  260   SVASFFVSRVDTLIDKMLEKIGTPEALDLRGKAAVAQAALAYQLYQKKFSGPRWEALVKK  319

Query  1141  G  1143
             G
Sbjct  320   G  320



>ref|XP_008674626.1| PREDICTED: uncharacterized protein LOC103650820 [Zea mays]
Length=310

 Score =   402 bits (1034),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/225 (84%), Positives = 210/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  367   GNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSN  546
             GNG+P K+TSLHDLYE QG SPWYDNLCRPVTDL+PLI SGVRGVTSNPAIFQKAIS+S+
Sbjct  7     GNGAPTKKTSLHDLYELQGLSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIFQKAISSSS  66

Query  547   AYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADD  726
             AY+DQFK+L+  GKD ES YWELV+KDIQDAC LFEPIYDET+  DGYVSVEVSPRLA+D
Sbjct  67    AYDDQFKQLISGGKDAESAYWELVIKDIQDACSLFEPIYDETDGADGYVSVEVSPRLAND  126

Query  727   TEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVID  906
             T+GT+EAAKWLHK V+R NVYIKIPATA C+PSI+EVIANGISVNVTLIFSI RYEAVID
Sbjct  127   TQGTVEAAKWLHKVVNRPNVYIKIPATAECVPSIREVIANGISVNVTLIFSIARYEAVID  186

Query  907   AYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEAL  1041
             AYLDGLEASGL+DLS+VTSVASFFVSRVDTL+DK+LEKIG+PEAL
Sbjct  187   AYLDGLEASGLSDLSRVTSVASFFVSRVDTLIDKMLEKIGTPEAL  231



>gb|ACU21292.1| unknown [Glycine max]
Length=269

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 205/270 (76%), Positives = 221/270 (82%), Gaps = 1/270 (0%)
 Frame = +1

Query  163  MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
            MA+I KLS P  A+S S   R        F    N  ++   LS+S L +     L  SL
Sbjct  1    MASIFKLSTPSPAASLSEALRPRDSRFLSFNPSSNAINYKINLSAS-LRSIHSLPLKTSL  59

Query  343  VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
             I+CSQ  GNGSP KRT LHDLYEK+GQSPWYDNLCRPVTDL+PLI SGVRGVTSNPAIF
Sbjct  60   RIKCSQTDGNGSPAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIF  119

Query  523  QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
            QKA S+SNAYNDQF+ELVQAGKDIES YWELVVKDIQDACKLFEPIYD+T+ GDGYVSVE
Sbjct  120  QKATSSSNAYNDQFRELVQAGKDIESAYWELVVKDIQDACKLFEPIYDQTDGGDGYVSVE  179

Query  703  VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
            VSPRLADDTEGTIEAAKWLHK VDR NVYIKIPAT  C+PSIKEVIANGISVNVTLIFS+
Sbjct  180  VSPRLADDTEGTIEAAKWLHKVVDRPNVYIKIPATEACVPSIKEVIANGISVNVTLIFSL  239

Query  883  ERYEAVIDAYLDGLEASGLNDLSKVTSVAS  972
             RYEAVIDAYLDGLEASG NDLS+VTSVAS
Sbjct  240  ARYEAVIDAYLDGLEASGSNDLSRVTSVAS  269



>ref|XP_003530596.1| PREDICTED: uncharacterized protein LOC100806367 [Glycine max]
Length=312

 Score =   390 bits (1003),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 203/298 (68%), Positives = 250/298 (84%), Gaps = 0/298 (0%)
 Frame = +1

Query  565   KELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIE  744
             +ELV+AGKDIES YWELVVKDIQD CKL E IY+ET+  DG+VS+ VSP+LA+DT+GTIE
Sbjct  5     RELVEAGKDIESAYWELVVKDIQDTCKLLELIYNETDGEDGHVSLAVSPKLANDTKGTIE  64

Query  745   AAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGL  924
             AAKWLH  V    VY+KIPAT   I S+KEVI+ GISVN TLIF + +YEAVIDAYLDGL
Sbjct  65    AAKWLHNMVGSPCVYMKIPATDESISSMKEVISLGISVNATLIFCLPKYEAVIDAYLDGL  124

Query  925   EASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkk  1104
             E+ G+ DLSKV+S A+F++SRVD  +DK LE+IG+ EALDL+GK A AQA LA+QLYQKK
Sbjct  125   ESCGMTDLSKVSSAAAFYISRVDVTLDKKLEQIGTTEALDLKGKGAVAQAVLAYQLYQKK  184

Query  1105  FSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDH  1284
             FSGPRWE L  +GAKKQRL+WAST+VKNP+YPDT YV+ LIGPDT+ST+P Q L AF+DH
Sbjct  185   FSGPRWERLENRGAKKQRLMWASTNVKNPSYPDTFYVNSLIGPDTISTLPVQVLQAFMDH  244

Query  1285  GSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
             G ++RT+DA VSEA+ IYNAI+KLG+DW  VG++LE E +DSF KSFD++L+ +Q+KA
Sbjct  245   GILSRTLDAKVSEAQDIYNAIEKLGIDWSSVGSELEHEVLDSFTKSFDNVLECMQKKA  302



>ref|XP_006598544.1| PREDICTED: uncharacterized protein LOC100797142 [Glycine max]
Length=320

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 202/297 (68%), Positives = 248/297 (84%), Gaps = 0/297 (0%)
 Frame = +1

Query  568   ELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEA  747
             ELV AGKDIES YWELVVKDIQD CKL EPIY+ET+  DG+VS+ VSP+LA+DT+GTIEA
Sbjct  14    ELVGAGKDIESAYWELVVKDIQDTCKLLEPIYNETDGEDGHVSLAVSPKLANDTKGTIEA  73

Query  748   AKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE  927
             AKWLH  V    VY+KIPAT   I S+KEVI+ GISVN TLIF + +YEAVIDAYLDGLE
Sbjct  74    AKWLHNMVGSPCVYMKIPATDESISSMKEVISLGISVNATLIFCLPKYEAVIDAYLDGLE  133

Query  928   ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF  1107
             + G+ DLSKV+S A+F++SRVD  +DK LE+IG+ EALDL+GK A AQA LA+QLYQKKF
Sbjct  134   SCGMTDLSKVSSAAAFYISRVDVTLDKKLEQIGTAEALDLKGKGAVAQAVLAYQLYQKKF  193

Query  1108  SGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHG  1287
             SGPRWE L  +GAKKQRL+WAST+VKNP+YPDT YV+ +IGPDT+ST   QAL AF+DHG
Sbjct  194   SGPRWERLENRGAKKQRLMWASTNVKNPSYPDTFYVNSVIGPDTISTFLVQALQAFMDHG  253

Query  1288  SVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
              ++RT+DA VSEA+ +YNAI+KLG+DW  VG++LE E +DSF KSFD++L+ +Q+KA
Sbjct  254   ILSRTLDAKVSEAQDMYNAIEKLGIDWSSVGSELEHEVLDSFTKSFDNVLECMQKKA  310



>ref|XP_010927795.1| PREDICTED: uncharacterized protein LOC105049749 [Elaeis guineensis]
Length=275

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/272 (71%), Positives = 225/272 (83%), Gaps = 0/272 (0%)
 Frame = +1

Query  163  MATISKLSNPGfassssftsrrsspapKCFVDIRNKSSFDARLSSSKLLAFAKPSLNGSL  342
            MA+ISKLSNP  A++SS +S      P   +     +    +LSS +L          SL
Sbjct  1    MASISKLSNPNLAAASSRSSSALRSEPTFSLKFLTGAPIQKQLSSLRLSVRRDRVERSSL  60

Query  343  VIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIF  522
            V+RCSQ  GNG+P KRT+LHDLYE+QGQSPWYDNLCRPVTDL+PLI SGVRGVTSNP IF
Sbjct  61   VVRCSQQDGNGAPAKRTTLHDLYEQQGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPTIF  120

Query  523  QKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVE  702
            QKAIS+S+AY++QF++LV AGKDIES+YWELV+ DIQDACKLFEPIYD+T+ GDGYVSVE
Sbjct  121  QKAISSSSAYDEQFRQLVSAGKDIESIYWELVINDIQDACKLFEPIYDQTDGGDGYVSVE  180

Query  703  VSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSI  882
            VSPRLA+DT GTIEAAKWLH+ V+R NVYIKIPATA C+PSIKEVI+NGI VNVTLIFS+
Sbjct  181  VSPRLANDTNGTIEAAKWLHQVVNRPNVYIKIPATAECVPSIKEVISNGICVNVTLIFSL  240

Query  883  ERYEAVIDAYLDGLEASGLNDLSKVTSVASFF  978
             RYEAVIDAYLDGLE+SGL+DLS++TSVASF 
Sbjct  241  SRYEAVIDAYLDGLESSGLDDLSRLTSVASFL  272



>ref|WP_039701607.1| transaldolase [marine actinobacterium MedAcidi-G2B]
 gb|KIE49809.1| transaldolase [marine actinobacterium MedAcidi-G2B]
Length=362

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/360 (54%), Positives = 271/360 (75%), Gaps = 4/360 (1%)
 Frame = +1

Query  391   TSLHDLYEKQGQSPWYDNLCRP---VTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             T L+DL++ +GQSPW DNL R      +L   +  GVRG+TSNP+IF+KA++ ++ Y+ +
Sbjct  2     TRLNDLFQTEGQSPWLDNLRRSWLESGELADWVTKGVRGITSNPSIFEKAMADTDDYDHE  61

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
             FKEL+ +GKD+   YW+LV+ DI  A ++ +P+Y+ +   DG+VSVEV PRLA DT GT+
Sbjct  62    FKELIASGKDVTECYWDLVITDILGALEVLKPVYESSNGTDGFVSVEVDPRLARDTSGTL  121

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
             ++A+ LHK++++ NV IKIPAT   IP ++ +I+ G SVNVTLIFS+ RY  V++AY+ G
Sbjct  122   DSARSLHKRINKPNVLIKIPATKESIPPVQTMISEGRSVNVTLIFSLSRYVEVMEAYISG  181

Query  922   LEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqk  1101
             LE S   DLSK++SVASFF+SR DT VD+ L++IGS +A DL+G+AA A    A+ L+++
Sbjct  182   LENSS-GDLSKISSVASFFISRTDTEVDRRLDEIGSQKATDLKGQAAVALGQAAYSLFKE  240

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
              FSGPRWEAL  +GA+ QR LWASTS KNP+Y DTLYVD LIGP+TV+T+P+  + AF D
Sbjct  241   TFSGPRWEALESRGARVQRPLWASTSTKNPSYVDTLYVDTLIGPNTVNTLPNTTIEAFED  300

Query  1282  HGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             HG+VART+DAN S+AE I + I  LG+D ++VG  LE EG+DSF  SF++L++SL  KA+
Sbjct  301   HGTVARTVDANSSKAEKILSEISSLGIDLEEVGDVLETEGIDSFITSFENLIESLSIKAS  360



>ref|XP_006576021.1| PREDICTED: uncharacterized protein LOC100813545 [Glycine max]
Length=353

 Score =   377 bits (968),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 244/298 (82%), Gaps = 0/298 (0%)
 Frame = +1

Query  565   KELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIE  744
             +ELV AGKDIES YWELVVKDIQD CKL EPIY+ET+  DG+VS+ +SP+LA+DT+GT E
Sbjct  46    RELVGAGKDIESAYWELVVKDIQDTCKLLEPIYNETDGEDGHVSLAISPKLANDTKGTTE  105

Query  745   AAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGL  924
             AAKWLH  V    VY+KIPAT   I S+KEVI+ GISVN TLIF + +YEAVIDAYLDGL
Sbjct  106   AAKWLHNMVGSPCVYMKIPATDESISSMKEVISLGISVNATLIFCLPKYEAVIDAYLDGL  165

Query  925   EASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkk  1104
             E+ G+ DLSKV+S A+F++SRVD  +DK LE+IG+ EALDL+GK A AQA LA+QLYQKK
Sbjct  166   ESCGMTDLSKVSSAAAFYISRVDVTLDKKLEQIGTTEALDLKGKGAVAQAVLAYQLYQKK  225

Query  1105  FSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDH  1284
             FSGPRWE L  +GAKKQRL+WAST+VKNP+Y DT YV+ +IGP T+ST   QAL AF+DH
Sbjct  226   FSGPRWERLENRGAKKQRLMWASTNVKNPSYLDTFYVNSVIGPHTISTFSVQALHAFMDH  285

Query  1285  GSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
             G ++R +DA VSEA+ IYN I+KLG+DW  VG+QLE E +DSF KSFD++L+ +Q+KA
Sbjct  286   GILSRMLDAKVSEAQDIYNEIEKLGIDWSSVGSQLEHEVLDSFTKSFDNVLECMQKKA  343



>gb|KGA04566.1| transaldolase [actinobacterium acAcidi]
Length=367

 Score =   370 bits (951),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 252/360 (70%), Gaps = 6/360 (2%)
 Frame = +1

Query  394   SLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQF  564
             +L  L+ + GQSPW DNL R       +  +I+SG+RG+TSNP+IFQKAI  S  Y+ QF
Sbjct  4     NLRLLHSEGGQSPWLDNLKRSYITSGHMRKVIDSGIRGLTSNPSIFQKAIQGSTDYDVQF  63

Query  565   KELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIE  744
              EL +AGK     YWE+V+KDI+DA +LF PIY  ++  DGYVSVEV P LA DTEGT  
Sbjct  64    SELAKAGKTAVESYWEMVIKDIRDALELFHPIYLSSDRQDGYVSVEVDPMLAHDTEGTTR  123

Query  745   AAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGL  924
             AA+ L + VDR NV IKIPAT   +  I+E+I+ G +VNVTLIFS+ERY  VI+AY+ G+
Sbjct  124   AARHLDQNVDRPNVMIKIPATVEGVSVIREMISEGRNVNVTLIFSLERYADVIEAYISGM  183

Query  925   EASGLND---LSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqly  1095
             EA   +D   LS V SVASFF+SRVD  VDK L  +G+PEA  L G  A AQA LA++L+
Sbjct  184   EALAKSDPSRLSHVASVASFFISRVDVEVDKRLAALGTPEADQLLGTCAIAQAKLAYKLF  243

Query  1096  qkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAF  1275
                FS PRW  L K GA+ QR LWASTS KNP YPDTLYVD LIGP TV+T+PD  + AF
Sbjct  244   TTSFSSPRWNDLAKLGARVQRPLWASTSTKNPLYPDTLYVDQLIGPLTVNTLPDPTMEAF  303

Query  1276  IDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              DHG++ RTIDA+V  AE  +  + KLG+D   V  QLE EGVDSF+KSF  L+ +L++K
Sbjct  304   ADHGTIERTIDADVEAAEATWEQLKKLGIDMSNVAAQLEQEGVDSFQKSFQELIAALEQK  363



>ref|WP_039703480.1| transaldolase [marine actinobacterium MedAcidi-G2A]
 gb|KIE50590.1| transaldolase [marine actinobacterium MedAcidi-G2A]
Length=364

 Score =   370 bits (950),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 193/360 (54%), Positives = 267/360 (74%), Gaps = 4/360 (1%)
 Frame = +1

Query  391   TSLHDLYEKQGQSPWYDNLCRP---VTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             T L+ L+ + GQSPW DNL R      DL   I+ GVRG+TSNP+IF+KAIS S+AY+ Q
Sbjct  2     TLLNQLFNEFGQSPWLDNLKREWLHSGDLQDWIDKGVRGLTSNPSIFEKAISQSDAYDQQ  61

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
             FK L+ +G  IE  YW+LV  DI DA +L +PI++ +   DGYVSVEV PRLA DT+ T+
Sbjct  62    FKSLITSGMSIEDAYWQLVQTDIADALRLLKPIHESSGGLDGYVSVEVDPRLARDTQATV  121

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
              AA+ L  +++ +N+YIKIP T+  +P+I+++I+ G S+NVTL+FS+ERY  VI+AY+ G
Sbjct  122   NAARELDDELNSKNLYIKIPGTSEGLPAIRQMISEGRSINVTLLFSVERYAEVIEAYISG  181

Query  922   LEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqk  1101
             LEA    DLS ++SVASFF+SR +T VDK LE+IG+PEAL L+GK A +Q  +A++L+ +
Sbjct  182   LEAYE-GDLSHISSVASFFISRTETEVDKRLEQIGTPEALALKGKTAISQGQIAYELFLE  240

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
             KFS  RW+ L  +GA+ QR LWASTS KNP YPDT+YVD LIGP+TV+T+PD  L AF+D
Sbjct  241   KFSDGRWKVLEDRGAQLQRPLWASTSTKNPDYPDTMYVDKLIGPNTVNTLPDGTLAAFLD  300

Query  1282  HGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             HG++ RTIDA+ +EA  +   +  +G+D   V  QLE EGV SF+ SF++LL++L++KA+
Sbjct  301   HGTLERTIDASFTEAHNVLANVQAIGIDLGDVAKQLEVEGVASFENSFENLLETLKQKAD  360



>gb|KGA04019.1| transaldolase [actinobacterium acAcidi]
Length=369

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/364 (53%), Positives = 259/364 (71%), Gaps = 7/364 (2%)
 Frame = +1

Query  385   KRTSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYN  555
             +   L +L+ ++GQSPW DNL R +    +L+ + ESG+RG+TSNP IFQKAI  S  Y+
Sbjct  3     RSARLVELFTQEGQSPWLDNLKRSLISSGELVKVRESGIRGLTSNPTIFQKAIQGSVDYD  62

Query  556   DQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEG  735
             +QF+ L++ G  I   YW +V++DI  A  +F P+Y+ +   DG+VSVEV P LA D  G
Sbjct  63    EQFQTLIRQGSSIIDSYWAMVLEDIHGALDVFAPVYESSAGTDGFVSVEVDPNLALDEAG  122

Query  736   TIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYL  915
             T+ A + L   V R N+ +KIPAT PCIP+I+ +IA G +VNVTLIFS+ERY+ V+DAY+
Sbjct  123   TLIAGQHLWDTVQRPNLMVKIPATQPCIPAIRAMIAAGRNVNVTLIFSLERYQKVMDAYI  182

Query  916   DGLE---ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalaf  1086
             DGLE   A+G   +  + SVASFF+SRVD+ VD  LE +G+ EAL LRGK+A  QA LA+
Sbjct  183   DGLEDRLAAG-QTIDGIASVASFFISRVDSEVDARLEALGTSEALSLRGKSAIGQAVLAY  241

Query  1087  qlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQAL  1266
             + +Q  FSG RWEALV+ GAK QR LWASTS KNP YPDTLYVD LIGPD+V+T+PD  +
Sbjct  242   EAFQTTFSGSRWEALVQHGAKVQRPLWASTSTKNPDYPDTLYVDQLIGPDSVNTLPDATV  301

Query  1267  LAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              AF DHG+V+RTID N  +A   + ++  +G+D + V  +LE EGV +F+KSF  L+D+L
Sbjct  302   DAFADHGTVSRTIDTNTDQAHADWQSLQMVGIDMEDVAQKLEREGVATFQKSFTELIDAL  361

Query  1447  QEKA  1458
              EKA
Sbjct  362   TEKA  365



>ref|WP_038290153.1| transaldolase [actinobacterium acAcidi]
Length=360

 Score =   360 bits (924),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/357 (54%), Positives = 256/357 (72%), Gaps = 7/357 (2%)
 Frame = +1

Query  406   LYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELV  576
             ++ ++GQSPW DNL R +    +L+ + ESG+RG+TSNP IFQKAI  S  Y++QF+ L+
Sbjct  1     MFTQEGQSPWLDNLKRSLISSGELVKVRESGIRGLTSNPTIFQKAIQGSVDYDEQFQTLI  60

Query  577   QAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKW  756
             + G  I   YW +V++DI  A  +F P+Y+ +   DG+VSVEV P LA D  GT+ A + 
Sbjct  61    RQGSSIIDSYWAMVLEDIHGALDVFAPVYESSAGTDGFVSVEVDPNLALDEAGTLIAGQH  120

Query  757   LHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---  927
             L   V R N+ +KIPAT PCIP+I+ +IA G +VNVTLIFS+ERY+ V+DAY+DGLE   
Sbjct  121   LWDTVQRPNLMVKIPATQPCIPAIRAMIAAGRNVNVTLIFSLERYQKVMDAYIDGLEDRL  180

Query  928   ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF  1107
             A+G   +  + SVASFF+SRVD+ VD  LE +G+ EAL LRGK+A  QA LA++ +Q  F
Sbjct  181   AAG-QTIDGIASVASFFISRVDSEVDARLEALGTSEALSLRGKSAIGQAVLAYEAFQTTF  239

Query  1108  SGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHG  1287
             SG RWEALV+ GAK QR LWASTS KNP YPDTLYVD LIGPD+V+T+PD  + AF DHG
Sbjct  240   SGSRWEALVQHGAKVQRPLWASTSTKNPDYPDTLYVDQLIGPDSVNTLPDATVDAFADHG  299

Query  1288  SVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
             +V+RTID N  +A   + ++  +G+D + V  +LE EGV +F+KSF  L+D+L EKA
Sbjct  300   TVSRTIDTNTDQAHADWQSLQMVGIDMEDVAQKLEREGVATFQKSFTELIDALTEKA  356



>ref|WP_011751576.1| transaldolase [Nocardioides sp. JS614]
 ref|YP_919314.1| transaldolase [Nocardioides sp. JS614]
 gb|ABL79451.1| transaldolase [Nocardioides sp. JS614]
Length=446

 Score =   361 bits (926),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 184/362 (51%), Positives = 260/362 (72%), Gaps = 5/362 (1%)
 Frame = +1

Query  391   TSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             + LH L+++QGQSPW DNL RP      L  L+  GVRGVT+NP I  KAI  S+AY+DQ
Sbjct  80    SRLHRLFDEQGQSPWLDNLTRPHLRDGTLADLVARGVRGVTANPTIVAKAIEASDAYDDQ  139

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
             FK+L+ AG DIE  YWEL + D+  A ++  P +  +   DG+VS+EV+P+ A D E TI
Sbjct  140   FKDLLSAGHDIEDAYWELALTDVAHALQILRPTFHHSGGHDGFVSIEVAPQWARDIEATI  199

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
               A++LH+++ + N+ +K+PATA  + +++ +I  G S+NVTL+FS+ RY  ++DAYL G
Sbjct  200   ADARYLHERIHQPNLLVKVPATAEGVHAVEALIGEGRSINVTLVFSLTRYREILDAYLSG  259

Query  922   LEASGLN--DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqly  1095
             +EA  L+  DL+ + SVASFFVSRVDT VD+ LE++G+ EAL LRG+AA AQA LA+QL+
Sbjct  260   MEAFALHGGDLTSIRSVASFFVSRVDTEVDRRLEELGTEEALALRGRAAIAQAKLAYQLF  319

Query  1096  qkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAF  1275
             +   SGPRW  L ++GA+ QR LWASTS KNP YPDTLYVD LIGPDTV+T+P+  + AF
Sbjct  320   RSTHSGPRWARLARRGAQVQRALWASTSTKNPHYPDTLYVDNLIGPDTVNTLPEPTIDAF  379

Query  1276  IDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              DHG+V RT+DA +++A  + +A+ ++G+D   VG  LE +G+ +F  S + +LD+L  K
Sbjct  380   EDHGTVVRTVDAGLADANFVMHALSRVGIDMDDVGLTLERQGLATFAASVNHVLDALDAK  439

Query  1456  AN  1461
             A+
Sbjct  440   AH  441



>ref|WP_038289289.1| transaldolase [actinobacterium acAcidi]
Length=350

 Score =   355 bits (912),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 242/345 (70%), Gaps = 6/345 (2%)
 Frame = +1

Query  439   DNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYW  609
             DNL R       +  +I+SG+RG+TSNP+IFQKAI  S  Y+ QF EL +AGK     YW
Sbjct  2     DNLKRSYITSGHMRKVIDSGIRGLTSNPSIFQKAIQGSTDYDVQFSELAKAGKTAVESYW  61

Query  610   ELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVY  789
             E+V+KDI+DA +LF PIY  ++  DGYVSVEV P LA DTEGT  AA+ L + VDR NV 
Sbjct  62    EMVIKDIRDALELFHPIYLSSDRQDGYVSVEVDPMLAHDTEGTTRAARHLDQNVDRPNVM  121

Query  790   IKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLND---LSKVT  960
             IKIPAT   +  I+E+I+ G +VNVTLIFS+ERY  VI+AY+ G+EA   +D   LS V 
Sbjct  122   IKIPATVEGVSVIREMISEGRNVNVTLIFSLERYADVIEAYISGMEALAKSDPSRLSHVA  181

Query  961   SVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKK  1140
             SVASFF+SRVD  VDK L  +G+PEA  L G  A AQA LA++L+   FS PRW  L K 
Sbjct  182   SVASFFISRVDVEVDKRLAALGTPEADQLLGTCAIAQAKLAYKLFTTSFSSPRWNDLAKL  241

Query  1141  GAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVS  1320
             GA+ QR LWASTS KNP YPDTLYVD LIGP TV+T+PD  + AF DHG++ RTIDA+V 
Sbjct  242   GARVQRPLWASTSTKNPLYPDTLYVDQLIGPLTVNTLPDPTMEAFADHGTIERTIDADVE  301

Query  1321  EAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              AE  +  + KLG+D   V  QLE EGVDSF+KSF  L+ +L++K
Sbjct  302   AAEATWEQLKKLGIDMSNVAAQLEQEGVDSFQKSFQELIAALEQK  346



>ref|WP_015442190.1| transaldolase [Ilumatobacter coccineus]
 ref|YP_007564881.1| transaldolase [Ilumatobacter coccineus YM16-304]
 dbj|BAN02943.1| transaldolase [Ilumatobacter coccineus YM16-304]
Length=369

 Score =   353 bits (906),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 200/361 (55%), Positives = 258/361 (71%), Gaps = 6/361 (2%)
 Frame = +1

Query  397   LHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFK  567
             L DLY +QGQS W DNL R       L+ + +SGVRG+TSNP+IFQKAI  S+ Y++QF+
Sbjct  5     LVDLYNEQGQSAWLDNLKRDYITSGKLVDIRDSGVRGLTSNPSIFQKAIQGSSDYDEQFR  64

Query  568   ELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEA  747
             E+   G      YW LV++DI  AC +F  +YD ++  DGYVSVEV+P LA D  GT  A
Sbjct  65    EIAADGGSTIDDYWSLVIRDIHGACDVFSKVYDHSDGVDGYVSVEVAPDLAHDGPGTEAA  124

Query  748   AKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE  927
             A+ LH++++RRN+ +KIP T   +  I+++IA G S+NVTLIFS+ RYE VI+AY+ GLE
Sbjct  125   ARELHERINRRNLMVKIPGTEAGLAPIEQMIAEGRSINVTLIFSLPRYEKVIEAYISGLE  184

Query  928   ASGLN---DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyq  1098
                 +   DLS+V SVASFF+SRVD  VDK LE  GS EAL LRGKAA AQ  LA++L+ 
Sbjct  185   QFATDPDADLSQVASVASFFISRVDVEVDKRLEANGSDEALALRGKAAVAQGQLAYKLFL  244

Query  1099  kkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFI  1278
              KFSG RWE L  +GA+ QR LWASTS KN AYPDTLYVD LIGPDTV+T+PD  L AF 
Sbjct  245   DKFSGERWEKLAARGARVQRPLWASTSTKNDAYPDTLYVDELIGPDTVNTLPDATLDAFA  304

Query  1279  DHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
             DHG++ART+DA+ + AE I+ A+  +GVD   V  QLE EGV SF+ +FD L+++L+ KA
Sbjct  305   DHGTLARTVDADFAAAEAIWAALPGVGVDMDDVADQLEREGVSSFQAAFDELIEALEAKA  364

Query  1459  N  1461
             +
Sbjct  365   S  365



>gb|EEC72073.1| hypothetical protein OsI_05007 [Oryza sativa Indica Group]
Length=258

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +1

Query  340  LVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAI  519
            ++   S   GNG+P KRT+LHDLY+ QGQSPWYDNLCRPVTDL+PLI SGVRGVTSNP+I
Sbjct  51   IIAMASAKEGNGAPTKRTTLHDLYDLQGQSPWYDNLCRPVTDLLPLIGSGVRGVTSNPSI  110

Query  520  FQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSV  699
            FQKAISTSNAY+DQFK+L+ AGKD ES YWELV+KDIQDACKLFEPIYD+T+  DGYVSV
Sbjct  111  FQKAISTSNAYDDQFKQLILAGKDAESAYWELVIKDIQDACKLFEPIYDQTDGADGYVSV  170

Query  700  EVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFS  879
            EVSPRLA+DT+GT+EAAKWLHK VDR NVYIKIPATA C+PSIKEVIANGISVNVTLIFS
Sbjct  171  EVSPRLANDTQGTVEAAKWLHKVVDRPNVYIKIPATAECVPSIKEVIANGISVNVTLIFS  230

Query  880  IERYEAVIDAYLDGLEAS  933
            I RYEAVIDAY+DGLEAS
Sbjct  231  IARYEAVIDAYIDGLEAS  248



>ref|WP_012687332.1| transaldolase [Rhodococcus opacus]
 ref|YP_002777267.1| transaldolase [Rhodococcus opacus B4]
 dbj|BAH48322.1| transaldolase [Rhodococcus opacus B4]
Length=381

 Score =   352 bits (902),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 254/368 (69%), Gaps = 7/368 (2%)
 Frame = +1

Query  373   GSPIKRTSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTS  543
             G+ + R  LH LY +QGQSPW DNL RP      L   + +G+RGVT+NP IF +AI+ S
Sbjct  11    GATVSR--LHRLYREQGQSPWLDNLTRPYLRDGTLAEFVAAGIRGVTANPTIFARAIAGS  68

Query  544   NAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLAD  723
             +AY+ QF  L+  G+ +E  YWEL   D+ DA  +  P+YD +   DG+VS+EV+P LA 
Sbjct  69    DAYDAQFAALIAQGRAVEDAYWELAAADVVDAAAVLRPVYDTSGGTDGFVSIEVAPELAR  128

Query  724   DTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVI  903
             DT+ TI AA  LH+++ R NV++KIPATA  IP+I ++I  G+S+N+TLIFS+ RYE VI
Sbjct  129   DTDATIAAAGRLHERIARPNVFVKIPATAEGIPAIADMIGKGVSINITLIFSLARYEQVI  188

Query  904   DAYLDGLEASGLN--DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaa  1077
             +AYL GLEA      DL+ V SVASFFVSRVDT VDK LE  G PEA  LRG+AA AQA 
Sbjct  189   EAYLQGLEARAARGADLAAVRSVASFFVSRVDTEVDKRLEHSGDPEAPALRGRAAIAQAR  248

Query  1078  lafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPD  1257
             LA++++Q +F+G RWE L  +GA+ QR LWASTS KNP YPDT YVD LIGPDTV+T+P+
Sbjct  249   LAYRIFQDRFTGTRWETLAARGARVQRPLWASTSTKNPDYPDTRYVDSLIGPDTVNTLPE  308

Query  1258  QALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLL  1437
               + AF DHG++ R+ID   + A  + + +   G+D   VG  LE +GV +F +SF  LL
Sbjct  309   ATITAFEDHGTLTRSIDTVPAGAAAVLDELAAAGIDMDDVGRTLEDQGVAAFHQSFADLL  368

Query  1438  DSLQEKAN  1461
               L+ KA+
Sbjct  369   TELRAKAH  376



>ref|WP_011599176.1| transaldolase [Rhodococcus jostii]
 ref|YP_707479.1| transaldolase [Rhodococcus jostii RHA1]
 gb|ABG99321.1| transaldolase [Rhodococcus jostii RHA1]
Length=380

 Score =   348 bits (892),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 188/368 (51%), Positives = 254/368 (69%), Gaps = 7/368 (2%)
 Frame = +1

Query  373   GSPIKRTSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTS  543
             G+ + R  LH LY +QGQSPW DNL RP      L   + +G+RGVT+NP IF +AI+ S
Sbjct  10    GAAVSR--LHRLYREQGQSPWLDNLTRPYLRDGTLAGFVAAGIRGVTANPTIFARAIAGS  67

Query  544   NAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLAD  723
             +AY+ QF  L+  G  +E  YWEL   D+ DA  +  P+YD +   DG+VS+EV+P LA 
Sbjct  68    DAYDAQFAALIAQGLAVEDAYWELAAADVVDAAAILRPVYDTSGGTDGFVSIEVAPELAR  127

Query  724   DTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVI  903
             DT+ TI AA  LH+++ R NV++KIPATA  IP+I ++I  G+S+N+TLIFS+ RYE VI
Sbjct  128   DTDATIAAAGRLHERIARPNVFVKIPATAEGIPAIADMIGKGVSINITLIFSLARYEQVI  187

Query  904   DAYLDGLE--ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaa  1077
             +AYL GLE  A+   + + V SVASFFVSRVDT VD+ LE  G PEA  LRG+AA AQA 
Sbjct  188   EAYLQGLETLAARGGEPAAVRSVASFFVSRVDTEVDRRLEHSGDPEAPGLRGRAAIAQAR  247

Query  1078  lafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPD  1257
             LA+++++ +F+GPRWE L  +GA+ QR LWASTS KNP YPDT YVD LIGPDTV+T+P+
Sbjct  248   LAYRIFRDRFTGPRWETLAARGARVQRPLWASTSTKNPDYPDTRYVDSLIGPDTVNTLPE  307

Query  1258  QALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLL  1437
               + AF DHG++ R+ID + + A  +   +  +G+D   VG  LE +GV +F +S+  LL
Sbjct  308   ATITAFEDHGTLTRSIDTDPAAAATVLGELAAVGIDMDDVGRTLEDQGVTAFHQSYADLL  367

Query  1438  DSLQEKAN  1461
               L  KA+
Sbjct  368   TELHAKAH  375



>ref|WP_006240966.1| transaldolase [Mycobacterium tusciae]
Length=368

 Score =   347 bits (889),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/362 (52%), Positives = 241/362 (67%), Gaps = 5/362 (1%)
 Frame = +1

Query  391   TSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             T L  LY +QGQSPW DNL RP      L   +  G+RGVT+NP I  KA+  S+AY+ Q
Sbjct  2     TQLKLLYTEQGQSPWLDNLTRPYLRDGTLAAFVADGIRGVTANPTILAKAMQASDAYDGQ  61

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
             F  L+ AG  +E  YWEL V+D+ DA  +  P YD +  GDG+VS+EV+P LA DT  TI
Sbjct  62    FFALIAAGSSVEEAYWELAVQDVTDALAVLRPTYDASHGGDGFVSIEVAPELARDTAATI  121

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
              AA  LH+++ R N+ +KIPAT   IP+I   I  G+S+NVTLIFS+ RY+ VI+AYL G
Sbjct  122   AAASRLHERIARPNLLVKIPATTEGIPAIAATIGRGMSINVTLIFSLARYDEVIEAYLLG  181

Query  922   LE--ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqly  1095
             LE  A    DLS V SVASFFVSRVD  VDK LE+IG  +A  LRG+AA AQA LA++++
Sbjct  182   LETLAGRGGDLSAVRSVASFFVSRVDAQVDKRLEQIGVQDAAALRGRAAIAQARLAYRMF  241

Query  1096  qkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAF  1275
              ++F+G RWE L  +GA  Q  LWASTS KNP YP TLY D LIGPDT++TM +  + AF
Sbjct  242   TERFAGTRWEKLAARGAHPQLPLWASTSTKNPDYPATLYADSLIGPDTINTMAESTIAAF  301

Query  1276  IDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               HG+VARTID  + EA  +   +  +G+D   V   LE +GV SF +SF  LL +L++K
Sbjct  302   EAHGTVARTIDTEIDEAARVMENLRAVGIDMDDVAHALEDQGVASFHQSFADLLITLRDK  361

