BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79077_g1_i1 len=1274 path=[1:0-1273]

Length=1274
                                                                      Score     E

ref|NP_001234192.1|  auxin efflux facilitator SlPIN5                    435   3e-147   
ref|XP_006345358.1|  PREDICTED: putative auxin efflux carrier com...    432   6e-146   
ref|XP_009587078.1|  PREDICTED: putative auxin efflux carrier com...    425   4e-143   
ref|XP_009804213.1|  PREDICTED: putative auxin efflux carrier com...    414   2e-139   
emb|CDP11399.1|  unnamed protein product                                404   4e-135   
ref|XP_002279191.1|  PREDICTED: putative auxin efflux carrier com...    403   1e-134   Vitis vinifera
gb|AIF28449.1|  PIN-like protein                                        399   5e-133   
gb|KDP23297.1|  hypothetical protein JCGZ_23130                         395   1e-131   
gb|EYU39430.1|  hypothetical protein MIMGU_mgv1a007953mg                392   7e-130   
ref|XP_009603485.1|  PREDICTED: putative auxin efflux carrier com...    389   2e-129   
ref|XP_009338007.1|  PREDICTED: putative auxin efflux carrier com...    389   3e-129   
ref|XP_011077192.1|  PREDICTED: putative auxin efflux carrier com...    391   4e-129   
ref|XP_004302153.1|  PREDICTED: putative auxin efflux carrier com...    389   5e-129   
ref|XP_002512623.1|  conserved hypothetical protein                     386   3e-128   Ricinus communis
ref|XP_008370812.1|  PREDICTED: putative auxin efflux carrier com...    386   5e-128   
ref|XP_008355844.1|  PREDICTED: LOW QUALITY PROTEIN: putative aux...    384   4e-127   
emb|CDP04220.1|  unnamed protein product                                384   5e-127   
emb|CDP04221.1|  unnamed protein product                                382   1e-126   
ref|XP_002325466.1|  putative auxin efflux carrier protein 9            382   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_008218436.1|  PREDICTED: putative auxin efflux carrier com...    380   6e-126   
ref|XP_008388803.1|  PREDICTED: putative auxin efflux carrier com...    380   1e-125   
ref|XP_007205413.1|  hypothetical protein PRUPE_ppa007621mg             380   2e-125   
ref|XP_010268327.1|  PREDICTED: putative auxin efflux carrier com...    379   3e-125   
ref|XP_011009309.1|  PREDICTED: putative auxin efflux carrier com...    378   6e-125   
ref|XP_009792134.1|  PREDICTED: putative auxin efflux carrier com...    378   7e-125   
ref|XP_007029400.1|  Auxin efflux carrier component                     375   6e-124   
ref|XP_004155098.1|  PREDICTED: putative auxin efflux carrier com...    375   1e-123   
ref|XP_010525085.1|  PREDICTED: putative auxin efflux carrier com...    375   2e-123   
ref|XP_009384295.1|  PREDICTED: putative auxin efflux carrier com...    374   2e-123   
ref|XP_003624144.1|  Auxin Efflux Carrier                               374   2e-123   
ref|XP_004152830.1|  PREDICTED: putative auxin efflux carrier com...    374   3e-123   
ref|NP_197157.4|  auxin transporter PIN5                                373   5e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802247.1|  PREDICTED: putative auxin efflux carrier com...    372   1e-122   
gb|KFK25870.1|  hypothetical protein AALP_AA8G172900                    370   4e-122   
ref|XP_006376058.1|  putative auxin efflux carrier protein 9            369   2e-121   
ref|XP_010673920.1|  PREDICTED: putative auxin efflux carrier com...    368   9e-121   
ref|XP_006288060.1|  hypothetical protein CARUB_v10001290mg             366   2e-120   
gb|KGN61255.1|  hypothetical protein Csa_2G074170                       365   8e-120   
ref|XP_010038273.1|  PREDICTED: putative auxin efflux carrier com...    365   1e-119   
ref|XP_004492828.1|  PREDICTED: putative auxin efflux carrier com...    365   1e-119   
gb|AIF28456.1|  PIN-like protein                                        364   2e-119   
ref|XP_006480409.1|  PREDICTED: putative auxin efflux carrier com...    363   4e-119   
gb|AIF28451.1|  PIN-like protein                                        362   9e-119   
ref|XP_009383317.1|  PREDICTED: putative auxin efflux carrier com...    362   1e-118   
gb|AIF28452.1|  PIN-like protein                                        361   2e-118   
ref|XP_003534521.1|  PREDICTED: putative auxin efflux carrier com...    361   4e-118   
ref|XP_006400192.1|  hypothetical protein EUTSA_v10013986mg             360   7e-118   
ref|XP_002871722.1|  hypothetical protein ARALYDRAFT_326097             359   1e-117   
ref|XP_009121478.1|  PREDICTED: putative auxin efflux carrier com...    358   2e-117   
ref|XP_006480407.1|  PREDICTED: putative auxin efflux carrier com...    358   2e-117   
gb|KHN29283.1|  Putative auxin efflux carrier component 8               358   1e-116   
gb|AIF28457.1|  PIN-like protein                                        357   1e-116   
ref|XP_011014382.1|  PREDICTED: putative auxin efflux carrier com...    356   2e-116   
ref|XP_010492564.1|  PREDICTED: putative auxin efflux carrier com...    356   2e-116   
emb|CDY67254.1|  BnaCnng54140D                                          355   4e-116   
ref|XP_010420348.1|  PREDICTED: putative auxin efflux carrier com...    355   4e-116   
gb|EYU39429.1|  hypothetical protein MIMGU_mgv1a009388mg                354   1e-115   
ref|XP_010453817.1|  PREDICTED: putative auxin efflux carrier com...    353   2e-115   
gb|AIF28459.1|  PIN-like protein                                        353   4e-115   
ref|XP_008794580.1|  PREDICTED: putative auxin efflux carrier com...    351   2e-114   
ref|XP_007139738.1|  hypothetical protein PHAVU_008G055200g             350   7e-114   
gb|AIF28454.1|  PIN-like protein                                        345   5e-113   
ref|XP_011077194.1|  PREDICTED: putative auxin efflux carrier com...    349   6e-113   
ref|XP_006480408.1|  PREDICTED: putative auxin efflux carrier com...    343   1e-111   
ref|NP_001276305.1|  uncharacterized protein LOC100784879               344   2e-111   
ref|NP_001045214.1|  Os01g0919800                                       344   2e-111   Oryza sativa Japonica Group [Japonica rice]
emb|CDX70699.1|  BnaC03g07830D                                          343   3e-111   
ref|XP_006645238.1|  PREDICTED: probable auxin efflux carrier com...    343   3e-111   
ref|XP_009131547.1|  PREDICTED: putative auxin efflux carrier com...    341   1e-110   
ref|XP_010927702.1|  PREDICTED: putative auxin efflux carrier com...    339   7e-110   
gb|AIF28455.1|  PIN-like protein                                        339   9e-110   
gb|AIF28450.1|  PIN-like protein                                        338   2e-109   
ref|XP_010927704.1|  PREDICTED: putative auxin efflux carrier com...    338   4e-109   
ref|XP_002272306.1|  PREDICTED: putative auxin efflux carrier com...    337   6e-109   Vitis vinifera
ref|NP_001276122.1|  uncharacterized protein LOC100788225               336   2e-108   
ref|XP_006659591.1|  PREDICTED: probable auxin efflux carrier com...    333   1e-107   
ref|XP_009402745.1|  PREDICTED: probable auxin efflux carrier com...    333   3e-107   
ref|XP_009402744.1|  PREDICTED: probable auxin efflux carrier com...    332   1e-106   
gb|KDO41492.1|  hypothetical protein CISIN_1g019021mg                   331   1e-106   
gb|AIF28460.1|  PIN-like protein                                        331   5e-106   
ref|XP_006480404.1|  PREDICTED: putative auxin efflux carrier com...    329   8e-106   