Query  1456  AN  1461
             A 
Sbjct  362   AQ  363



>ref|WP_014208649.1| transaldolase [Mycobacterium rhodesiae]
 ref|YP_004998044.1| transaldolase [Mycobacterium rhodesiae NBB3]
 gb|AEV70829.1| transaldolase [Mycobacterium rhodesiae NBB3]
Length=368

 Score =   341 bits (874),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 187/363 (52%), Positives = 242/363 (67%), Gaps = 7/363 (2%)
 Frame = +1

Query  391   TSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             T L  LY +Q QSPW DNL RP      L   +  G+RGVT+NP I  +AI  S+AY+ Q
Sbjct  2     TRLERLYTEQRQSPWLDNLTRPYLRDGTLAGFVAEGIRGVTANPTILARAIEGSDAYDAQ  61

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
             F  L+  G  +   YWEL V+D+ DA  +    +D +   DG+VS+EV+P LA DTE TI
Sbjct  62    FAVLIAQGYSLGDAYWELAVQDVTDALAVLRSTFDNSHGSDGFVSIEVAPELARDTEATI  121

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
              AA  LH ++ R N+ +K+PATA  IP+I  +I  G+S+N+TLIFS+ RY  VIDAYL+G
Sbjct  122   AAAARLHDRIARPNLLVKVPATAEGIPAIAALIGRGLSINITLIFSLSRYAQVIDAYLEG  181

Query  922   LE---ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql  1092
             LE   A+G  DL+ V SVASFFVSRVDT VD  L +IG  +A+ LRG+AA AQA LA+Q+
Sbjct  182   LETFTAAG-GDLAAVHSVASFFVSRVDTEVDHRLARIGGDDAVALRGRAAVAQARLAYQI  240

Query  1093  yqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLA  1272
             ++ +F+G RW  L  +GA+ Q  LWASTS KNP YPDTLYVD LIGPDTV+TM +  + A
Sbjct  241   FRNRFAGERWAKLAARGARVQPPLWASTSTKNPDYPDTLYVDSLIGPDTVNTMAETTITA  300

Query  1273  FIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQE  1452
             F DHG+VART+D  + +AE + + +  +GVD   VG  LE  GV  F KSF  LL +L  
Sbjct  301   FEDHGTVARTVDTGIEQAERVMHDLATVGVDMDDVGHTLEDHGVAGFHKSFADLLVTLDA  360

Query  1453  KAN  1461
             KA 
Sbjct  361   KAR  363



>gb|AAT08720.1| transaldolase [Hyacinthus orientalis]
Length=264

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = +1

Query  814   CIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVD  993
             C+PSIKEVI+ GISVNVTLIFS+ RYEAVIDAYLDGLE+SGL+DLSK+TSVASFFVSRVD
Sbjct  3     CVPSIKEVISLGISVNVTLIFSLSRYEAVIDAYLDGLESSGLSDLSKLTSVASFFVSRVD  62

Query  994   TLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWAS  1173
             TLVDK+LEKIG+PEAL+LRGKAA AQAALA++LY+KKFSGPRWEALVKKGAKKQRLLWAS
Sbjct  63    TLVDKMLEKIGTPEALNLRGKAAVAQAALAYKLYRKKFSGPRWEALVKKGAKKQRLLWAS  122

Query  1174  TSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDK  1353
             TSVKNPAY DTLYV PLIGPDTVSTMPDQAL AFIDHG V+RTIDANVS+AEGIY+A++K
Sbjct  123   TSVKNPAYSDTLYVAPLIGPDTVSTMPDQALQAFIDHGVVSRTIDANVSDAEGIYSALEK  182

Query  1354  LGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             LG+DW +VGT L+A+GV+SFKKSFDSLL SLQE  +
Sbjct  183   LGIDWNEVGTILDADGVESFKKSFDSLLVSLQENGD  218



>ref|WP_020509411.1| hypothetical protein [Actinoplanes globisporus]
Length=368

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/362 (51%), Positives = 242/362 (67%), Gaps = 5/362 (1%)
 Frame = +1

Query  391   TSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             T+L  LY + GQSPW DNL R       L  ++ +G+RGVT+NP IF KA+  S  Y+ Q
Sbjct  2     TALQRLYAEYGQSPWLDNLTRGYLRDGTLKQMVANGIRGVTANPTIFAKAVLGSTDYDGQ  61

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
             F  L  AG  +E  YW+LVV D   A  +  P++D +   DG+VSVEV+  LA DT+ T+
Sbjct  62    FAALTAAGVPLEDAYWQLVVDDTTAALAVLRPVFDGSGGTDGFVSVEVAAELARDTQATL  121

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
              AA+ LH+++   N+++KIPATA  IP+I+ + A G S+N+TLIFS+ RYE VI+AYL G
Sbjct  122   VAARALHERIAAPNLFVKIPATAEGIPAIQAMTAEGHSINITLIFSLARYEQVIEAYLSG  181

Query  922   LEASGL--NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqly  1095
             LEA      D S+V SVASFFVSRVDT VD+ LE  G+ +AL LRG+AA AQA LA++L+
Sbjct  182   LEAFAERGGDPSRVHSVASFFVSRVDTEVDRRLETTGTEDALTLRGQAAIAQAKLAYRLF  241

Query  1096  qkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAF  1275
             +++F+  RW+ L   GA  QR LWASTS KNPAYPDT YVD LIGPDTV+T+P+  + AF
Sbjct  242   RERFADERWQRLAAHGAHPQRPLWASTSTKNPAYPDTRYVDELIGPDTVNTLPEATIAAF  301

Query  1276  IDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              DHG+ ARTID  V EA  +   + + GVD   VG  LE  GV +F  S   +L +L  K
Sbjct  302   NDHGTPARTIDTAVDEAAEVMRRLARAGVDLDDVGQTLEDGGVAAFHTSHQQVLAALAAK  361

Query  1456  AN  1461
             A+
Sbjct  362   AD  363



>ref|WP_029538055.1| transaldolase [Rhodococcus sp. DK17]
Length=352

 Score =   323 bits (828),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 239/346 (69%), Gaps = 5/346 (1%)
 Frame = +1

Query  439   DNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYW  609
             DNL RP      L   + +G+RGVT+NP IF +AI+ S+AY+ QF  L+  G  +E  YW
Sbjct  2     DNLTRPYLRDGTLAGFVAAGIRGVTANPTIFARAIAGSDAYDAQFAALIAEGLAVEDAYW  61

Query  610   ELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVY  789
             EL   D+ DA  +  P+YD +   DG+VS+EV+P LA DT+ TI AA  LH+++ R NV+
Sbjct  62    ELAAADVVDAAAILRPVYDTSGGTDGFVSIEVAPELARDTDATIAAAGRLHERIARPNVF  121

Query  790   IKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE--ASGLNDLSKVTS  963
             +KIPATA  IP+I ++I  G+S+N+TLIFS+ RYE VI+AYL GLE  A+   + + V S
Sbjct  122   VKIPATAEGIPAIADMIGKGVSINITLIFSLARYEQVIEAYLQGLETLAARGGEPAAVRS  181

Query  964   VASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKG  1143
             VASFFVSRVDT VD+ LE  G PEA  LRG+AA AQA LA+++++ +F+G RWEAL  +G
Sbjct  182   VASFFVSRVDTEVDRRLEHSGDPEAPGLRGRAAIAQARLAYRIFRDRFTGARWEALAARG  241

Query  1144  AKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSE  1323
             A+ QR LWASTS KNP YPDT YVD LIGPDTV+T+P+  + AF DHG++ R+ID + + 
Sbjct  242   ARVQRPLWASTSTKNPDYPDTRYVDSLIGPDTVNTLPEATITAFEDHGTLTRSIDTDPAG  301

Query  1324  AEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             A  +   +  +GVD   VG  LE +GV +F +SF  LL  L  KA+
Sbjct  302   AAAVLGELAAVGVDMDDVGRTLEDQGVAAFHQSFADLLTELHAKAH  347



>ref|WP_007300319.1| transaldolase [Rhodococcus imtechensis]
 gb|EID74445.1| transaldolase [Rhodococcus imtechensis RKJ300 = JCM 13270]
Length=352

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 239/346 (69%), Gaps = 5/346 (1%)
 Frame = +1

Query  439   DNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYW  609
             DNL RP      L   + +G+RGVT+NP IF +AI+ S+AY+ QF  L+  G  +E  YW
Sbjct  2     DNLTRPYLRDGTLAGFVAAGIRGVTANPTIFARAIAGSDAYDAQFAALIAQGLAVEDAYW  61

Query  610   ELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVY  789
             EL   D+ DA  +  P+YD +   DG+VS+EV+P LA DT+ TI AA  LH+++ R NV+
Sbjct  62    ELAAADVVDAAAILRPVYDTSGGTDGFVSIEVAPELARDTDATIAAAGRLHERIARPNVF  121

Query  790   IKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE--ASGLNDLSKVTS  963
             +KIPATA  IP+I ++I  G+S+N+TLIFS+ RYE VI+AYL GLE  A+   + + V S
Sbjct  122   VKIPATAEGIPAIADMIGKGVSINITLIFSLARYEQVIEAYLQGLETLAARGGEPAAVRS  181

Query  964   VASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKG  1143
             VASFFVSRVDT VD+ LE  G PEA  LRG+AA AQA LA+++++ +F+GPRWE L  +G
Sbjct  182   VASFFVSRVDTEVDRRLEHSGDPEAPGLRGRAAIAQARLAYRIFRDRFTGPRWETLAARG  241

Query  1144  AKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSE  1323
             A+ QR LWASTS KNP YPDT YVD LIGPDTV+T+P+  + AF DHG++ R+ID + + 
Sbjct  242   ARVQRPLWASTSTKNPDYPDTRYVDSLIGPDTVNTLPEATITAFEDHGTLTRSIDTDPAA  301

Query  1324  AEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             A  +   +  +G+D   VG  LE +GV +F +S+  LL  L  KA+
Sbjct  302   AATVLGELAAVGIDMDDVGRTLEDQGVTAFHQSYADLLTELHAKAH  347



>ref|WP_036564310.1| transaldolase, partial [Nocardioides halotolerans]
Length=346

 Score =   321 bits (823),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 239/345 (69%), Gaps = 5/345 (1%)
 Frame = +1

Query  439   DNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYW  609
             DNL RP         L+ +G+RGVT+NP I  +AI +S+AY++QF+ L+ AG  +E  YW
Sbjct  2     DNLSRPQLRDGTFARLVAAGIRGVTANPTIIARAIESSDAYDEQFESLLSAGCTVEEAYW  61

Query  610   ELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVY  789
             ELV+ D+  A +L  P +D++  GDG+VS+EV+PR A DT+ TI AA+ LH+++   N+ 
Sbjct  62    ELVISDVVRALELLRPTFDQSHRGDGFVSIEVAPRWAHDTDATIVAARALHERIREPNLL  121

Query  790   IKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--NDLSKVTS  963
             +KIPAT   + +I+ +I  G S+NVTL+FS+ RY  V+DAYL GLEA      DLS V S
Sbjct  122   VKIPATDEGVRAIEVMIGEGRSINVTLVFSLRRYGNVLDAYLSGLEALARRGGDLSTVQS  181

Query  964   VASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKG  1143
             VASFFVSRVDT VD+ L+  G   AL LRG+AA AQA LA+QL+QK  S  RWE L  +G
Sbjct  182   VASFFVSRVDTEVDRRLDATGGQAALRLRGRAAIAQAKLAYQLFQKAHSNARWERLAHQG  241

Query  1144  AKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSE  1323
             A+ QR LWASTS KNP++PDTLYVD LIGPDTV+T+P+  L AF+DHG+VARTID  V +
Sbjct  242   ARVQRPLWASTSTKNPSWPDTLYVDSLIGPDTVNTLPEVTLHAFVDHGTVARTIDTGVED  301

Query  1324  AEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
             A  +  A+  +G+D   VG  LE +G+ +F  S   +L +L+ ++
Sbjct  302   ALALMGALSTVGIDMDDVGHTLEEQGIAAFDASVAHVLGTLRARS  346



>ref|WP_005564233.1| transaldolase [Rhodococcus wratislaviensis]
 gb|ELB92748.1| transaldolase [Rhodococcus wratislaviensis IFP 2016]
Length=352

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 237/346 (68%), Gaps = 5/346 (1%)
 Frame = +1

Query  439   DNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYW  609
             DNL RP      L   + +G+RGVT+NP IF +AI+ S+AY+ QF  L+  G  +E  YW
Sbjct  2     DNLTRPYLRDGTLTAFVAAGIRGVTANPTIFARAIAGSDAYDAQFAALIAQGLAVEDAYW  61

Query  610   ELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVY  789
             EL   D+ DA  +  P+YD +   DG+VS+EV+P LA DT+ TI AA  LH+++ R NV+
Sbjct  62    ELAAADVVDAAAILRPVYDTSGGTDGFVSIEVAPELARDTDATIAAAGQLHERIARPNVF  121

Query  790   IKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--NDLSKVTS  963
             +KIPATA  IP+I ++I  G+S+N+TLIFS+ RYE VI+AYL GLEA      D + V S
Sbjct  122   VKIPATAEGIPAIADMIGKGVSINITLIFSLTRYEQVIEAYLQGLEALAARGGDPAAVRS  181

Query  964   VASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKG  1143
             VASFFVSRVDT VD+ LE    PEA  LRG+AA AQA LA+++++ +F+G RWE L  +G
Sbjct  182   VASFFVSRVDTEVDRRLEHSSDPEAPALRGRAAIAQARLAYRIFRDRFTGTRWETLAARG  241

Query  1144  AKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSE  1323
             A+ QR LWASTS KNP YPDT YVD LIGPDTV+T+P+  + AF DHG++ R+ID + + 
Sbjct  242   ARVQRPLWASTSTKNPDYPDTRYVDSLIGPDTVNTLPEATITAFEDHGTLTRSIDTDPAG  301

Query  1324  AEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             A  +   +  +G+D   VG  LE +GV +F +SF  LL  L+ KA+
Sbjct  302   AAAVLGELAAVGIDMDDVGRTLEDQGVAAFHQSFAELLTELRAKAH  347



>emb|CCH74595.1| Transaldolase [Tetrasphaera australiensis Ben110]
Length=370

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 188/351 (54%), Positives = 243/351 (69%), Gaps = 9/351 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIE-SGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  ++E SGV GVT+NP+IFQ A+   NAY+ Q  EL +AGK
Sbjct  14    GVSVWLDDLSRERLTSGNLKDVMEHSGVVGVTTNPSIFQAALDHGNAYDAQVAELAEAGK  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              +E   +E+  +D++DAC +  PIYD+T   DG VS+EV PRLA D   T+E AK L+ K
Sbjct  74    SVEEAVFEITTQDVRDACDVLRPIYDKTGGKDGRVSIEVDPRLAHDEGPTVEQAKALYAK  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   +P+I EVIA+GISVNVTLIFS+ERY AV++AYL+GLE   A+G 
Sbjct  134   VDRPNVMIKIPATLAGLPAISEVIADGISVNVTLIFSLERYRAVMNAYLEGLERALAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
              DLS + SVASFFVSRVDT +DK LE IGSPEA+ LRG AA A A LA+Q Y++ FS  R
Sbjct  193   KDLSTIWSVASFFVSRVDTEIDKRLEAIGSPEAMALRGTAAVANAQLAYQAYEEVFSTSR  252

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             WE L  +GA KQR LWAST VKNP Y DTLYV  L+  +TV+TMP++ L A IDHG++A 
Sbjct  253   WETLAAEGANKQRPLWASTGVKNPDYSDTLYVTNLVADNTVNTMPEKTLDAVIDHGNIAG  312

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
               +  + ++A  + + I    + + +V   LE EGV+ F+ S++SLL  LQ
Sbjct  313   DAVTGHYADAAKVLDDIAAQNISYTEVTELLEKEGVEKFEASWNSLLTDLQ  363



>ref|WP_005261837.1| transaldolase [Rhodococcus opacus]
 gb|EKT78896.1| transaldolase [Rhodococcus opacus M213]
Length=352

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 236/346 (68%), Gaps = 5/346 (1%)
 Frame = +1

Query  439   DNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYW  609
             DNL RP      L   + +G+RGVT+NP IF +AI+ S+ Y+ QF  L+  G + E  YW
Sbjct  2     DNLTRPYLRDGTLAGFVAAGIRGVTANPTIFARAIAGSDVYDAQFAALIAEGLEAEDAYW  61

Query  610   ELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVY  789
             EL   D+ DA  +  P+YD +   DG+VS+EV+P LA DT+ TI AA  LH+++ R NV+
Sbjct  62    ELAAADVVDAAAVLRPVYDTSGGTDGFVSIEVAPELARDTDATIVAAGRLHERIARPNVF  121

Query  790   IKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--NDLSKVTS  963
             +KIPATA  IP+I ++I  G+S+N+TLIFS+ RYE VI+AYL GLEA      D + V S
Sbjct  122   VKIPATAEGIPAIADMIGKGVSINITLIFSLARYEQVIEAYLQGLEALAARGGDPAAVRS  181

Query  964   VASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKG  1143
             VASFFVSRVDT VD+ LE I  PEA  LRG+AA AQA LA+++++ +F+G RWE L  +G
Sbjct  182   VASFFVSRVDTEVDRRLEHIADPEAPALRGRAAIAQARLAYRIFRDRFTGKRWETLAARG  241

Query  1144  AKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSE  1323
             A+ QR LWASTS KNP YPDT YVD LIGPDTV+T+P+  + AF DHG++ R+ID + + 
Sbjct  242   ARVQRPLWASTSTKNPDYPDTRYVDSLIGPDTVNTLPEATITAFEDHGTLTRSIDTDPAA  301

Query  1324  AEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             A  +   +   G+D   VG  LE +GV +F +SF  LL  L+ KA+
Sbjct  302   AAAVLGELAAAGIDMDDVGRTLEDQGVAAFHQSFADLLTELRAKAH  347



>ref|WP_012228740.1| Transaldolase [Candidatus Microthrix parvicella]
 emb|CCM64553.1| Transaldolase [Candidatus Microthrix parvicella RN1]
Length=363

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 178/360 (49%), Positives = 239/360 (66%), Gaps = 6/360 (2%)
 Frame = +1

Query  391   TSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             + L  L+E  GQSPW DN+ R      ++   IE GVRGVTSNP IF+KA+ +++ Y+++
Sbjct  2     SQLIKLHEDCGQSPWLDNITRQWINSGEIRRWIERGVRGVTSNPTIFKKAMESAD-YDEE  60

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
                L ++G   E  YW+LV  DI  A  L   +++ +   DG+VSVEVSP LA DT  TI
Sbjct  61    LARLTRSGATTEQAYWQLVGSDISAAADLLSGVHERSNGEDGWVSVEVSPELAHDTAATI  120

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
             EA + L + +   N+Y+K+PAT   I +I+ + + GI VNVTLIFS++RY  VI+AYL G
Sbjct  121   EAGRELARNLGLPNMYVKVPATPAGIEAIRVLTSEGIPVNVTLIFSLDRYADVIEAYLSG  180

Query  922   LEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqk  1101
             LEA     LS ++SV SFF+SRVDT VD+ L++IG+ +ALDL G AA  Q  LA+QL  +
Sbjct  181   LEAH-QGGLSHISSVGSFFISRVDTEVDRRLQEIGTNDALDLMGTAAITQGKLAYQLAME  239

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
              FSGPRW+AL ++GA  QR LWASTS KNP YPDT YVD LIGP TV+T+P+  L AF D
Sbjct  240   AFSGPRWDALTERGATMQRPLWASTSTKNPDYPDTYYVDSLIGPHTVNTLPEATLEAFDD  299

Query  1282  HGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             HG+V  T+DAN       +  + +L VD   VG  LE+EGV SF +SF  +L +L E+ +
Sbjct  300   HGTVVSTLDANPEADRKRWEQLGEL-VDLDDVGATLESEGVASFAQSFREVLTTLAERVD  358



>ref|WP_037561823.1| transaldolase [Spirochaeta sp. JC202]
 gb|KGM43554.1| transaldolase [Spirochaeta sp. JC202]
Length=372

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 244/362 (67%), Gaps = 20/362 (6%)
 Frame = +1

Query  412   EKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
             EK GQS W+D + R +    +L  LI+ GVRG+TSNPAIF+KAI+ SN Y++   EL++ 
Sbjct  8     EKLGQSVWFDFIRRSLITSGELQALIDKGVRGITSNPAIFEKAIAGSNDYDEAISELIET  67

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
             G  ++ +Y  L ++DI  A  L   IYD T   DGYVS+EV+P LAD+TE TI  A+ L 
Sbjct  68    GAGVDEIYESLAIEDISMAADLLRKIYDSTSGRDGYVSLEVNPHLADETEKTIAEARRLF  127

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE-----  927
             + ++R NV IK+PATA  +P+I E+I  G++VNVTLIF +E Y+AV +AYL GLE     
Sbjct  128   ETLNRPNVMIKVPATAAGLPAIAELIGAGVNVNVTLIFGLENYKAVAEAYLAGLEKLLGS  187

Query  928   ---ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyq  1098
                 +G + +++V SVASFFVSRVD+ VD+ L ++ + E   L+GK A A + +A+  ++
Sbjct  188   GPAVTGGHPVNRVASVASFFVSRVDSAVDQALAEVNATE---LQGKIAIANSKVAYAEFK  244

Query  1099  kkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFI  1278
             K F GPRWE L   GA+ QR+LWASTS KNP YPDT+YVD LIGP TV+T+P   + +F+
Sbjct  245   KIFDGPRWEKLKNNGARVQRVLWASTSAKNPDYPDTIYVDELIGPQTVNTLPPATVDSFM  304

Query  1279  DHGSVARTIDANVSEAEGIYNAIDK---LGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             DHG VA T+   V EA   Y  +DK   LG+D   +  +L+ +GV +F K FD+L++SL 
Sbjct  305   DHGQVAETLTRGVEEA---YRQVDKLKTLGIDLSAITQKLQDDGVIAFAKPFDALMESLA  361

Query  1450  EK  1455
             EK
Sbjct  362   EK  363



>gb|KHN17454.1| Transaldolase [Glycine soja]
Length=321

 Score =   312 bits (799),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  370   NGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAISTSNA  549
             NG  IK T LH LYEKQ QSP+YDNLCRPV+DL+P I +G+RGVT+NPAIF++AIS+SNA
Sbjct  4     NGPKIKSTILHHLYEKQRQSPYYDNLCRPVSDLLPFIANGIRGVTTNPAIFERAISSSNA  63

Query  550   YNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDT  729
             Y+DQ +ELV AGKDIES YWELVVKDIQD CKL EPIY+ET+  DG+VS+ VSP+LA+DT
Sbjct  64    YDDQLRELVGAGKDIESAYWELVVKDIQDTCKLLEPIYNETDGEDGHVSLAVSPKLANDT  123

Query  730   EGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDA  909
             +GTIEAAKWLH  V    VY+KIPAT   I S+KEVI+ GISVN T        EAVIDA
Sbjct  124   KGTIEAAKWLHNMVGSPCVYMKIPATDESISSMKEVISLGISVNATAHSFSYSDEAVIDA  183

Query  910   YLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALD  1044
             YLDGLE+ G+ DLSKV+S A+F++SRVD  +DK LE+IG+ EALD
Sbjct  184   YLDGLESCGMTDLSKVSSAAAFYISRVDVTLDKKLEQIGTTEALD  228


 Score =   100 bits (249),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  1240  VSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKK  1419
             +ST+P QAL AF+DHG ++RT+DA VSEA+ IYNAI+KLG+DW  VG++LE E +DSF K
Sbjct  233   ISTLPVQALQAFMDHGILSRTLDAKVSEAQDIYNAIEKLGIDWSSVGSELEHEVLDSFTK  292

Query  1420  SFDSLLDSLQEKA  1458
             SFD++L+ +Q+KA
Sbjct  293   SFDNVLECMQKKA  305



>emb|CCH76529.1| Transaldolase 2 [Tetrasphaera japonica T1-X7]
Length=375

 Score =   313 bits (803),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 181/370 (49%), Positives = 252/370 (68%), Gaps = 13/370 (4%)
 Frame = +1

Query  385   KRTSLHDLYEKQGQSPWYDNLCR---PVTDLIPLIE-SGVRGVTSNPAIFQKAISTSNAY  552
             K+ ++H L E  G S W D+L R      +L  ++E  GV GVT+NP IFQ+A+S  +AY
Sbjct  7     KQNAVHQLAEA-GVSVWLDDLSRERLTSGNLKDIMEHQGVVGVTTNPTIFQQALSQGHAY  65

Query  553   NDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTE  732
             + Q  EL  AG+ ++   + L  +D++DAC +F PIYD T+  DG VS+EV PRLA DTE
Sbjct  66    DGQVAELAAAGRTVDEAVFALTTQDVRDACDVFRPIYDATDGKDGRVSIEVDPRLAHDTE  125

Query  733   GTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAY  912
              T+E AK L + VDR NV +KIPAT   +P+I  V+A GISVNVTLIFS++RY AV++AY
Sbjct  126   KTVEQAKALREAVDRPNVMVKIPATVAGLPAITAVLAEGISVNVTLIFSLDRYRAVMNAY  185

Query  913   LDGLE---ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaala  1083
             L+G+E   A+G  D++  TSVASFFVSRVDT +DK L+ +G+ EA  L+GKA  A A LA
Sbjct  186   LEGIEQARAAG-KDIAHTTSVASFFVSRVDTEIDKRLDAVGTDEAKALKGKAGVANAQLA  244

Query  1084  fqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQA  1263
             +Q Y++ FS PRW+ L + GA KQR LWAST VKNP Y DT+YVD L+  +TV+TMP++ 
Sbjct  245   YQAYEEVFSTPRWQTLEEAGAFKQRPLWASTGVKNPDYSDTMYVDELVASNTVNTMPEKT  304

Query  1264  LLAFIDHGS-VARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLD  1440
             L A  DHG+ VA  + ++ ++A  + + + ++G+ +  V   LE EGV+ F+ S+  LL 
Sbjct  305   LAAVADHGTIVADAVTSHYADAAAVLDELARVGISYSDVVQVLEDEGVEKFETSWGQLLA  364

Query  1441  SLQ---EKAN  1461
              +Q   EKA+
Sbjct  365   GVQAELEKAS  374



>ref|WP_013492521.1| transaldolase [Intrasporangium calvum]
 ref|YP_004098933.1| transaldolase [Intrasporangium calvum DSM 43043]
 gb|ADU48206.1| transaldolase [Intrasporangium calvum DSM 43043]
Length=370

 Score =   313 bits (801),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 232/353 (66%), Gaps = 9/353 (3%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTD---LIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R + +   +  L+E   V G+TSNP+IFQ A++  + YN+    L  AGK
Sbjct  13    GVSIWLDDLSRELLETGKIAELMEERNVVGLTSNPSIFQAALAKGDRYNEDLAALTSAGK  72

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              +E +  EL   D++DAC LF P+YD T   DG  S+EV PRLA DT+ TI  AK ++  
Sbjct  73    SVEEVVHELTTADVRDACDLFRPLYDRTGGVDGRASIEVDPRLAHDTDATIAQAKQMYAD  132

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   +P+I  V A GISVNVTLIFS++RY AV++AYL+GLE   A+G 
Sbjct  133   VDRPNVLIKIPATRAGLPAITAVTAEGISVNVTLIFSLDRYRAVMNAYLEGLEKAHAAG-  191

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
              DLS + SVASFFVSRVDT +DK L+ IG+ EA  LRG+A  A A LA+Q +++ FS PR
Sbjct  192   KDLSTIHSVASFFVSRVDTEIDKRLDAIGTDEARSLRGQAGVANARLAYQAFEEVFSTPR  251

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             W  L   GA  QR LWAST VK+PAYPDTLYV  L+ P  V+TMP   L A  DHG +  
Sbjct  252   WRNLADDGANAQRPLWASTGVKDPAYPDTLYVTELVAPGVVNTMPGTTLEATADHGEIRG  311

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              TI    +EA  + +A+D  GV + +V   LEAEGVD F+KS+  LLD + E+
Sbjct  312   DTISGRYAEAAAVLDALDTQGVSYSEVVELLEAEGVDKFEKSWGELLDGVSEE  364



>ref|WP_028962436.1| transaldolase [Sulfobacillus thermosulfidooxidans]
Length=935

 Score =   328 bits (840),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 187/364 (51%), Positives = 246/364 (68%), Gaps = 10/364 (3%)
 Frame = +1

Query  382   IKRTSLHDLYEKQGQSPWYDNLCRPVTD---LIPLIESGVRGVTSNPAIFQKAISTSNAY  552
             +  T++H L E  GQS WYDN+ R + D   L  LI  G+ GVTSNP IF+KAI+ SN Y
Sbjct  2     VMTTAIHRLNEL-GQSIWYDNIRRGIIDSGELAHLIAQGISGVTSNPTIFEKAINGSNDY  60

Query  553   NDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTE  732
             +D  ++LV   K ++ +Y  LV++DI     L  P+YD T   DGY+SVEV P +A DT+
Sbjct  61    DDALRKLVAERKSLQEIYDTLVLEDIARGADLLRPVYDRTHGVDGYISVEVPPTMAQDTD  120

Query  733   GTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAY  912
              TIE A+ L   + R NV IK+PAT   IP+I+++++ GI++NVTLIFS+E YE V+DAY
Sbjct  121   KTIEEARRLFHTLARPNVMIKVPATPEGIPAIRQLLSEGININVTLIFSLEAYEEVMDAY  180

Query  913   LDGLE---ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaala  1083
             L GLE   A G   + ++ SVASFFVSRVDTLVD+L+++ G PE+L   GKAA A A LA
Sbjct  181   LSGLEDRLAQG-QPIDRIASVASFFVSRVDTLVDRLIKEKGLPESL--LGKAAVANAKLA  237

Query  1084  fqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQA  1263
             ++L+ K F+ PR+EAL   GA  QR LWASTS KNPAYPD LYVD LIGPDTV+T+P Q 
Sbjct  238   YELFLKYFNSPRFEALKNHGAMVQRPLWASTSTKNPAYPDLLYVDTLIGPDTVNTLPPQT  297

Query  1264  LLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDS  1443
             + A +DH  VART+D ++ EA  +   ++  G+  K V  QL  EGVDSF  SF +L   
Sbjct  298   ISAVLDHVKVARTVDKDLDEAHHVIQELESHGISMKAVTDQLLQEGVDSFSASFVTLFQG  357

Query  1444  LQEK  1455
             L+ K
Sbjct  358   LRRK  361



>ref|WP_034715710.1| transaldolase [Intrasporangium chromatireducens]
 gb|EWT06344.1| transaldolase [Intrasporangium chromatireducens Q5-1]
Length=370

 Score =   312 bits (799),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 235/350 (67%), Gaps = 7/350 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIESG-VRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LIE   V GVTSNP+IFQ A+S  + YN     L +AGK
Sbjct  13    GVSIWLDDLSRDRLETGNLKELIEDKCVVGVTSNPSIFQAALSKGDRYNADLTALTKAGK  72

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
               E + +EL   D++DAC LF P++D T   DG VS+EV PRLA DT+ T E AK L + 
Sbjct  73    SAEEIVFELTTSDVRDACDLFMPVFDRTSGIDGRVSIEVDPRLAHDTDRTNEEAKKLFEA  132

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR NVYIKIPAT   +P+I   +A GISVNVTLIFS++RY  V++A+L+GLE +     
Sbjct  133   VDRPNVYIKIPATEAGLPAIAATLAEGISVNVTLIFSLDRYRGVMNAFLEGLERAHQAGK  192

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLS +TSVASFFVSRVDT VDK L+ IG+ EA  LRGKA  A A LA++ +++ FS PRW
Sbjct  193   DLSTITSVASFFVSRVDTEVDKRLDAIGTDEAKALRGKAGLANARLAYEAFEEVFSTPRW  252

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
             ++L  +GA+ QR LWAST VK+PAYPDTLYV  L+ P  V+TMP+Q L A  DHG V   
Sbjct  253   KSLEAEGARVQRPLWASTGVKDPAYPDTLYVTELVAPGVVNTMPEQTLEAVADHGDVHGD  312

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             T+    +E+  + +A+D+LG+ +  V   LE EGVD F K++D L D ++
Sbjct  313   TVTGTYAESREVLDALDRLGISYTDVVELLEREGVDKFDKAWDQLGDGVK  362



>ref|WP_034804827.1| transaldolase [Intrasporangium oryzae]
 gb|EWT01829.1| transaldolase [Intrasporangium oryzae NRRL B-24470]
Length=370

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 236/350 (67%), Gaps = 9/350 (3%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTD---LIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R + +   ++ L+E   V G+TSNP+IFQ A+S  + YN    EL +AGK
Sbjct  13    GVSIWLDDLSRELLETGRIVELVEERNVVGLTSNPSIFQAAMSKGDLYNADLAELTEAGK  72

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              +E + +EL   D+++AC +F P+Y  T   DG VS+EV PR+A DTE T E AK LH  
Sbjct  73    SVEEVVFELTTSDVREACDIFLPLYRSTGGVDGRVSIEVDPRIAHDTEATNEQAKQLHAA  132

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   +P+I   IA GISVNVTLIFS++RY AV++AYLDGLE   A+G 
Sbjct  133   VDRPNVLIKIPATKAGLPAIAATIAEGISVNVTLIFSLDRYRAVMNAYLDGLEKAHAAG-  191

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
              DLS + SVASFFVSRVDT +DK L+ +G+ +A  LRGKA  A A LA+Q Y++ FS PR
Sbjct  192   KDLSTIHSVASFFVSRVDTEIDKRLDALGTDDAKALRGKAGVANARLAYQAYEEVFSTPR  251

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             W++L   GA  QR LWAST VK+PAYPDTLYV  L+ P  V+TMP++ L A  DHG+V  
Sbjct  252   WKSLADAGAHPQRPLWASTGVKDPAYPDTLYVTELVAPGIVNTMPEKTLDATADHGTVTG  311

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              TI     EA  + +A++  G+ + +V   LE EGVD F+KS+  LLD +
Sbjct  312   DTITGAYDEASAVLDALEAHGISYSEVVDLLEVEGVDKFEKSWGELLDGV  361



>gb|KGN65410.1| hypothetical protein Csa_1G418760 [Cucumis sativus]
Length=339

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 169/372 (45%), Positives = 231/372 (62%), Gaps = 80/372 (22%)
 Frame = +1

Query  289   LSSSKLLAFAKPSLNGSLVIRCSQGGGNGSPIKRTSLHDLYEKQGQSPWYDNLCRPVTDL  468
             +S + + +F+   +N S  + CS+ G      +++ LH L+++QGQ+             
Sbjct  11    ISQAVMASFSNLLMNQSSFVACSKNG-----FRKSILHVLHKRQGQA-------------  52

Query  469   IPLIESGVRGVTSNPAIFQKAISTSNAYNDQFK---------------------------  567
                  SG+ GVTSNP IF+++I +S AY++QF+                           
Sbjct  53    -----SGIIGVTSNPKIFERSILSSKAYDEQFRYSHLSLSQYIDVWKQRVAESFVVQICF  107

Query  568   ----------ELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRL  717
                       +L + GKD+E  YWELV KDI+D   + +PIY ET   DGYVSV+VSP L
Sbjct  108   VCFDLNSMDRDLTKEGKDVECAYWELVTKDIRDTSVILKPIYKETTGLDGYVSVQVSPWL  167

Query  718   ADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEA  897
             AD+T+  ++AAKWLHKK+ R NVY KIPATA  IP+IK+VI+ GISVN TLIF I  YE 
Sbjct  168   ADNTKKIVKAAKWLHKKLGRPNVYTKIPATAESIPAIKQVISQGISVNATLIFCISTYEK  227