gb|KHN40463.1|  Putative auxin efflux carrier component 8               329   2e-105   
ref|XP_003564940.1|  PREDICTED: probable auxin efflux carrier com...    328   2e-105   
gb|AFK32343.1|  putative auxin efflux carrier PIN5a                     329   3e-105   
ref|XP_006848440.1|  hypothetical protein AMTR_s00013p00241000          327   4e-105   
ref|XP_010111063.1|  Putative auxin efflux carrier component 8          324   2e-104   
dbj|BAJ91285.1|  predicted protein                                      326   3e-104   
gb|AIF28462.1|  PIN-like protein                                        322   6e-104   
dbj|BAJ96544.1|  predicted protein                                      324   1e-103   
emb|CDX78697.1|  BnaA03g06090D                                          323   4e-103   
ref|NP_001148155.1|  auxin efflux carrier component 6                   323   5e-103   Zea mays [maize]
ref|XP_010038261.1|  PREDICTED: putative auxin efflux carrier com...    321   2e-102   
ref|XP_004971070.1|  PREDICTED: probable auxin efflux carrier com...    318   3e-101   
ref|XP_010070144.1|  PREDICTED: putative auxin efflux carrier com...    315   3e-100   
ref|XP_009346849.1|  PREDICTED: putative auxin efflux carrier com...    313   5e-100   
ref|XP_003576710.1|  PREDICTED: probable auxin efflux carrier com...    314   7e-100   
ref|XP_006350420.1|  PREDICTED: putative auxin efflux carrier com...    313   8e-100   
ref|XP_010045960.1|  PREDICTED: putative auxin efflux carrier com...    313   2e-99    
ref|NP_001062317.1|  Os08g0529000                                       312   5e-99    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001234230.1|  auxin efflux facilitator SlPIN10                   309   5e-98    
ref|XP_010068801.1|  PREDICTED: putative auxin efflux carrier com...    308   2e-97    
ref|XP_002320435.2|  hypothetical protein POPTR_0014s14390g             305   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_002462627.1|  hypothetical protein SORBIDRAFT_02g029210          305   3e-96    Sorghum bicolor [broomcorn]
ref|XP_002444705.1|  hypothetical protein SORBIDRAFT_07g026370          302   1e-94    Sorghum bicolor [broomcorn]
ref|XP_007138460.1|  hypothetical protein PHAVU_009G210900g             301   2e-94    
gb|KDO47605.1|  hypothetical protein CISIN_1g041301mg                   296   1e-93    
ref|NP_001140977.1|  uncharacterized protein LOC100273056               298   1e-93    Zea mays [maize]
ref|XP_007138749.1|  hypothetical protein PHAVU_009G234000g             298   9e-93    
ref|XP_004978371.1|  PREDICTED: probable auxin efflux carrier com...    296   1e-92    
ref|XP_006853065.1|  hypothetical protein AMTR_s00038p00074050          295   3e-92    
ref|XP_004957280.1|  PREDICTED: probable auxin efflux carrier com...    294   5e-92    
ref|XP_009781685.1|  PREDICTED: putative auxin efflux carrier com...    292   1e-91    
gb|EMS56061.1|  putative auxin efflux carrier component 4               293   1e-91    
gb|EAZ07744.1|  hypothetical protein OsI_29999                          292   2e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_009342872.1|  PREDICTED: putative auxin efflux carrier com...    291   4e-91    
ref|XP_008379330.1|  PREDICTED: putative auxin efflux carrier com...    287   2e-89    
dbj|BAB09622.1|  unnamed protein product                                286   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663186.1|  PREDICTED: probable auxin efflux carrier com...    288   5e-89    
gb|AIF28445.1|  PIN-like protein                                        288   6e-89    
ref|XP_007216395.1|  hypothetical protein PRUPE_ppa021573mg             285   1e-88    
ref|XP_003569680.1|  PREDICTED: probable auxin efflux carrier com...    284   2e-88    
ref|XP_008230728.1|  PREDICTED: putative auxin efflux carrier com...    284   3e-88    
gb|KCW65009.1|  hypothetical protein EUGRSUZ_G02548                     282   9e-88    
tpd|FAA00684.1|  TPA: auxin efflux carrier                              280   8e-87    
ref|XP_004963479.1|  PREDICTED: probable auxin efflux carrier com...    280   1e-86    
gb|KDO39721.1|  hypothetical protein CISIN_1g035534mg                   277   2e-86    
gb|EMS67819.1|  Putative auxin efflux carrier component 5               278   4e-86    
ref|XP_007032452.1|  Auxin efflux carrier family protein                277   1e-85    
emb|CDM83606.1|  unnamed protein product                                276   4e-85    
ref|XP_008775592.1|  PREDICTED: probable auxin efflux carrier com...    274   2e-84    
ref|XP_010068800.1|  PREDICTED: uncharacterized protein LOC104455763    283   2e-84    
ref|XP_002458404.1|  hypothetical protein SORBIDRAFT_03g032850          272   1e-83    Sorghum bicolor [broomcorn]
ref|XP_010087804.1|  Putative auxin efflux carrier component 5          272   1e-83    
ref|XP_004302355.1|  PREDICTED: probable auxin efflux carrier com...    272   1e-83    
ref|XP_010912889.1|  PREDICTED: probable auxin efflux carrier com...    270   1e-82    
emb|CDM85668.1|  unnamed protein product                                268   2e-82    
ref|XP_008673108.1|  PREDICTED: uncharacterized protein LOC100381...    271   2e-82    
ref|XP_011098572.1|  PREDICTED: auxin efflux carrier component 4 ...    268   7e-82    
gb|EYU34112.1|  hypothetical protein MIMGU_mgv1a024604mg                267   8e-82    
tpg|DAA57876.1|  TPA: hypothetical protein ZEAMMB73_331388              267   8e-82    
ref|NP_001168208.1|  uncharacterized protein LOC100381964               265   5e-81    Zea mays [maize]
gb|AFK32346.1|  putative auxin efflux carrier PIN8                      265   7e-81    
ref|XP_004969744.1|  PREDICTED: auxin efflux carrier component 4-...    263   5e-80    
gb|AIF28442.1|  PIN-like protein                                        263   1e-79    
gb|KGN59594.1|  hypothetical protein Csa_3G827360                       259   2e-78    
ref|XP_004147461.1|  PREDICTED: probable auxin efflux carrier com...    258   3e-78    
gb|EMT05834.1|  Putative auxin efflux carrier component 6               257   3e-78    
ref|XP_009386292.1|  PREDICTED: auxin efflux carrier component 1        258   4e-78    
ref|XP_006482537.1|  PREDICTED: putative auxin efflux carrier com...    257   5e-78    
ref|XP_010242365.1|  PREDICTED: probable auxin efflux carrier com...    256   1e-77    
ref|XP_002458992.1|  hypothetical protein SORBIDRAFT_03g043960          253   2e-76    Sorghum bicolor [broomcorn]
gb|KDP45475.1|  hypothetical protein JCGZ_09724                         253   3e-76    
ref|XP_008664247.1|  PREDICTED: LOW QUALITY PROTEIN: probable aux...    252   8e-76    
gb|AGW52147.1|  PIN13                                                   251   2e-75    
ref|XP_006338481.1|  PREDICTED: putative auxin efflux carrier com...    251   3e-75    
ref|XP_011098571.1|  PREDICTED: probable auxin efflux carrier com...    250   4e-75    
ref|XP_010696206.1|  PREDICTED: probable auxin efflux carrier com...    253   5e-75    
ref|XP_002305371.1|  hypothetical protein POPTR_0004s12310g             248   2e-74    Populus trichocarpa [western balsam poplar]
ref|XP_007139602.1|  hypothetical protein PHAVU_008G043700g             248   2e-74    
ref|XP_006373306.1|  hypothetical protein POPTR_0017s11440g             247   4e-74    
ref|XP_007151202.1|  hypothetical protein PHAVU_004G026500g             247   5e-74    
ref|XP_004489373.1|  PREDICTED: putative auxin efflux carrier com...    247   5e-74    
ref|XP_010906421.1|  PREDICTED: probable auxin efflux carrier com...    246   1e-73    