Query  898   VIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaa  1077
             VI+AYL+GLE+SGL+DLS ++S A+F++SRVD                            
Sbjct  228   VIEAYLNGLESSGLSDLSAISSAAAFYISRVDAAARAQAAI-------------------  268

Query  1078  lafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPD  1257
              A++++++KFSGPRWEAL K+GAKKQRL+WAST+VKNPAYPDT YVD LIGP+T+ST+P+
Sbjct  269   -AYKIFREKFSGPRWEALAKRGAKKQRLMWASTNVKNPAYPDTCYVDLLIGPETISTIPE  327

Query  1258  QALLAFIDHGSV  1293
             +AL AF+DHG V
Sbjct  328   EALAAFMDHGIV  339



>ref|WP_020374455.1| hypothetical protein [Sulfobacillus thermosulfidooxidans]
Length=933

 Score =   327 bits (837),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 187/361 (52%), Positives = 245/361 (68%), Gaps = 10/361 (3%)
 Frame = +1

Query  391   TSLHDLYEKQGQSPWYDNLCRPVTD---LIPLIESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             T++H L E  GQS WYDN+ R + D   L  LI  G+ GVTSNP IF+KAI+ SN Y+D 
Sbjct  3     TAIHRLNEL-GQSIWYDNIRRGIIDSGELAHLIAQGISGVTSNPTIFEKAINGSNDYDDA  61

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
              ++LV   K ++ +Y  LV++DI     L  P+YD T   DGY+SVEV P +A DT+ TI
Sbjct  62    LRKLVAERKSLQEIYDTLVLEDIARGADLLRPVYDRTHGVDGYISVEVPPTMAQDTDKTI  121

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
             E A+ L   + R NV IK+PAT   IP+I+++++ GI++NVTLIFS+E YE V+DAYL G
Sbjct  122   EEARRLFHTLARPNVMIKVPATPEGIPAIRQLLSEGININVTLIFSLEAYEEVMDAYLSG  181

Query  922   LE---ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql  1092
             LE   A G   + ++ SVASFFVSRVDTLVD+L+++ G PE+L   GKAA A A LA++L
Sbjct  182   LEDRLAQG-QPIDRIASVASFFVSRVDTLVDRLIKEKGLPESL--LGKAAVANAKLAYEL  238

Query  1093  yqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLA  1272
             + K F+ PR+EAL   GA  QR LWASTS KNPAYPD LYVD LIGPDTV+T+P Q + A
Sbjct  239   FLKYFNSPRFEALKNHGAMVQRPLWASTSTKNPAYPDLLYVDTLIGPDTVNTLPPQTVSA  298

Query  1273  FIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQE  1452
              +DH  VART+D ++ EA  +   ++  G+  K V  QL  EGVDSF  SF +L   L+ 
Sbjct  299   VLDHVKVARTVDKDLDEAHHVIQELESHGISMKAVTDQLLQEGVDSFSASFVTLFQGLRR  358

Query  1453  K  1455
             K
Sbjct  359   K  359



>ref|WP_015166749.1| transaldolase [Pseudanabaena sp. PCC 7367]
 ref|YP_007104223.1| transaldolase [Pseudanabaena sp. PCC 7367]
 gb|AFY71795.1| transaldolase [Pseudanabaena sp. PCC 7367]
Length=378

 Score =   311 bits (796),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 230/361 (64%), Gaps = 16/361 (4%)
 Frame = +1

Query  418   QGQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
              GQS W DNL R +    +L  +IE+ G+RG+TSNPAIFQKAI+ +  Y++     ++AG
Sbjct  12    HGQSVWLDNLSRSIIQSGELAEMIENQGIRGITSNPAIFQKAIAGNEVYDEAILAGIKAG  71

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
             K    +Y  L  KDIQDA  L +PIY+ +   DGYVS+EVSP+LA DT GTI  A    +
Sbjct  72    KSANEIYESLAFKDIQDAADLLKPIYEASGGQDGYVSIEVSPKLARDTTGTIAEALRFSE  131

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASG  936
              VDR NV IKIP TA   P+I+ V A GI VNVTL+F++E YE    AY+ GLE   A G
Sbjct  132   AVDRPNVMIKIPGTAEGFPAIERVTAEGIPVNVTLLFAVEDYEKSAWAYIKGLESRVAQG  191

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKI---GSPEALDlrgkaanaqaalafqlyqkk-  1104
               D+SKVTSVASFF+SR+D LVD+ LE +    S EA      +   + A+A      + 
Sbjct  192   -KDISKVTSVASFFLSRIDVLVDQKLEDLLAQTSDEAEKTTINSLMGKVAIANAKIAYQT  250

Query  1105  ----FSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLA  1272
                 ++  RW+AL+ KGA +QRLLWASTS KNP Y D +YVD L+G  TV+TMP + + A
Sbjct  251   YKDIYASDRWQALLAKGANEQRLLWASTSTKNPTYSDVMYVDNLVGDHTVNTMPPETIAA  310

Query  1273  FIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQE  1452
              IDH  +   I+ NV +AE +   + KLG+D  QV  QLE EG++ F K FDSL+ SL+E
Sbjct  311   CIDHCDIEDRIEINVEQAEEVVATVQKLGIDLNQVMKQLEDEGIEKFIKPFDSLMGSLEE  370

Query  1453  K  1455
             K
Sbjct  371   K  371



>ref|WP_015747528.1| transaldolase [Nakamurella multipartita]
 ref|YP_003201627.1| transaldolase [Nakamurella multipartita DSM 44233]
 gb|ACV78638.1| transaldolase [Nakamurella multipartita DSM 44233]
Length=369

 Score =   310 bits (794),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 235/353 (67%), Gaps = 7/353 (2%)
 Frame = +1

Query  418   QGQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             QG S W D+L R      +L  LIE+  + GVT+NP+IFQ A+    +Y  Q  EL   G
Sbjct  11    QGVSLWLDDLSRQRLHSGNLKNLIETWHISGVTTNPSIFQAALKDGASYQKQLDELAARG  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               ++    E+   D++DAC LF  I+  T   DG VS+EV PRLA +T+GTI+ A  LHK
Sbjct  71    ASVDDTVREVTTDDVRDACDLFTGIFQATHHVDGRVSIEVDPRLAHETQGTIDQAAELHK  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE--ASGL  939
              VDR NV IKIPAT   +P+I  VI  GISVNVTLIFS+ERY AV+ AYLDGLE  A   
Sbjct  131   IVDRPNVLIKIPATEAGLPAITAVIGEGISVNVTLIFSLERYRAVMAAYLDGLEQAAEAG  190

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
             +DLS++ SVASFFVSRVD+ +DK L+ IGSPEA  L G+AA A A LA+Q Y++ F+GPR
Sbjct  191   HDLSEIHSVASFFVSRVDSEIDKRLKAIGSPEADALEGQAAIANARLAYQAYEQTFTGPR  250

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             WEAL  KGA KQR LWAST VK+P Y DT YV  L+ P+TV+T P++ + A  DHG +  
Sbjct  251   WEALAAKGANKQRPLWASTGVKDPKYDDTRYVVELVAPETVNTAPEKTIAAVADHGVITG  310

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              TI+   ++A  +++ ++ LG+D   V   LE EGVD F  +++ LL+S+ ++
Sbjct  311   NTIEGTYAQASAVFSGLEALGIDLDDVFAVLETEGVDKFIAAWEELLESVSQE  363



>ref|WP_028785585.1| transaldolase [Terracoccus sp. 273MFTsu3.1]
Length=370

 Score =   310 bits (794),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 236/353 (67%), Gaps = 11/353 (3%)
 Frame = +1

Query  415   KQGQSPWYDNLCR------PVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELV  576
             + G S W D+L R       +++LI   E  V G+TSNP+IFQ A+S    YND    L 
Sbjct  11    EAGVSIWLDDLSRELIETGKISELIE--ERNVVGLTSNPSIFQAALSKGERYNDDLAALT  68

Query  577   QAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKW  756
             + GKD+ES+ +EL   D++ AC LF P+Y+ T+  DG VS+EV PRLA DT+ T+E AK 
Sbjct  69    KDGKDVESVVFELTTSDVRRACDLFLPLYESTKGVDGRVSIEVDPRLAHDTDKTVEQAKQ  128

Query  757   LHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASG  936
             L+  VDR NV IKIPAT   +P+I   IA GISVNVTLIFS+ERY AV++AYL+GLE + 
Sbjct  129   LYAAVDRPNVLIKIPATKAGLPAITATIAEGISVNVTLIFSLERYRAVMNAYLEGLEKAH  188

Query  937   LN--DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS  1110
              N  DLS + SVASFFVSRVDT +DK L+ IG+ EA  L+GKA  A A LA+Q +++ FS
Sbjct  189   ANGHDLSTIHSVASFFVSRVDTEIDKRLDAIGTEEARALKGKAGLANARLAYQAFEEVFS  248

Query  1111  GPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGS  1290
              PRW +L + GA  QR LWAST VK+PAYPDT+YVD L+  D V+TMP + L A  DHG 
Sbjct  249   TPRWGSLAEAGANVQRPLWASTGVKDPAYPDTMYVDELVAADVVNTMPGKTLEATADHGD  308

Query  1291  V-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             +   T+  +   A  + + ++ +GV + +V   LE EGVD F+K++  LLD +
Sbjct  309   IHGDTVTGSYELAGNVLDDLEGVGVSYNEVVDLLETEGVDKFEKAWGELLDGV  361



>gb|KCW57903.1| hypothetical protein EUGRSUZ_H00650 [Eucalyptus grandis]
Length=276

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 219/299 (73%), Gaps = 28/299 (9%)
 Frame = +1

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
              +EL+QA KD+ES YWE+VV D ++ACKLF+ I+ +T+  DGYVS+EVSP LA DT  T 
Sbjct  6     IRELLQAKKDVESAYWEMVVDDAREACKLFQTIFTDTDGEDGYVSIEVSPMLAYDTRRTT  65

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
             E AK L + V+  N+ IKIPAT   I SIKE I+  I VN T+IF++  YEAV+DAYLDG
Sbjct  66    EEAKRLCEMVNCPNICIKIPATTESIISIKEGISQRICVNATVIFTLPTYEAVVDAYLDG  125

Query  922   LEASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqk  1101
             LEASGL DLS+VTSVASF++SRVD L+D+ LE+IG+ +AL L+GKAA AQA LA++L+QK
Sbjct  126   LEASGLIDLSRVTSVASFYISRVDNLIDQKLEEIGTSQALKLKGKAAVAQATLAYKLFQK  185

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
             KFSGPRWEAL K+GA+KQ+LLWAST+VKNP+YPDT Y++PLIGPDT              
Sbjct  186   KFSGPRWEALRKRGARKQKLLWASTNVKNPSYPDTSYINPLIGPDT--------------  231

Query  1282  HGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKA  1458
                           AE  Y  +++LG+DW  VG QLE E V SFKKSF ++L+SLQEKA
Sbjct  232   --------------AECTYCMLEELGIDWNAVGAQLELEVVGSFKKSFQNVLNSLQEKA  276



>ref|WP_026863466.1| transaldolase [Intrasporangiaceae bacterium URHB0013]
Length=370

 Score =   309 bits (791),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 235/353 (67%), Gaps = 11/353 (3%)
 Frame = +1

Query  415   KQGQSPWYDNLCRP------VTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELV  576
             + G S W D+L R       +++LI   E  V G+TSNP+IFQ A+S    YND    L 
Sbjct  11    EAGVSIWLDDLSRELIETGKISELIE--ERNVVGMTSNPSIFQAALSKGERYNDDLATLT  68

Query  577   QAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKW  756
             + GKD+E + +EL   D++ AC LF P+Y+ T   DG VS+EV PRLA DT+ T+  AK 
Sbjct  69    KDGKDVEDVVFELTTSDVRAACDLFLPLYESTGGVDGRVSIEVDPRLAHDTDATVAQAKQ  128

Query  757   LHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASG  936
             LH  VDR NV+IKIPAT   +P+I   IA GISVNVTLIFS+ERY AV++AYL+GLE + 
Sbjct  129   LHAAVDRPNVHIKIPATKAGLPAITATIAEGISVNVTLIFSLERYRAVMNAYLEGLEKAH  188

Query  937   LN--DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS  1110
              N  DL+K+ SVASFFVSRVDT +DK L+ IG+ EA  L+GKA  A A LA+Q +++ FS
Sbjct  189   ANGHDLAKIHSVASFFVSRVDTEIDKRLDAIGTDEARALKGKAGLANARLAYQAFEEVFS  248

Query  1111  GPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGS  1290
              PRW +L + GA  QR LWAST VK+PAYPDT+YVD L+  + V+TMP + L A  DHG 
Sbjct  249   TPRWGSLAEAGANVQRPLWASTGVKDPAYPDTMYVDELVAANVVNTMPGKTLEATADHGD  308

Query  1291  V-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             +   T+      A  + + ++++GV + +V   LE EGV+ F+K++  LLD +
Sbjct  309   IHGDTVTGAYELAGNVLDELERVGVSYTEVVDLLETEGVEKFEKAWGELLDGV  361



>ref|WP_030202159.1| transaldolase [Corynebacterium variabile]
Length=370

 Score =   308 bits (789),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 235/354 (66%), Gaps = 13/354 (4%)
 Frame = +1

Query  415   KQGQSPWYDNLCR------PVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELV  576
             + G S W D+L R       ++DLI   E  V GVTSNP+IFQ A+S    YND    L 
Sbjct  11    EAGVSIWLDDLSRELIETGKISDLI--TERNVVGVTSNPSIFQAALSKGERYNDDLSALT  68

Query  577   QAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKW  756
             +AG+ ++ +  EL   D++ AC LF P+Y+ T+  DG VS+EV PRLA DT+ T+E AK 
Sbjct  69    KAGRGVDEVVHELTTSDVRSACDLFLPLYESTKGVDGRVSIEVDPRLAHDTDKTVEQAKQ  128

Query  757   LHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---  927
             LH  +DR NV IKIPAT   +P+I   IA GISVNVTLIFS++RY AV++AYL+GLE   
Sbjct  129   LHADIDRPNVLIKIPATKAGLPAITATIAEGISVNVTLIFSLDRYRAVMNAYLEGLEKAH  188

Query  928   ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF  1107
             A+G +DLSK+ SVASFFVSRVDT +DK L+ IG+ EA  L+GKA  A A LA+Q +++ F
Sbjct  189   AAG-HDLSKIHSVASFFVSRVDTEIDKRLDAIGTDEAKGLKGKAGLANARLAYQAFEEVF  247

Query  1108  SGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHG  1287
             S PRW  L + GA  QR LWAST VK+PAYPDT+YV  L+  D V+TMP + L A  DHG
Sbjct  248   STPRWGTLAEAGANLQRPLWASTGVKDPAYPDTMYVTELVAADVVNTMPGKTLEATADHG  307

Query  1288  SV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              +   T+      A  + + ++++GV + +V   LE EGVD F+K++  LLD +
Sbjct  308   DIHGDTVTGGYELASNLLDDLERVGVSYTEVVDLLETEGVDKFEKAWGELLDGV  361



>emb|CCI54568.1| Transaldolase 2 [Tetrasphaera jenkinsii Ben 74]
Length=370

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 239/351 (68%), Gaps = 9/351 (3%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIE-SGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  ++E SGV GVT+NP+IFQ A+S  ++Y  Q  EL QAG 
Sbjct  14    GVSVWLDDLSRARLTSGNLKDVMENSGVVGVTTNPSIFQAALSNGDSYAAQVAELAQAGS  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              ++   + +  +D++DAC +F PIYD T   DG VS+EV PRLA     TIE AK L+  
Sbjct  74    SVDDAVFAITTQDVRDACDVFRPIYDSTLGKDGRVSIEVDPRLAHQEAETIEQAKALYAA  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   +P+I  VIA GISVNVTLIFS+ERY AV++AY+DGLE   A+G 
Sbjct  134   VDRPNVMIKIPATLAGLPAISAVIAEGISVNVTLIFSLERYRAVMNAYIDGLERAHAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
             +DLS + SVASFFVSRVD+ +DK L+ IG+ EA  L+GKAA A A LA+Q Y++ FS PR
Sbjct  193   HDLSSIWSVASFFVSRVDSEIDKRLDAIGTDEAAALKGKAAVANARLAYQAYEEVFSTPR  252

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             W+AL + GA KQR LWAST VKNP Y DT+YV  L+  +TV+TMP++ LLA IDHG +A 
Sbjct  253   WQALEEAGANKQRPLWASTGVKNPDYSDTMYVTDLVASNTVNTMPEKTLLAVIDHGDIAG  312

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
               +  + ++A  + + I   G+ + +V   LE+EGV+ F+ S+  LL  LQ
Sbjct  313   DAVTGHYADAAQVLDDIAAQGISYGEVTDLLESEGVEKFEASWADLLSELQ  363



>ref|WP_007906483.1| transaldolase [Ktedonobacter racemifer]
 gb|EFH89696.1| transaldolase [Ktedonobacter racemifer DSM 44963]
Length=376

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 178/360 (49%), Positives = 236/360 (66%), Gaps = 14/360 (4%)
 Frame = +1

Query  412   EKQGQSPWYDNLCRP------VTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKEL  573
             + QGQS WYDN+ R        T +  L E G+ GVT+NP IF+K+IS  +AY++Q ++L
Sbjct  9     QDQGQSVWYDNIDRAQIASGEFTRM--LKEDGILGVTANPTIFEKSISAGHAYDEQMQQL  66

Query  574   VQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAK  753
             ++ GK    +Y +LV++DI+    L  PIYD TE  DGYVS+EVSP LA+DTEGTI+ A+
Sbjct  67    IKEGKSSNEIYEDLVIQDIRTVADLLRPIYDRTEGKDGYVSLEVSPELANDTEGTIKEAE  126

Query  754   WLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA-  930
                  V+R N+ IKIPAT   IP+I E +  GI+VN+TLIFS++ Y  V+DAY+  LE  
Sbjct  127   RFWNIVERPNLMIKIPATPAGIPAIYETLRKGINVNITLIFSLQSYADVVDAYVRALEER  186

Query  931   -SGLNDLSKVTSVASFFVSRVDTLVDKLLE---KIGSPEAL-Dlrgkaanaqaalafqly  1095
              SG  D+S++ SVASFFVSRVDTLVDKLLE   K G   +L +L GKAA A A L +Q +
Sbjct  187   NSGGQDISRIASVASFFVSRVDTLVDKLLEDKIKAGGAASLKELEGKAAIANARLVYQDF  246

Query  1096  qkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAF  1275
             ++ F+ PR+E L   GA  QR LWASTS KNPAY D LY + LIGPDTV TMP   +  F
Sbjct  247   KRFFNTPRFETLKHAGAHVQRPLWASTSTKNPAYRDVLYAEELIGPDTVDTMPLDTIKNF  306

Query  1276  IDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              DHG V  TI+ ++  A+   + ++K G+ + QV  QL+ EGV  F  SF  L   ++ K
Sbjct  307   RDHGIVKNTIENDIEGAKRTLDELEKNGIQYDQVTKQLQDEGVQKFIDSFHQLFAGIKSK  366



>ref|WP_016455765.1| MULTISPECIES: transaldolase [Propionimicrobium]
 gb|EPD33391.1| transaldolase [Propionimicrobium lymphophilum ACS-093-V-SCH5]
 gb|ETJ98329.1| transaldolase [Propionimicrobium sp. BV2F7]
Length=367

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 237/360 (66%), Gaps = 11/360 (3%)
 Frame = +1

Query  394   SLHDLYEKQGQSPWYDNLCRPVT---DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             +LHD     G S W D+L R      DL  LI E  V GVT+NP+IF  A    + Y D+
Sbjct  7     ALHD----AGVSIWLDDLSRQRIESGDLKKLIDEKSVTGVTTNPSIFAAAFKDMSVYGDK  62

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
              +EL +AG D++    +L+  D++DACK+F  +Y +T+  DG VS+EVSP LA++TE TI
Sbjct  63    LRELKEAGTDLDETIRQLMSMDVKDACKIFADLYSKTDGYDGRVSIEVSPLLANETEPTI  122

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
             E AK LH  VD  NV IKIPAT   +P+I++ IANGISVNVTLIFS+ERY  V+DAYL G
Sbjct  123   EQAKVLHDMVDEENVLIKIPATKAGLPAIRKTIANGISVNVTLIFSLERYREVMDAYLSG  182

Query  922   LEAS--GLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqly  1095
             LE +     DLSK+ SVASFFVSRVDT +DK LE IGS +AL LRGKAA A A LA++ Y
Sbjct  183   LEDALEAGKDLSKIHSVASFFVSRVDTEIDKRLEAIGSEDALALRGKAAIANAQLAYKAY  242

Query  1096  qkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAF  1275
             ++ FS  R++AL  KGA  QR LWAST VKNP Y DT+YV  LI    V+TMP   + AF
Sbjct  243   KEVFSSDRFKALKAKGANLQRPLWASTGVKNPEYDDTMYVAELIAEPCVNTMPGATMDAF  302

Query  1276  IDHGSVA-RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQE  1452
              DHG VA  TI     EAE    A++K+G+D   V   LE EGV+ F  S+  L+D ++E
Sbjct  303   ADHGKVAGDTITPAFDEAEKTMAAVEKIGIDLNDVFDVLEKEGVEKFNVSWYELVDGVKE  362



>ref|WP_038020223.1| transaldolase, partial [Thermithiobacillus tepidarius]
Length=372

 Score =   305 bits (781),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 172/363 (47%), Positives = 238/363 (66%), Gaps = 19/363 (5%)
 Frame = +1

Query  415   KQGQSPWYDNLCRPVTDLIPL----IESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
             + GQS W DNL R       L     E G+RGVTSNP IF KAIS S  Y++Q ++L+  
Sbjct  9     EHGQSYWLDNLTRGKIRSGELRRRVTEEGLRGVTSNPTIFNKAISQSQDYDEQIQQLIDE  68

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
             G+  + +Y  LV++DIQDAC +  P+YDE+   DGY+S+EVSP  A DT  ++  A+ LH
Sbjct  69    GRSSDEIYEALVIRDIQDACDVLRPVYDESGGLDGYISLEVSPHHAHDTLSSVAEARHLH  128

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS---  933
               V+R N+ IKIP +   +P+I+E++  GI+VNVTL+F+I+ YEAV  AY+  LE     
Sbjct  129   SAVNRPNLLIKIPGSPEGVPAIEELLFEGINVNVTLLFAIDSYEAVAWAYIRALERRVEM  188

Query  934   GLNDLSKVTSVASFFVSRVDTLVDKLL-EKIGS--------PEALDlrgkaanaqaalaf  1086
             GL  +  + SVASFF+SR+D LVD+LL E++ S        PE L   GKAA A A LA+
Sbjct  189   GL-PVHNIASVASFFLSRIDVLVDQLLKERMQSGAAPSGMRPEEL--LGKAAVANAKLAY  245

Query  1087  qlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQAL  1266
             Q ++    G RW+AL  +GA+ QR+LWASTS K P Y D +YV+PLIGPDTV+TMPD+ +
Sbjct  246   QRFRAILQGERWQALAARGARVQRMLWASTSTKTPGYSDVMYVEPLIGPDTVNTMPDETI  305

Query  1267  LAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              AF DHG V  T+   V EA+ I + + +LG+D++QV  QL  EGV  F + +D+L+ S+
Sbjct  306   AAFADHGVVRDTVAEGVDEAQRIMDELARLGIDFRQVTDQLLREGVQKFVEPYDALIKSI  365

Query  1447  QEK  1455
              +K
Sbjct  366   DDK  368



>ref|WP_022921826.1| transaldolase [Ornithinimicrobium pekingense]
Length=389

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 178/362 (49%), Positives = 242/362 (67%), Gaps = 9/362 (2%)
 Frame = +1

Query  388   RTSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYND  558
             RT+LH+L +  G S W D+L RP+    DL   I+ GV GVT+NP IF  A+S   AY  
Sbjct  23    RTALHELADA-GVSVWLDDLNRPMIQDGDLATYIDRGVLGVTTNPTIFATALSEGEAYTP  81

Query  559   QFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGT  738
             Q K L  AG   E+++  L  +D+++AC +F P+++ T   DG VS+EV P LA DT GT
Sbjct  82    QIKTLA-AGTTEEAVF-ALTTEDVRNACDVFTPVFERTGGLDGRVSIEVDPHLAKDTAGT  139

Query  739   IEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLD  918
             +E AK L  ++DR N+ IKIPAT   +P+I + +A GISVNVTLIFS++RY  V++AYL 
Sbjct  140   VELAKRLWAEIDRPNLLIKIPATVEGLPAISQTLAEGISVNVTLIFSLDRYRGVMNAYLT  199

Query  919   GLEASGLN--DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql  1092
             GLE +     DLS + SVASFFVSRVD  +DK LE IG+ EAL LRGKA  A A LA+Q 
Sbjct  200   GLEQARERGKDLSSIYSVASFFVSRVDGEIDKRLEAIGTDEALALRGKAGLANARLAYQA  259

Query  1093  yqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLA  1272
             +++ FS PRW+ L   GA  QR LWAST VKNP YPDTLYV  L+ P TV+TMP + + A
Sbjct  260   FEEVFSTPRWQNLADDGANVQRPLWASTGVKNPDYPDTLYVTELVAPHTVNTMPAKTMEA  319

Query  1273  FIDHGSVA-RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
              +DHG ++  T+  + +EA+ + + + ++GV + +V   LE EGVD F+ S+  LLD++ 
Sbjct  320   TVDHGKISGDTVSGSYAEAQQVLDDLARVGVSYTEVVELLETEGVDKFETSWQELLDTVS  379

Query  1450  EK  1455
             E+
Sbjct  380   EE  381



>ref|WP_038679905.1| transaldolase [Rubrobacter radiotolerans]
 gb|AHY45343.1| transaldolase [Rubrobacter radiotolerans]
Length=364

 Score =   304 bits (779),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 237/353 (67%), Gaps = 10/353 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKD  591
             GQS W D+L R      DL  L+++GV GVTSNP IFQKAIS+S+ Y+DQ  EL +   D
Sbjct  12    GQSVWIDSLSRDDLKNGDLKELLDAGVTGVTSNPTIFQKAISSSSLYDDQLAELAREESD  71

Query  592   IESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKV  771
              + +++ L   DI+DAC LF P+++ T   DGYVS+EVSP +A DTEGT+E A+ L + V
Sbjct  72    PKEVFFRLAKDDIRDACDLFRPVWERTGGLDGYVSLEVSPDIAYDTEGTVEEAQRLFEMV  131

Query  772   DRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGLN  942
             D+ N+ +KIPAT   +P+I+E+I+ G S+NVTLIFS+ERY AV +AY+ GLE    SG  
Sbjct  132   DKPNLLVKIPATEAGLPAIEEMISRGRSINVTLIFSLERYWAVAEAYIKGLERYVESG-G  190

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             D S V+SVASFFVSRVD+  DK L ++G     DL+G+ A   A LA+  +++ FSG RW
Sbjct  191   DPSGVSSVASFFVSRVDSETDKRLAEVGRE---DLKGRLAVDNAKLAYAAFEEIFSGERW  247

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVART  1302
             E LV+KGA  QR LWASTS K+P Y D  YV+PLIGP TV+TMP + L A ++   V  T
Sbjct  248   ERLVEKGANPQRPLWASTSTKDPEYSDLKYVEPLIGPKTVNTMPLETLRATMERAEVRET  307

Query  1303  IDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             I  ++  A  +   +++ GVD+  V   LE EGV  F  SF+ L++ ++EK+ 
Sbjct  308   IRDDLDSARALLGELEEAGVDYDDVSKTLEDEGVKKFADSFEELIEGIREKSR  360



>ref|WP_020110114.1| transaldolase [Rhodococcus sp. 114MFTsu3.1]
Length=374

 Score =   303 bits (776),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 183/353 (52%), Positives = 238/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI+S  V GVT+NP+IFQ A+S  +AY+ Q  EL + G 
Sbjct  14    GVSVWLDDLSRDRITSGNLQELIDSKSVVGVTTNPSIFQAALSKGDAYDAQVTELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +F PIY+ +   DG VS+EV PRLA DTE TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDIFAPIYESSAGVDGRVSIEVDPRLAHDTEKTIAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA--SGLN  942
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAVIDAYL+GLEA  +  +
Sbjct  134   VDRPNVLIKIPATEAGIPAIAKVIGEGISVNVTLIFSVERYEAVIDAYLEGLEAARAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLSK+ SVASFFVSRVDT +D  L+KIG+P+A  L+GKAA A A LA+  YQ+ F  GPR
Sbjct  194   DLSKIHSVASFFVSRVDTEIDARLDKIGTPDAEALKGKAALANARLAYVAYQQAFEVGPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             +  L   GA+ QR LWAST VKN AYPDTLYV  L+ P+TV+TMP++ L A  DHG V+ 
Sbjct  254   FHELAGSGARPQRPLWASTGVKNTAYPDTLYVTDLVSPNTVNTMPEKTLDAVADHGEVSG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              TI     E++ +++ +  +G+D   V   LE EGV  F+ S+  LL++  E+
Sbjct  314   DTISGKGPESQEVFDRLSAIGIDVTDVFLTLENEGVQKFEASWSELLEATGEQ  366



>ref|WP_019284791.1| MULTISPECIES: hypothetical protein [Actinomycetales]
Length=368

 Score =   303 bits (775),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/350 (48%), Positives = 237/350 (68%), Gaps = 7/350 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  ++++ GV GVT+NP+IF  A++    Y  Q KEL+  G 
Sbjct  13    GVSIWLDDLSRERISTGNLQEVVDTKGVVGVTTNPSIFASALAKGEKYTPQVKELIAEGA  72

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E   + L   D++DAC +  P+YD T+  DG VS+EV PRLA DTE T++ A+ L+  
Sbjct  73    DVERSVFALTTTDVRDACDIMRPVYDRTDGVDGRVSIEVDPRLAHDTERTVQVAQELYAA  132

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR NV IKIPAT   +P+I  V+A GISVNVTLIFS++RY AV++A++ G+E +     
Sbjct  133   VDRPNVMIKIPATVEGLPAISRVLAEGISVNVTLIFSLDRYRAVMNAFMTGVEQAREAGR  192

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLS++ SVASFFVSRVD+ VDK L+++G+ EA  L+GKA  A A LA+Q +Q++F  PRW
Sbjct  193   DLSQIHSVASFFVSRVDSEVDKRLDEVGTDEAAALKGKAGLANARLAYQAWQEQFGTPRW  252

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
               L   GA  QR LWAST VK+PAY DT+YVD L+ P TV+TMP++ L A  DHG +   
Sbjct  253   ANLADDGAHVQRPLWASTGVKDPAYKDTMYVDELVAPQTVNTMPEKTLDAAADHGEITGD  312

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             TI     E++ + +A+++ G+ + +V  QLE EGVD F+KS+  LL+++Q
Sbjct  313   TITGTYDESDAVMDALERQGISYVEVVEQLEREGVDKFEKSWTELLETVQ  362



>ref|WP_022924043.1| transaldolase [Serinicoccus marinus]
Length=381

 Score =   303 bits (776),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 170/360 (47%), Positives = 245/360 (68%), Gaps = 7/360 (2%)
 Frame = +1

Query  388   RTSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYND  558
             RT+LHDL +  G S W D+L RP+    +L   ++ GV GVT+NP IF  A++  +AY++
Sbjct  6     RTTLHDLADA-GVSVWLDDLNRPMISSGELQSYVDRGVLGVTTNPTIFASALAEGDAYSE  64

Query  559   QFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGT  738
             Q +EL   G D++   + L   D++DAC +  P+YD T+  DG VS+EV P  A DTE T
Sbjct  65    QVRELAADGADVDDAVFALTTDDVRDACDVLRPVYDRTDGVDGRVSIEVDPGAAKDTERT  124

Query  739   IEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLD  918
             ++ A+ L + +DR N++IKIPAT   +P+I + +A+GISVNVTLIFS++RY  V++AYL 
Sbjct  125   VQIAQQLWETIDRPNLFIKIPATVEGLPAITQTLASGISVNVTLIFSLDRYRGVMNAYLT  184

Query  919   GLEASGLN--DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql  1092
             GLE +     DLS + SVASFFVSRVD  +D  LE+IG+ EAL LRG+A  A A LA+Q 
Sbjct  185   GLEQAREQGRDLSTIHSVASFFVSRVDGEIDSRLEEIGTDEALALRGRAGLANARLAYQA  244

Query  1093  yqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLA  1272
             +++ F  PRW+ L   GA+ QR LWAST VKNP Y DT+YV  L+ P TV+TMP + L A
Sbjct  245   FEEVFGTPRWQNLADDGARLQRPLWASTGVKNPDYSDTMYVTGLVAPHTVNTMPAKTLEA  304

Query  1273  FIDHGSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
              +DH ++   T+  + ++A+ + + ++++GV + +V  QLEAEGVD F+ S+  LLD++Q
Sbjct  305   TVDHAALEGDTVSGSYAQAQQVLDDLERMGVSYAEVVDQLEAEGVDKFEASWSELLDTVQ  364



>ref|WP_005181151.1| transaldolase [Gordonia amarae]
 dbj|GAB03528.1| transaldolase [Gordonia amarae NBRC 15530]
Length=371

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 178/352 (51%), Positives = 236/352 (67%), Gaps = 7/352 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    DL  LI++  V GVT+NP+IFQ A+S   +Y+ Q  EL   G 
Sbjct  14    GVSVWLDDLSRDLISSGDLAALIDTKSVTGVTTNPSIFQAALSKGTSYDAQVSELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +   +Y+ T+  DG VS+EV PRLA DT+ T+  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLAGVYEATDGVDGRVSIEVDPRLAHDTDATVAQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N+ IKIPAT   +P+I +VIA GISVNVTLIFS+ERY  V+DAYL GLEA+    +
Sbjct  134   VDRPNLLIKIPATVAGLPAISKVIAEGISVNVTLIFSVERYLGVMDAYLAGLEAAATAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVDT VDK L  IGSPEA +L+GKAA A A LA+  Y+  FSG R+
Sbjct  194   DLSKIHSVASFFVSRVDTEVDKRLAAIGSPEATELQGKAALANARLAYAAYEDVFSGDRF  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
             +ALV KG + QR LWAST VKNP YPDTLYV  L+ P+TV+TMP + + AF DHG V   
Sbjct  254   DALVAKGGRSQRPLWASTGVKNPDYPDTLYVSELVAPNTVNTMPGKTMDAFADHGWVNTS  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
             +I      ++ +++ I  LGVD+  V   LE+EGV  F+ +++ LL +  E+
Sbjct  314   SIIGLGGASQEVFDKIAALGVDFTDVFEVLESEGVSKFEDAWNELLTATAEQ  365



>ref|WP_029536027.1| transaldolase [Saccharopolyspora spinosa]
Length=367

 Score =   302 bits (774),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 171/364 (47%), Positives = 231/364 (63%), Gaps = 9/364 (2%)
 Frame = +1

Query  388   RTSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYND  558
             RT LH L E  GQSPW D L R      DL  L+E G+ GVTSNP IFQ AI+  + Y+D
Sbjct  2     RTPLHALAE-HGQSPWVDYLSRRFVRDGDLAELVERGLAGVTSNPTIFQGAIAEGDYYDD  60

Query  559   QFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDET-EAGDGYVSVEVSPRLADDTEG  735
             Q +E++    D + ++  +  +DI+ AC +  P++D + +  DG+VS+EV P+LA+DT+ 
Sbjct  61    QLREVLATETDPKEVFLAIAREDIRYACDVLRPVFDRSKDTRDGWVSLEVDPQLANDTQA  120

Query  736   TIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYL  915
             TI+ A  LH+ +DR N+++KIP T   +P+I+E IA+GI VNVTL+FS+ER+ +  +AYL
Sbjct  121   TIDEAARLHRMIDRPNLFVKIPGTQAGLPAIEETIASGIPVNVTLLFSLERHRSAAEAYL  180

Query  916   DGLEASGLN--DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafq  1089
              GL     N  DL  VTSVASFFVSRVDT  D+ L+ IG  + +  +G  A A A LA++
Sbjct  181   RGLRRLRDNGGDLRSVTSVASFFVSRVDTEADRRLDAIGGHDEI--KGTLAIANAKLAYR  238

Query  1090  lyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALL  1269
              Y++ F+G  WE L   GA  QR LWASTS KNP Y D LYV+ LIGP TV+TM  + L 
Sbjct  239   TYEELFTGADWEELAAAGASPQRCLWASTSTKNPQYSDVLYVEELIGPQTVNTMTRETLQ  298

Query  1270  AFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
              F DHG VA T++ +V EA   ++     GVD+  V   LE EGVD F  SF  L D + 
Sbjct  299   DFQDHGRVAYTLERDVDEARRTFDRFAAAGVDYDDVTAVLEREGVDKFAASFQKLFDEIT  358

Query  1450  EKAN  1461
              K +
Sbjct  359   HKRD  362



>ref|WP_028822354.1| transaldolase [Propionimicrobium lymphophilum]
Length=367

 Score =   302 bits (774),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 186/360 (52%), Positives = 236/360 (66%), Gaps = 11/360 (3%)
 Frame = +1

Query  394   SLHDLYEKQGQSPWYDNLCRPVT---DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQ  561
             +LHD     G S W D+L R      DL  LI E  V GVT+NP+IF  A    + Y D+
Sbjct  7     ALHD----AGVSIWLDDLSRQRIESGDLKKLIDEKSVTGVTTNPSIFAAAFKDMSVYGDK  62

Query  562   FKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTI  741
              +EL +AG D++    +L+  D++DACK+F  +Y +T+  DG VS+EVSP LA++TE TI
Sbjct  63    LRELKEAGTDLDETIRQLMSMDVKDACKIFADLYSKTDGYDGRVSIEVSPLLANETEPTI  122

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
             E AK LH  VD  N+ IKIPAT   +P+I++ IAN ISVNVTLIFS+ERY  V+DAYL G
Sbjct  123   EQAKVLHDMVDEENILIKIPATKAGLPAIRKTIANSISVNVTLIFSLERYREVMDAYLSG  182

Query  922   LEAS--GLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqly  1095
             LE +     DLSK+ SVASFFVSRVDT +DK LE IGS +AL LRGKAA A A LA++ Y
Sbjct  183   LEDALEAGKDLSKIHSVASFFVSRVDTEIDKRLEAIGSEDALALRGKAAIANAQLAYKAY  242

Query  1096  qkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAF  1275
             ++ FS  R++AL  KGA  QR LWAST VKNP Y DT+YV  LI    V+TMP   + AF
Sbjct  243   KEVFSSDRFKALKAKGANLQRPLWASTGVKNPEYDDTMYVAELIAEPCVNTMPGATMDAF  302

Query  1276  IDHGSVA-RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQE  1452
              DHG VA  TI     EAE    A++K+G+D   V   LE EGV+ F  S+  L+D ++E
Sbjct  303   ADHGKVAGNTITPAFDEAEKTMAAVEKIGIDLNDVFDVLEKEGVEKFNVSWYELVDGVKE  362



>ref|WP_037113195.1| transaldolase [Rhodococcus fascians]
Length=374

 Score =   302 bits (774),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 182/353 (52%), Positives = 238/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI+S  V GVT+NP+IFQ A+S  +AY+ Q  EL + G 
Sbjct  14    GVSVWLDDLSRDRITSGNLKELIDSKSVVGVTTNPSIFQAALSKGDAYDAQVTELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +F PI++ +   DG VS+EV PRLA DTE TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDIFAPIHESSAGVDGRVSIEVDPRLAHDTEKTIAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA--SGLN  942
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAVI AYL+GLEA  +  +
Sbjct  134   VDRPNVLIKIPATEAGIPAIAKVIGEGISVNVTLIFSVERYEAVIGAYLEGLEAARAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLSK+ SVASFFVSRVDT +D  L+KIG+P+A  L+GKAA A A LA+  YQ+ F  GPR
Sbjct  194   DLSKIHSVASFFVSRVDTEIDARLDKIGTPDAEALKGKAALANARLAYVAYQQAFEVGPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             +  L   GA+ QR LWAST VKNPAYPDTLYV  L+ P+TV+TMP++ L A  DHG V+ 
Sbjct  254   FHELAGSGARPQRPLWASTGVKNPAYPDTLYVTDLVSPNTVNTMPEKTLDAVADHGEVSG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              TI     E++ +++ +  +G+D   V   LE EGV  F+ S+  LL++  E+
Sbjct  314   DTISGKGPESQEVFDQLSAIGIDVTDVFLTLENEGVQKFEASWSELLEATGEQ  366



>gb|AHI03139.1| transaldolase [Corynebacterium falsenii DSM 44353]
Length=371

 Score =   302 bits (773),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 238/355 (67%), Gaps = 8/355 (2%)
 Frame = +1

Query  415   KQGQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
             + G S W D+L R      +L  +I++ GV GVT+NPAIF KA+S  +AYNDQ +EL   
Sbjct  12    QAGTSVWLDDLSRDRLRSGNLKDVIDNKGVVGVTTNPAIFAKAMSAGDAYNDQLRELADK  71

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
             G    S  +++   D+++AC +F PIY+ T+  DG VS+EV PRLA++ E T+  A+ L 
Sbjct  72    GTPAHSAVFDMAADDVREACDVFAPIYEATDGVDGRVSLEVDPRLANEREATVTQARELA  131

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN  942
             + VDR N+ IKIPAT  C+P+I +V+ +G+SVNVTLIFS+ RY  V+DA+++G++ +  N
Sbjct  132   RTVDRENLLIKIPATEECLPAITDVLGSGVSVNVTLIFSVARYRQVMDAFIEGMKLAKDN  191

Query  943   --DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql-yqkkFSG  1113
               DL+K+ SVASFFVSRVDT +DK L+ IG+ EA  L+GKA  A A LA+    +     
Sbjct  192   GHDLTKIHSVASFFVSRVDTEIDKRLDAIGTEEAKALKGKAGVANAQLAYAAFKEALLDN  251

Query  1114  PRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV  1293
             P W+ L  +GA  QR LWASTSVKNP YPDT+YV  L GP+TV+TMP++ L A IDHG+V
Sbjct  252   PEWKDLETQGAHVQRPLWASTSVKNPEYPDTMYVTNLAGPNTVNTMPEETLDATIDHGTV  311

Query  1294  A-RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
             +   ++     A  ++ A+D +G+D   V   LE EGV+ F  S++ LLD+L E+
Sbjct  312   SGDALEGTEESAHEVFAALDSIGIDLGDVWKVLETEGVEKFVDSWNELLDTLSEQ  366



>ref|WP_010148530.1| transaldolase [Serinicoccus profundi]
Length=381

 Score =   302 bits (774),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 167/362 (46%), Positives = 241/362 (67%), Gaps = 7/362 (2%)
 Frame = +1

Query  388   RTSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYND  558
             RT+LHDL +  G S W D+L RP+    +L   ++ GV GVT+NP IF  A++   AY D
Sbjct  6     RTTLHDL-DDAGVSVWLDDLNRPMITSGELQAYVDRGVLGVTTNPTIFAAALAEGEAYTD  64

Query  559   QFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGT  738
             Q ++L  AG D++   + L  +D+++AC +  P+Y+ T   DG VS+EV P  A DTE T
Sbjct  65    QVRDLAAAGADVDEAVFALTTEDVRNACDVLMPVYERTGGQDGRVSIEVDPGAAKDTERT  124

Query  739   IEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLD  918
             ++ A+ L  ++DR N+ +KIPAT   +P+I + +A GISVNVTLIFS++RY  V++AYL 
Sbjct  125   VQIAERLWSEIDRPNLLVKIPATVEGLPAISQTLAKGISVNVTLIFSLDRYRGVMNAYLT  184

Query  919   GLEASGLN--DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql  1092
             GLE +  +  DLS + SVASFFVSRVD  +D  LEKIG+ EAL LRG+A  A A LA+Q 
Sbjct  185   GLEQAREHGVDLSTIRSVASFFVSRVDAEIDARLEKIGTEEALALRGQAGLANARLAYQA  244

Query  1093  yqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLA  1272
             +++ F  PRW+ L   GA  QR LWAST VKNP Y DT+YV  L+ P TV+TMP + L A
Sbjct  245   FEEVFGTPRWQNLADDGATLQRPLWASTGVKNPDYSDTMYVTGLVAPQTVNTMPAKTLEA  304

Query  1273  FIDHGSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
              +DH  +   T+  + ++A+ + + ++++GV + +V  QLE EGVD F+ S+  LL ++Q
Sbjct  305   TVDHAELEGDTVTGSYAQAQQVLDDLERVGVSYAEVVDQLETEGVDKFEASWSELLGTVQ  364

Query  1450  EK  1455
             ++
Sbjct  365   DE  366



>ref|WP_006591004.1| transaldolase [Kineosphaera limosa]
 dbj|GAB94471.1| transaldolase [Kineosphaera limosa NBRC 100340]
Length=384

 Score =   302 bits (773),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 221/355 (62%), Gaps = 11/355 (3%)
 Frame = +1

Query  415   KQGQSPWYDNLCRPVTDLIPL----IESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
             + G S W D+L RP+     L     E GV GVT+NP IF  A++   AY+ Q  +L   
Sbjct  20    RAGVSIWLDDLNRPMLTSGELGRKVAELGVVGVTTNPTIFAAALTQGGAYDQQVAQLAAE  79

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
             G D+ES  W L  +D+QDAC +  P++D T+  DG VS+EV PRLA D +GT++ A+ L 
Sbjct  80    GADVESAVWALTTRDVQDACDVLRPVFDATDGVDGRVSIEVDPRLARDKQGTLDMARRLW  139

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN  942
             + VDR NV IKIPAT   +P+I E IA GI+VNVTLIF I+RY  V++AYL GLE +  +
Sbjct  140   QSVDRPNVMIKIPATVEGLPAIAEAIAEGINVNVTLIFGIDRYRGVMNAYLTGLEQAREH  199

Query  943   --DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkk----  1104
               DLS++ SVASFFVSRVD+ VD+ L+++   E  D     A        +L  +     
Sbjct  200   GRDLSRIHSVASFFVSRVDSEVDQRLQQLADGEHADQARALAGKAGIANARLAYQAFEEV  259

Query  1105  FSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDH  1284
             FS PRW  L   GA KQR LWAST VKNP YPDT+YV  LI P+TV+TMP++ L A  DH
Sbjct  260   FSTPRWANLGDDGAHKQRPLWASTGVKNPEYPDTMYVTELIAPETVNTMPEKTLQAVADH  319

Query  1285  GSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             G V   TI     ++    + +++LG+ + QV  QLE EG+  F+ S++ LL+S+
Sbjct  320   GEVTGDTIVGQYEQSASTLDDLERLGISYTQVVEQLEQEGLTKFEASWEELLESV  374



>ref|WP_034396277.1| transaldolase [Candidatus Microthrix parvicella]
Length=347

 Score =   301 bits (770),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 167/328 (51%), Positives = 223/328 (68%), Gaps = 3/328 (1%)
 Frame = +1

Query  478   IESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEP  657
             IE GVRGVTSNP IF+KA+ +++ Y+++   L ++G   E  YW+LV  DI  A  L   
Sbjct  18    IERGVRGVTSNPTIFKKAMESAD-YDEELARLTRSGATTEQAYWQLVGSDISAAADLLSG  76

Query  658   IYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEV  837
             +++ +   DG+VSVEVSP LA DT  TIEA + L + +   N+Y+K+PAT   I +I+ +
Sbjct  77    VHERSNGEDGWVSVEVSPELAHDTAATIEAGRELARNLGLPNMYVKVPATPAGIEAIRVL  136

Query  838   IANGISVNVTLIFSIERYEAVIDAYLDGLEASGLNDLSKVTSVASFFVSRVDTLVDKLLE  1017
              + GI VNVTLIFS++RY  VI+AYL GLEA     LS ++SV SFF+SRVDT VD+ L+
Sbjct  137   TSEGIPVNVTLIFSLDRYADVIEAYLSGLEAH-QGGLSHISSVGSFFISRVDTEVDRRLQ  195

Query  1018  KIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAY  1197
             +IG+ +ALDL G AA  Q  LA+QL  + FSGPRW+AL ++GA  QR LWASTS KNP Y
Sbjct  196   EIGTNDALDLMGTAAITQGKLAYQLAMEAFSGPRWDALTERGATMQRPLWASTSTKNPDY  255

Query  1198  PDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQV  1377
             PDT YVD LIGP TV+T+P+  L AF DHG+V  T+DAN       +  + +L VD   V
Sbjct  256   PDTYYVDSLIGPHTVNTLPEATLEAFDDHGTVVSTLDANPEADRKRWEQLGEL-VDLDDV  314

Query  1378  GTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             G  LE+EGV SF +SF  +L +L E+ +
Sbjct  315   GATLESEGVASFAQSFREVLTTLAERVD  342



>ref|WP_012834170.1| transaldolase [Gordonia bronchialis]
 ref|YP_003273508.1| transaldolase [Gordonia bronchialis DSM 43247]
 gb|ACY21615.1| transaldolase [Gordonia bronchialis DSM 43247]
Length=372

 Score =   301 bits (772),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 243/353 (69%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    DL  LI +  V GVT+NP+IFQ A+S  N+Y+ Q  EL   G 
Sbjct  14    GVSVWLDDLSRDLIASGDLADLIATKSVVGVTTNPSIFQAALSKGNSYDAQVNELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +  P+++E+   DG VS+EV PRLA DT+GT+  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLAPVFEESNGVDGRVSIEVDPRLAHDTDGTVAQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N+ IKIPAT   +P+I +V+A GISVNVTLIFS+ERY+ V+DAYLDGL+A+ L  +
Sbjct  134   VDRPNLLIKIPATKAGLPAITKVLAEGISVNVTLIFSVERYKEVMDAYLDGLDAAALAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS + SVASFFVSRVDT VDK L+ IG+PEAL+LRGKAA A A LA+Q YQ+ F    R
Sbjct  194   DLSTIHSVASFFVSRVDTEVDKRLDAIGTPEALELRGKAALANARLAYQAYQEIFEVESR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +  L+ +GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP + + AF DHG V  
Sbjct  254   FPDLLAQGARPQRALWASTGVKNPDYPDTLYVSELVAPNTVNTMPGKTMDAFADHGWVNT  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              +I     E++ +++AI  LGVD+  V   LE+EGV  F+ +++ LL +  E+
Sbjct  314   GSIVGLGQESQAVFDAIAALGVDFADVFEVLESEGVSKFEDAWNDLLTATAEQ  366



>ref|WP_019513103.1| MULTISPECIES: transaldolase [Mycobacterium]
 ref|YP_008907121.1| transaldolase [Mycobacterium neoaurum VKM Ac-1815D]
 gb|AHC25486.1| transaldolase [Mycobacterium neoaurum VKM Ac-1815D]
Length=371

 Score =   301 bits (771),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 178/350 (51%), Positives = 235/350 (67%), Gaps = 7/350 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI +  V GVT+NP+IFQ A+S  +AY++Q  EL   G 
Sbjct  14    GVSVWLDDLSRERLQTGNLADLIATKSVVGVTTNPSIFQAALSKGDAYDEQVNELAAQGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +    Y+ T+  DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLAKTYEATDGVDGRVSIEVDPRLAHDTDKTILQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPAT   +P+I  VIA GISVNVTLIFS+ER++AVIDAYL GLE +    +
Sbjct  134   VDRPNLLIKIPATQAGLPAITAVIAEGISVNVTLIFSVERHKAVIDAYLAGLEKAKEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVD+ +D  LEKIGS EALDLRGKA  A A LA+  Y++ F G R+
Sbjct  194   DLSKIHSVASFFVSRVDSEIDARLEKIGSKEALDLRGKAGVANARLAYAAYEELFGGERF  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
              AL   GA+ QR LWAST VKNP Y DTLYV  L+ P+TV+TMP++ L A  DHG V   
Sbjct  254   AALKADGARAQRPLWASTGVKNPDYSDTLYVTELVAPNTVNTMPEKTLDAVADHGVVTGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             T+    +EA+G+++A+  +G+D   V   LE EGV+ F+KS+  L+++ Q
Sbjct  314   TVSGTAAEAQGVFDALVAVGIDKDDVFITLEEEGVEKFEKSWAELMEATQ  363



>ref|WP_005241794.1| transaldolase [Rhodococcus opacus]
 gb|EHI47413.1| transaldolase [Rhodococcus opacus PD630]
 gb|AHK31145.1| Transaldolase [Rhodococcus opacus PD630]
Length=374

 Score =   301 bits (771),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 236/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTDLIPLIE----SGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R   +   L E      V GVT+NP+IFQ A+S  + Y+ Q +EL + G 
Sbjct  14    GVSVWLDDLSRDRIESGNLAELVATKSVVGVTTNPSIFQAALSKGHVYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+    +   D++ AC +  P ++ +   DG VS+EV PRLA D + T+  A  L K 
Sbjct  74    DVEATIRTVTTDDVRAACDVLAPQFEASHGVDGRVSIEVDPRLAHDADKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N++IKIPAT   IP+I +V+  GISVNVTLIFS+ERYE V+ AYLDGLEA+    +
Sbjct  134   VDRPNLFIKIPATEAGIPAIAKVLGEGISVNVTLIFSVERYELVMGAYLDGLEAAKAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+KIG+PEAL LRGKAA A A LA+  YQ+ F   PR
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDKIGTPEALALRGKAALANARLAYAAYQQVFEVQPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             ++ L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L AF DHG VA 
Sbjct  254   FQGLLPGGARPQRALWASTGVKNPDYPDTLYVAELVAPNTVNTMPEKTLDAFADHGEVAG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+     EA+ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  314   DTVSGTAVEAQEVFDKLSAVGIDLTDVFKVLEDEGVDKFEVSWNELLDATAEQ  366



>ref|WP_030135669.1| MULTISPECIES: transaldolase [Mycobacterium]
 emb|CDQ44151.1| transaldolase [Mycobacterium neoaurum]
Length=371

 Score =   301 bits (771),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 178/350 (51%), Positives = 235/350 (67%), Gaps = 7/350 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI +  V GVT+NP+IFQ A+S  +AY++Q  EL   G 
Sbjct  14    GVSVWLDDLSRERLQTGNLADLIATKSVVGVTTNPSIFQAALSKGDAYDEQVNELAAQGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +    Y+ T+  DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLAKTYEATDGVDGRVSIEVDPRLAHDTDKTILQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPAT   +P+I  VIA GISVNVTLIFS+ER++AVIDAYL GLE +    +
Sbjct  134   VDRPNLLIKIPATQAGLPAITAVIAEGISVNVTLIFSVERHKAVIDAYLAGLEKAKEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVD+ +D  LEKIGS EALDLRGKA  A A LA+  Y++ F G R+
Sbjct  194   DLSKIHSVASFFVSRVDSEIDARLEKIGSQEALDLRGKAGVANARLAYAAYEELFGGDRF  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
              AL   GA+ QR LWAST VKNP Y DTLYV  L+ P+TV+TMP++ L A  DHG V   
Sbjct  254   AALKADGARAQRPLWASTGVKNPDYSDTLYVTELVAPNTVNTMPEKTLDAVADHGVVTGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             T+    +EA+G+++A+  +G+D   V   LE EGV+ F+KS+  L+++ Q
Sbjct  314   TVSGTAAEAQGVFDALVAVGIDKDDVFITLEEEGVEKFEKSWAELMEATQ  363



>ref|WP_007295871.1| transaldolase [Rhodococcus imtechensis]
 gb|EID81432.1| transaldolase [Rhodococcus imtechensis RKJ300 = JCM 13270]
Length=374

 Score =   301 bits (771),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 238/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTD---LIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R   +   L  LI +  V GVT+NP+IFQ A+S  + Y+ Q +EL + G 
Sbjct  14    GVSVWLDDLSRDRIESGNLAELIATKSVVGVTTNPSIFQAALSKGHVYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+    +   D++ AC +  P ++ +   DG VS+EV PRLA D + T+  A  L K 
Sbjct  74    DVEATIRTVTTDDVRAACDVLAPQFEASHGVDGRVSIEVDPRLAHDADKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N++IKIPAT   IP+I +V+  GISVNVTLIFS+ERYE V+ AYLDGLEA+    +
Sbjct  134   VDRPNLFIKIPATEAGIPAIAKVLGEGISVNVTLIFSVERYELVMGAYLDGLEAAKAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+KIG+PEAL LRGKAA A A LA+  YQ+ F   PR
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDKIGTPEALGLRGKAALANARLAYAAYQQVFEVQPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             ++ L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L AF DHG VA 
Sbjct  254   FQGLLSDGARPQRALWASTGVKNPDYPDTLYVAELVAPNTVNTMPEKTLDAFADHGEVAG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+     EA+ +++ +  +G+D   V   LE EGVD F+ S++ LL++  E+
Sbjct  314   DTVSGTAVEAQEVFDKLSAVGIDLTDVFKVLEDEGVDKFEVSWNELLEATAEQ  366



>ref|WP_007727941.1| transaldolase [Rhodococcus qingshengii]
 gb|EME24599.1| transaldolase [Rhodococcus qingshengii BKS 20-40]
Length=377

 Score =   301 bits (771),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 238/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S  +AY+ Q +EL Q G 
Sbjct  17    GVSIWLDDLSRDRIQSGNLQNLIDTKSIVGVTTNPSIFQAALSKGSAYDAQVRELAQRGA  76

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ +   DG VS+EV PRLA DT+ T+  A  LHK 
Sbjct  77    DVDATITAVTTDDVRAACDILAPQFEASNGVDGRVSIEVDPRLAHDTDATVAQAIELHKI  136

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAV+ AYL+GL+   A+G 
Sbjct  137   VDRPNVLIKIPATLAGIPAIAKVIGEGISVNVTLIFSVERYEAVMGAYLEGLDTAKAAG-  195

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
              D+S + SVASFFVSRVD+ +D  L  IG+PEAL+LRGKAA A A LA+  YQ+ F   P
Sbjct  196   RDISSIESVASFFVSRVDSEIDNRLTAIGTPEALELRGKAALANARLAYNAYQQIFEVQP  255

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++AL+  GAK QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG + 
Sbjct  256   RFQALLADGAKAQRPLWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDALADHGEIT  315

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI     E++ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  316   GDTISGTAQESQAVFDQLAAVGIDLADVFKVLETEGVDKFEVSWNELLDATAEQ  369



>ref|WP_018623215.1| hypothetical protein [Spirosoma luteum]
Length=368

 Score =   301 bits (770),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 240/348 (69%), Gaps = 10/348 (3%)
 Frame = +1

Query  424   QSPWYDNLCRPVT---DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKD  591
             QS W D + R +    +L  LI E G+RG+TSNPAIF+KAIS+ + Y++  K+L Q GK 
Sbjct  13    QSVWLDYIDRKIMNTGELQKLIDEDGIRGLTSNPAIFEKAISSGSDYDEDIKKLAQEGKP  72

Query  592   IESLYWELVVKDIQDACKLFEPIYDETEAG-DGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              E +++ L V DIQ A  LF+P+YDE   G DGYVS+EVSP LA +T+GTI+ A+ L + 
Sbjct  73    NEDIFYGLAVADIQQAADLFKPVYDEEVRGADGYVSLEVSPHLALNTDGTIKQARALWRA  132

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE--ASGLN  942
             VDR NV IKIP TA C+P+I++ I++GI++NVTL+F +ERYEAV+DAY+ GLE       
Sbjct  133   VDRDNVMIKIPGTAQCLPAIRQSISDGININVTLLFGLERYEAVVDAYMSGLEERVEKGQ  192

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
              + +++SVASFF+SR+D LVD LL + G     DL+G+ A A A  A+++Y+++FS  R+
Sbjct  193   IVDQISSVASFFLSRIDVLVDPLLHEKGLG---DLKGEVAIALARKAYEIYKREFSSDRF  249

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVART  1302
               L  KGAK QRLLWASTS K+P++ D  YV+ LIGP TV+T+P + L AF DHG  A  
Sbjct  250   RKLQAKGAKPQRLLWASTSSKDPSFSDVKYVEALIGPKTVNTIPMETLEAFRDHGKAASR  309

Query  1303  IDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             ++ ++ +A      + K G+D K +  QLE EG++ F K +D LL+++
Sbjct  310   LEDDLDKATQALERVQKAGIDLKSISQQLEDEGIEKFNKPYDKLLEAI  357



>ref|WP_030536403.1| transaldolase [Rhodococcus erythropolis]
Length=374

 Score =   301 bits (771),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 238/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S  +AY+ Q +EL Q G 
Sbjct  14    GVSIWLDDLSRDRIQSGNLQNLIDTKSIVGVTTNPSIFQAALSKGSAYDAQVRELAQRGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ +   DG VS+EV PRLA DT+ T+  A  LHK 
Sbjct  74    DVDATITAVTTDDVRAACDILAPQFEASNGVDGRVSIEVDPRLAHDTDATVAQAIELHKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAV+ AYL+GL+   A+G 
Sbjct  134   VDRPNVLIKIPATLAGIPAIAKVIGEGISVNVTLIFSVERYEAVMGAYLEGLDTAKAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
              D+S + SVASFFVSRVD+ +D  L  IG+PEAL+LRGKAA A A LA+  YQ+ F   P
Sbjct  193   RDISSIESVASFFVSRVDSEIDNRLTAIGTPEALELRGKAALANARLAYNAYQQIFEVQP  252

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++AL+  GAK QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG + 
Sbjct  253   RFQALLSDGAKAQRPLWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDALADHGEIT  312

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI     E++ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  313   GDTISGTAQESQAVFDQLAAVGIDLADVFKVLETEGVDKFEVSWNELLDATAEQ  366



>ref|WP_030528398.1| transaldolase [Phycicoccus jejuensis]
Length=371

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 241/358 (67%), Gaps = 8/358 (2%)
 Frame = +1

Query  397   LHDLYEKQGQSPWYDNLCR---PVTDLIPLIE-SGVRGVTSNPAIFQKAISTSNAYNDQF  564
             L DL    G S W D+L R      +L  LI+  GV GVT+NP+IFQ A++  +AY++Q 
Sbjct  7     LQDLA-ANGVSVWLDDLSRDRISSGNLQELIDDHGVVGVTTNPSIFQAALAEGHAYDEQV  65

Query  565   KELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIE  744
              EL + G+ ++   + L  +D+ DAC++F P+++ T+  DG VS+EV PR A DT  T++
Sbjct  66    AELARDGRSVDETVFSLTTRDVHDACEIFMPVFERTDGEDGRVSIEVDPRSAHDTAKTVQ  125

Query  745   AAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGL  924
              AK L   VD+ NV IKIPAT   +P+I +V+A GISVNVTLIFS++RY AV++A+L GL
Sbjct  126   EAKALRDAVDQPNVLIKIPATLEGLPAISQVLAEGISVNVTLIFSLDRYRAVMNAFLTGL  185

Query  925   EASGL--NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyq  1098
             E +     DLS++ SVASFFVSRVD  +DK L+ IG+ EA  LRGKA  A A LA+Q Y+
Sbjct  186   EQAREKGKDLSQIRSVASFFVSRVDGEIDKRLDAIGTDEAKALRGKAGLANARLAYQAYE  245

Query  1099  kkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFI  1278
             + FS PRW +L   GA  QR LWAST VK+PAYPDT+YV  L+ P TV+TMP++ L A  
Sbjct  246   EVFSTPRWASLEAAGAHPQRPLWASTGVKDPAYPDTMYVTELVAPGTVNTMPEKTLNATA  305

Query  1279  DHGSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             DHG V   T+  + +EA  + + +++LG+ + +V   LE EGV+ F+KS+  LLD +Q
Sbjct  306   DHGEVTGDTVTGSYAEATAVLDGLERLGISYSEVVDLLEREGVEKFEKSWAELLDRVQ  363



>ref|WP_027505286.1| transaldolase [Rhodococcus sp. UNC23MFCrub1.1]
Length=373

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 179/354 (51%), Positives = 238/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI+S  V GVT+NP+IFQ A+S   +Y++Q  EL   G 
Sbjct  14    GVSVWLDDLSRDRISSGNLKDLIDSKSVVGVTTNPSIFQAALSKGTSYDEQVNELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D++S+   +   D+++AC +  P+Y+ T   DG VS+EV PRLA DT+ T+  A  L K 
Sbjct  74    DVDSVIRTVTTDDVRNACDVLAPVYEATNGVDGRVSIEVDPRLAHDTDKTVAQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAV++AYL+GLE   A+G 
Sbjct  134   VDRPNVLIKIPATEAGIPAIAKVIGEGISVNVTLIFSVERYEAVMNAYLEGLESAKAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
             +DLS + SVASFFVSRVDT +DK L+ IG+PEA DL+GKAA A A LA+  YQ+ F  G 
Sbjct  193   HDLSSIHSVASFFVSRVDTEIDKRLDAIGTPEATDLKGKAALANARLAYVAYQQVFEIGS  252

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++ ++   A+ QR LWAST VK+P  PDTLYV  L+ P+TV+TMP++ + AF DHG V 
Sbjct  253   RFQGMLTDNARPQRPLWASTGVKDPTLPDTLYVSELVAPNTVNTMPEKTMDAFADHGEVT  312

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI     E++ +++AI  LG+D   V   LE EGV  F+ S+  LLD+  E+
Sbjct  313   GDTITGKGQESQAVFDAISALGIDLTDVFLVLENEGVQKFEASWGELLDATSEQ  366



>ref|WP_003945000.1| transaldolase [Rhodococcus erythropolis]
 gb|EEN85460.1| transaldolase [Rhodococcus erythropolis SK121]
Length=374

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 238/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S  +AY+ Q +EL Q G 
Sbjct  14    GVSIWLDDLSRDRIQSGNLQNLIDTKSIVGVTTNPSIFQAALSKGSAYDAQVRELAQRGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ +   DG VS+EV PRLA DT+ T+  A  LHK 
Sbjct  74    DVDATITAVTTDDVRAACDILAPQFEASNGVDGRVSIEVDPRLAHDTDATVAQAIELHKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAV+ AYL+GL+   A+G 
Sbjct  134   VDRPNVLIKIPATLAGIPAIAKVIGEGISVNVTLIFSVERYEAVMGAYLEGLDTAKAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
              D+S + SVASFFVSRVD+ +D  L  IG+PEAL+LRGKAA A A LA+  YQ+ F   P
Sbjct  193   RDISSIESVASFFVSRVDSEIDNRLTAIGTPEALELRGKAALANARLAYNAYQQIFEVQP  252

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++AL+  GAK QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG + 
Sbjct  253   RFQALLADGAKAQRPLWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDALADHGEIT  312

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI     E++ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  313   GDTISGTAQESQAVFDQLAGVGIDLADVFRVLETEGVDKFEVSWNELLDATAEQ  366



>ref|WP_019666351.1| MULTISPECIES: transaldolase [Rhodococcus]
Length=374

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 182/353 (52%), Positives = 237/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI+S  V GVT+NP+IFQ A+S  +AY+ Q  EL + G 
Sbjct  14    GVSVWLDDLSRDRITSGNLQELIDSKSVVGVTTNPSIFQAALSKGDAYDAQVTELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +F PIY+ +   DG VS+EV PRLA DTE TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDIFAPIYESSAGVDGRVSIEVDPRLAHDTEKTIAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA--SGLN  942
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAVI AYL+GLEA  +  +
Sbjct  134   VDRPNVLIKIPATEAGIPAIAKVIGEGISVNVTLIFSVERYEAVIGAYLEGLEAARAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLSK+ SVASFFVSRVDT +D  L+KIG+P+A  L+GKAA A A LA+  YQ+ F  GPR
Sbjct  194   DLSKIHSVASFFVSRVDTEIDARLDKIGTPDAEALKGKAALANARLAYVAYQQAFEVGPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             +  L   GA+ QR LWAST VKN AYPDTLYV  L+ P+TV+TMP++ L A  DHG V+ 
Sbjct  254   FHELAGSGARPQRPLWASTGVKNTAYPDTLYVTDLVSPNTVNTMPEKTLDAVADHGEVSG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              TI     E++ +++ +  +G+D   V   LE EGV  F+ S+  LL++  E+
Sbjct  314   DTISGKGPESQEVFDRLSAIGIDVTDVFLTLENEGVQKFEASWSELLEATGEQ  366



>ref|WP_005262260.1| transaldolase [Rhodococcus opacus]
 gb|EKT78504.1| transaldolase [Rhodococcus opacus M213]
Length=374

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 238/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI +  V GVT+NP+IFQ A+S  + Y+ Q +EL + G 
Sbjct  14    GVSVWLDDLSRDRIESGNLAELIATKSVVGVTTNPSIFQAALSKGHVYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+    +   D++ AC +  P ++ +   DG VS+EV PRLA D + T+  A  L K 
Sbjct  74    DVEATIRTVTTDDVRAACDVLAPQFEASHGVDGRVSIEVDPRLAHDADKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N++IKIPAT   IP+I +V+  GISVNVTLIFS+ERYE V+ AYLDGLEA+    +
Sbjct  134   VDRPNLFIKIPATEAGIPAIAKVLGEGISVNVTLIFSVERYELVMGAYLDGLEAAKAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+KIG+PEAL LRGKAA A A LA+  YQ+ F   PR
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDKIGTPEALALRGKAALANARLAYAAYQQVFEVQPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             ++ L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L AF DHG VA 
Sbjct  254   FQGLLPGGARPQRALWASTGVKNPDYPDTLYVAELVAPNTVNTMPEKTLDAFADHGEVAG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+     EA+ +++ +  +G+D   V   LE EGVD F+ S++ LL++  E+
Sbjct  314   DTVSGTAVEAQEVFDKLSAVGIDLTDVFKVLEDEGVDKFEVSWNELLEATAEQ  366



>ref|WP_013806692.1| transaldolase [Amycolicicoccus subflavus]
 ref|YP_004493143.1| transaldolase [Amycolicicoccus subflavus DQS3-9A1]
 gb|AEF40343.1| Transaldolase [Amycolicicoccus subflavus DQS3-9A1]
Length=375

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 230/354 (65%), Gaps = 9/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  L+E+  V GVT+NP IFQ A+++ +AY  Q  ELV  G 
Sbjct  14    GVSVWLDDLSRERLSSGNLAELVETRSVVGVTTNPTIFQGALASGHAYEAQLTELVSRGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              ++ +  EL   D+++AC L  P+YD T   DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    GVDDVVRELTTDDVRNACDLLTPVYDATGGQDGRVSIEVDPRLAHDTDRTIAQAHELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N+ +KIPAT   +P+I  VIA+GISVNVTLIFS+ERYEAVI AYL GLE +     
Sbjct  134   VDRPNLLVKIPATLAGLPAITSVIADGISVNVTLIFSVERYEAVISAYLAGLEQARQIGR  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR-  1119
             DLS++ SVASFFVSRVD+ +D  LEK+G+ EA  L G+A  A A LA+  +++ F G   
Sbjct  194   DLSRIRSVASFFVSRVDSEIDGRLEKLGTEEARGLLGQAGVANARLAYASFERVFGGSND  253

Query  1120  -WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
              W  L   GA  QR LWAST VKNP Y DT+YV  L+ P+TV+TMP++ + AF DHG V 
Sbjct  254   LWNGLKTAGAHVQRPLWASTGVKNPDYSDTMYVSELVAPNTVNTMPEKTMQAFADHGEVR  313