ref|XP_003534463.1|  PREDICTED: probable auxin efflux carrier com...    246   2e-73    
gb|AIF28458.1|  PIN-like protein                                        242   2e-73    
ref|XP_011005065.1|  PREDICTED: putative auxin efflux carrier com...    245   2e-73    
ref|XP_010029286.1|  PREDICTED: putative auxin efflux carrier com...    244   5e-73    
gb|KCW58740.1|  hypothetical protein EUGRSUZ_H01382                     241   8e-73    
ref|XP_003574813.1|  PREDICTED: probable auxin efflux carrier com...    244   1e-72    
gb|KHN11585.1|  Putative auxin efflux carrier component 5               243   2e-72    
gb|EMT08432.1|  Putative auxin efflux carrier component 4               243   2e-72    
ref|XP_011009448.1|  PREDICTED: putative auxin efflux carrier com...    242   3e-72    
gb|AGJ95049.1|  PIN11                                                   242   4e-72    
ref|XP_009795990.1|  PREDICTED: putative auxin efflux carrier com...    242   4e-72    
ref|XP_010686764.1|  PREDICTED: probable auxin efflux carrier com...    244   5e-72    
emb|CDP02197.1|  unnamed protein product                                242   5e-72    
gb|KDO36786.1|  hypothetical protein CISIN_1g048649mg                   238   6e-72    
gb|EMT25709.1|  Putative auxin efflux carrier component 5               243   6e-72    
ref|NP_001234211.1|  auxin efflux facilitator SlPIN8                    242   6e-72    
ref|XP_009617494.1|  PREDICTED: putative auxin efflux carrier com...    241   7e-72    
ref|XP_003552512.1|  PREDICTED: auxin efflux carrier component 3-...    240   2e-71    
ref|XP_010315851.1|  PREDICTED: auxin efflux facilitator SlPIN8 i...    240   2e-71    
ref|XP_003621113.1|  Auxin efflux carrier component                     239   4e-71    
ref|XP_010550069.1|  PREDICTED: putative auxin efflux carrier com...    239   5e-71    
ref|XP_009395146.1|  PREDICTED: probable auxin efflux carrier com...    239   7e-71    
tpg|DAA05219.1|  TPA: auxin efflux carrier protein                      237   3e-70    
ref|NP_001063602.1|  Os09g0505400                                       238   3e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002282480.1|  PREDICTED: putative auxin efflux carrier com...    237   5e-70    Vitis vinifera
gb|EAY75605.1|  hypothetical protein OsI_03509                          235   6e-70    Oryza sativa Indica Group [Indian rice]
ref|XP_010492334.1|  PREDICTED: putative auxin efflux carrier com...    236   1e-69    
ref|NP_001044064.2|  Os01g0715600                                       234   2e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006853071.1|  hypothetical protein AMTR_s00038p00082540          235   2e-69    
ref|XP_008443438.1|  PREDICTED: putative auxin efflux carrier com...    234   5e-69    
ref|XP_008443437.1|  PREDICTED: putative auxin efflux carrier com...    234   6e-69    
ref|XP_010420162.1|  PREDICTED: putative auxin efflux carrier com...    233   2e-68    
gb|KHN47561.1|  Putative auxin efflux carrier component 5               232   3e-68    
ref|NP_001267507.1|  uncharacterized protein LOC100795531               232   3e-68    
emb|CDM84597.1|  unnamed protein product                                234   4e-68    
ref|XP_006431075.1|  hypothetical protein CICLE_v10012051mg             232   4e-68    
ref|XP_003550957.1|  PREDICTED: putative auxin efflux carrier com...    232   5e-68    
ref|XP_008788611.1|  PREDICTED: probable auxin efflux carrier com...    232   1e-67    
ref|XP_003564417.1|  PREDICTED: probable auxin efflux carrier com...    232   2e-67    
ref|NP_197014.1|  auxin transporter PIN8                                228   9e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489167.1|  PREDICTED: auxin efflux carrier component 1-...    228   1e-66    
ref|NP_001130684.1|  uncharacterized protein LOC100191787               230   1e-66    Zea mays [maize]
ref|XP_009121614.1|  PREDICTED: putative auxin efflux carrier com...    227   2e-66    
ref|NP_001276251.1|  uncharacterized protein LOC100801456               228   2e-66    
ref|NP_001276253.1|  uncharacterized protein LOC100779697               227   3e-66    
ref|NP_001044548.1|  Os01g0802700                                       228   8e-66    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ45288.1|  hypothetical protein OsJ_29930                          226   1e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646264.1|  PREDICTED: auxin efflux carrier component 1-...    223   4e-65    
gb|AGV28597.1|  auxin efflux carrier 9                                  226   4e-65    
ref|XP_006600903.1|  PREDICTED: putative auxin efflux carrier com...    223   4e-65    
gb|KCW84567.1|  hypothetical protein EUGRSUZ_B01406                     221   4e-65    
ref|XP_006286843.1|  hypothetical protein CARUB_v10003844mg             223   1e-64    
ref|XP_006400028.1|  hypothetical protein EUTSA_v10016062mg             223   1e-64    
ref|XP_004973987.1|  PREDICTED: probable auxin efflux carrier com...    221   4e-64    
ref|XP_004970283.1|  PREDICTED: probable auxin efflux carrier com...    223   5e-64    
emb|CDX85565.1|  BnaA02g02480D                                          221   5e-64    
gb|KHN12058.1|  Auxin efflux carrier component 2                        219   8e-64    
ref|XP_006644857.1|  PREDICTED: probable auxin efflux carrier com...    223   8e-64    
ref|XP_008673109.1|  PREDICTED: uncharacterized protein LOC100381...    218   9e-64    
ref|XP_009126029.1|  PREDICTED: putative auxin efflux carrier com...    220   1e-63    
ref|XP_010686765.1|  PREDICTED: probable auxin efflux carrier com...    216   2e-62    
gb|EEE55544.1|  hypothetical protein OsJ_03782                          217   8e-62    Oryza sativa Japonica Group [Japonica rice]
gb|KHG05246.1|  Putative auxin efflux carrier component 5               214   1e-61    
gb|EEC71656.1|  hypothetical protein OsI_04108                          215   3e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_002873708.1|  pin-formed 8                                       214   3e-61    
ref|XP_002517471.1|  conserved hypothetical protein                     209   6e-60    Ricinus communis
gb|AIF28463.1|  PIN-like protein                                        202   3e-59    
gb|EMT10264.1|  Putative auxin efflux carrier component 4               204   5e-59    
gb|EMS56676.1|  putative auxin efflux carrier component 5               206   2e-57    
gb|KHG05247.1|  Putative auxin efflux carrier component 5               201   9e-57    
ref|XP_010029287.1|  PREDICTED: putative auxin efflux carrier com...    201   1e-56    
gb|KFK25746.1|  hypothetical protein AALP_AA8G154200                    199   1e-55    
ref|XP_006853068.1|  hypothetical protein AMTR_s00038p00079560          200   1e-55    
ref|XP_001765763.1|  PIND AtPIN5-like auxin efflux carrier              193   2e-53    
ref|XP_006661411.1|  PREDICTED: probable auxin efflux carrier com...    187   1e-52    
ref|XP_006646411.1|  PREDICTED: probable auxin efflux carrier com...    191   4e-52    
ref|XP_010906423.1|  PREDICTED: auxin efflux carrier component 7-...    188   6e-52    
ref|NP_001267522.1|  uncharacterized protein LOC100781239               192   6e-52    
ref|XP_010268329.1|  PREDICTED: auxin efflux carrier component 1-...    192   2e-51    
ref|XP_007138429.1|  hypothetical protein PHAVU_009G208200g             191   2e-51    
gb|AIF28453.1|  PIN-like protein                                        182   3e-51    
ref|XP_010268328.1|  PREDICTED: probable auxin efflux carrier com...    192   3e-51    
gb|AIF28448.1|  PIN-like protein                                        181   4e-51    
ref|XP_003535060.1|  PREDICTED: auxin efflux carrier component 2-...    189   7e-51    
emb|CDY63766.1|  BnaCnng42600D                                          184   8e-51    
gb|AIF28444.1|  PIN-like protein                                        184   1e-50    
gb|AIF28311.1|  PIN-like protein                                        179   1e-48    
gb|AIF28406.1|  PIN-like protein                                        179   1e-48    
gb|AIF28403.1|  PIN-like protein                                        174   2e-48    
ref|XP_007034342.1|  Auxin efflux carrier family protein isoform 1      182   2e-48    
emb|CBI15569.3|  unnamed protein product                                177   2e-48    
gb|KHN15228.1|  Putative auxin efflux carrier component 1b              182   3e-48    
dbj|BAD93921.1|  auxin transporter splice variant b                     173   8e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033744.1|  PREDICTED: auxin efflux carrier component 1-...    183   8e-48    
gb|AIF28428.1|  PIN-like protein                                        173   2e-47    
gb|KHN17646.1|  Auxin efflux carrier component 2                        182   2e-47    
ref|XP_006600116.1|  PREDICTED: auxin efflux carrier protein 4 is...    182   2e-47    
ref|NP_001234170.1|  auxin efflux facilitator SlPIN2                    182   2e-47    
emb|CBI17877.3|  unnamed protein product                                179   3e-47    
gb|KHN22650.1|  Auxin efflux carrier component 2                        182   3e-47    
ref|XP_006593364.1|  PREDICTED: auxin efflux carrier protein 3 is...    182   3e-47    
gb|AIF28294.1|  PIN-like protein                                        172   4e-47    
gb|AIF28357.1|  PIN-like protein                                        174   4e-47    
gb|AIF28272.1|  PIN-like protein                                        179   4e-47    
ref|XP_008441865.1|  PREDICTED: putative auxin efflux carrier com...    169   4e-47    
gb|AHN96182.1|  PIN-formed protein 1                                    181   4e-47    
gb|AIF28409.1|  PIN-like protein                                        181   5e-47    
ref|XP_006366195.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    181   5e-47    
ref|XP_007154690.1|  hypothetical protein PHAVU_003G139600g             181   5e-47    
gb|AIF28416.1|  PIN-like protein                                        181   6e-47    
gb|AIF28472.1|  PIN-like protein                                        181   7e-47    
dbj|BAO49653.1|  putative auxin efflux carrier protein                  180   1e-46    
gb|EMS62769.1|  putative auxin efflux carrier component 1c              175   1e-46    
gb|AIF28413.1|  PIN-like protein                                        180   1e-46    
ref|XP_010650417.1|  PREDICTED: auxin efflux carrier component 3        177   1e-46    
gb|AIF28386.1|  PIN-like protein                                        180   1e-46    
emb|CDO98348.1|  unnamed protein product                                179   2e-46    
gb|AIF28390.1|  PIN-like protein                                        180   2e-46    
gb|AIF28300.1|  PIN-like protein                                        173   2e-46    
ref|XP_011069941.1|  PREDICTED: auxin efflux carrier component 2        179   2e-46    
gb|AIF28391.1|  PIN-like protein                                        179   2e-46    
gb|AIF28348.1|  PIN-like protein                                        168   3e-46    
ref|XP_007161379.1|  hypothetical protein PHAVU_001G0639000g            169   3e-46    
ref|XP_002527704.1|  Auxin efflux carrier component, putative           179   3e-46    
gb|AIF28293.1|  PIN-like protein                                        170   3e-46    
gb|KDO63827.1|  hypothetical protein CISIN_1g007420mg                   177   3e-46    
gb|KDP46642.1|  hypothetical protein JCGZ_13598                         179   3e-46    
ref|XP_002266059.1|  PREDICTED: auxin efflux carrier component 2        179   4e-46    
gb|AIF28443.1|  PIN-like protein                                        176   4e-46    
gb|AIF28473.1|  PIN-like protein                                        179   4e-46    
gb|AIF28393.1|  PIN-like protein                                        178   4e-46    
gb|ABQ95663.1|  auxin efflux carrier                                    176   5e-46    
gb|AIF28304.1|  PIN-like protein                                        178   5e-46    
gb|ABQ95664.1|  auxin efflux carrier                                    176   5e-46    
ref|XP_007036846.1|  Auxin efflux facilitator isoform 1                 178   5e-46    
gb|AIF28270.1|  PIN-like protein                                        176   5e-46    
gb|AIF28398.1|  PIN-like protein                                        178   6e-46    
gb|AHN96184.1|  PIN-formed protein 1                                    178   6e-46    
gb|KCW78612.1|  hypothetical protein EUGRSUZ_C00078                     178   6e-46    
gb|AHN96183.1|  PIN-formed protein 1                                    177   7e-46    
ref|XP_009763716.1|  PREDICTED: auxin efflux carrier component 2        178   7e-46    
ref|XP_010046903.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    178   7e-46    
ref|XP_007014497.1|  Auxin efflux carrier family protein                178   7e-46    
ref|XP_009610818.1|  PREDICTED: auxin efflux carrier component 2        178   8e-46    
ref|XP_004965062.1|  PREDICTED: probable auxin efflux carrier com...    177   8e-46    
ref|XP_009407784.1|  PREDICTED: probable auxin efflux carrier com...    177   9e-46    
ref|XP_010246122.1|  PREDICTED: auxin efflux carrier component 2-...    177   9e-46    
gb|AIF28315.1|  PIN-like protein                                        174   1e-45    
ref|XP_011039131.1|  PREDICTED: probable auxin efflux carrier com...    177   1e-45    
gb|AIF28373.1|  PIN-like protein                                        177   1e-45    
ref|XP_006490772.1|  PREDICTED: probable auxin efflux carrier com...    177   1e-45    
ref|XP_006663800.1|  PREDICTED: probable auxin efflux carrier com...    176   1e-45    
ref|XP_011084207.1|  PREDICTED: probable auxin efflux carrier com...    177   1e-45    
gb|AIF28423.1|  PIN-like protein                                        177   1e-45    
gb|AIF28476.1|  PIN-like protein                                        167   1e-45    
gb|AIF28387.1|  PIN-like protein                                        177   1e-45    
ref|XP_002317874.1|  auxin efflux carrier component 1 family protein    177   1e-45    
ref|XP_008453545.1|  PREDICTED: auxin efflux carrier component 2        177   2e-45    
ref|XP_010927284.1|  PREDICTED: probable auxin efflux carrier com...    174   2e-45    
gb|AIF28410.1|  PIN-like protein                                        177   2e-45    
ref|XP_009419111.1|  PREDICTED: probable auxin efflux carrier com...    177   2e-45    
gb|AIF28438.1|  PIN-like protein                                        173   2e-45    
emb|CDP03009.1|  unnamed protein product                                176   2e-45    
ref|XP_008374845.1|  PREDICTED: probable auxin efflux carrier com...    176   2e-45    
ref|XP_002282220.1|  PREDICTED: probable auxin efflux carrier com...    176   3e-45    
ref|XP_004167314.1|  PREDICTED: auxin efflux carrier component 2-...    176   3e-45    