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               T+     EA+ +++A+   GVD   V  +LE EGVD F+KS++ LL++  ++
Sbjct  314   GDTVSGTADEAQRVFSALADAGVDLADVFVKLEEEGVDKFEKSWNELLEATSQQ  367



>ref|WP_010841007.1| MULTISPECIES: transaldolase [Gordonia]
 ref|YP_006669083.1| Transaldolase [Gordonia sp. KTR9]
 gb|AFR48927.1| Transaldolase [Gordonia sp. KTR9]
 gb|EON34468.1| transaldolase [Gordonia terrae C-6]
Length=373

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 239/353 (68%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    DL  LI +  V GVT+NP+IFQ A+S  NAY+DQ  EL   G 
Sbjct  14    GVSVWLDDLSRDLISSGDLADLIATKSVVGVTTNPSIFQAALSKGNAYDDQVNELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +  P ++ T+  DG VS+EV PRLA DT+ T+  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLAPTFEATDGVDGRVSIEVDPRLAHDTDATVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N+ IKIPAT   +P+I +VIA GISVNVTLIFS+ERYE VIDAYLDGL+A+    +
Sbjct  134   VDRPNLLIKIPATEAGLPAIAKVIAEGISVNVTLIFSVERYEKVIDAYLDGLDAAAQAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+ IG+PEA++L+GKAA A A LA+  YQ+ F    R
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDAIGTPEAVELKGKAALANARLAYSAYQQVFEVESR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +  L+ KGA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP + + AF DHG V  
Sbjct  254   FPDLLAKGARPQRALWASTGVKNPDYPDTLYVSELVAPNTVNTMPGKTMDAFADHGWVNT  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              +I    +E++ I++ I  +GVD   V   LE EGV  F+ +++ LL +  E+
Sbjct  314   GSIIGLAAESQEIFDKISAVGVDVADVFKVLEDEGVSKFEDAWNDLLSATAEQ  366



>ref|WP_005627313.1| transaldolase [Mycobacterium hassiacum]
 gb|EKF23761.1| transaldolase [Mycobacterium hassiacum DSM 44199]
Length=372

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 237/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  V GVT+NP IFQ A+S    Y+ Q +EL + G 
Sbjct  14    GVSVWLDDLSRERLQTGNLQQLIDTRSVVGVTTNPTIFQGALSNGTYYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+    +   D+++AC +    Y++++  DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    DVEATIRTVTTDDVRNACDVLAKQYEQSDGVDGRVSIEVDPRLAHDTDKTILQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPAT   +P+I  VIA GISVNVTLIFS+ERY  V+DAYL GLE +    +
Sbjct  134   VDRPNLLIKIPATMAGLPAITAVIAEGISVNVTLIFSVERYRLVMDAYLAGLEKAKEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF-SGPR  1119
             DLSK+ SVASFFVSRVDT VDK LEKIG+PEAL+LRG+A  A A LA+  YQ+ F  G R
Sbjct  194   DLSKIHSVASFFVSRVDTEVDKRLEKIGTPEALELRGQAGLANARLAYAAYQEVFLGGAR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +EAL   GA+ QR LWAST VKNPAYPDTLYV  L+ P+TV+TMP++ L A  DHG +  
Sbjct  254   YEALKPHGARVQRPLWASTGVKNPAYPDTLYVTELVAPNTVNTMPEKTLEAVADHGVITG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+    +E++ +++ +  +G+D   V   LE EGV+ F+KS+  LL++ Q +
Sbjct  314   DTVTGRATESQELFDKLSAIGIDLPDVFRVLEDEGVEKFEKSWQELLEATQTQ  366



>ref|WP_037747386.1| transaldolase [Streptomyces sp. CNQ-525]
Length=372

 Score =   300 bits (768),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 179/354 (51%), Positives = 237/354 (67%), Gaps = 9/354 (3%)
 Frame = +1

Query  418   QGQSPWYDNLCRP-VT--DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             +G + W D+L R  +T  +L  LI ES V GVT+NP IFQKAIS  + YN Q  +L   G
Sbjct  11    EGVAIWLDDLSRKRITSGNLAELIDESHVVGVTTNPTIFQKAISAGDGYNGQLTDLAVRG  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               +E     +   D++DA  +  P++D TE  DG VS+EV PRLA +T  T+  AK L  
Sbjct  71    VTVEEAVRMITTADVRDAADVLRPVFDATEGQDGRVSIEVDPRLAHETAATVAEAKQLAW  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASG  936
              VDR N+++KIPAT   +P+I EV+  GISVNVTLIFS+ERY  V+DA+L GLE   A+G
Sbjct  131   LVDRPNMFVKIPATRAGLPAITEVLGKGISVNVTLIFSLERYREVMDAFLAGLEQAKAAG  190

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
             L DL+++ SVASFFVSRVDT VDK L+ +G+PEA +LRG+AA A A LA++ Y++ FS  
Sbjct  191   L-DLAEIRSVASFFVSRVDTEVDKRLDALGTPEAKELRGRAAVANARLAYEAYEEVFSSD  249

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW AL K GA KQR LWAST VK+ AY DTLYVD L+ P TV+TMP+  L A  DHG + 
Sbjct  250   RWLALEKSGAHKQRPLWASTGVKDKAYKDTLYVDDLVAPGTVNTMPESTLHAVADHGGIE  309

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
                +    +EA    +A++KLG+ + +V   LE EGV+ F KS+  LLDS +++
Sbjct  310   GDKVRGTYAEARADLDALEKLGISYDEVVGLLEDEGVEKFAKSWTDLLDSTRQE  363



>ref|WP_004021955.1| transaldolase [Gordonia terrae]
 dbj|GAB45090.1| transaldolase [Gordonia terrae NBRC 100016]
Length=373

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 240/353 (68%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    DL  LI +  V GVT+NP+IFQ A+S  NAY+DQ  EL   G 
Sbjct  14    GVSVWLDDLSRDLISSGDLADLIATKSVVGVTTNPSIFQAALSKGNAYDDQVNELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +  P ++ T+  DG VS+EV PRLA DT+ T+  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLAPTFESTDGVDGRVSIEVDPRLAHDTDATVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N+ IKIPAT   +P+I +VIA GISVNVTLIFS+ERYE VI+AYLDGL+A+G   +
Sbjct  134   VDRPNLLIKIPATEAGLPAISKVIAEGISVNVTLIFSVERYEKVIEAYLDGLDAAGQAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+ IG+PEA++L+GKAA A A LA+  YQ+ F    R
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDAIGTPEAVELKGKAALANARLAYSAYQQVFEVESR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +  L+ KGA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP + + AF DHG V  
Sbjct  254   FPDLLAKGARPQRALWASTGVKNPDYPDTLYVSELVAPNTVNTMPGKTMDAFADHGWVNT  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              +I    +E++ I++ I  +GVD   V   LE EGV  F+ +++ LL +  E+
Sbjct  314   DSIIGLAAESQEIFDKIAAIGVDVVDVFKVLEDEGVSKFEDAWNDLLSATAEQ  366



>ref|WP_018835692.1| MULTISPECIES: transaldolase [Streptomyces]
Length=372

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 179/354 (51%), Positives = 237/354 (67%), Gaps = 9/354 (3%)
 Frame = +1

Query  418   QGQSPWYDNLCRP-VT--DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             +G + W D+L R  +T  +L  LI ES V GVT+NP IFQKAIS  + YN Q  +L   G
Sbjct  11    EGVAIWLDDLSRKRITSGNLAELIDESHVVGVTTNPTIFQKAISAGDGYNGQLTDLAVRG  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               +E     +   D++DA  +  P++D TE  DG VS+EV PRLA +T  T+  AK L  
Sbjct  71    VTVEEAVRMITTADVRDAADVLRPVFDATEGQDGRVSIEVDPRLAHETAATVAEAKQLAW  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASG  936
              VDR N+++KIPAT   +P+I EV+  GISVNVTLIFS+ERY  V+DA+L GLE   A+G
Sbjct  131   LVDRPNMFVKIPATRAGLPAITEVLGKGISVNVTLIFSLERYREVMDAFLAGLEQAKAAG  190

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
             L DL+++ SVASFFVSRVDT VDK L+ +G+PEA +LRG+AA A A LA++ Y++ FS  
Sbjct  191   L-DLAEIRSVASFFVSRVDTEVDKRLDALGTPEAKELRGRAAVANARLAYEAYEEVFSSD  249

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW AL K GA KQR LWAST VK+ AY DTLYVD L+ P TV+TMP+  L A  DHG + 
Sbjct  250   RWLALEKAGAHKQRPLWASTGVKDKAYKDTLYVDDLVAPGTVNTMPESTLHAVADHGGIE  309

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
                +    +EA    +A++KLG+ + +V   LE EGV+ F KS+  LLDS +++
Sbjct  310   GDKVRGTYAEARADLDALEKLGISYDEVVGLLEDEGVEKFAKSWTDLLDSTRQE  363



>ref|WP_036467261.1| transaldolase [Mycobacterium genavense]
Length=372

 Score =   300 bits (767),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 238/355 (67%), Gaps = 8/355 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  V GVT+NP+IFQKA +  ++Y+ Q  EL + G 
Sbjct  14    GVSVWLDDLSRQRLQSGNLKELIDTESVVGVTTNPSIFQKAFAEGDSYDSQIAELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ ++  DG VS+EV PRLA DT+ T+  A  L K 
Sbjct  74    DVDATIRTVTTDDVRTACDVLAPQWESSDGVDGRVSIEVDPRLAGDTDKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N++IKIPAT   +P+I  V+A GISVNVTLIFS+ER+ AV+DAYL GLE +    +
Sbjct  134   VDRPNLFIKIPATEAGLPAISAVLAEGISVNVTLIFSVERHRAVMDAYLAGLEKAREAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF-SGPR  1119
             DLSK+ SVASFFVSRVDT +DK LEKIGSPEALDLRG+A  A A LA+  YQ+ F  G R
Sbjct  194   DLSKIHSVASFFVSRVDTEIDKRLEKIGSPEALDLRGQAGVANARLAYAAYQEVFEGGAR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +EAL   GA+ QR LWAST VKNP Y DTLYV  L+ P+TV+TMP++ + A  DHG +  
Sbjct  254   YEALKADGARVQRPLWASTGVKNPDYSDTLYVTELVAPNTVNTMPEKTIDAVADHGVITG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
              TI     EA+G+++ +  +G+D   V   LE EGV+ F +S+  LLD  Q++ N
Sbjct  314   DTISGTAQEAQGVFDKLSAVGIDVTDVFLVLENEGVEKFVESWTELLDETQKQLN  368



>ref|WP_037237803.1| transaldolase [Rhodococcus wratislaviensis]
 dbj|GAF47978.1| transaldolase [Rhodococcus wratislaviensis NBRC 100605]
 gb|AII03917.1| transaldolase [Rhodococcus opacus]
Length=374

 Score =   299 bits (766),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 236/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTDLIPLIE----SGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R   +   L E      V GVT+NP+IFQ A+S  + Y+ Q +EL + G 
Sbjct  14    GVSVWLDDLSRDRIESGNLAELVATKSVVGVTTNPSIFQAALSKGHVYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+    +   D++ AC +  P ++ +   DG VS+EV PRLA D + T+  A  L K 
Sbjct  74    DVEATIRTVTTDDVRAACDVLAPQFEASHGVDGRVSIEVDPRLAHDADKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N++IKIPAT   IP+I +V+  GISVNVTLIFS+ERYE V+ AYLDGLEA+    +
Sbjct  134   VDRPNLFIKIPATEAGIPAIAKVLGEGISVNVTLIFSVERYELVMGAYLDGLEAAKAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+KIG+PEAL+LRGKAA A A LA+  YQ+ F   PR
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDKIGTPEALELRGKAAVANARLAYAAYQQIFEVQPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             ++ L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L AF DHG VA 
Sbjct  254   FQGLLSDGARPQRALWASTGVKNPDYPDTLYVAELVAPNTVNTMPEKTLDAFADHGEVAG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+     E++ +++ +  +G+D   V   LE EGVD F+ S+  LL++  E+
Sbjct  314   DTVSGTAVESQEVFDKLSAVGIDLTDVFKVLEDEGVDKFEVSWTELLEATAEQ  366



>ref|WP_038568295.1| transaldolase [Dermacoccus nishinomiyaensis]
 gb|AIF40853.1| transaldolase [Dermacoccus nishinomiyaensis]
Length=373

 Score =   299 bits (766),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 229/352 (65%), Gaps = 7/352 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIESG-VRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L RP+    +L  L+E+  V GVTSNP IF  A+S  +AYN+Q  EL  AG+
Sbjct  14    GVSIWLDDLNRPMVTGDELSKLVETNNVVGVTSNPTIFATALSDGSAYNEQVAELAAAGQ  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              ++   + +  KD+  AC +  P+YD T   DG VS+EV PR+A DTEGT+  AK L + 
Sbjct  74    GVDEAVFAITTKDVMAACDILRPVYDATNGEDGRVSIEVDPRMARDTEGTVTMAKQLWET  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN--  942
             + R N  IKIPAT   +P+I  V+A GISVNVTLIFS++RY  V++A+L GLE +  N  
Sbjct  134   IGRENCMIKIPATVEGLPAISAVLAEGISVNVTLIFSLDRYRGVMNAFLTGLEQARENGK  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVDT  D  L+ +G+ EA  L+ KA  A A LA+Q +++ FS PRW
Sbjct  194   DLSKIRSVASFFVSRVDTEFDARLDAVGTDEAKALKSKAGIANARLAYQAFEEVFSTPRW  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
             + L   GA  QR LWAST VK+P+ PDTLYV  L  P+TV+TMP + L A  DHG+V   
Sbjct  254   QTLADDGAHVQRPLWASTGVKDPSLPDTLYVTELAAPNTVNTMPPKTLAALADHGTVEGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              I     EA+   +A++  GV +  V  +LE EG+D F+KS++ LL S++ +
Sbjct  314   RITGTHDEAKATMDALEHAGVSYADVVDKLETEGLDKFEKSWEELLGSVRSE  365



>ref|WP_006945373.1| transaldolase [Dermacoccus sp. Ellin185]
 gb|EFP58069.1| transaldolase [Dermacoccus sp. Ellin185]
Length=373

 Score =   299 bits (765),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 229/352 (65%), Gaps = 7/352 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIESG-VRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L RP+    +L  L+E+  V GVTSNP IF  A+S  +AYN+Q  EL  AG+
Sbjct  14    GVSIWLDDLNRPMVTGDELSKLVETNNVVGVTSNPTIFATALSDGSAYNEQVAELAAAGQ  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              ++   + +  KD+  AC +  P+YD T   DG VS+EV PR+A DTEGT+  AK L + 
Sbjct  74    GVDEAVFGITTKDVMAACDILRPVYDATNGEDGRVSIEVDPRMARDTEGTVTMAKQLWET  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN--  942
             + R N  IKIPAT   +P+I  V+A GISVNVTLIFS++RY  V++A+L GLE +  N  
Sbjct  134   IGRENCMIKIPATVEGLPAISAVLAEGISVNVTLIFSLDRYRGVMNAFLTGLEQARENGK  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVDT  D  L+ +G+ EA  L+ KA  A A LA+Q +++ FS PRW
Sbjct  194   DLSKIRSVASFFVSRVDTEFDARLDAVGTDEAKALKSKAGIANARLAYQAFEEVFSTPRW  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
             + L   GA  QR LWAST VK+P+ PDTLYV  L  P+TV+TMP + L A  DHG+V   
Sbjct  254   QTLADDGAHVQRPLWASTGVKDPSLPDTLYVTELAAPNTVNTMPPKTLAALADHGTVEGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              I     EA+   +A++  GV +  V  +LE EG+D F+KS++ LL S++ +
Sbjct  314   RISGTYDEAKATMDALEHAGVSYADVVDKLETEGLDKFEKSWEELLGSVRSE  365



>ref|WP_028326322.1| transaldolase [Dermatophilus congolensis]
Length=371

 Score =   299 bits (765),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 174/349 (50%), Positives = 233/349 (67%), Gaps = 7/349 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    DL  LI ESGV GVT+NP IF  A+S   AY DQ  +L  A  
Sbjct  14    GVSVWLDDLSRTLISSGDLQKLIDESGVVGVTTNPTIFATALSNGEAYADQVAQLAAANT  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              ++   + +   D+++AC + +PIYD T   DG VS+EV PRLA +T+ T++ AK L+  
Sbjct  74    PVDDAVFAITTDDVRNACDVLKPIYDATGGKDGRVSIEVDPRLAHETDATVDMAKKLYAT  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR NV IKIPAT   +P+I  V+A GISVNVTLIFS+++Y  V+ A+++G+E +     
Sbjct  134   VDRENVMIKIPATTAGLPAITAVLAEGISVNVTLIFSLDQYRGVLAAFIEGIEKAKEAGK  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             D+SK+ SVASFFVSRVDT +D  LEKIG+ EAL LRGKAA A A LA+Q++++ F+  RW
Sbjct  194   DISKIHSVASFFVSRVDTEIDPRLEKIGTDEALALRGKAAIANARLAYQVFEEAFATSRW  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
             + L   GA KQR LWAST VKNP Y DT+YV  L  P TV+TMP + L A  DHG V A 
Sbjct  254   DVLEAAGANKQRALWASTGVKNPEYDDTMYVVDLAAPHTVNTMPGKTLEAVADHGKVRAN  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              I  +  +++ I + +  LG+ + +V T+LE EGV+ F+KS+  LLDSL
Sbjct  314   AIAGSYEDSQAILDKLAALGISYDEVVTKLEKEGVEKFEKSWTELLDSL  362



>ref|WP_005573327.1| transaldolase [Rhodococcus wratislaviensis]
 gb|ELB86977.1| transaldolase [Rhodococcus wratislaviensis IFP 2016]
Length=374

 Score =   299 bits (765),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 237/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTD---LIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R   +   L  LI +  V GVT+NP+IFQ A+S  + Y+ Q +EL + G 
Sbjct  14    GVSVWLDDLSRDRIESGNLAELIATKSVVGVTTNPSIFQAALSKGHVYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+    +   D++ AC +  P ++ +   DG VS+EV PRLA D + T+  A  L K 
Sbjct  74    DVEATIRTVTTDDVRAACDVLAPQFEASHGVDGRVSIEVDPRLAHDADKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N++IKIPAT   IP+I +V+  GISVNVTLIFS+ERYE V+ AYLDGLEA+    +
Sbjct  134   VDRPNLFIKIPATEAGIPAIAKVLGEGISVNVTLIFSVERYELVMGAYLDGLEAAKAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+KIG+PEAL LRGKAA A A LA+  YQ+ F   PR
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDKIGTPEALALRGKAALANARLAYAAYQQVFEVQPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-  1296
             ++ L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L AF DHG VA 
Sbjct  254   FQGLLSDGARPQRALWASTGVKNPDYPDTLYVAELVAPNTVNTMPEKTLDAFADHGEVAG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+     E++ +++ +  +G+D   V   LE EGVD F+ S+  LL++  E+
Sbjct  314   DTVSGTAVESQQVFDKLSAVGIDLTDVFKVLEDEGVDKFEVSWTELLEATAEQ  366



>ref|WP_006866293.1| transaldolase [Gordonia namibiensis]
 dbj|GAC00071.1| transaldolase [Gordonia namibiensis NBRC 108229]
Length=373

 Score =   298 bits (764),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 237/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    DL  LI +  V GVT+NP+IFQ A+S   AYN Q  EL   G 
Sbjct  14    GVSVWLDDLSRDLISSGDLAELIATKSVVGVTTNPSIFQAALSKGTAYNAQVNELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D++     +   D+++AC +  P+Y+E++  DG VS+EV PRLA DT+GT+  A  L K 
Sbjct  74    DVDGTIRTVTTDDVRNACDVLAPVYEESDGVDGRVSIEVDPRLAHDTDGTVAQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N+ IKIPAT   +P+I +VIA GISVNVTLIFS+ERY+ V+DAYLDGL+A+    +
Sbjct  134   VDRPNLLIKIPATKAGLPAITKVIAEGISVNVTLIFSVERYKEVMDAYLDGLDAAAEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS + SVASFFVSRVDT +DK L+ IG+PEA++L+GKAA A A LA+  YQ+ F    R
Sbjct  194   DLSNIHSVASFFVSRVDTEIDKRLDAIGTPEAVELKGKAALANARLAYSAYQQVFEVESR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +  L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP + + AF DHG V  
Sbjct  254   FPDLLAHGARPQRALWASTGVKNPDYPDTLYVSELVAPNTVNTMPGKTMDAFADHGWVNT  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              +I     E++ I++ I  LGVD   V   LE EGV  F+ +++ LLD+  E+
Sbjct  314   GSIIGLAQESQEIFDKIAALGVDTVDVFKVLEEEGVSKFEDAWNDLLDATAEQ  366



>ref|WP_037038734.1| transaldolase [Pseudonocardia autotrophica]
Length=370

 Score =   298 bits (764),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 234/352 (66%), Gaps = 7/352 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP-VT--DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R  +T  +L+ LI E  V GVT+NP IF  A+    AYN Q  EL   G 
Sbjct  14    GVSIWLDDLSRERITSGNLVELITERSVVGVTTNPTIFAAALKNGEAYNAQVNELAGRGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             DI +   E+ V D+Q AC +F   ++ T+  DG VS+EV P LA DTE T+  A  L K 
Sbjct  74    DIAASIREITVADVQQACDVFSGTWEATQGIDGRVSLEVDPTLARDTEATVAQALDLWKA  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN--  942
             VDR N+ +KIPAT P +P+I   ++ G+SVNVTLIFS+ERY+AV++A+L GLE +  N  
Sbjct  134   VDRPNLLVKIPATEPGLPAITRALSEGVSVNVTLIFSVERYKAVMEAFLSGLEQADKNGQ  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             +LS++ SVASFFVSRVDT +D  L+KIG+ EA  L+GKA  A + LAF  Y++ F   RW
Sbjct  194   ELSRIASVASFFVSRVDTEIDARLDKIGTDEAKALKGKAGVANSRLAFAAYEEVFGSERW  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
              AL  KGA++QR LWAST VKNP YPDT+Y+  L+ P+ V+TMP++ L AF DHG V   
Sbjct  254   AALEAKGARRQRPLWASTGVKNPEYPDTMYITELVVPNVVNTMPEKTLQAFADHGEVEGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              +    +EA+ +++ ++++G+D   V   LE EGVD F+KS+  L +S+Q++
Sbjct  314   KVTGTAAEAQQVFDDLERVGIDLTDVFLTLENEGVDKFEKSWSELQESVQQQ  365



>ref|WP_007927588.1| transaldolase [Janibacter hoylei]
 gb|EKA61042.1| transaldolase [Janibacter hoylei PVAS-1]
Length=379

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 239/350 (68%), Gaps = 9/350 (3%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  +I++ G+ GVT+NP+IFQ A++  +AY +Q   L   GK
Sbjct  22    GVSVWLDDLSRERLRSGNLQEVIDTKGIVGVTTNPSIFQAALADGDAYTEQLTALAAEGK  81

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D++ + + L   D+++AC LF PIY+ T+  DG VS+EV PRLA D E T   AK L + 
Sbjct  82    DVDEVVFALTTDDVREACDLFVPIYEATDGVDGRVSIEVDPRLAHDAEQTAVVAKQLAET  141

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             V R  V+IKIPAT   +P+I   +A GISVNVTLIFS+ERY AV++AY++GLE   A+G 
Sbjct  142   VGRPQVHIKIPATETGLPAITATLAEGISVNVTLIFSLERYRAVMNAYVEGLEQALAAG-  200

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
              D+S++ SVASFFVSRVD+ +D  L++IG+ EA  LRGKA  A A LA+Q Y++ F+  R
Sbjct  201   KDISQIHSVASFFVSRVDSEIDGRLDEIGTDEARALRGKAGLANARLAYQAYEEVFATQR  260

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             W+ L  +G ++QR LWAST VK+PAYPDTLYV  L+  DTV+TMP++ L A IDHG V  
Sbjct  261   WQRLEAEGGRRQRPLWASTGVKDPAYPDTLYVTELVAADTVNTMPEKTLDATIDHGEVTG  320

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              T+     EA+ + +A++ LG+ + +V  QLE EGV+ F+K++  LLD +
Sbjct  321   DTVTGGYEEAQQVLDALEGLGISYTEVTAQLEREGVEKFEKAWAELLDGV  370



>ref|WP_020907723.1| probable transaldolase [Rhodococcus erythropolis]
 ref|YP_002766491.1| probable transaldolase [Rhodococcus erythropolis PR4]
 dbj|BAH33752.1| probable transaldolase [Rhodococcus erythropolis PR4]
Length=377

 Score =   298 bits (763),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 176/354 (50%), Positives = 238/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S  +AY+ Q +EL + G 
Sbjct  17    GVSIWLDDLSRDRIQSGNLQNLIDTKSIVGVTTNPSIFQAALSKGSAYDAQVRELAERGA  76

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ +   DG VS+EV PRLA DT+ T+  A  LHK 
Sbjct  77    DVDATITAVTTDDVRAACDILAPQFEASNGVDGRVSIEVDPRLAHDTDATVAQAIELHKI  136

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAV+ AYLDGL+   A+G 
Sbjct  137   VDRPNVLIKIPATLAGIPAIAKVIGEGISVNVTLIFSVERYEAVMGAYLDGLDTAKAAG-  195

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
              D+S + SVASFFVSRVD+ +D  L  IG+PEAL+LRGKAA A A LA+  YQ+ F   P
Sbjct  196   RDISSIESVASFFVSRVDSEIDNRLTAIGTPEALELRGKAALANARLAYNAYQQIFEVQP  255

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++AL+  GAK QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG + 
Sbjct  256   RFQALLSDGAKAQRPLWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDALADHGEIT  315

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI     +++ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  316   GDTISGTAQDSQVVFDQLAAVGIDLADVFKVLETEGVDKFEVSWNELLDATAEQ  369



>ref|WP_037668542.1| transaldolase [Streptomyces griseus]
Length=372

 Score =   298 bits (763),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 179/352 (51%), Positives = 233/352 (66%), Gaps = 9/352 (3%)
 Frame = +1

Query  418   QGQSPWYDNLCRP-VT--DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             +G + W D+L R  +T  +L  LI +  V GVT+NP IFQKAIS+ + Y  Q ++L    
Sbjct  11    EGVAIWLDDLSRKRITSGNLAELIDQQHVVGVTTNPTIFQKAISSGDGYEQQLEDLAARK  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               +E     +   D++DA  +  P++D T+  DG VS+EV PRLA +T  T+  AK L  
Sbjct  71    VTVEEAVRMITTADVRDAADILRPVFDATDGQDGRVSIEVDPRLAHNTRATVAEAKQLAW  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS---G  936
              VDR N  IKIPAT   +P+I EVI NGISVNVTLIFS+ERY  V+DAYL GLE +   G
Sbjct  131   LVDRPNTLIKIPATRAGLPAITEVIGNGISVNVTLIFSLERYREVMDAYLSGLEKAREKG  190

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
             L DLSK+ SVASFFVSRVDT +DK L+ +G+PEA   RGKAA A A LA+Q Y++ FS  
Sbjct  191   L-DLSKIRSVASFFVSRVDTEIDKRLDDLGTPEAKAARGKAAVANARLAYQAYEEVFSSD  249

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW AL K GA+KQR LWAST VK+PAY DTLYVD L+ P+TV+TMP+  LLA  DHG + 
Sbjct  250   RWSALEKAGARKQRPLWASTGVKDPAYKDTLYVDDLVAPNTVNTMPEATLLATEDHGEIT  309

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
               T+     +A    +A++KLG+ +  V   LE EGV+ F+ S++ LL S +
Sbjct  310   GNTVGGAYEQARTDLDALEKLGISYDDVVQVLEDEGVEKFEASWNDLLKSTE  361



>ref|WP_034976510.1| transaldolase [Corynebacterium jeikeium]
Length=370

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 229/356 (64%), Gaps = 8/356 (2%)
 Frame = +1

Query  403   DLYEKQGQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKE  570
             D     G S W D+L R      +L  +IE+ GV GVT+NPAIF  A+S   AY++Q ++
Sbjct  8     DALANAGTSVWLDDLSRDRLRSGNLAEVIENKGVVGVTTNPAIFANAMSQGTAYDEQLQQ  67

Query  571   LVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAA  750
             L  AG   ++  +E+   D+ +AC +F PIY+ T   DG VS+EV PRLA + E T+  A
Sbjct  68    LAAAGTPADTAVFEMAADDVAEACDVFLPIYERTNGVDGRVSLEVDPRLAKEREATVTQA  127

Query  751   KWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE-  927
             + L  KV R N+ IKIPAT  C+P+I +V+A GISVNVTLIFS+ RY  V++A+++G+  
Sbjct  128   RELAAKVGRENLMIKIPATEECLPAIADVLAEGISVNVTLIFSVSRYIQVMEAFIEGMSR  187

Query  928   -ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql-yqk  1101
              A    DL+K+ SVASFFVSRVDT +DK L++IG+  AL L+GK+  A A LA+      
Sbjct  188   AAGAGKDLTKIHSVASFFVSRVDTEIDKRLDEIGTDAALALKGKSGVANAQLAYAAFQDT  247

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
               + P WEAL  KGA  QR LWASTSVKNP YPDTLYV  L GP TV+TMP+  L A ID
Sbjct  248   LLNNPAWEALADKGAPVQRPLWASTSVKNPEYPDTLYVTELAGPHTVNTMPENTLDATID  307

Query  1282  HGSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             HG V   T+      A  ++ A+D+ GV+  +V T LE EGV+ F  S++ LL +L
Sbjct  308   HGEVRGDTLSGTTDSARAVFAALDEAGVNLAEVWTVLENEGVEKFVDSWNELLGTL  363



>ref|WP_029255341.1| MULTISPECIES: transaldolase [Rhodococcus]
Length=374

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/354 (50%), Positives = 238/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S  +AY+ Q +EL + G 
Sbjct  14    GVSIWLDDLSRDRIQSGNLQNLIDTKSIVGVTTNPSIFQAALSKGSAYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ +   DG VS+EV PRLA DT+ T+  A  LHK 
Sbjct  74    DVDATITAVTTDDVRAACDILAPQFEASNGVDGRVSIEVDPRLAHDTDATVAQAIELHKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAV+ AYLDGL+   A+G 
Sbjct  134   VDRPNVLIKIPATLAGIPAIAKVIGEGISVNVTLIFSVERYEAVMGAYLDGLDTAKAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
              D+S + SVASFFVSRVD+ +D  L  IG+PEAL+LRGKAA A A LA+  YQ+ F   P
Sbjct  193   RDISSIESVASFFVSRVDSEIDNRLTAIGTPEALELRGKAALANARLAYNAYQQIFEVQP  252

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++AL+  GAK QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG + 
Sbjct  253   RFQALLADGAKAQRPLWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDALADHGEIT  312

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI     +++ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  313   GDTISGTAQDSQVVFDQLAAVGIDLADVFKVLETEGVDKFEVSWNELLDATAEQ  366



>ref|WP_033440753.1| transaldolase [Saccharothrix sp. NRRL B-16314]
Length=370

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 233/354 (66%), Gaps = 7/354 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTD---LIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R   D   L  L+ +  V GVT+NP IF  A+S   AY++Q +EL   G 
Sbjct  13    GVSIWLDDLSRERLDTGNLAGLVADRHVVGVTTNPTIFAGALSKGTAYDEQVRELASRGA  72

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D ++   E+   D+++AC LF  IY+ T+  DG VS+EV PRLA+DT+ TI  A  L K 
Sbjct  73    DTDAAVREITTTDVRNACDLFRDIYNATDGVDGRVSIEVDPRLANDTDATIAEALDLAKA  132

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN--  942
             VDR N+ +KIPAT   +P+I  VIA GISVNVTLIFS+ERY  V++A++ GLE +  N  
Sbjct  133   VDRPNLLVKIPATVEGLPAITRVIAEGISVNVTLIFSVERYRHVMEAFVAGLEQAKANGH  192

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DL  + SVASFFVSRVD+ +DK L+ +G+PEA  LRGKAA A A LA+  +Q+ F+G RW
Sbjct  193   DLRGIHSVASFFVSRVDSEIDKRLDALGTPEATALRGKAAIANAVLAYAAFQETFTGARW  252

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
             EAL   GA+ QR LWAST VK+P Y DT YVD L+  DTV+TMP++ L A  DHG +   
Sbjct  253   EALAADGARAQRPLWASTGVKDPQYSDTRYVDQLVVADTVNTMPEKTLHAVADHGKIEGD  312

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             T+    + A+ +++A+  +G+D   V   LE EGVD F+KS+  LLD++  + N
Sbjct  313   TVTGRAAGAQEVFDALVGVGIDLDDVFVVLETEGVDKFEKSWAELLDTVTGQLN  366



>ref|WP_020969597.1| MULTISPECIES: transaldolase [Rhodococcus]
 ref|YP_008453364.1| transaldolase [Rhodococcus erythropolis CCM2595]
 gb|AGT92643.1| transaldolase [Rhodococcus erythropolis CCM2595]
Length=374

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/354 (50%), Positives = 238/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S  +AY+ Q +EL + G 
Sbjct  14    GVSIWLDDLSRDRIQSGNLQNLIDTKSIVGVTTNPSIFQAALSKGSAYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ +   DG VS+EV PRLA DT+ T+  A  LHK 
Sbjct  74    DVDATITAVTTDDVRAACDILAPQFEASNGVDGRVSIEVDPRLAHDTDATVAQAIELHKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI+ GISVNVTLIFS+ERYEAV+ AYLDGL+   A+G 
Sbjct  134   VDRPNVLIKIPATLAGIPAIAKVISEGISVNVTLIFSVERYEAVMGAYLDGLDTAKAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
              D+S + SVASFFVSRVD+ +D  L  IG+PEAL LRGKAA A A LA+  YQ+ F   P
Sbjct  193   RDISSIESVASFFVSRVDSEIDNRLTAIGTPEALQLRGKAALANARLAYNAYQQIFEVQP  252

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++AL+  GAK QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG + 
Sbjct  253   RFQALLADGAKAQRPLWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDALADHGEIT  312

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI     +++ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  313   GDTISGTAQDSQVVFDQLAAVGIDLADVFKVLETEGVDKFEVSWNELLDATAEQ  366



>ref|WP_033232242.1| transaldolase [Rhodococcus rhodochrous]
Length=374

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/354 (49%), Positives = 236/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S  + Y+ Q +EL Q G 
Sbjct  14    GVSIWLDDLSRDRIQSGNLQNLIDTKSIVGVTTNPSIFQAALSKGSDYDAQVRELAQRGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ +   DG VS+EV PRLA +T+ T+  A  LHK 
Sbjct  74    DVDATITAVTTDDVRAACDILAPQFEASNGVDGRVSIEVDPRLAHNTDATVAQAVELHKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAV+ AYLDGLE   A+G 
Sbjct  134   VDRPNVLIKIPATLAGIPAIAKVIGEGISVNVTLIFSVERYEAVMGAYLDGLETAKAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
              D+S + SVASFFVSRVD+ +D  L  IG+PEAL+LRGKAA A A LA+  YQ+ F   P
Sbjct  193   RDVSSIESVASFFVSRVDSEIDNRLTAIGTPEALELRGKAALANARLAYNAYQQVFEVQP  252

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++ L+  GAK QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG + 
Sbjct  253   RFQGLLADGAKAQRPLWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDALADHGEIT  312

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               T+     E++ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  313   GDTVSGTAQESQAVFDQLAAVGIDLADVFNVLETEGVDKFEVSWNELLDATAEQ  366



>gb|EQM32954.1| transaldolase [Rhodococcus erythropolis DN1]
 gb|ERB52825.1| transaldolase [Rhodococcus sp. P27]
Length=377

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/354 (50%), Positives = 238/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S  +AY+ Q +EL + G 
Sbjct  17    GVSIWLDDLSRDRIQSGNLQNLIDTKSIVGVTTNPSIFQAALSKGSAYDAQVRELAERGA  76

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ +   DG VS+EV PRLA DT+ T+  A  LHK 
Sbjct  77    DVDATITAVTTDDVRAACDILAPQFEASNGVDGRVSIEVDPRLAHDTDATVAQAIELHKI  136

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAV+ AYLDGL+   A+G 
Sbjct  137   VDRPNVLIKIPATLAGIPAIAKVIGEGISVNVTLIFSVERYEAVMGAYLDGLDTAKAAG-  195

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
              D+S + SVASFFVSRVD+ +D  L  IG+PEAL+LRGKAA A A LA+  YQ+ F   P
Sbjct  196   RDISSIESVASFFVSRVDSEIDNRLTAIGTPEALELRGKAALANARLAYNAYQQIFEVQP  255

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++AL+  GAK QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG + 
Sbjct  256   RFQALLADGAKAQRPLWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDALADHGEIT  315

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI     +++ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  316   GDTISGTAQDSQVVFDQLAAVGIDLADVFKVLETEGVDKFEVSWNELLDATAEQ  369



>ref|WP_027742954.1| transaldolase [Streptomyces sp. CNT371]
Length=372

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 178/354 (50%), Positives = 237/354 (67%), Gaps = 9/354 (3%)
 Frame = +1

Query  418   QGQSPWYDNLCRP-VT--DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             +G + W D+L R  +T  +L  LI ES V GVT+NP IFQKAIS  + Y+ Q  +L   G
Sbjct  11    EGVAIWLDDLSRKRITSGNLAELIDESHVVGVTTNPTIFQKAISAGDGYDGQLTDLAVRG  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               +E     +   D++DA  +  P++D TE  DG VS+EV PRLA +T  T+  AK L  
Sbjct  71    VTVEEAVRMITTADVRDAADVLRPVFDATEGQDGRVSIEVDPRLAHETAATVAEAKQLAW  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASG  936
              VDR N+++KIPAT   +P+I EV+  GISVNVTLIFS+ERY  V+DA+L GLE   A+G
Sbjct  131   LVDRPNMFVKIPATRAGLPAITEVLGKGISVNVTLIFSLERYREVMDAFLAGLEQAKAAG  190

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
             L DL+++ SVASFFVSRVDT VDK L+ +G+PEA +LRG+AA A A LA++ Y++ FS  
Sbjct  191   L-DLAEIRSVASFFVSRVDTEVDKRLDALGTPEAKELRGRAAVANARLAYEAYEEVFSSD  249

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW AL K GA KQR LWAST VK+ AY DTLYVD L+ P TV+TMP+  L A  DHG + 
Sbjct  250   RWLALEKAGAHKQRPLWASTGVKDKAYKDTLYVDDLVAPGTVNTMPESTLHAVADHGGIE  309

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
                +    +EA    +A++KLG+ + +V   LE EGV+ F KS+  LLDS +++
Sbjct  310   GDKVRGTYAEARADLDALEKLGISYDEVVGLLEDEGVEKFAKSWTDLLDSTRQE  363



>ref|WP_009480450.1| transaldolase [Rhodococcus sp. JVH1]
 gb|EJI93689.1| transaldolase [Rhodococcus sp. JVH1]
Length=374

 Score =   297 bits (761),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 236/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTD---LIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R   +   L  LI +  V GVT+NP+IFQ A+S  + Y+ Q +EL + G 
Sbjct  14    GVSVWLDDLSRDRIESGNLAELIATKSVVGVTTNPSIFQAALSKGHVYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+    +   D++ AC +  P ++ +   DG VS+EV PRLA D + T+  A  L K 
Sbjct  74    DVEATIRTVTTDDVRAACAVLAPQFEASHGVDGRVSIEVDPRLAHDADKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N++IKIPAT   IP+I +V+  GISVNVTLIFS+ERYE V+ AYLDGLEA+    +
Sbjct  134   VDRPNLFIKIPATEAGIPAIAKVLGEGISVNVTLIFSVERYELVMGAYLDGLEAAKAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+KIG+PEAL LRGKAA A A LA+  YQ+ F   PR
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDKIGTPEALALRGKAALANARLAYAAYQQVFEVQPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGS-VA  1296
             ++ L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L AF DHG  V 
Sbjct  254   FQGLLPDGARPQRALWASTGVKNPDYPDTLYVSELVAPNTVNTMPEKTLDAFADHGEVVG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+     E++ +++ +  +G+D   V   LE EGVD F+ S+  LL++  E+
Sbjct  314   DTVSGTAVESQEVFDKLSAVGIDLTDVFKVLEDEGVDKFEVSWTELLEATAEQ  366



>ref|WP_029538101.1| transaldolase [Rhodococcus erythropolis]
Length=374

 Score =   297 bits (760),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 176/354 (50%), Positives = 237/354 (67%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S  +AY+ Q +EL + G 
Sbjct  14    GVSIWLDDLSRDRIRSGNLQNLIDTKSIVGVTTNPSIFQAALSKGSAYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P +  +   DG VS+EV PRLA DT+ T+  A  LHK 
Sbjct  74    DVDATITAVTTDDVRAACDILAPQFKASNGVDGRVSIEVDPRLAHDTDATVAQAIELHKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR NV IKIPAT   IP+I +VI  GISVNVTLIFS+ERYEAV+ AYLDGL+   A+G 
Sbjct  134   VDRPNVLIKIPATLAGIPAIAKVIGEGISVNVTLIFSVERYEAVMGAYLDGLDTAKAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GP  1116
              D+S + SVASFFVSRVD+ +D  L  IG+PEAL+LRGKAA A A LA+  YQ+ F   P
Sbjct  193   RDISSIESVASFFVSRVDSEIDNRLTAIGTPEALELRGKAALANARLAYNAYQQIFEVQP  252

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R++AL+  GAK QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG + 
Sbjct  253   RFQALLADGAKAQRPLWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDALADHGEIT  312

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI     +++ +++ +  +G+D   V   LE EGVD F+ S++ LLD+  E+
Sbjct  313   GDTISGTAQDSQVVFDQLAAVGIDLADVFKVLETEGVDKFEVSWNELLDATAEQ  366



>gb|KHN16892.1| Transaldolase, partial [Glycine soja]
Length=240

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 164/241 (68%), Positives = 196/241 (81%), Gaps = 3/241 (1%)
 Frame = +1

Query  406   LYEKQGQSPWYDNLCRPVTDLIP-LIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
             LYE Q Q P+YDNLCRPV+DL+P +I +G RGVT+NP  F++AIS+SN Y+D+ +EL +A
Sbjct  1     LYENQRQKPYYDNLCRPVSDLLPFIIVNGFRGVTTNP--FERAISSSNVYDDRLRELAEA  58

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
             GKDIES YWELVVKDIQDACKL EPIY+E +  DG VSV VSP+LA+DT+GTIEAAK LH
Sbjct  59    GKDIESAYWELVVKDIQDACKLLEPIYNEKDGEDGNVSVMVSPKLANDTKGTIEAAKKLH  118

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN  942
             K V   +VYIKIPAT   I S+KEVI  GISV  TLIF + +YEAVIDAYLDGLEA  L 
Sbjct  119   KMVGSPSVYIKIPATDEFISSMKEVICLGISVYATLIFCLPKYEAVIDAYLDGLEACSLT  178

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DL KV+S A+F++SRVD  +DK L++IG+ EALDL+GK A AQA LA+QLYQKKFSGPRW
Sbjct  179   DLYKVSSAAAFYISRVDATLDKKLDQIGTTEALDLKGKGAVAQAVLAYQLYQKKFSGPRW  238

Query  1123  E  1125
             E
Sbjct  239   E  239



>ref|WP_011598880.1| transaldolase [Rhodococcus jostii]
 ref|YP_707107.1| transaldolase [Rhodococcus jostii RHA1]
 gb|ABG98949.1| transaldolase [Rhodococcus jostii RHA1]
Length=374

 Score =   297 bits (760),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 236/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTD---LIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R   +   L  LI +  V GVT+NP+IFQ A+S  + Y+ Q +EL + G 
Sbjct  14    GVSVWLDDLSRDRIESGNLAELIATKSVVGVTTNPSIFQAALSKGHVYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+    +   D++ AC +  P ++ +   DG VS+EV PRLA D + T+  A  L K 
Sbjct  74    DVEATIRTVTTDDVRAACDVLAPQFEASHGVDGRVSIEVDPRLAHDADKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N++IKIPAT   IP+I +V+  GISVNVTLIFS+ERYE V+ AYLDGLEA+    +
Sbjct  134   VDRPNLFIKIPATEAGIPAIAKVLGEGISVNVTLIFSVERYELVMGAYLDGLEAAKAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+KIG+PEAL LRGKAA A A LA+  YQ+ F   PR
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDKIGTPEALALRGKAALANARLAYAAYQQVFEVQPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGS-VA  1296
             ++ L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L AF DHG  V 
Sbjct  254   FQGLLPDGARPQRALWASTGVKNPDYPDTLYVSELVAPNTVNTMPEKTLDAFADHGEVVG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+     E++ +++ +  +G+D   V   LE EGVD F+ S+  LL++  E+
Sbjct  314   DTVSGTAVESQEVFDKLSAVGIDLTDVFKVLEDEGVDKFEVSWTELLEATAEQ  366



>ref|WP_028644196.1| transaldolase [Nocardioides sp. URHA0020]
Length=368

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 237/351 (68%), Gaps = 10/351 (3%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LIE+  V GVT+NP IF  AI+    Y++Q ++LV  G+
Sbjct  12    GVSIWLDDLSRERIETGNLAELIETKSVVGVTTNPTIFAAAIANGERYDEQVRQLVDKGE  71

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              ++ + +EL  +D+++AC +F P+  E E+ DG VS+EV P LA+DTEGTI +A+ L   
Sbjct  72    SVDRVIFELTTEDVRNACDIFAPLAGE-ESADGRVSIEVEPTLANDTEGTIGSARALWSA  130

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA---SGL  939
             VDR NV IKIPAT   +P+I   IA GISVNVTLIF   RY+ V+DAYL GLEA   +GL
Sbjct  131   VDRSNVLIKIPATKEGLPAITAAIAEGISVNVTLIFGKVRYQEVMDAYLSGLEAARDAGL  190

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
              DLS++ SVASFFVSRVD+ VD  L+KIG+ EA  L+GKAA A A +A+  Y++  +  R
Sbjct  191   -DLSRIQSVASFFVSRVDSEVDARLDKIGTDEAAALKGKAAVANARIAYAAYEEVHASDR  249

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             W  L K GA  QR LWAST VK+PAYPDTLYV  L+  DTV+TMP++ + AF DHG V  
Sbjct  250   WAVLAKDGANPQRPLWASTGVKDPAYPDTLYVADLVVADTVNTMPEKTMDAFADHGEVTG  309

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
               +    +EA+ +++ +  +G+D++ V   LE EGVD FKKS+  L+++++
Sbjct  310   DQVTGKATEAQAVFDQLAAVGIDFEDVLVVLETEGVDKFKKSWTELVETVK  360



>ref|WP_024497112.1| transaldolase [Gordonia amicalis]
Length=373

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 235/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    DL  LI +  V GVT+NP+IFQ A+S   AYN Q  EL   G 
Sbjct  14    GVSVWLDDLSRDLITSGDLAELISTKSVVGVTTNPSIFQAALSKGTAYNAQVTELAARGT  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D++     +   D++DAC +  P+Y+E++  DG VS+EV PRLA DT+ T+  A  L K 
Sbjct  74    DVDGTIRTVTTDDVRDACDVLAPVYEESDGVDGRVSIEVDPRLAHDTDATVAQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N+ IKIPAT   +P+I  VIA GISVNVTLIFS+ERY+ V+DAYLDGL+A+    +
Sbjct  134   VDRPNLLIKIPATKAGLPAITRVIAEGISVNVTLIFSVERYKEVMDAYLDGLDAAAEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS + SVASFFVSRVDT +DK L+ IG+PEA +L+GKAA A A LA+  YQ+ F    R
Sbjct  194   DLSNIHSVASFFVSRVDTEIDKRLDAIGTPEATELKGKAALANARLAYSAYQQVFEVESR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +  L+ KGA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP + + AF DHG V  
Sbjct  254   FPDLLAKGARPQRALWASTGVKNPDYPDTLYVSELVAPNTVNTMPGKTMDAFADHGWVNT  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              +I     E++ +++ I  LGVD   V   LE EGV  F+ +++ LL++  E+
Sbjct  314   GSIIGLAQESQEVFDKIAALGVDTVDVFKVLEEEGVSKFEDAWNDLLNATAEQ  366



>ref|WP_012087367.1| transaldolase [Kineococcus radiotolerans]
 ref|YP_001362651.1| transaldolase [Kineococcus radiotolerans SRS30216 = ATCC BAA-149]
 gb|ABS04387.1| transaldolase [Kineococcus radiotolerans SRS30216 = ATCC BAA-149]
Length=373

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 235/354 (66%), Gaps = 6/354 (2%)
 Frame = +1

Query  412   EKQGQSPWYDNLCRPVTD---LIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
              + G S W D+L R +TD   L  L+++GV GVTSNP IF  A+S  + Y DQ KELV  
Sbjct  9     HQHGVSVWLDDLSRELTDGGELQRLVDAGVLGVTSNPTIFATALSKGDRYTDQVKELVGK  68

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
             G D E   + +  +D++ AC + +P++D T+  DG VS+EV PR A DT  T  +A+ L 
Sbjct  69    GVDTEEAVFHITTEDVRRACDVLKPVFDRTDGIDGRVSLEVDPRQARDTAATEASARRLW  128

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN  942
             + V R N++IKIPAT   +P+I   ++ GISVNVTLIFS++RY AV+ A+L GLE +  N
Sbjct  129   EAVGRENLHIKIPATVEGLPAITTALSEGISVNVTLIFSLDRYRAVMQAFLTGLEQAKQN  188

Query  943   --DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
               D+SK+ SVASFFVSRVDT VD+ L +IG+ EA  LR KA  A A LA+Q Y++ FS P
Sbjct  189   GHDISKIHSVASFFVSRVDTEVDRRLGEIGTDEANALRSKAGLANARLAYQAYEEVFSTP  248

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW+ L + GA  QR LWAST VK+P  PDTLYV  L+  +TV+TMP + L A IDHG V 
Sbjct  249   RWQVLKEAGAHAQRPLWASTGVKDPNLPDTLYVTGLVAENTVNTMPGKTLDATIDHGEVT  308

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               TI  +  E++ + + +++LG+ + +V   LE EG+D F+KS+  LL ++ ++
Sbjct  309   GDTIRGSYGESQSVLDDLERLGISYTEVVELLETEGLDKFEKSWTELLQTVTDE  362



>ref|WP_028652247.1| transaldolase [Nocardioides halotolerans]
Length=366

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 179/361 (50%), Positives = 239/361 (66%), Gaps = 11/361 (3%)
 Frame = +1

Query  397   LHDLYEKQGQSPWYDNLCRP---VTDLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQF  564
             L DL +  G S W D+L R      +L  LI +  V GVT+NP IF  AI+    Y+DQ 
Sbjct  5     LQDLADA-GVSIWLDDLSRERIETGNLAELIKDRHVVGVTTNPTIFASAIAEGERYDDQV  63

Query  565   KELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIE  744
             ++LV  G D+  + +EL  +D+++ C +  P+Y+ T+A DG VS+EV P LA+DT+ TI+
Sbjct  64    RKLVADGADVTKVIFELTTEDVRNGCDIMTPVYESTKA-DGRVSIEVEPDLANDTDATID  122

Query  745   AAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGL  924
             +AK L + VDR N YIKIPAT   +P+I   IA GI+VNVTLIFS+ERY  V+DAYL GL
Sbjct  123   SAKKLWRAVDRPNAYIKIPATEEGLPAITAAIAEGINVNVTLIFSVERYRGVMDAYLAGL  182

Query  925   EA---SGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqly  1095
             E    +GL DLS++ SVASFFVSRVDT VDK L+ +GS EA  LRGKAA A A LA+  Y
Sbjct  183   EQARDAGL-DLSRIFSVASFFVSRVDTEVDKRLDDLGSDEAKALRGKAAVANAVLAYAAY  241

Query  1096  qkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAF  1275
              +  +  RW+ L   GA  QR LWAST VKNP YPDTLYV  L+  DTV+TMP++ L AF
Sbjct  242   DEVVASDRWKQLADAGANPQRPLWASTGVKNPDYPDTLYVTDLVVADTVNTMPEKTLEAF  301

Query  1276  IDHGSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQE  1452
              DHG V    +     EA+ +++ +D +G+D   V   LE EGVD FKKS+  L++++++
Sbjct  302   ADHGEVKGDVVSGRAEEAQALFDQLDGVGIDLPDVFRVLEEEGVDKFKKSWTELVETVEK  361

Query  1453  K  1455
             +
Sbjct  362   Q  362



>ref|WP_035008178.1| transaldolase [Corynebacterium jeikeium]
Length=370

 Score =   296 bits (759),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 229/356 (64%), Gaps = 8/356 (2%)
 Frame = +1

Query  403   DLYEKQGQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKE  570
             D     G S W D+L R      +L  +IE+ GV GVT+NPAIF  A+S   AY++Q ++
Sbjct  8     DALANAGTSVWLDDLSRDRLRSGNLAEVIENKGVVGVTTNPAIFANAMSQGTAYDEQLQQ  67

Query  571   LVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAA  750
             L  AG   ++  +E+   D+ +AC +F PIY+ T   DG VS+EV PRLA + E T+  A
Sbjct  68    LAAAGTPADTAVFEMAADDVAEACDVFLPIYERTNGVDGRVSLEVDPRLAKEREATVTQA  127

Query  751   KWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE-  927
             + L  KV R N+ IKIPAT  C+P+I +V+A GISVNVTLIFS+ RY  V++A+++G+  
Sbjct  128   RELAAKVGRENLMIKIPATEECLPAIADVLAEGISVNVTLIFSVSRYIQVMEAFIEGMSR  187

Query  928   -ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql-yqk  1101
              A    DL+K+ SVASFFVSRVDT +DK L++IG+  AL L+GK+  A A LA+      
Sbjct  188   AAGAGKDLTKIHSVASFFVSRVDTEIDKRLDEIGTDAALALKGKSGVANAQLAYAAFEDT  247

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
               + P W AL +KGA  QR LWASTSVKNP YPDTLYV  L GP TV+TMP+  L A ID
Sbjct  248   LLNNPAWNALAEKGAPVQRPLWASTSVKNPEYPDTLYVTELAGPHTVNTMPENTLDATID  307

Query  1282  HGSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             HG V   T+      A  ++ A+D+ GV+  +V T LE EGV+ F  S++ LL +L
Sbjct  308   HGEVRGDTLSGTTDSARAVFAALDEAGVNLAEVWTVLENEGVEKFVDSWNELLGTL  363



>ref|WP_002812891.1| transaldolase [Nitrosococcus oceani]
 gb|EDZ65869.1| transaldolase [Nitrosococcus oceani AFC27]
 gb|KFI20753.1| transaldolase [Nitrosococcus oceani C-27]
Length=377

 Score =   296 bits (759),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 164/359 (46%), Positives = 234/359 (65%), Gaps = 14/359 (4%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTDLIPLI----ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             GQS W DNL R +     L     E G+ GVTSNP+IF KAI+ S+ Y+ Q + L++ G+
Sbjct  12    GQSYWIDNLTRRMIKNGELKHRVEEQGLGGVTSNPSIFHKAIANSDDYDPQIETLIREGR  71

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
                 +Y  L+  DI+DAC +  P+Y E +  DG+VS+EVSP LA DTEG+I+ A+ L + 
Sbjct  72    SKIEIYEALITTDIRDACDILHPVYKERKGQDGFVSLEVSPYLAHDTEGSIQEARRLWQT  131

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA--SGLN  942
             VDR N++IKIP TA  +P+I+E++  GI++N+TL+FSI+ Y+AV +AYL  LE       
Sbjct  132   VDRPNLFIKIPGTAAGVPAIEELLFEGININITLLFSIDHYQAVAEAYLRALERRLEAGQ  191

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEAL--------Dlrgkaanaqaalafqlyq  1098
              +  + SVASFF+SR+D L D+LL     PE          +LRGK A A A LA+Q ++
Sbjct  192   TVENIASVASFFLSRIDVLADQLLSHRIPPEGKSPSAPHPENLRGKVAIANAKLAYQRFK  251

Query  1099  kkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFI  1278
             +     RW+ L  KGA+ QR+LWASTS KNPAY D +YV+PLIGP TV+T+P++ + AF 
Sbjct  252   EILQSERWKTLAGKGAQVQRMLWASTSTKNPAYRDVMYVEPLIGPYTVNTLPEKTIKAFA  311

Query  1279  DHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
             DHG V  T++ N+ E+  ++  ++K+G+D+  V  QLE EGV  F   +D+LL  L+ K
Sbjct  312   DHGIVKETVEENIEESRKVFADLEKIGIDFNLVTAQLENEGVQKFIDPYDALLAMLEAK  370



>ref|WP_011330282.1| transaldolase [Nitrosococcus oceani]
 ref|YP_342329.1| transaldolase [Nitrosococcus oceani ATCC 19707]
 gb|ABA56799.1| transaldolase [Nitrosococcus oceani ATCC 19707]
Length=376

 Score =   296 bits (759),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 164/359 (46%), Positives = 234/359 (65%), Gaps = 14/359 (4%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTDLIPLI----ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             GQS W DNL R +     L     E G+ GVTSNP+IF KAI+ S+ Y+ Q + L++ G+
Sbjct  11    GQSYWIDNLTRRMIKNGELKHRVEEQGLGGVTSNPSIFHKAIANSDDYDPQIETLIREGR  70

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
                 +Y  L+  DI+DAC +  P+Y E +  DG+VS+EVSP LA DTEG+I+ A+ L + 
Sbjct  71    SKIEIYEALITTDIRDACDILHPVYKERKGQDGFVSLEVSPYLAHDTEGSIQEARRLWQT  130

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA--SGLN  942
             VDR N++IKIP TA  +P+I+E++  GI++N+TL+FSI+ Y+AV +AYL  LE       
Sbjct  131   VDRPNLFIKIPGTAAGVPAIEELLFEGININITLLFSIDHYQAVAEAYLRALERRLEAGQ  190

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEAL--------Dlrgkaanaqaalafqlyq  1098
              +  + SVASFF+SR+D L D+LL     PE          +LRGK A A A LA+Q ++
Sbjct  191   TVENIASVASFFLSRIDVLADQLLSHRIPPEGKSPSAPHPENLRGKVAIANAKLAYQRFK  250

Query  1099  kkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFI  1278
             +     RW+ L  KGA+ QR+LWASTS KNPAY D +YV+PLIGP TV+T+P++ + AF 
Sbjct  251   EILQSERWKTLAGKGAQVQRMLWASTSTKNPAYRDVMYVEPLIGPYTVNTLPEKTIKAFA  310

Query  1279  DHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
             DHG V  T++ N+ E+  ++  ++K+G+D+  V  QLE EGV  F   +D+LL  L+ K
Sbjct  311   DHGIVKETVEENIEESRKVFADLEKIGIDFNLVTAQLENEGVQKFIDPYDALLAMLEAK  369



>ref|WP_021764447.1| transaldolase [Leifsonia aquatica]
 gb|ERK69895.1| transaldolase [Leifsonia aquatica ATCC 14665]
Length=370

 Score =   296 bits (758),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 229/351 (65%), Gaps = 9/351 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R       L  LI E  V GVT+NP IF  A+S   AY DQ K L  AG 
Sbjct  14    GVSIWLDDLSRERIATGGLQKLIAEKNVVGVTTNPTIFAAALSKGEAYADQVKSLAAAGT  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              +E   +E+   D+  A  +F  +Y++TE  DG VS+EV P LA D  GTIE AK L  K
Sbjct  74    SVEDAIFEITTDDVAAASDIFHDVYEQTEGTDGRVSIEVEPGLAHDAAGTIEQAKKLATK  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA---SGL  939
             VD+ NV IKIPAT   + +I E IA GISVNVTLIFS+ERY AVIDAYL GLE    +G+
Sbjct  134   VDKPNVLIKIPATVEGLEAITETIAAGISVNVTLIFSLERYRAVIDAYLTGLEKAKDAGI  193

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
              DLS + SVASFFVSRVDT +DK L  IG+ EA  L+ KA  A A LA+++Y++ F+  R
Sbjct  194   -DLSGIQSVASFFVSRVDTEIDKRLTAIGTDEANSLKSKAGIANARLAYEVYEQAFATDR  252

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
              +ALV  GA +QR LWAST VK+P+ PDTLYV  L+ P+TV+TMP++ L A  DHG +  
Sbjct  253   AKALVASGANEQRPLWASTGVKDPSLPDTLYVTELVAPNTVNTMPEKTLDATFDHGVITG  312

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
              T+  N ++A+G+ +A+  LGVD+  V   LE EGVD F  S+  L+++++
Sbjct  313   DTVTGNYADAQGVLDALAGLGVDYDDVTATLEREGVDKFNVSWSELVETVK  363



>ref|WP_013985981.1| transaldolase [Sulfobacillus acidophilus]
 ref|YP_004718984.1| transaldolase [Sulfobacillus acidophilus TPY]
 ref|YP_005257731.1| transaldolase, glucose-6-phosphate isomerase [Sulfobacillus acidophilus 
DSM 10332]
 gb|AEJ39241.1| transaldolase [Sulfobacillus acidophilus TPY]
 gb|AEW06059.1| transaldolase, glucose-6-phosphate isomerase [Sulfobacillus acidophilus 
DSM 10332]
Length=924

 Score =   311 bits (797),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 178/352 (51%), Positives = 241/352 (68%), Gaps = 11/352 (3%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTD---LIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKD  591
             GQS WYDN+ R + +   L  LI+ G+ GVTSNP IF+KAI+ S+ Y+   + LV+ G  
Sbjct  11    GQSLWYDNIRRGILESGELARLIDQGITGVTSNPTIFEKAINGSHDYDADIRALVKQGLT  70

Query  592   IESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKV  771
             ++++Y  LV++DI     L  PIYD+T   DGY+S+EV P LA DT+ TI+ A  L++ +
Sbjct  71    VDAIYDHLVLEDIGRGADLLRPIYDQTAGVDGYISIEVPPTLAQDTQKTIDEAHRLYQAL  130

Query  772   DRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA---SGLN  942
             +R N+ IK+PAT   IP+I+ +I +GI VNVTLIFS+  Y AV++AY+ GLEA    GL 
Sbjct  131   NRPNIMIKVPATPEGIPAIETLIRDGIPVNVTLIFSLNAYRAVMEAYIRGLEARLEQGL-  189

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIG-SPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
              ++ V SVASFFVSRVDTL+D+L++  G +PE    +G+AA A A LA++L+Q+ F+GPR
Sbjct  190   PVNGVASVASFFVSRVDTLIDQLIQTHGLNPE---WQGRAAIANAKLAYRLFQETFAGPR  246

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVAR  1299
             W+ L   GA+ QR LWASTS KNPAYPD LYV+ LIGPDTV T+P   + A +DHG  AR
Sbjct  247   WDRLKNAGARVQRPLWASTSTKNPAYPDLLYVEALIGPDTVDTLPPATVDAILDHGQAAR  306

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
             T+D NV EA      ++K G+    V  QL AEGV SF +SF +L+ SL  K
Sbjct  307   TVDQNVDEARQFIETLEKAGISMDAVTDQLLAEGVQSFNQSFVTLMQSLTRK  358



>ref|WP_026146027.1| transaldolase [Nocardioides sp. Iso805N]
Length=369

 Score =   296 bits (758),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 230/353 (65%), Gaps = 14/353 (4%)
 Frame = +1

Query  421   GQSPWYDNLCRP------VTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
             G S W D+L R       + DL+   ES V GVT+NP IF  AI+    Y+DQ  +LV  
Sbjct  13    GVSIWLDDLSRERIETGNLADLVK--ESSVVGVTTNPTIFAAAIANGERYDDQVAQLVAG  70

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
             G D++ + +EL  +D+++AC +  P+ + T+  DG VS+EV P LA+DT+ TI +AK L 
Sbjct  71    GADVDKVIFELTTEDVRNACDILAPVAEATK-DDGRVSIEVEPTLANDTDATIASAKALW  129

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA---S  933
               VDR N  IKIPAT   +P+I   IA GISVNVTLIFS+ERY AV+DAYL GLE    +
Sbjct  130   AAVDRPNALIKIPATLEGLPAITAAIATGISVNVTLIFSVERYRAVMDAYLTGLEQAKEA  189

Query  934   GLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSG  1113
             G+ DLS + SVASFFVSRVDT +D  LEKIGS EAL LRGKAA A A LA+  +++  + 
Sbjct  190   GI-DLSTIRSVASFFVSRVDTEIDARLEKIGSDEALALRGKAAVANARLAYAAFEEVIAS  248

Query  1114  PRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV  1293
              RW+ L   GA  QR LWAST VKNPAY DTLYV  L+  DTV+TMP++ L AF DHG V
Sbjct  249   ERWQPLAAAGANAQRPLWASTGVKNPAYSDTLYVTDLVVADTVNTMPEKTLQAFADHGEV  308

Query  1294  -ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
                 +    +EA+ +++ +   G+D   V   LE EGVD FK S+  LLD+++
Sbjct  309   HGDQVSGKGAEAQQVFDQLVAAGIDVDDVFLTLETEGVDKFKASWTELLDTVK  361



>ref|WP_006902264.1| transaldolase [Gordonia paraffinivorans]
 dbj|GAC86001.1| transaldolase [Gordonia paraffinivorans NBRC 108238]
Length=373

 Score =   296 bits (758),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 235/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIE-SGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    DL  LI    V GVT+NPAIFQ A+S   AY+ Q  EL   G 
Sbjct  14    GVSVWLDDLSRDLITSGDLAELINIKSVVGVTTNPAIFQAALSKGTAYDAQVNELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +F  +Y+E++  DG VS+EV PRLA DTEGT+  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVFAGVYEESDGVDGRVSIEVDPRLAHDTEGTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPAT   +P+I +VIA GISVNVTLIFS+ERY+ V+DAYLDGL+A+    +
Sbjct  134   VDRPNLLIKIPATKAGLPAITKVIAEGISVNVTLIFSVERYKEVMDAYLDGLDAATEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS + SVASFFVSRVDT +DK LE IG+PEAL+LRGKAA A A LA+  YQ+ F    R
Sbjct  194   DLSTIHSVASFFVSRVDTEIDKRLEAIGTPEALELRGKAALANARLAYAAYQEVFEVETR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +  L  +GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP + + AF DHG V  
Sbjct  254   FPDLQAQGARAQRPLWASTGVKNPEYPDTLYVSELVAPNTVNTMPGKTMDAFADHGWVDT  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              +I    +E+  I+  I  +GVD   V   LE EGV  F+ +++ LL +  E+
Sbjct  314   GSIIGKEAESREIFEKISAVGVDLADVFVVLEDEGVRKFEDAWNELLTATAEQ  366



>ref|WP_007298765.1| transaldolase [Rhodococcus imtechensis]
 gb|EID77998.1| transaldolase [Rhodococcus imtechensis RKJ300 = JCM 13270]
Length=374

 Score =   296 bits (758),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 233/354 (66%), Gaps = 10/354 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  L+ +  V GVT+NP+IF  A++T +AY +Q + L   G 
Sbjct  14    GVSVWLDDLSRDRLQSGNLAELVSTRSVVGVTTNPSIFHAALTTGHAYTEQLRRLAADGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D++++   L   D++ AC L  P ++ +   DG VS+EV PRLA DT+ TIE A  L K 
Sbjct  74    DVDTVIRTLTTDDVRRACDLLAPQFETSNGVDGRVSLEVDPRLAHDTDATIEQALELWKL  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VDR N+ IKIPAT   IP+I  VI  GISVNVTLIFSIERY+AVIDAYL+GL+   A+G 
Sbjct  134   VDRPNLLIKIPATRAGIPAIATVIGEGISVNVTLIFSIERYQAVIDAYLEGLDTARAAG-  192

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
              DL+ + SVASFFVSRVDT +D  L +IG+ EAL LRG AA A A LA+  +Q+ F+  R
Sbjct  193   RDLASIHSVASFFVSRVDTEIDAQLTQIGTAEALALRGTAALANARLAYHTFQRNFTSDR  252

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVAR  1299
             W AL   GA++QR LWAST VKNP YPDTLYV  LI PDTV+TMP+  L A  DHG +  
Sbjct  253   WAALSDAGARRQRPLWASTGVKNPEYPDTLYVTELIAPDTVNTMPEATLNAVADHGIIPA  312

Query  1300  --TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
                I   V ++  +++A+  +G++  +V T LEAEGV+ F  ++ +L +++  +
Sbjct  313   HDNISDTVEQSRAVFDALTDVGINLPEVFTTLEAEGVEKFVAAWTTLTEAIATQ  366



>gb|KHL05203.1| transaldolase [Sinomonas sp. MUSC 117]
Length=373

 Score =   296 bits (757),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 229/346 (66%), Gaps = 7/346 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTD---LIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R       L  LI E  V GVT+NP IFQ AI+  + Y+ Q +ELV  G 
Sbjct  12    GVSIWLDDLSRQRLQDGSLKALIDEKNVVGVTTNPTIFQGAITKGHGYDAQLRELVADGA  71

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E   +EL  +D+ DAC LF P+ + T+  DG VS+EV PRLA DT GTI  AK L  K
Sbjct  72    DVERTVFELTTRDVADACDLFAPVAEATKGVDGRVSIEVDPRLAWDTAGTIAEAKKLRDK  131

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN--  942
             V++ NVYIKIPAT   + +I E +ANGISVNVTLIFS+ERY AVI+A+L GLE +  N  
Sbjct  132   VNKGNVYIKIPATLEGLEAIAETLANGISVNVTLIFSLERYRAVINAFLTGLEKAKENGH  191

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVD+ VDK LE IG+ EA  L+GKA  A A LA+Q+++++F+  RW
Sbjct  192   DLSKIHSVASFFVSRVDSEVDKRLEAIGTDEAKALKGKAGLANARLAYQVFEEEFTTERW  251

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGS-VAR  1299
             + L   GA  QR LWAST VK+P  PDTLYV  L+ P  V+TMP++ L A  DH   V  
Sbjct  252   KLLADAGALPQRPLWASTGVKDPNLPDTLYVTGLVAPGVVNTMPEKTLEATFDHAEVVGD  311

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLL  1437
             TI  +  E+    +A++K+GV +  V   LE+EG+D F  S++ LL
Sbjct  312   TIHGSYEESNAHLDALEKIGVSYNDVVAVLESEGLDKFVASWNDLL  357



>ref|WP_011894548.1| transaldolase [Mycobacterium gilvum]
 ref|YP_001134955.1| transaldolase [Mycobacterium gilvum PYR-GCK]
 ref|YP_004077488.1| transaldolase [Mycobacterium gilvum Spyr1]
 gb|ABP46167.1| transaldolase [Mycobacterium gilvum PYR-GCK]
 gb|ADT99653.1| transaldolase [Mycobacterium gilvum Spyr1]
Length=371