ref|XP_010274646.1|  PREDICTED: auxin efflux carrier component 4-...    176   3e-45    
gb|AIF28400.1|  PIN-like protein                                        176   3e-45    
emb|CBI26909.3|  unnamed protein product                                169   3e-45    
ref|XP_002981763.1|  hypothetical protein SELMODRAFT_451571             176   3e-45    
gb|EYU37304.1|  hypothetical protein MIMGU_mgv1a002534mg                176   3e-45    
ref|XP_007160541.1|  hypothetical protein PHAVU_002G330300g             176   3e-45    
ref|XP_010483205.1|  PREDICTED: auxin efflux carrier component 2-...    175   3e-45    
ref|XP_006290757.1|  hypothetical protein CARUB_v10016856mg             176   4e-45    
ref|XP_010527774.1|  PREDICTED: auxin efflux carrier component 4-...    176   4e-45    
gb|ABQ95658.1|  auxin efflux carrier                                    174   4e-45    
ref|XP_010451788.1|  PREDICTED: auxin efflux carrier component 2-...    175   4e-45    
emb|CDY40380.1|  BnaA02g26940D                                          175   4e-45    
dbj|BAJ97950.1|  predicted protein                                      175   4e-45    
ref|XP_010554422.1|  PREDICTED: auxin efflux carrier component 4-...    176   5e-45    
ref|NP_001234163.1|  auxin efflux facilitator SlPIN1                    175   5e-45    
ref|XP_006398529.1|  hypothetical protein EUTSA_v10000822mg             175   5e-45    
gb|AIF28289.1|  PIN-like protein                                        176   5e-45    
gb|AIF28485.1|  PIN-like protein                                        167   6e-45    
ref|XP_009614860.1|  PREDICTED: probable auxin efflux carrier com...    175   6e-45    
gb|ABQ95659.1|  auxin efflux carrier                                    173   6e-45    
ref|XP_009129244.1|  PREDICTED: auxin efflux carrier component 4        175   6e-45    
ref|XP_010913714.1|  PREDICTED: probable auxin efflux carrier com...    175   7e-45    
ref|XP_009400551.1|  PREDICTED: probable auxin efflux carrier com...    175   8e-45    
ref|XP_006430537.1|  hypothetical protein CICLE_v10012938mg             164   8e-45    
ref|XP_011017712.1|  PREDICTED: auxin efflux carrier component 2        175   8e-45    
ref|XP_006280155.1|  hypothetical protein CARUB_v10026053mg             175   8e-45    
emb|CDX68327.1|  BnaA07g23670D                                          173   9e-45    
ref|NP_568848.1|  auxin efflux carrier component 2                      175   9e-45    
ref|XP_011000408.1|  PREDICTED: probable auxin efflux carrier com...    174   9e-45    
ref|XP_010451791.1|  PREDICTED: auxin efflux carrier component 2-...    175   9e-45    
ref|XP_009126903.1|  PREDICTED: auxin efflux carrier component 2        175   1e-44    
ref|XP_010443377.1|  PREDICTED: auxin efflux carrier component 2 ...    175   1e-44    
ref|XP_009783366.1|  PREDICTED: probable auxin efflux carrier com...    174   1e-44    
gb|AIF28483.1|  PIN-like protein                                        164   1e-44    
emb|CDY20694.1|  BnaA02g08340D                                          174   1e-44    
ref|XP_010483204.1|  PREDICTED: auxin efflux carrier component 2-...    174   1e-44    
gb|KDP23925.1|  hypothetical protein JCGZ_27085                         174   1e-44    
ref|XP_009104930.1|  PREDICTED: auxin efflux carrier component 3        174   1e-44    
ref|XP_002864498.1|  hypothetical protein ARALYDRAFT_918870             174   1e-44    
ref|XP_006341527.1|  PREDICTED: auxin efflux carrier component 1-...    174   1e-44    
emb|CDY23471.1|  BnaC06g24400D                                          172   1e-44    
ref|XP_008393426.1|  PREDICTED: probable auxin efflux carrier com...    174   1e-44    
ref|XP_002526018.1|  Auxin efflux carrier component, putative           174   1e-44    
ref|NP_001066091.1|  Os12g0133800                                       168   1e-44    
ref|XP_010552711.1|  PREDICTED: auxin efflux carrier component 3        174   1e-44    
gb|AIN44211.1|  PIN1                                                    174   1e-44    
ref|XP_002324677.2|  auxin efflux carrier component 2 family protein    174   1e-44    
ref|XP_008781803.1|  PREDICTED: probable auxin efflux carrier com...    174   1e-44    
gb|AIF28268.1|  PIN-like protein                                        173   1e-44    
gb|AIF28256.1|  PIN-like protein                                        174   1e-44    
ref|NP_001058268.1|  Os06g0660200                                       174   1e-44    
gb|AIF28277.1|  PIN-like protein                                        174   1e-44    
ref|XP_006401246.1|  hypothetical protein EUTSA_v10012929mg             174   1e-44    
ref|XP_006386327.1|  hypothetical protein POPTR_0002s07300g             164   1e-44    
ref|XP_006474301.1|  PREDICTED: auxin efflux carrier component 2-...    174   1e-44    
ref|XP_009415659.1|  PREDICTED: probable auxin efflux carrier com...    173   1e-44    
ref|XP_006656324.1|  PREDICTED: probable auxin efflux carrier com...    174   2e-44    
ref|XP_010246173.1|  PREDICTED: probable auxin efflux carrier com...    174   2e-44    
gb|KDO61974.1|  hypothetical protein CISIN_1g036474mg                   174   2e-44    
ref|XP_009414067.1|  PREDICTED: probable auxin efflux carrier com...    174   2e-44    
gb|KHN11028.1|  Putative auxin efflux carrier component 6               164   2e-44    
ref|XP_010036951.1|  PREDICTED: auxin efflux carrier component 1-...    174   2e-44    
ref|XP_010260501.1|  PREDICTED: auxin efflux carrier component 4-...    174   2e-44    
ref|XP_010246171.1|  PREDICTED: probable auxin efflux carrier com...    173   2e-44    
ref|XP_004965663.1|  PREDICTED: probable auxin efflux carrier com...    174   2e-44    
gb|EYU24143.1|  hypothetical protein MIMGU_mgv1a003175mg                173   2e-44    
ref|NP_849923.1|  auxin efflux carrier component 4                      174   2e-44    
gb|AAM55299.1|  auxin efflux carrier protein                            174   2e-44    
gb|AIF28269.1|  PIN-like protein                                        173   2e-44    
gb|AAM54034.1|AF515435_1  PIN1-like auxin transport protein             173   2e-44    
gb|KHG30686.1|  Auxin efflux carrier component 1 -like protein          171   2e-44    
gb|AIF28291.1|  PIN-like protein                                        174   2e-44    
gb|KFK33369.1|  hypothetical protein AALP_AA5G004800                    173   2e-44    
gb|KFK33370.1|  hypothetical protein AALP_AA5G004800                    173   2e-44    
ref|XP_008464398.1|  PREDICTED: probable auxin efflux carrier com...    173   2e-44    
ref|NP_001275530.1|  auxin efflux carrier component 1-like              173   2e-44    
dbj|BAJ97662.1|  predicted protein                                      173   2e-44    
gb|AIF28466.1|  PIN-like protein                                        174   2e-44    
emb|CDY38263.1|  BnaA10g11110D                                          173   3e-44    
ref|XP_002322614.1|  putative auxin efflux carrier protein 10           173   3e-44    
ref|XP_010695799.1|  PREDICTED: auxin efflux carrier component 2        174   3e-44    
ref|XP_002876748.1|  pin-formed 4                                       173   3e-44    
ref|XP_009120227.1|  PREDICTED: auxin efflux carrier component 2-...    173   3e-44    
ref|XP_004299530.1|  PREDICTED: auxin efflux carrier component 1-...    173   3e-44    
gb|AAQ14256.1|AF246995_1  AEC1                                          173   3e-44    
ref|NP_565261.1|  auxin efflux carrier component 4                      173   3e-44    
gb|AAQ14257.1|AF247004_1  auxin efflux carrier                          173   3e-44    
emb|CAC24691.1|  efflux carrier of polar auxin transport                173   3e-44    
ref|XP_011072996.1|  PREDICTED: auxin efflux carrier component 1-...    172   3e-44    
gb|AIF28342.1|  PIN-like protein                                        169   3e-44    
gb|AIF28362.1|  PIN-like protein                                        173   3e-44    
gb|ACH91863.1|  PIN-FORMED1                                             173   3e-44    
ref|XP_011006097.1|  PREDICTED: auxin efflux carrier component 3-...    171   4e-44    
ref|XP_003563339.1|  PREDICTED: probable auxin efflux carrier com...    173   4e-44    
ref|XP_010431512.1|  PREDICTED: auxin efflux carrier component 1-...    171   4e-44    
gb|AGY29597.1|  auxin efflux carrier                                    172   4e-44    
ref|XP_009360078.1|  PREDICTED: probable auxin efflux carrier com...    172   4e-44    
ref|XP_010471100.1|  PREDICTED: auxin efflux carrier component 3-...    170   4e-44    
ref|XP_006416127.1|  hypothetical protein EUTSA_v10007111mg             172   4e-44    
gb|AIF28440.1|  PIN-like protein                                        170   5e-44    
gb|AIF28309.1|  PIN-like protein                                        171   5e-44    
ref|NP_001152108.1|  LOC100285745                                       172   5e-44    
gb|AIF28535.1|  PIN-like protein                                        172   5e-44    
ref|XP_008453480.1|  PREDICTED: probable auxin efflux carrier com...    172   5e-44    
gb|AFW63651.1|  hypothetical protein ZEAMMB73_874569                    165   5e-44    
ref|XP_009380316.1|  PREDICTED: probable auxin efflux carrier com...    172   5e-44    
gb|AGG79244.1|  auxin efflux facilitator PIN1b                          172   5e-44    
gb|AIF28326.1|  PIN-like protein                                        172   6e-44    
gb|ACR35125.1|  unknown                                                 172   6e-44    
gb|AIF28262.1|  PIN-like protein                                        172   6e-44    
gb|ACH91613.2|  PIN-like auxin efflux carrier                           172   6e-44    
ref|XP_003564038.1|  PREDICTED: probable auxin efflux carrier com...    172   6e-44    
ref|XP_004507913.1|  PREDICTED: auxin efflux carrier component 2-...    172   6e-44    
ref|XP_007028296.1|  Auxin efflux carrier family protein isoform 2      172   6e-44    
emb|CAL51275.1|  auxin efflux carrier                                   171   6e-44    
ref|XP_008363929.1|  PREDICTED: auxin efflux carrier component 2        172   6e-44    
ref|XP_006390822.1|  hypothetical protein EUTSA_v10018257mg             172   6e-44    
emb|CDX88606.1|  BnaA03g10430D                                          172   6e-44    
ref|XP_007045125.1|  Auxin efflux facilitator isoform 2                 172   6e-44    
ref|XP_004505266.1|  PREDICTED: auxin efflux carrier component 3-...    172   6e-44    
ref|XP_007028295.1|  Auxin efflux carrier family protein isoform 1      172   7e-44    
ref|XP_011075451.1|  PREDICTED: probable auxin efflux carrier com...    171   7e-44    
ref|XP_010263760.1|  PREDICTED: probable auxin efflux carrier com...    172   7e-44    
gb|KFK44397.1|  hypothetical protein AALP_AA1G252100                    172   7e-44    
ref|XP_009132150.1|  PREDICTED: auxin efflux carrier component 2-...    172   7e-44    
ref|XP_006605368.1|  PREDICTED: uncharacterized protein LOC100802...    172   7e-44    
ref|NP_001267527.1|  uncharacterized protein LOC100802247               172   8e-44    
dbj|BAO49654.1|  putative auxin efflux carrier protein                  172   8e-44    
ref|XP_009350116.1|  PREDICTED: auxin efflux carrier component 2-...    172   8e-44    
ref|XP_006605369.1|  PREDICTED: uncharacterized protein LOC100802...    172   8e-44    
emb|CDY11886.1|  BnaC03g13120D                                          172   8e-44    
gb|EYU33972.1|  hypothetical protein MIMGU_mgv1a003655mg                171   8e-44    
ref|XP_007227619.1|  hypothetical protein PRUPE_ppa024134mg             172   8e-44    
emb|CAH60725.1|  putative plasma membrane intrinsic protein             167   9e-44    
ref|XP_003595119.1|  Auxin efflux carrier component                     162   9e-44    
gb|AFK46028.1|  unknown                                                 170   9e-44    
gb|AAM55297.1|  auxin efflux carrier protein                            172   9e-44    
gb|AIF28288.1|  PIN-like protein                                        172   9e-44    
ref|XP_008223846.1|  PREDICTED: auxin efflux carrier component 2-...    172   9e-44    
ref|XP_009359964.1|  PREDICTED: auxin efflux carrier component 2-...    172   9e-44    
gb|AAD16060.1|  root gravitropism control protein                       172   1e-43    
gb|AIF28385.1|  PIN-like protein                                        172   1e-43    
ref|XP_007157735.1|  hypothetical protein PHAVU_002G094000g             172   1e-43    
ref|XP_006848444.1|  hypothetical protein AMTR_s00013p00242590          168   1e-43    
gb|ABA95736.2|  Auxin efflux carrier component 3, putative, expre...    168   1e-43    
ref|XP_007157734.1|  hypothetical protein PHAVU_002G094000g             172   1e-43    
dbj|BAH47607.1|  auxin:hydrogen symporter/transporter                   171   1e-43    
ref|XP_009601533.1|  PREDICTED: auxin efflux carrier component 3-...    171   1e-43    
gb|KHN30345.1|  Auxin efflux carrier component 1                        171   1e-43    
ref|XP_009356039.1|  PREDICTED: probable auxin efflux carrier com...    171   1e-43    
emb|CDY12491.1|  BnaC07g13310D                                          171   1e-43    
ref|NP_001267492.1|  uncharacterized protein LOC100820506               171   1e-43    
emb|CDX96484.1|  BnaA07g30950D                                          171   1e-43    
ref|XP_010246119.1|  PREDICTED: auxin efflux carrier component 2-...    171   1e-43    
gb|AIF28358.1|  PIN-like protein                                        168   1e-43    
ref|XP_009391391.1|  PREDICTED: probable auxin efflux carrier com...    171   1e-43    
emb|CDY63826.1|  BnaC02g47640D                                          171   1e-43    
ref|XP_002436761.1|  hypothetical protein SORBIDRAFT_10g008290          171   1e-43    
ref|XP_009761336.1|  PREDICTED: auxin efflux carrier component 3-...    171   1e-43    
gb|AIF28253.1|  PIN-like protein                                        171   1e-43    
gb|KFK27268.1|  hypothetical protein AALP_AA8G359900                    171   1e-43    
ref|XP_002307966.1|  putative auxin efflux carrier protein 10           171   1e-43    
ref|XP_010271843.1|  PREDICTED: probable auxin efflux carrier com...    171   1e-43    
gb|AIF28274.1|  PIN-like protein                                        171   1e-43    
ref|XP_004160415.1|  PREDICTED: auxin efflux carrier component 1-...    171   1e-43    
gb|AIF28332.1|  PIN-like protein                                        166   1e-43    
ref|XP_004137343.1|  PREDICTED: auxin efflux carrier component 1-...    171   1e-43    
gb|AIF28381.1|  PIN-like protein                                        171   1e-43    
emb|CDY25767.1|  BnaA07g10150D                                          171   2e-43    
ref|XP_002990501.1|  hypothetical protein SELMODRAFT_131936             171   2e-43    
gb|AGJ95053.1|  PIN1a                                                   171   2e-43    