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 233/351 (66%), Gaps = 8/351 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  + GVT+NP+IFQ A+S   AY+DQ +EL + G 
Sbjct  14    GVSVWLDDLSRERLQTGNLQELIDTKSIVGVTTNPSIFQAALSAGEAYDDQIRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +F  IY+++   DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVFAKIYEQSGGVDGRVSIEVDPRLAHDTDKTILQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPAT   +P+I  V+A GISVNVTLIFS+ERY  V+DAYL GLE +    +
Sbjct  134   VDRPNLLIKIPATEAGVPAIASVLAEGISVNVTLIFSVERYRLVMDAYLQGLEKAKEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF-SGPR  1119
             DLS++ SVASFFVSRVDT +D  LEKIGS EAL LRGKA  A A LA+  Y++ F  G R
Sbjct  194   DLSRIHSVASFFVSRVDTEIDNRLEKIGSEEALALRGKAGVANARLAYAAYEEIFLGGER  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             + AL   GA+ QR LWAST VKNP Y DTLYV  L+ PDTV+TMP++ L A  DHG V  
Sbjct  254   FAALKDAGARVQRPLWASTGVKNPDYSDTLYVTELVAPDTVNTMPEKTLDAVADHGVVTG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
              T+     E++ I++ +  LG+D   V   LE EGV+ F+KS+  LL++ Q
Sbjct  314   DTVTGRAGESQEIFDQLAALGIDLTDVFLVLENEGVEKFEKSWQELLEATQ  364



>ref|WP_012360246.1| transaldolase [Corynebacterium urealyticum]
 ref|YP_001800392.1| transaldolase [Corynebacterium urealyticum DSM 7109]
 ref|YP_007416818.1| transaldolase [Corynebacterium urealyticum DSM 7111]
 emb|CAQ04958.1| unnamed protein product [Corynebacterium urealyticum DSM 7109]
 gb|AGE36574.1| transaldolase [Corynebacterium urealyticum DSM 7111]
Length=370

 Score =   295 bits (756),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 227/352 (64%), Gaps = 7/352 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L RP     +L  LI++ G+ GVT+NPAIF  A+S  +AY++Q  +L  AG 
Sbjct  14    GTSVWLDDLSRPRLTSGELASLIDTKGIVGVTTNPAIFAAAMSQRDAYDEQLHQLAAAGI  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
               +   + + VKD+QDAC +   ++++T   DG+VS+EV PRLA D  GT+  AK L  +
Sbjct  74    AADEAVFAMAVKDVQDACDVLAGVHEQTGGVDGWVSLEVDPRLAHDAAGTVAQAKELAAQ  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             V+R N+ IKIPAT  C+P+I EV+A GISVNVTLIFS+ERYE V++A+++G+ A+     
Sbjct  134   VNRANLMIKIPATTECLPAISEVLAAGISVNVTLIFSVERYEQVMEAFIEGIAAAEKAGQ  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             D+SK+ SVASFFVSRVD+ +D  L + G+  A      A             K  + PRW
Sbjct  194   DISKIHSVASFFVSRVDSDIDPQLAEKGAEAAALQGKAALANARLAYASYLDKLANNPRW  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHG-SVAR  1299
             +  V +GA  QR LWASTSVKNP YPDTLYV  L GP+TV+TMP+  L A IDHG +   
Sbjct  254   QEFVGRGANTQRPLWASTSVKNPQYPDTLYVTELAGPNTVNTMPEATLDATIDHGETTGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              +    SE+  +++A+   G+D  +V  +LE EGV  F+++++ LL +L+E+
Sbjct  314   QLSGRASESLEVFSALTSAGIDLPEVWQRLETEGVQKFEQAWNELLATLREQ  365



>ref|WP_005194886.1| transaldolase [Gordonia rubripertincta]
 dbj|GAB83905.1| transaldolase [Gordonia rubripertincta NBRC 101908]
Length=373

 Score =   295 bits (756),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 238/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    DL  LI +  V GVT+NP+IFQ A+S   AYN Q  EL   G 
Sbjct  14    GVSVWLDDLSRDLISSGDLAELIATKSVVGVTTNPSIFQAALSKGTAYNAQVTELAARGT  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D++     +   D+++AC +  P+Y+E++  DG VS+EV PRLA DT+GT+  A  L K 
Sbjct  74    DVDGTIRTVTTDDVRNACDVLAPVYEESDGVDGRVSIEVDPRLAHDTDGTVAQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N+ IKIPAT   +P+I +VIA GISVNVTLIFS+ERY+ V+DAYLDGL+A+    +
Sbjct  134   VDRPNLLIKIPATKAGLPAITKVIAEGISVNVTLIFSVERYKEVMDAYLDGLDAAAEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS + SVASFFVSRVDT +DK L+ IG+PEA++L+GKAA A A LA+  YQ+ F    R
Sbjct  194   DLSDIHSVASFFVSRVDTEIDKRLDAIGTPEAVELKGKAALANARLAYSAYQQVFEVESR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +  L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP + + AF DHG V  
Sbjct  254   FPDLLAHGARPQRALWASTGVKNPDYPDTLYVSELVAPNTVNTMPGKTMDAFADHGWVNT  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              ++     E++ +++ +  +GVD   V T LE EGV  F+ +++ LL++  E+
Sbjct  314   GSVVGLAQESQEVFDKLSAVGVDTVDVFTVLEEEGVSKFEDAWNDLLNATAEQ  366



>ref|WP_035001870.1| transaldolase [Corynebacterium jeikeium]
Length=370

 Score =   295 bits (756),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 228/356 (64%), Gaps = 8/356 (2%)
 Frame = +1

Query  403   DLYEKQGQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKE  570
             D     G S W D+L R      +L  +IE+ GV GVT+NPAIF  A+S   AY++Q ++
Sbjct  8     DALANAGTSVWLDDLSRDRLRSGNLAEVIENKGVVGVTTNPAIFANAMSQGTAYDEQLQQ  67

Query  571   LVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAA  750
             L  AG   ++  +E+   D+ +AC +F PIY+ T   DG VS+EV PRLA + E T+  A
Sbjct  68    LATAGTPADTAVFEMAADDVAEACDVFLPIYERTNGVDGRVSLEVDPRLAKEREATVTQA  127

Query  751   KWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE-  927
             + L  KV R N+ IKIPAT  C+P+I +V+A GISVNVTLIFS+ RY  V++A+++GL  
Sbjct  128   RELAAKVGRENLMIKIPATEECLPAIADVLAEGISVNVTLIFSVSRYIQVMEAFIEGLSR  187

Query  928   -ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql-yqk  1101
              A    +L+K+ SVASFFVSRVDT +DK L++IG+  AL L+GKA  A A LA+      
Sbjct  188   AAGAGKNLTKIHSVASFFVSRVDTEIDKRLDEIGTDAALALKGKAGVANAQLAYAAFEDT  247

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
               + P W AL  KGA  QR LWASTSVKNP YPDTLYV  L GP TV+TMP+  L A ID
Sbjct  248   LLNNPAWNALADKGAPVQRPLWASTSVKNPEYPDTLYVTELAGPHTVNTMPENTLDATID  307

Query  1282  HGSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             HG V   T+      A  ++ A+D+ GV+  +V T LE EGV+ F  S++ LL +L
Sbjct  308   HGEVRGDTLSGTTDSARAVFAALDEAGVNLAEVWTVLENEGVEKFVNSWNELLGTL  363



>ref|WP_036468641.1| transaldolase [Mycobacterium triplex]
 emb|CDO88303.1| transaldolase [Mycobacterium triplex]
Length=372

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 237/355 (67%), Gaps = 8/355 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  V GVT+NP+IFQKA +  ++Y+ Q  EL + G 
Sbjct  14    GVSVWLDDLSRQRLQSGNLQELIDTKSVVGVTTNPSIFQKAFAEGDSYDSQIAELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D++ AC +  P ++ ++  DG VS+EV PRLA +T+ T+  A  L K 
Sbjct  74    DVDATIRTVTTDDVRTACDVLAPQWESSDGIDGRVSIEVDPRLAGETDKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N++IKIPAT   +P+I  V+A GISVNVTLIFS+ER+ AV+DAYL GLE +    +
Sbjct  134   VDRPNLFIKIPATEAGLPAITAVLAEGISVNVTLIFSVERHRAVMDAYLAGLEKAREAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF-SGPR  1119
             DLSK+ SVASFFVSRVDT +DK LEKIGSPEALDLRG+A  A A LA+  YQ+ F  G R
Sbjct  194   DLSKIHSVASFFVSRVDTEIDKRLEKIGSPEALDLRGQAGVANARLAYAAYQEVFEGGAR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +EAL   GA+ QR LWAST VKNP Y DTLYV  L+  +TV+TMP++ + A  DHG +  
Sbjct  254   FEALKADGARVQRPLWASTGVKNPDYSDTLYVTELVAANTVNTMPEKTIDAVADHGVITG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
              TI     EA+G+++ +  +G+D   V   LE EGV+ F +S+  LLD  Q++ N
Sbjct  314   DTIRGTAQEAQGVFDKLSAIGIDVTDVFVVLENEGVEKFVESWTELLDETQKQLN  368



>ref|WP_030465180.1| transaldolase [Lechevalieria aerocolonigenes]
Length=358

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 235/359 (65%), Gaps = 14/359 (4%)
 Frame = +1

Query  388   RTSLHDLYEKQGQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYND  558
             RT+LH L E+ GQSPW D L R +    DL  L+ESGV GVTSNP IFQ+A+S+ NAY+ 
Sbjct  2     RTALHGLAER-GQSPWMDQLSRDLLRGGDLAALVESGVLGVTSNPTIFQEAMSSGNAYDA  60

Query  559   QFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGT  738
             Q ++L   G + + L+  L  +D+++AC L       T   DG+VS+EV P  A DT+ T
Sbjct  61    QKRDL--HGLERKELFLALATEDVRNACDLLAG--KGTSPRDGWVSMEVDPNFAHDTQAT  116

Query  739   IEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLD  918
             I+ A+ LH+ VDR N+++KIP T+  +P+I+E IANGI VNVTL+FS++R+    +AY+ 
Sbjct  117   IDEARRLHEMVDRPNLFVKIPGTSESMPAIEESIANGIPVNVTLLFSLDRHREAAEAYVR  176

Query  919   GLE---ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafq  1089
             GL+   A+G  DLSKV SVAS+FVSRVDT  D  L+ +   E L  +G+ A A A LA+Q
Sbjct  177   GLQRLRATG-GDLSKVASVASYFVSRVDTEADARLDAMRGHEVL--KGRLAIANAKLAYQ  233

Query  1090  lyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALL  1269
              Y + FSG  WE L K GA  Q  LWASTS KNPAY DT YV+ LIGP+TV+TMP + + 
Sbjct  234   QYLEIFSGKAWEDLAKAGATPQWCLWASTSTKNPAYRDTRYVEELIGPETVTTMPRKTIE  293

Query  1270  AFIDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             AF+DHG VA T+   V  A  + +   ++ V ++ +  +LE +GV  F  S+  L DSL
Sbjct  294   AFLDHGRVADTLTRGVDAARSVLDRFGEIRVSYRDITAKLERDGVRKFADSYQRLFDSL  352



>ref|WP_025159469.1| transaldolase [Leifsonia aquatica]
Length=370

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 229/351 (65%), Gaps = 9/351 (3%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R       L  LI E  V GVT+NP IF  A+S   AY DQ K L  AG 
Sbjct  14    GVSIWLDDLSRERIATGGLQKLIAEKNVVGVTTNPTIFAAALSKGEAYADQVKSLAAAGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
              +E   +E+   D+  A  +F  +Y++TE  DG VS+EV P LA D  GTIE AK L  K
Sbjct  74    SVEDAIFEITTDDVAAASDIFHEVYEQTEGTDGRVSIEVEPGLAHDAAGTIEQAKKLAAK  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGL  939
             VD+ NV IKIPAT   + +I E IA GISVNVTLIFS++RY  VIDAYL GLE   A+G+
Sbjct  134   VDKPNVLIKIPATVEGLEAITETIAAGISVNVTLIFSLDRYRGVIDAYLTGLEKAKAAGI  193

Query  940   NDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPR  1119
              DLS + SVASFFVSRVDT +DK L  IG+ EA  L+ KA  A A LA+++Y++ F+  R
Sbjct  194   -DLSGIQSVASFFVSRVDTEIDKRLTAIGTDEANALKSKAGVANARLAYEVYEQTFASDR  252

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
              +ALV  GA +QR LWAST VK+P+ PDTLYV  L+ P+TV+TMP++ L A  DHG +  
Sbjct  253   AKALVAAGANEQRPLWASTGVKDPSLPDTLYVTELVAPNTVNTMPEKTLDATFDHGVITG  312

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
              T+  N ++A+G+ +A+  LGVD+  V   LE EGVD F  S+  L+++++
Sbjct  313   DTVTGNYADAKGVLDALAALGVDYDDVTATLEREGVDKFNVSWSELVETVK  363



>ref|WP_019969510.1| transaldolase [Mycobacterium sp. 141]
Length=371

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 229/352 (65%), Gaps = 11/352 (3%)
 Frame = +1

Query  421   GQSPWYDNLCRP------VTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
             G S W D+L R       +TDLI      V GVT+NP+IFQ A+S   AY+ Q  EL Q 
Sbjct  14    GVSVWLDDLSRERLQSGNLTDLIN--TRSVVGVTTNPSIFQAALSKGTAYDAQVTELAQR  71

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
             G D+++    +   D+++AC +    Y+ ++  DG VS+EV PRLA DT+ TI  A  L 
Sbjct  72    GADVDATIRTVTTDDVRNACDVLAKTYEASDGVDGRVSIEVDPRLAHDTDKTILQAIELF  131

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--G  936
             K VDR NV IKIPAT   +P+I  VIA GISVNVTLIFS+ER+ AV+DAYL+GLE +   
Sbjct  132   KIVDRPNVLIKIPATLAGLPAIAAVIAEGISVNVTLIFSVERHRAVMDAYLEGLEKAREA  191

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
              +DLSK+ SVASFFVSRVDT +D  LEKIGS EAL LRG+A  A A LA+  Y++ F G 
Sbjct  192   GHDLSKIHSVASFFVSRVDTEIDARLEKIGSAEALALRGQAGVANARLAYAAYEEVFGGK  251

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             R+ AL   GA+ QR LWAST VKNP Y DTLYV  L+ P+TV+TMP++ + A  DHG V 
Sbjct  252   RFAALKADGARVQRPLWASTGVKNPDYSDTLYVTELVAPNTVNTMPEKTIEAVADHGVVT  311

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
               TI    + ++  ++ +  +G+D   V   LE EG+D F+KS+  LLD+ Q
Sbjct  312   GDTISGTAAASQETFDKLAAVGIDLADVFKLLEDEGLDKFEKSWQELLDATQ  363



>ref|WP_030431268.1| transaldolase [Allokutzneria albata]
Length=370

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 231/354 (65%), Gaps = 7/354 (2%)
 Frame = +1

Query  415   KQGQSPWYDNLCRPVTD---LIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
             + G S W D+L R   +   L+ LI E  V GVT+NP IF  A+S   AY+ Q  EL + 
Sbjct  11    EAGVSVWLDDLSRERLESGNLVQLINELSVVGVTTNPTIFAGALSKGTAYDKQVAELAER  70

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
             G  ++    E+   D++ AC +F   ++ T+  DG VS+EV PRLA DT+GT   A+ L 
Sbjct  71    GASVDQAVREITTADVRHACDVFRATWEATDGLDGRVSLEVDPRLAHDTDGTAAEAQELW  130

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN  942
             K VDR N+ +KIPAT   +P+I + +A GISVNVTLIFS+ERY AV+DA+L+GLE +  N
Sbjct  131   KAVDRPNLMVKIPATVAGLPAITKALAEGISVNVTLIFSVERYRAVMDAFLEGLEQAKAN  190

Query  943   --DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
               DLSK+ SVASFFVSRVD+ VDK +  +G+PEA  LRG+AA A A LA+  Y+  F+ P
Sbjct  191   GHDLSKIASVASFFVSRVDSEVDKRIGALGTPEAEALRGQAAIANARLAYAAYEDVFASP  250

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW AL + GA+ QR LWAST VK+PAY DT YVD L+ P  V+TMP++ L A  DHG + 
Sbjct  251   RWTALAEAGARPQRPLWASTGVKDPAYSDTRYVDELVAPGVVNTMPEKTLHAVADHGKIT  310

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               T+      A+ +++A+   G+D   V   LE EGVD F+KS+  LL+++ ++
Sbjct  311   GDTVTGTAESAQEVFDALADAGIDLDDVFAVLETEGVDKFEKSWAELLETVTDQ  364



>ref|WP_014560819.1| transaldolase [Ignavibacterium album]
 ref|YP_005846938.1| transaldolase [Ignavibacterium album JCM 16511]
 gb|AFH49670.1| Transaldolase [Ignavibacterium album JCM 16511]
Length=936

 Score =   310 bits (793),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 246/350 (70%), Gaps = 8/350 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKD  591
             GQS WYD + R      +L  LIE G+RGVTSNP+IF+KAI+ S+ Y++  KEL++    
Sbjct  11    GQSIWYDYIRRQFITRGELQKLIEKGLRGVTSNPSIFEKAIAGSSDYDEDIKELIEQDLT  70

Query  592   IESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKV  771
             ++ +Y +LVVKDIQ A  L  P+Y +T   DGYVS+EVSP LA ++  TI+ AK L+K +
Sbjct  71    VQEIYEKLVVKDIQLAASLMLPVYYKTNELDGYVSLEVSPTLAHNSHATIDEAKRLYKLL  130

Query  772   DRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE--ASGLND  945
             +R+NV IK+PAT   +P+I E+I +GISVN+TLIF+I+ Y+ V +AYL GLE  +    D
Sbjct  131   ERKNVMIKVPATQEGLPAITELIGSGISVNMTLIFNIDNYKQVAEAYLKGLELLSERGGD  190

Query  946   LSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRWE  1125
             +SKV+SVASFF+SR+D  VDK   ++    A  L+GK A A A +A+Q++QK +  PRW+
Sbjct  191   ISKVSSVASFFISRIDADVDK---EVNKRNADHLKGKIAIANAKVAYQIFQKIYHTPRWK  247

Query  1126  ALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVARTI  1305
             AL K+GA+ QRLLWAST VKNP+YPDT+YVD LIG  TV+T+P      F+DHGS+  T+
Sbjct  248   ALEKRGARVQRLLWASTGVKNPSYPDTIYVDGLIGKQTVNTVPPATFNDFMDHGSLIITL  307

Query  1306  DANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
             D N+ EA      +  L +D  ++  QL+AEG++SF KSF++L+ +++ K
Sbjct  308   DENIEEAISQLEELKSLDIDLDKITNQLQAEGLESFSKSFENLMKAIELK  357



>ref|WP_030014327.1| transaldolase [Curtobacterium sp. S6]
Length=366

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 170/349 (49%), Positives = 231/349 (66%), Gaps = 7/349 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI E  + GVT+NP IF +A+S  +AY+ Q KEL QAG 
Sbjct  12    GVSIWLDDLSRERLTSGNLDQLIRERNIVGVTTNPTIFAQALSKGDAYDAQMKELAQAGA  71

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E   + +   D++DAC +F PIY+ ++  DG VS+EV PRLA  T  T+E A+ LH+ 
Sbjct  72    DVEEAVFTVTTDDVRDACDVFAPIYESSQGVDGRVSIEVDPRLAHKTAETVEMARRLHET  131

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN--  942
             V R NV IKIPAT   +  I E +A+GISVNVTLIFS+ERY AVI+A++ GLE +  N  
Sbjct  132   VGRENVMIKIPATEAGLDPIAETLAHGISVNVTLIFSLERYRAVINAFMTGLERALENGY  191

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVD+ +D  L++IG+ EA  L+GKA  A A LA+Q+Y++ FS  RW
Sbjct  192   DLSKIHSVASFFVSRVDSEIDAQLDRIGTEEAKQLKGKAGLANARLAYQVYEEAFSTERW  251

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
               L + GA  QR LWAST  K+PAYPDT+YV  L   +TV+TMP++ L A  DH  +   
Sbjct  252   NRLAEAGAAPQRPLWASTGTKDPAYPDTMYVTGLCVENTVNTMPEKTLEATADHAEITGD  311

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             T+     ++E   NA++K+GV +  V  +LE EG+  F+ S+  LLD++
Sbjct  312   TVTGTYDQSEAEINALEKIGVSYNDVVAKLETEGIQKFEDSWKELLDTV  360



>gb|KGM11921.1| transaldolase [Cellulomonas carbonis T26]
Length=393

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 170/366 (46%), Positives = 236/366 (64%), Gaps = 15/366 (4%)
 Frame = +1

Query  379   PIKRTSLHDLYEKQGQSPWYDNLCRPVT---DLIPLI-ESGVRGVTSNPAIFQKAISTSN  546
             P++R       +  G + W D+L R +    +L  L+ E GV GVT+NP IF  A++  +
Sbjct  25    PVRR------LQDAGVAIWLDDLSRELLRTGELERLVAERGVVGVTTNPTIFASALAEGS  78

Query  547   AYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADD  726
             AY++Q ++L   G D+E+  +E+   D++ AC +  P++  T+  DG VS+EV PRLA D
Sbjct  79    AYDEQLRDLASRGADVETAVFEITTDDVRTACDVLAPVHRATDGRDGRVSIEVDPRLARD  138

Query  727   TEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVID  906
             TE T+E A+ L   VDR N++IKIPAT   +P+I   +A+GISVNVTLIFS+ERY AVID
Sbjct  139   TEATVETARRLWSTVDRPNLFIKIPATVEGLPAITAAVADGISVNVTLIFSLERYRAVID  198

Query  907   AYLDGLE---ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaa  1077
             AYLDGLE   A G +DL+++ SVASFFVSRVD  VDK L+ +G+ EA  LRG  A A A 
Sbjct  199   AYLDGLEQARAHG-HDLTQIHSVASFFVSRVDAAVDKRLDALGTDEAAALRGTVALANAR  257

Query  1078  lafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPD  1257
             LA+Q++++  +G RW  L   GA  QR LWAST VK+PAYPDTLYVD L+  D V+TMP 
Sbjct  258   LAYQVFEETVAGERWRGLATAGANVQRPLWASTGVKDPAYPDTLYVDQLVARDVVNTMPG  317

Query  1258  QALLAFIDHGSVA-RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSL  1434
               L A  DH  V+  T+     +A    + +  LG++  +V T LE EGV  F+ S+  L
Sbjct  318   ATLEAAADHAEVSGDTVRGTYDDAAATIDRLRALGIELDEVTTTLEEEGVAKFEASWSEL  377

Query  1435  LDSLQE  1452
             L ++++
Sbjct  378   LTTVED  383



>ref|WP_039319782.1| transaldolase [Mycobacterium setense]
 gb|KHO21904.1| transaldolase [Mycobacterium setense]
 gb|KHO26418.1| transaldolase [Mycobacterium setense]
Length=371

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 233/350 (67%), Gaps = 7/350 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  V GVT+NP+IFQ A+S   AY+ Q KEL + G 
Sbjct  14    GVSVWLDDLSRERLQTGNLQNLIDTRSVVGVTTNPSIFQAALSKGTAYDAQVKELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +    Y+ ++  DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLAKQYEASDGVDGRVSIEVDPRLAHDTDKTILQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPAT   +P+I  VIA GISVNVTLIFS+ER+ AV+DAYL GLEA+    +
Sbjct  134   VDRPNLLIKIPATLAGLPAITAVIAEGISVNVTLIFSVERHRAVMDAYLAGLEAAKEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVDT +DK LE+IGS  AL LRGKA  A + LA+  Y++ F G R+
Sbjct  194   DLSKIHSVASFFVSRVDTEIDKRLEQIGSDAALALRGKAGVANSRLAYAAYEEVFGGERF  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-R  1299
              AL   GA+ QR+LWAST VKNP Y DTLYV  L+ P TV+T+P++ L A  DHG ++  
Sbjct  254   AALKSAGARVQRVLWASTGVKNPDYSDTLYVTELVAPHTVNTLPEKTLEAVADHGKISGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             TI    + ++ I++ +  +GVD   V   LE EGVD F+KS+  LLD+ Q
Sbjct  314   TITGTAAASQEIFDQLSAIGVDLVDVFKVLEDEGVDKFEKSWQELLDATQ  363



>ref|WP_006357237.1| transaldolase [Gordonia alkanivorans]
 dbj|GAA11063.1| transaldolase [Gordonia alkanivorans NBRC 16433]
 gb|ETA06409.1| transaldolase [Gordonia alkanivorans CGMCC 6845]
Length=373

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 237/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    +L  LI +  V GVT+NP+IFQ A+S   AYN Q  EL   G 
Sbjct  14    GVSVWLDDLSRDLIGSGELAELISTKSVVGVTTNPSIFQAALSKGTAYNAQVTELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D++     +   D+++AC +  P+Y+E++  DG VS+EV PRLA DT+GT+  A  L K 
Sbjct  74    DVDGTIRTVTTDDVRNACDVLAPVYEESDGVDGRVSIEVDPRLAHDTDGTVAQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR N+ IKIPAT   +P+I +VIA GISVNVTLIFS+ERY+ V+DAYLDGL+A+    +
Sbjct  134   VDRPNLLIKIPATTAGLPAITKVIAEGISVNVTLIFSVERYKDVMDAYLDGLDAAAEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS + SVASFFVSRVDT +DK L+ IG+PEA++L+GKAA A A LA+  YQ+ F    R
Sbjct  194   DLSNIHSVASFFVSRVDTEIDKRLDAIGTPEAMELKGKAALANARLAYSAYQQVFEVESR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +  L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP + + AF DHG V  
Sbjct  254   FPDLLAHGARPQRALWASTGVKNPDYPDTLYVSELVAPNTVNTMPGKTMDAFADHGWVNT  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              +I     E++ +++ I  LGVD   V   LE EGV  F+ +++ LL++  E+
Sbjct  314   GSIIGLAQESQEVFDKIAALGVDTVDVFKVLEDEGVSKFEDAWNDLLNATAEQ  366



>ref|WP_030791284.1| transaldolase [Streptomyces sp. NRRL F-5008]
Length=372

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 232/353 (66%), Gaps = 9/353 (3%)
 Frame = +1

Query  415   KQGQSPWYDNLCRP-VT--DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQA  582
             ++G + W D+L R  +T  +L  LI +  V GVT+NP+IFQKAIS  + Y+ Q  +L   
Sbjct  10    EEGVAIWLDDLSRKRITSGNLAELIDQQHVVGVTTNPSIFQKAISQGDGYDRQLADLAAR  69

Query  583   GKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLH  762
                +E     +   D++DA  +  P++D T+  DG VS+EV PRLA +T  T+  AK L 
Sbjct  70    KVTVEEAIRMITTADVRDAADILRPVFDATDGQDGRVSIEVDPRLAHNTRATVAEAKQLA  129

Query  763   KKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS---  933
               VDR N  IKIPAT   +P+I EVI NGISVNVTLIFS+ERY  V+DAYL GLE +   
Sbjct  130   WLVDRPNTLIKIPATKAGLPAITEVIGNGISVNVTLIFSLERYREVMDAYLAGLEKAKEK  189

Query  934   GLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSG  1113
             GL DLS + SVASFFVSRVDT +DK L+ +G+ EA   RGKAA A A LA+Q Y++ FSG
Sbjct  190   GL-DLSLIHSVASFFVSRVDTEIDKRLDALGTDEAKAARGKAALANARLAYQAYEEVFSG  248

Query  1114  PRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV  1293
             PRW AL K GA +QR LWAST VK+PAY DTLYVD L+ P+TV+TMP+  L A  DHG +
Sbjct  249   PRWTALEKAGANRQRPLWASTGVKDPAYKDTLYVDDLVAPNTVNTMPEATLFATGDHGQI  308

Query  1294  -ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
                T+     +A    +A++KLG+ +  V   LE EGV+ F+ S++ LL S +
Sbjct  309   TGNTVAGTYEQARAELDAVEKLGISYDDVVQLLEDEGVEKFEASWNDLLKSTE  361



>ref|WP_036443496.1| transaldolase, partial [Mycobacterium mageritense]
Length=373

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 227/346 (66%), Gaps = 7/346 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R       L  LI E  V GVT+NP+IFQ AI+T + Y+ +  EL   G 
Sbjct  14    GVSIWLDDLSRGRLQSGSLQKLIDEKSVVGVTTNPSIFQAAITTGHDYDAKIAELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E   +E+   D+ DAC LF PI   T+  DG VS+EV PRLA DT GTI  AK L+KK
Sbjct  74    DVEETIFEITTADVADACDLFAPIAAATKGVDGRVSIEVDPRLAWDTAGTIAEAKNLYKK  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN--  942
             V + NV IKIPAT   + +I E +A GISVNVTLIFS+ERY AVI+A+  GLE +  N  
Sbjct  134   VAKDNVLIKIPATREGLEAITETLAGGISVNVTLIFSLERYRAVINAFQSGLEQARDNGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DL  + SVASFFVSRVDT +DK L+ +G+ EAL L+GKAA A A LA+Q Y++ F+  RW
Sbjct  194   DLLAIHSVASFFVSRVDTEIDKRLDAVGTDEALALKGKAAVANARLAYQAYEELFATERW  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
              AL + GA  QR LWAST VK+PAYPDTLYV  L+  D V+TMP++ L A  DHG V   
Sbjct  254   AALAEAGALPQRPLWASTGVKDPAYPDTLYVTELVAADVVNTMPEKTLDATFDHGVVTGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLL  1437
             TI     EA+ + NAI+ LG+ +  V  QLE+EG++ F  S+  LL
Sbjct  314   TITGRYEEAKAVLNAIEGLGISYDDVVAQLESEGLEKFVASWKELL  359



>ref|WP_034981959.1| transaldolase [Corynebacterium jeikeium]
Length=370

 Score =   294 bits (753),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 229/356 (64%), Gaps = 8/356 (2%)
 Frame = +1

Query  403   DLYEKQGQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKE  570
             D     G S W D+L R      +L  +IE+ GV GVT+NPAIF  A+S   AY++Q ++
Sbjct  8     DALANAGTSVWLDDLSRDRLRSGNLAEVIENKGVVGVTTNPAIFANAMSQGTAYDEQLQQ  67

Query  571   LVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAA  750
             L  AG   ++  +E+   D+ +AC +F PIY+ T   DG VS+EV PRLA + E T+  A
Sbjct  68    LAAAGTHADTAVFEMAADDVAEACDVFLPIYERTNGVDGRVSLEVDPRLAKEREATVIQA  127

Query  751   KWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE-  927
             + L  KV R N+ IKIPAT  C+P+I +V+A GISVNVTLIFS+ RY  V++A+++G+  
Sbjct  128   RELAAKVGRENLMIKIPATEECLPAIADVLAEGISVNVTLIFSVSRYIQVMEAFIEGMSR  187

Query  928   -ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql-yqk  1101
              A    +L+K+ SVASFFVSRVDT +DK L++IG+  AL L+GKA  A A LA+      
Sbjct  188   AADAGKNLTKIHSVASFFVSRVDTEIDKRLDEIGTDAALALKGKAGVANAQLAYAAFEDT  247

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
               + P W AL +KGA  QR LWASTSVKNP YPDTLYV  L GP TV+TMP+  L A ID
Sbjct  248   LLNNPAWNALAEKGAPVQRPLWASTSVKNPEYPDTLYVTELAGPHTVNTMPENTLDATID  307

Query  1282  HGSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             HG V   T+      A  ++ A+D+ GV+  +V T LE EGV+ F  S++ LL +L
Sbjct  308   HGEVRGDTLSGTTDSARAVFAALDEAGVNLAEVWTVLENEGVEKFVDSWNELLGTL  363



>ref|WP_030028502.1| transaldolase [Streptomyces flavotricini]
Length=372

 Score =   294 bits (753),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 180/352 (51%), Positives = 230/352 (65%), Gaps = 9/352 (3%)
 Frame = +1

Query  418   QGQSPWYDNLCRP-VT--DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             +G + W D+L R  +T  +L  LI +S V GVT+NPAIFQKAIS    Y  Q  +L    
Sbjct  11    EGVAIWLDDLSRKRITSGNLAELIDQSHVVGVTTNPAIFQKAISGGEGYEQQLTDLATRR  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               +E     +   D++DA  +  P+YD T+  DG VS+EV PRLA DT  T+  AK L  
Sbjct  71    VTVEEALRMITTADVRDAADILRPVYDRTDGQDGRVSIEVDPRLAHDTAATVAEAKQLAW  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASG  936
              VDR N  IKIPAT   +P+I EVI  GISVNVTLIFS+ERY  V+DAYL GLE   A+G
Sbjct  131   LVDRPNTLIKIPATKAGLPAITEVIGRGISVNVTLIFSLERYREVMDAYLAGLEKAKAAG  190

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
             L DLS + SVASFFVSRVDT +DK L+ +G+ EA  L+GKAA A A LA+Q Y++ FS  
Sbjct  191   L-DLSLIHSVASFFVSRVDTEIDKRLDAVGTDEAKALKGKAALANARLAYQAYEEVFSSE  249

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW AL + GA KQR LWAST VK+PAY DTLYVD L+ P+TV+TMP+  L A  DHGS+ 
Sbjct  250   RWTALERAGANKQRALWASTGVKDPAYKDTLYVDDLVAPNTVNTMPEATLEATADHGSIT  309

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
               T+  +  +A    +A+ KLG+ +  V   LE EGV+ F+ S++ LL S +
Sbjct  310   GDTVRGSYEQARAELDAVAKLGISYDDVVQLLEDEGVEKFEASWNDLLKSTE  361



>ref|WP_011563047.1| transaldolase [Rubrobacter xylanophilus]
 ref|YP_642841.1| transaldolase [Rubrobacter xylanophilus DSM 9941]
 gb|ABG03029.1| transaldolase [Rubrobacter xylanophilus DSM 9941]
Length=365

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 225/353 (64%), Gaps = 11/353 (3%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGKD  591
             GQS W D+L R       L  L+E GV GVTSNP IFQ+AIS S  Y++Q +EL    ++
Sbjct  12    GQSVWVDSLSREDVVEGGLRRLVEEGVSGVTSNPTIFQQAISGSPLYDEQLRELA-GEEE  70

Query  592   IESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKKV  771
                +++ L  +DI+ AC +  P+Y+ T   DGYVS+EVSP LA DTEGT+E A+ LH+ V
Sbjct  71    PREVFFRLAREDIRGACDVLMPVYERTGGEDGYVSLEVSPDLAYDTEGTVEEAQRLHEMV  130

Query  772   DRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASGLN  942
             +R N+ +KIPAT   +P+I+E+I+ G S+NVTLIFS+ RY  V  AY+ GL     SG  
Sbjct  131   ERPNLLVKIPATREGLPAIEEMISRGRSINVTLIFSLGRYREVAGAYIRGLRRLVGSG-G  189

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             D S+V SVASFFVSRVDT  D+ LE  G PE   L+G+ A A A LA+Q +++ FSGP W
Sbjct  190   DPSRVASVASFFVSRVDTEADRRLEAAGRPE---LKGRLAVANAKLAYQEFKRIFSGPEW  246

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVART  1302
             E L   GA+ QR LWASTS KNP Y D  YV+ L+GP TV+TMP   L A +DH  V  T
Sbjct  247   ERLASAGARVQRPLWASTSTKNPEYSDVKYVEELVGPQTVNTMPHSTLRATMDHARVRPT  306

Query  1303  IDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEKAN  1461
             ++  + EA   +  + + GVD+  +   LE EGV  F  SF  LL  +++K  
Sbjct  307   LEEGLEEARKTFALVREAGVDYDDLTRVLEEEGVRKFADSFQELLREIEQKGR  359