>ref|NP_001234192.1| auxin efflux facilitator SlPIN5 [Solanum lycopersicum]
 gb|ADR30412.1| auxin efflux facilitator SlPIN5 [Solanum lycopersicum]
Length=358

 Score =   435 bits (1119),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 291/368 (79%), Gaps = 14/368 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW+++YKVVV M PLYVAL LGY SV+ WHMFKP+QCD INRFNCFF++PFFNFQF+A
Sbjct  1     MIGWDDIYKVVVGMMPLYVALILGYGSVKWWHMFKPEQCDTINRFNCFFILPFFNFQFIA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              INPY+LNY FLS D +AK LVI  L  WANF KKGS    +T FSLSTL NTL+VGVPL
Sbjct  61    KINPYNLNYLFLSGDVIAKALVILILVLWANFYKKGSFCWGITTFSLSTLNNTLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYGDLG DLVVQAAVIQ L+W T LLFAL+FW  +T  T +S +       D++ +S
Sbjct  121   MKAMYGDLGVDLVVQAAVIQALLWLTSLLFALEFW--KTKMTNNSNLI-----DDNNNNS  173

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             +++ G++ + N    N  + + A         LM  V + LA+NPNSYACFLGLFWAL+A
Sbjct  174   LEL-GNISSTNTQMRNINNIELAFWP------LMKAVSTKLAKNPNSYACFLGLFWALVA  226