>ref|WP_029107565.1| transaldolase [Mycobacterium sp. URHD0025]
Length=371

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 232/350 (66%), Gaps = 7/350 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  V GVT+NP+IFQ A+S   AY+ Q KEL + G 
Sbjct  14    GVSVWLDDLSRERLQTGNLQNLIDTRSVVGVTTNPSIFQAALSKGTAYDAQVKELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +    Y+ ++  DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLAKQYEASDGVDGRVSIEVDPRLAHDTDKTILQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPAT   +P+I  VIA GISVNVTLIFS+ER+ AV+DAYL GLEA+    +
Sbjct  134   VDRPNLLIKIPATLAGLPAITSVIAEGISVNVTLIFSVERHRAVMDAYLAGLEAAKEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVDT +DK LEKIGS  AL LRGKA  A + LA+  Y++ F G R+
Sbjct  194   DLSKIHSVASFFVSRVDTEIDKRLEKIGSDAALALRGKAGVANSRLAYAAYEEVFGGERF  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA-R  1299
              AL   GA+ QR+LWAST VKNP Y DT+YV  L+ P TV+T+P++ L A  DHG +A  
Sbjct  254   AALKGSGARVQRVLWASTGVKNPDYSDTMYVTELVAPHTVNTLPEKTLEAVADHGKIAGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             TI    + ++  ++ +  +GVD   V   LE EGVD F+KS+  LLD+ Q
Sbjct  314   TITGTAAASQDTFDKLAAVGVDLPDVFKVLEDEGVDKFEKSWQELLDATQ  363



>ref|WP_031081953.1| transaldolase [Streptomyces sp. NRRL WC-3549]
Length=372

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 178/352 (51%), Positives = 229/352 (65%), Gaps = 9/352 (3%)
 Frame = +1

Query  418   QGQSPWYDNLCRP-VT--DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             +G + W D+L R  +T  +L  LI ES V GVT+NP+IFQKAIS  + Y+ Q  +L    
Sbjct  11    EGVAIWLDDLSRKRITSGNLAELIDESHVVGVTTNPSIFQKAISQGDGYDQQLTDLAARK  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               +E     +   D++DA  +  P++D TE  DG VS+EV PRLA DT+ T+  AK L  
Sbjct  71    VTVEEAIRMITTADVRDAADILRPVFDATEGQDGRVSIEVDPRLAHDTQATVAEAKQLAW  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASG  936
              VDR N  IKIPAT   +P+I E I  GISVNVTLIFS+ERY  V+DAYL GLE   A+G
Sbjct  131   LVDRPNTLIKIPATKAGLPAITETIGRGISVNVTLIFSLERYREVMDAYLAGLEKAKAAG  190

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
             L DLSK+ SVASFFVSRVDT +DK L+ +GS EA   +GK+A A A LA++ Y++ FSG 
Sbjct  191   L-DLSKIHSVASFFVSRVDTEIDKRLDAVGSDEAKAAKGKSALANARLAYEAYEQVFSGE  249

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVA  1296
             RW  L K  A KQR LWAST VK+P+  DTLYVD L+ P+TV+TMP+  L A  DHG ++
Sbjct  250   RWAVLDKAHANKQRPLWASTGVKDPSLKDTLYVDDLVAPNTVNTMPEATLEAVADHGEIS  309

Query  1297  -RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
               T+     +A    +AI KLGVD+  V   LE EGV+ F  S++ LL S +
Sbjct  310   GNTVAGRYDQARADLDAIKKLGVDYDDVVQVLEDEGVEKFATSWNDLLKSTE  361



>gb|KGI68100.1| transaldolase [Mycobacterium rufum]
Length=371

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 236/351 (67%), Gaps = 8/351 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  V GVT+NP+IFQ A+S  +AY+DQ KEL + G 
Sbjct  14    GVSVWLDDLSRERLQTGNLQELIDTKSVVGVTTNPSIFQAALSKGDAYDDQIKELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +F  IY++++  DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVFAKIYEQSDGVDGRVSIEVDPRLAHDTDKTILQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPAT   +P+I  V+A GISVNVTLIFS+ERY  V+DAYL GLE +    +
Sbjct  134   VDRPNLLIKIPATEAGVPAIASVLAEGISVNVTLIFSVERYRLVMDAYLKGLEKAKEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF-SGPR  1119
             DLS+V SVASFFVSRVDT +DK LE IG+ EAL LRGKA  A A LA+  Y++ F  G R
Sbjct  194   DLSRVHSVASFFVSRVDTEIDKRLEDIGTDEALALRGKAGVANARLAYAAYEEVFLGGER  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +E L   GA+ QR LWAST VKNP Y DTLYV  L+ P+TV+TMP++ + A  DHG V  
Sbjct  254   FEKLTGDGARVQRPLWASTGVKNPDYSDTLYVTELVAPNTVNTMPEKTMDAVADHGEVTG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
              T+    +E++ +++ +  +G+D   V   LE EGV+ F+KS+  LL++ Q
Sbjct  314   DTVTGRGAESQEVFDQLSGVGIDLTDVFVVLEDEGVEKFEKSWHELLEATQ  364



>ref|WP_027753555.1| transaldolase [Streptomyces sp. CNH099]
Length=376

 Score =   294 bits (753),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 177/356 (50%), Positives = 233/356 (65%), Gaps = 13/356 (4%)
 Frame = +1

Query  418   QGQSPWYDNLCRP-VT--DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             +G + W D+L R  +T  +L  L+ ES V GVT+NP IFQKAIS  + Y+ Q  +L    
Sbjct  11    EGVAIWLDDLSRKRITSGNLAELVDESHVVGVTTNPTIFQKAISAGDGYDGQLTDLAARR  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               +E     +   D++DA  +  P+YD TE  DG VS+EV PRLA +T  TI  AK L  
Sbjct  71    VTVEEAVRMITTADVRDAADVLRPVYDATEGQDGRVSIEVDPRLAHNTAATIAEAKQLAW  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASG  936
              VDR N+++KIPAT   +P+I EVI  GISVNVTLIFS+ERY  V+DA+L GLE   A+G
Sbjct  131   LVDRPNLFVKIPATRAGLPAITEVIGKGISVNVTLIFSLERYREVMDAFLAGLEQAKAAG  190

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
             L DL+++ SVASFFVSRVD  +DK L+ +G+PEA + RGKAA A A LA++ +++ FS  
Sbjct  191   L-DLAEIRSVASFFVSRVDAEIDKRLDALGTPEAKEARGKAAVANARLAYEAFEEVFSSD  249

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW AL K GA KQR LWAST VK+ AY DTLYVD L+ P TV+TMP+  L A  DHG++ 
Sbjct  250   RWTALEKAGAHKQRPLWASTGVKDKAYKDTLYVDELVAPGTVNTMPEPTLHAVADHGAIR  309

Query  1294  ----ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
                  +       EA    +A++KLGV + +V   LE EGV+ F KS++ LLDS +
Sbjct  310   GPAMGKEQRGTYDEARADIDALEKLGVSYDEVVALLEDEGVEKFAKSWNDLLDSTR  365



>ref|WP_014141855.1| transaldolase [Streptomyces cattleya]
 ref|YP_004910624.1| Transaldolase 2 [Streptomyces cattleya NRRL 8057 = DSM 46488]
 ref|YP_006052986.1| transaldolase [Streptomyces cattleya NRRL 8057 = DSM 46488]
 emb|CCB73817.1| Transaldolase 2 [Streptomyces cattleya NRRL 8057 = DSM 46488]
 gb|AEW93463.1| transaldolase [Streptomyces cattleya NRRL 8057 = DSM 46488]
Length=372

 Score =   294 bits (752),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 230/352 (65%), Gaps = 9/352 (3%)
 Frame = +1

Query  418   QGQSPWYDNLCRP-VT--DLIPLIE-SGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             +G + W D+L R  +T  +L  LI+ S V GVT+NP IFQKAIS+   Y +Q  +L    
Sbjct  11    EGVAIWLDDLSRQRITSGNLAELIDASHVVGVTTNPTIFQKAISSGEGYQEQVADLAARR  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               +E     +   D++DA  +  P++D T+  DG VS+EV PRLA DT  T+  AK L  
Sbjct  71    VTVEEAVRMITTADVRDAADILRPLFDATDGQDGRVSIEVDPRLAHDTRATVAEAKQLAW  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA---SG  936
              VDR N  IKIPAT   +P+I EVI  GISVNVTLIFS+ERY AV+DAYL GLE    +G
Sbjct  131   LVDRPNTLIKIPATKAGLPAITEVIGRGISVNVTLIFSLERYRAVMDAYLSGLEKAKEAG  190

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
             + DL+ + SVASFFVSRVDT VDK L+KIG  EA  LRGKAA A A LA+Q Y++ F   
Sbjct  191   I-DLAGIRSVASFFVSRVDTEVDKRLDKIGGEEAKALRGKAALANARLAYQAYEEVFGSE  249

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW AL K GA KQR LWAST VK+PA PDTLYV  L+ P+TV+TMP+  L A  DHG V 
Sbjct  250   RWAALEKAGAHKQRPLWASTGVKDPALPDTLYVTELVAPNTVNTMPEPTLHATGDHGEVT  309

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
               TI     EA+G+ +A+  LGVD+  V   LE EGV+ F+ S++ LL S +
Sbjct  310   GDTIRGRYQEAQGVLDALAGLGVDYDDVVQVLEDEGVEKFEASWNDLLKSTE  361



>ref|WP_003923639.1| transaldolase [Mycobacterium thermoresistibile]
 gb|EHI14757.1| transaldolase [Mycobacterium thermoresistibile ATCC 19527]
Length=372

 Score =   294 bits (752),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 239/353 (68%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIESG-VRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  V GVT+NP+IFQ A+S  ++Y++Q +EL   G 
Sbjct  14    GVSVWLDDLSRDRLRSGNLQQLIDTRCVVGVTTNPSIFQAALSKGHSYDEQIRELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D++S    +   D+++AC +  P ++ ++  DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    DVDSAIRTVTTDDVREACDVLRPQWEASDGVDGRVSIEVDPRLAHDTDKTILQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N++IKIPAT   +P+I  V+A G+SVNVTLIFS+ERY  V+DAYL GLEA+    +
Sbjct  134   VDRPNLFIKIPATKAGLPAITAVLAEGVSVNVTLIFSVERYREVMDAYLAGLEAAKQAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF-SGPR  1119
             DLSK+ SVASFFVSRVDT +D  LE IG+ +AL LRGKA  A A LA+  Y++ F  G R
Sbjct  194   DLSKIHSVASFFVSRVDTEIDNRLEAIGTEQALALRGKAGLANARLAYAAYREVFEGGSR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +EAL   GA+ QR LWAST VKNPAYPDTLYV  L+ P+TV+T+P++ L A  DHG +  
Sbjct  254   FEALKADGARVQRPLWASTGVKNPAYPDTLYVTELVAPNTVNTLPEKTLEAVADHGEITG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+     E++ I++ +  +G+D   V  +LE EGV  F++S++ LLD+ +E+
Sbjct  314   DTVTGRAEESQAIFDQLTAVGIDLDDVFLKLENEGVQKFEQSWEELLDATREQ  366



>ref|WP_034623560.1| transaldolase [Cellulomonas sp. URHE0023]
Length=380

 Score =   294 bits (753),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 178/368 (48%), Positives = 234/368 (64%), Gaps = 17/368 (5%)
 Frame = +1

Query  376   SPIKRTSLHDLYEKQGQSPWYDNLCRP------VTDLIPLIESGVRGVTSNPAIFQKAIS  537
             SP+ R +        G + W D+L R       + DL+   +SGV GVT+NP+IF  A+S
Sbjct  6     SPLARLA------DAGVAIWLDDLSRERLRSGNLADLVA--DSGVVGVTTNPSIFASALS  57

Query  538   TSNAYNDQFKELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRL  717
               +AY+ Q +EL   G D++   +++   D++ A  +  P+YDET+  DG VS+EV PRL
Sbjct  58    KGDAYDAQLRELAAQGTDVDDAVFQITTDDVRQAADVLRPVYDETDGVDGRVSIEVDPRL  117

Query  718   ADDTEGTIEAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEA  897
             A DT+ TI +AK L   VDR NV+IKIPAT   +P+I  V+A GISVNVTLIFSIERY A
Sbjct  118   AKDTDATIASAKSLWSTVDRPNVFIKIPATREGLPAITAVLAEGISVNVTLIFSIERYGA  177

Query  898   VIDAYLDGLEASGLN--DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaq  1071
             V+DA+  GLE +  N  DL+ + SVASFFVSRVD  +D LL+KIGSPE+  LRGKAA A 
Sbjct  178   VLDAFESGLEKAKANGHDLAPIASVASFFVSRVDAAIDPLLDKIGSPESAALRGKAAIAN  237

Query  1072  aalafqlyqkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTM  1251
             A LA+ LYQ+  +  RW+AL   GAK QR LWAST VK+ AYPDTLYVD L+    V+TM
Sbjct  238   ARLAYGLYQEVVADDRWKALAAAGAKPQRPLWASTGVKDKAYPDTLYVDELVVAGVVNTM  297

Query  1252  PDQALLAFIDHGSVAR-TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFD  1428
             P+  L A  DHG     T+    + AE +   +  LG+D   V  QLE EGVD F  ++ 
Sbjct  298   PEATLKAVADHGGDGHDTVTGTRAAAEAVIAGLRDLGIDIDDVTEQLEVEGVDKFTTAWG  357

Query  1429  SLLDSLQE  1452
              LL ++ +
Sbjct  358   ELLSTVSD  365



>emb|CDO27145.1| transaldolase [Mycobacterium mageritense DSM 44476]
Length=395

 Score =   295 bits (754),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 227/346 (66%), Gaps = 7/346 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R       L  LI E  V GVT+NP+IFQ AI+T + Y+ +  EL   G 
Sbjct  14    GVSIWLDDLSRGRLQSGSLQKLIDEKSVVGVTTNPSIFQAAITTGHDYDAKIAELAARGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E   +E+   D+ DAC LF PI   T+  DG VS+EV PRLA DT GTI  AK L+KK
Sbjct  74    DVEETIFEITTADVADACDLFAPIAAATKGVDGRVSIEVDPRLAWDTAGTIAEAKNLYKK  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLN--  942
             V + NV IKIPAT   + +I E +A GISVNVTLIFS+ERY AVI+A+  GLE +  N  
Sbjct  134   VAKDNVLIKIPATREGLEAITETLAGGISVNVTLIFSLERYRAVINAFQSGLEQARDNGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DL  + SVASFFVSRVDT +DK L+ +G+ EAL L+GKAA A A LA+Q Y++ F+  RW
Sbjct  194   DLLAIHSVASFFVSRVDTEIDKRLDAVGTDEALALKGKAAVANARLAYQAYEELFATERW  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
              AL + GA  QR LWAST VK+PAYPDTLYV  L+  D V+TMP++ L A  DHG V   
Sbjct  254   AALAEAGALPQRPLWASTGVKDPAYPDTLYVTELVAADVVNTMPEKTLDATFDHGVVTGD  313

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLL  1437
             TI     EA+ + NAI+ LG+ +  V  QLE+EG++ F  S+  LL
Sbjct  314   TITGRYEEAKAVLNAIEGLGISYDDVVAQLESEGLEKFVASWKELL  359



>ref|WP_020601537.1| hypothetical protein [Spirosoma spitsbergense]
Length=368

 Score =   293 bits (751),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 168/357 (47%), Positives = 238/357 (67%), Gaps = 14/357 (4%)
 Frame = +1

Query  397   LHDLYEKQGQSPWYDNLCRPVT---DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQF  564
             +HD      QS W D + R +    +L  LI E G+RG+TSNPAIF+KAIS+ + Y++  
Sbjct  8     IHDF----DQSIWLDYIDRKIMNTGELQKLIDEDGIRGLTSNPAIFEKAISSGSDYDENI  63

Query  565   KELVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAG-DGYVSVEVSPRLADDTEGTI  741
             K L Q  K  E++++ L V DIQ A  LF+P+YDE   G DGYVS+EVSP LA + +GTI
Sbjct  64    KTLAQEDKSNEAIFYGLAVADIQQAADLFKPVYDEEVKGSDGYVSLEVSPHLALNADGTI  123

Query  742   EAAKWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDG  921
             + A+ L K VDR NV IKIP TA C+P+IK+ I++GI++NVTL+F +ERYEAV+DAY+ G
Sbjct  124   KQARELWKAVDRDNVMIKIPGTAQCLPAIKQSISDGININVTLLFGLERYEAVVDAYMSG  183

Query  922   LE--ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqly  1095
             LE        + ++ SVASFF+SR+D LVD +L + G     DL+G  A A A  A+++Y
Sbjct  184   LEVRVEKGQSVDQIASVASFFLSRIDVLVDPILNEKGLD---DLKGDIAIALARKAYEIY  240

Query  1096  qkkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAF  1275
             +++FS  R+  L  KGAK QRLLWASTS K+P++ D  YV+ LIGP TV+T+P + L AF
Sbjct  241   KREFSSDRFRKLEAKGAKPQRLLWASTSSKDPSFSDVKYVEALIGPKTVNTIPMETLEAF  300

Query  1276  IDHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
              DHG  A  ++ ++ +A      +++  +  K +  QLE EG++ F K +D LLD++
Sbjct  301   RDHGKAAARLEDDLDKATQALERVEQASIRLKDISQQLEDEGIEKFNKPYDKLLDAI  357



>ref|WP_026533959.1| transaldolase [Arthrobacter sp. H14]
Length=380

 Score =   294 bits (752),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 232/350 (66%), Gaps = 7/350 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLI-ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R +    +L  L+ E  V G+T+NP+IF  A+S   +Y +Q  EL  +G 
Sbjct  19    GVSIWLDDLSRELLASGNLQKLMDERNVVGITTNPSIFASALSDGESYAEQVSELAASGA  78

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+  +E+  +D+ +AC LF PI + T+  DG VS+EV PRL+DD   T E A+ L +K
Sbjct  79    DVETAVFEITTRDVTEACDLFAPIAERTDGVDGRVSIEVDPRLSDDAAKTAEVAQQLSRK  138

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             V+R NV+IKIPAT   +  I   +A GISVNVTLIFS++RY  VI+A++ G+E +     
Sbjct  139   VNRNNVHIKIPATEAGLEPIAATLAEGISVNVTLIFSLDRYREVINAFMLGMERAKEAGK  198

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLSK+ SVASFFVSRVD+ VD  L+ IG+ EA  L+GKA  A A LA+Q+Y+++FS  RW
Sbjct  199   DLSKIHSVASFFVSRVDSEVDTRLDAIGTDEAKALKGKAGVANARLAYQVYEQQFSTERW  258

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-AR  1299
             + L   GA++QR LWAST VK+PAYPDT+YV  L+ P+ V+TMP++ L A  DH  V   
Sbjct  259   KTLADAGARQQRPLWASTGVKDPAYPDTMYVTDLVAPNVVNTMPEKTLEAAADHAEVTGD  318

Query  1300  TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
             T+     EA  + N ++KLG+ +  V   LE EGVD F KS+  LLD++Q
Sbjct  319   TVTGTYDEANAVLNDLEKLGISYNDVVGLLETEGVDKFVKSWSQLLDTVQ  368



>ref|WP_034967964.1| transaldolase [Corynebacterium jeikeium]
Length=370

 Score =   293 bits (751),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 229/356 (64%), Gaps = 8/356 (2%)
 Frame = +1

Query  403   DLYEKQGQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKE  570
             D     G S W D+L R      +L  +IE+ GV GVT+NPAIF  A+S   AY++Q ++
Sbjct  8     DALANAGTSVWLDDLSRDRLRSGNLAEVIENKGVVGVTTNPAIFANAMSQGTAYDEQLQQ  67

Query  571   LVQAGKDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAA  750
             L  AG   ++  +E+   D+ +AC +F PIY+ T   DG VS+EV PRLA + E T+  A
Sbjct  68    LATAGTYADTAVFEMAADDVAEACDVFLPIYERTNGVDGRVSLEVDPRLAKEREATVIQA  127

Query  751   KWLHKKVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE-  927
             + L  KV R N+ IKIPAT  C+P+I +V+A GISVNVTLIFS+ RY  V++A+++G+  
Sbjct  128   RELAAKVGRENLMIKIPATEECLPAIADVLAEGISVNVTLIFSVSRYIQVMEAFIEGMSR  187

Query  928   -ASGLNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafql-yqk  1101
              A    +L+K+ SVASFFVSRVDT +DK L++IG+  AL L+GKA  A A LA+      
Sbjct  188   AADAGKNLTKIHSVASFFVSRVDTEIDKRLDEIGTDAALALKGKAGVANAQLAYAAFEDT  247

Query  1102  kFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFID  1281
               + P W AL +KGA  QR LWASTSVKNP YPDTLYV  L GP TV+TMP+  L A ID
Sbjct  248   LLNNPAWNALAEKGAPVQRPLWASTSVKNPEYPDTLYVTELAGPHTVNTMPENTLDATID  307

Query  1282  HGSV-ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             HG V   T+      A  ++ A+D+ GV+  +V T LE EGV+ F  S++ LL +L
Sbjct  308   HGEVRGDTLSGTTDSARAVFAALDEAGVNLAEVWTVLENEGVEKFVNSWNELLGTL  363



>ref|WP_015890638.1| transaldolase [Rhodococcus opacus]
 ref|YP_002784158.1| transaldolase [Rhodococcus opacus B4]
 dbj|BAH55213.1| transaldolase [Rhodococcus opacus B4]
Length=374

 Score =   294 bits (752),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 232/353 (66%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTDLIPLIE----SGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R   +   L E      V GVT+NP+IFQ A+S  + Y+ Q +EL + G 
Sbjct  14    GVSVWLDDLSRDRIESGNLAELVATKSVVGVTTNPSIFQAALSKGHVYDAQVRELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+E+    +   D++ AC +  P ++ +   DG VS+EV PRLA D + T+  A  L K 
Sbjct  74    DVEATIRTVTTDDVRAACDVLAPQFEASHGVDGRVSIEVDPRLAHDADKTVAQAVELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGL--N  942
             VDR NV+IKIPAT   IP+I +V+  GISVNVTLIFS+ERYE V+ AYLDGLEA+    +
Sbjct  134   VDRPNVFIKIPATEAGIPAIAKVLGEGISVNVTLIFSVERYELVMGAYLDGLEAAKAAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFS-GPR  1119
             DLS++ SVASFFVSRVDT +DK L+KIG+P+AL LRGKA  A A LA+  YQ+ F   PR
Sbjct  194   DLSRIHSVASFFVSRVDTEIDKRLDKIGTPDALALRGKAGLANARLAYAAYQQIFEVQPR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             ++ L+  GA+ QR LWAST VKNP YPDTLYV  L+ P+TV+TMP++ L A  DHG V  
Sbjct  254   FQGLLDSGARPQRALWASTGVKNPDYPDTLYVTELVAPNTVNTMPEKTLDAVADHGEVHG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               +      ++ I++ +  +G+D   V T LE EGVD F+ S++ LLD+  E+
Sbjct  314   DAVSGTAVASQEIFDQLTAVGIDLPDVFTVLEDEGVDKFEVSWNELLDATAEQ  366



>ref|WP_037243117.1| transaldolase [Rhodococcus wratislaviensis]
 dbj|GAF50340.1| transaldolase [Rhodococcus wratislaviensis NBRC 100605]
Length=374

 Score =   293 bits (751),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 227/353 (64%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCR---PVTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  L+ +  V GVT+NP+IF  A++T  AY +Q + L   G 
Sbjct  14    GVSVWLDDLSRDRLQSGNLAELVSTRSVVGVTTNPSIFHTALTTGEAYTEQLRRLDTDGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D++S+   L   D++ AC L  P +D     DG VS+EV PRLA DT+ TIE A  L K 
Sbjct  74    DVDSVIRTLTTDDVRRACDLLSPQFDAGNGVDGRVSLEVDPRLAHDTDATIEQAIELWKL  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA--SGLN  942
             VDR N+ IKIPAT   IP+I  VI  GISVNVTL+FS+ERY+AVIDAYL GL+A  +   
Sbjct  134   VDRPNLLIKIPATRAGIPAIAAVIGEGISVNVTLVFSVERYQAVIDAYLAGLDAARAAGR  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGPRW  1122
             DLS + SVASFFVSRVDT +D  LEKIG+ +AL LRG AA A A LA+  +Q+ F+  RW
Sbjct  194   DLSTIHSVASFFVSRVDTEIDARLEKIGTADALALRGTAALANARLAYHAFQQNFASDRW  253

Query  1123  EALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSVAR-  1299
               L   GA+ QR LWAST VKNP YPDTLYV  L+ PDTV+TMP+  L A  DHG++   
Sbjct  254   VTLADAGARLQRPLWASTGVKNPDYPDTLYVTELVAPDTVNTMPEATLNAVADHGNIPAH  313

Query  1300  -TIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
               I     ++  I++A+  +G+D   V T LEAEGV+ F  ++ +L +++  +
Sbjct  314   DNISDTAEQSRAIFDALTDVGIDLPAVFTALEAEGVEKFVAAWTALTEAISTR  366



>ref|WP_014213534.1| transaldolase [Mycobacterium rhodesiae]
 ref|YP_005003008.1| transaldolase [Mycobacterium rhodesiae NBB3]
 gb|AEV75793.1| transaldolase [Mycobacterium rhodesiae NBB3]
Length=376

 Score =   294 bits (752),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 236/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  LI++  V GVT+NP+IFQ A+S  ++Y+ Q KEL + G 
Sbjct  14    GVSVWLDDLSRERLQTGNLQELIDTKSVVGVTTNPSIFQAALSKGDSYDGQVKELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +    Y+ ++  DG VS+EV PRLA DT+ TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLAKQYELSDGVDGRVSIEVDPRLAHDTDKTILQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPAT   IP+I  V+A GISVNVTLIFS+ER+  V+DAYL GLE +    +
Sbjct  134   VDRPNLLIKIPATEAGIPAIASVLAEGISVNVTLIFSVERHRMVMDAYLKGLEKAKDAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF-SGPR  1119
             D+SK+ SVASFFVSRVDT +DK LEKIGS EAL LRGKA  A A LA+  Y++ F  G R
Sbjct  194   DISKIHSVASFFVSRVDTEIDKRLEKIGSDEALKLRGKAGVANAHLAYAAYEEVFVGGSR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +EAL   GA+ QR LWAST VKN  Y DTLYV  L+ P+TV+TMP++ + A  DHG +  
Sbjct  254   FEALKADGARVQRPLWASTGVKNEDYSDTLYVTELVAPNTVNTMPEKTMDAVADHGVITG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+     EA+G+++ +D +G+D   V   LE EGV+ F+KS+  LLD+ QE+
Sbjct  314   DTVTGKAEEAQGVFDKLDAVGIDLPDVFRLLEDEGVEKFEKSWQELLDATQEQ  366



>ref|WP_027771347.1| transaldolase [Streptomyces sp. CNQ329]
Length=372

 Score =   293 bits (751),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 234/352 (66%), Gaps = 9/352 (3%)
 Frame = +1

Query  418   QGQSPWYDNLCRP-VT--DLIPLIE-SGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAG  585
             +G + W D+L R  +T  +L  LI+ S V GVT+NP IFQKAIS  + Y  Q ++L   G
Sbjct  11    EGVAIWLDDLSRKRITSGNLAELIDGSHVVGVTTNPTIFQKAISAGDGYEGQLRDLATRG  70

Query  586   KDIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHK  765
               +E     +   D++DA  +  P++D TE  DG VS+EV PRLA  T  TI  AK L  
Sbjct  71    VTVEEAVRMITTADVRDAADVLRPVHDATEGQDGRVSIEVDPRLAHHTAATIAEAKQLAW  130

Query  766   KVDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLE---ASG  936
              VDR N+++KIPAT   +P+I EV+  GISVNVTLIFS+ERY  V+DA+L GLE   A+G
Sbjct  131   LVDRPNLFVKIPATRAGLPAITEVLGKGISVNVTLIFSLERYREVMDAFLAGLEQAKAAG  190

Query  937   LNDLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkFSGP  1116
             L DL+++ SVASFFVSRVDT VDK L+ +G+ EA +LRG+AA A A LA++ Y++ FS  
Sbjct  191   L-DLAEIRSVASFFVSRVDTEVDKRLDAMGTAEAKELRGRAAVANARLAYEAYEEVFSSD  249

Query  1117  RWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-  1293
             RW AL + GA KQR LWAST VK+ AY DTLYVD L+ P TV+TMP+  L A  DHG++ 
Sbjct  250   RWLALERAGAHKQRPLWASTGVKDKAYKDTLYVDDLVAPGTVNTMPEATLHAVADHGAIE  309

Query  1294  ARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQ  1449
                +    +EA    +A++KLG+ + +V   LE EGV+ F KS+  LLDS +
Sbjct  310   GDAVRGTYAEARADLDALEKLGISYDEVVGVLEDEGVEKFAKSWTDLLDSTR  361



>ref|WP_036498908.1| transaldolase [Nitrosococcus oceani]
 gb|KFI23824.1| transaldolase [Nitrosococcus oceani]
Length=377

 Score =   293 bits (751),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 163/359 (45%), Positives = 233/359 (65%), Gaps = 14/359 (4%)
 Frame = +1

Query  421   GQSPWYDNLCRPVTDLIPLI----ESGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             GQS W DNL R +     L     E G+ GVTSNP+IF KAI+ S+ Y+ Q + L++ G+
Sbjct  12    GQSYWIDNLTRRMIKNGELKHRVEEQGLGGVTSNPSIFHKAIANSDDYDPQIETLIREGR  71

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
                 +Y  L+  DI+DAC +  P+Y E +  DG+VS+EVSP LA DTEG+I+ A+ L + 
Sbjct  72    SKIEIYEALITTDIRDACDILHPVYKERKGQDGFVSLEVSPYLAHDTEGSIQEARRLWQT  131

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEA--SGLN  942
             VDR N++IKIP TA  +P+I+E++  GI++N+TL+FSI+ Y+AV +AYL  LE       
Sbjct  132   VDRPNLFIKIPGTAAGVPAIEELLFEGININITLLFSIDHYQAVAEAYLRALERRLEAGQ  191

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEAL--------Dlrgkaanaqaalafqlyq  1098
              +  + SVASFF+SR+D L D+LL     PE          +LRGK A A A LA+Q ++
Sbjct  192   TVENIASVASFFLSRIDVLADQLLSHRIPPEGKSPSAPHPENLRGKVAIANAKLAYQRFK  251

Query  1099  kkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFI  1278
             +     RW+ L  K A+ QR+LWASTS KNPAY D +YV+PLIGP TV+T+P++ + AF 
Sbjct  252   EILQSERWKTLAGKRAQVQRMLWASTSTKNPAYRDVMYVEPLIGPYTVNTLPEKTIKAFA  311

Query  1279  DHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
             DHG V  T++ N+ E+  ++  ++K+G+D+  V  QLE EGV  F   +D+LL  L+ K
Sbjct  312   DHGIVKETVEENIEESRKVFADLEKIGIDFNLVTAQLENEGVQKFIDPYDALLAMLEAK  370



>ref|WP_006244788.1| transaldolase [Mycobacterium tusciae]
Length=372

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 236/353 (67%), Gaps = 8/353 (2%)
 Frame = +1

Query  421   GQSPWYDNLCRP---VTDLIPLIES-GVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             G S W D+L R      +L  L+++  V GVT+NP+IFQ A+S  NAY+DQ KEL + G 
Sbjct  14    GVSVWLDDLSRERLQTGNLQELVDTRSVVGVTTNPSIFQAALSKGNAYDDQVKELAERGA  73

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
             D+++    +   D+++AC +    Y+++   DG VS+EV PRLA D + TI  A  L K 
Sbjct  74    DVDATIRTVTTDDVRNACDVLTKQYEQSGGVDGRVSIEVDPRLAHDADKTIAQAIELWKI  133

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEAS--GLN  942
             VDR N+ IKIPA    IP+I  VIA GISVNVTLIFS+ER+ AV+DAYL GLE +    +
Sbjct  134   VDRPNLLIKIPAMEEGIPAITSVIAEGISVNVTLIFSVERHRAVMDAYLAGLEKAKEAGH  193

Query  943   DLSKVTSVASFFVSRVDTLVDKLLEKIGSPEALDlrgkaanaqaalafqlyqkkF-SGPR  1119
             D+SK+ SVASFFVSRVDT +DK LE+IGS EAL LRGKA  A A LA+  Y++ F  G R
Sbjct  194   DISKIHSVASFFVSRVDTEIDKRLEQIGSEEALALRGKAGVANAHLAYAAYEEVFVGGSR  253

Query  1120  WEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFIDHGSV-A  1296
             +E L   GA+ QR LWAST VKNP Y DTLYV  L+ P+TV+TMP++ + A  DHG +  
Sbjct  254   FEPLKAAGARVQRPLWASTGVKNPDYSDTLYVTELVAPNTVNTMPEKTIDAVADHGVITG  313

Query  1297  RTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSLQEK  1455
              T+    +EA+ +++ ++ +G+D   V   LE EGV+ F+KS+  LLD+ QE+
Sbjct  314   DTVTGKGAEAQAVFDKLEAVGIDLPDVFKVLEDEGVEKFEKSWQELLDATQEQ  366



>ref|WP_013032607.1| transaldolase [Nitrosococcus halophilus]
 ref|YP_003527107.1| transaldolase [Nitrosococcus halophilus Nc 4]
 gb|ADE14720.1| transaldolase [Nitrosococcus halophilus Nc 4]
Length=981

 Score =   309 bits (791),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/356 (47%), Positives = 239/356 (67%), Gaps = 14/356 (4%)
 Frame = +1

Query  421   GQSPWYDNLCRPVT---DLIPLIE-SGVRGVTSNPAIFQKAISTSNAYNDQFKELVQAGK  588
             GQS W DNL R +    DL   +E  G+RGVTSNP IF +AI+ S+ Y+ Q + L+  G+
Sbjct  11    GQSYWLDNLTRRMIKNGDLKRRVEKQGLRGVTSNPKIFHEAIAKSDDYDAQIETLIAEGR  70

Query  589   DIESLYWELVVKDIQDACKLFEPIYDETEAGDGYVSVEVSPRLADDTEGTIEAAKWLHKK  768
                 +Y  LV  D+QDAC +  P+YDE +  DG+VS+E+SP LA DT G+I+ A+ L + 
Sbjct  71    SNIEIYEALVTTDLQDACDILRPVYDELKGQDGFVSLEISPHLAHDTPGSIQEARRLWQT  130

Query  769   VDRRNVYIKIPATAPCIPSIKEVIANGISVNVTLIFSIERYEAVIDAYLDGLEASGLND-  945
             VDR N+ IKIPATA  IP+I+E++  GI++N+TL+FSIERY+AV  AYL  LE     D 
Sbjct  131   VDRPNLLIKIPATAAGIPTIEELLFEGININITLLFSIERYQAVAQAYLKALERRLEADK  190

Query  946   -LSKVTSVASFFVSRVDTLVDKLL-EKIG-------SPEALDlrgkaanaqaalafqlyq  1098
              ++ + SVASFF+SR+D L D+LL  +I         P   DL+GK A A A LA+Q ++
Sbjct  191   SVAHIASVASFFLSRIDVLADQLLSHRIPLEGRSHLEPHPEDLQGKVAIANAKLAYQYFK  250

Query  1099  kkFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVDPLIGPDTVSTMPDQALLAFI  1278
                   RW+AL  KGA+ QR+LWASTS KNPAY D +Y++PLIGP T++TMP+  + AF 
Sbjct  251   HILQSNRWKALEAKGAQVQRMLWASTSTKNPAYHDVMYIEPLIGPRTINTMPEDTIEAFA  310

Query  1279  DHGSVARTIDANVSEAEGIYNAIDKLGVDWKQVGTQLEAEGVDSFKKSFDSLLDSL  1446
             DHG+V  T++ N+ EA+ +   ++K+G+D++ V +QLE EG+  F   +D LL++L
Sbjct  311   DHGTVKETVEKNIEEAQKVITELEKIGIDFQLVASQLENEGIQKFIDPYDELLETL  366



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4944699788280