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SRW  ++PSIIEGSI+IMSKAGSGV+MFSMGLF+AL+  I+ CGA++T  +M+LRFIVGP
Sbjct  227   SRWHFEMPSIIEGSILIMSKAGSGVSMFSMGLFMALRGKIIACGAALTIYSMILRFIVGP  286

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             AT  +GC+VLGLRG+VLR+++IQAALPQ++ SFVYA+EYGLHAD+LSTAV +GT++S+PL
Sbjct  287   ATMALGCVVLGLRGNVLRVAIIQAALPQAVTSFVYAQEYGLHADVLSTAVIVGTIISLPL  346

Query  1132  LITYYVIL  1155
             LI YY +L
Sbjct  347   LIAYYAVL  354



>ref|XP_006345358.1| PREDICTED: putative auxin efflux carrier component 8-like [Solanum 
tuberosum]
Length=355

 Score =   432 bits (1110),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 283/368 (77%), Gaps = 17/368 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW+++YKVVV M PLYVAL LGY SV+ WHMFKP+QCD INRFNCFF++PFFNFQF+A
Sbjct  1     MIGWDDIYKVVVGMMPLYVALILGYGSVKWWHMFKPEQCDTINRFNCFFILPFFNFQFIA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             +INPY+LNY FL+ D +AK LVI  L  WANF +KGS S  +T FSLSTL NTL+VGVPL
Sbjct  61    NINPYNLNYLFLTGDVIAKALVILILVLWANFYRKGSFSWGITTFSLSTLNNTLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYGDLG DLVVQAAVIQ L+W T LLFAL+FW T+ +   +           +  ++
Sbjct  121   MKAMYGDLGVDLVVQAAVIQALLWLTSLLFALEFWKTKMNNNINGIANNNSVELGNINTT  180

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              QM      N NN               +   LM  V + LA+NPNSYACFLGLFWAL+A
Sbjct  181   TQMR-----NINNA------------ELAFWPLMKAVSTKLAKNPNSYACFLGLFWALVA  223

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SRW  ++PSIIEGSI+IMSKAGSGVAMFSMGLF+ALQ  I+ CGA++T  AM+LRF+VGP
Sbjct  224   SRWHFRMPSIIEGSILIMSKAGSGVAMFSMGLFMALQGKIIACGAALTIYAMILRFVVGP  283

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             AT  +GC+VLGLRG+VLRI++IQAALPQ++ SFVYA+EYGLHAD+LSTAV +GT++S+PL
Sbjct  284   ATMALGCVVLGLRGNVLRIAIIQAALPQAVTSFVYAQEYGLHADVLSTAVIVGTIISLPL  343

Query  1132  LITYYVIL  1155
             LI YY IL
Sbjct  344   LIAYYAIL  351



>ref|XP_009587078.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
tomentosiformis]
Length=367

 Score =   425 bits (1092),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 225/377 (60%), Positives = 292/377 (77%), Gaps = 15/377 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE++YKVV AM PLYVAL LGY SV+ WHMFK +QCDAINRFNCFF++PFFNF+F+A
Sbjct  1     MIGWEDIYKVVTAMVPLYVALILGYGSVKWWHMFKSEQCDAINRFNCFFILPFFNFEFIA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             + +PY++N  FL+ D ++K L+I  L  WANF KKG+ S S+T FSLSTL NTL+VGVPL
Sbjct  61    NFDPYNVNGLFLTGDVISKVLLIVILVLWANFYKKGNFSWSITTFSLSTLNNTLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG LG D+V+QAAVIQ L+W T LLFAL+FW T+ + + S+ V        S+G+S
Sbjct  121   MKAMYGKLGVDIVIQAAVIQALLWLTSLLFALEFWKTKMNNSDSNGVINGA----SNGNS  176

Query  592   VQMAG--DVEANNNNET---NTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLF  756
             V++    D+E NN + T   N  ++  A      V+S+       LA+NPNSYACFLGL 
Sbjct  177   VELGSISDLEGNNTSVTPVRNNTNNGLAFRPLIKVVSI------KLAKNPNSYACFLGLI  230

Query  757   WALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLR  936
             WALLA+RW+ ++PSIIEG I+IMSKAGSGVAMFSMGLF+ALQ  I+ CG ++T  AM+LR
Sbjct  231   WALLANRWNFEMPSIIEGPILIMSKAGSGVAMFSMGLFMALQGKIIACGTALTIYAMILR  290

Query  937   FIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTL  1116
             F+VGPAT   GC+VLGL G+VLR+++IQ+ALPQ++ SFVYA+EYGLHAD+LSTAV +GT+
Sbjct  291   FVVGPATMAFGCVVLGLHGNVLRVAIIQSALPQAVTSFVYAQEYGLHADVLSTAVIVGTI  350

Query  1117  VSVPLLITYYVILGFLH  1167
             +S+PLLI YY +L  +H
Sbjct  351   ISLPLLIAYYAVLDIMH  367



>ref|XP_009804213.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
sylvestris]
Length=345

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 222/372 (60%), Positives = 284/372 (76%), Gaps = 27/372 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI WE++YKVV AM PLYVAL LGY SV+ WHMFK +QCDAINRFNCFF+IPFFNF+F+A
Sbjct  1     MIEWEDIYKVVAAMTPLYVALILGYGSVKWWHMFKSEQCDAINRFNCFFIIPFFNFEFIA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             + +PY++N  FL+ D ++K L+I  L  WANF KKG+ S S+T FSLSTL NTL+VGVPL
Sbjct  61    NFDPYNVNGLFLTGDVISKALLIVILVLWANFYKKGNFSWSITTFSLSTLNNTLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG LG DLV+QAAVIQ L+W T LLFAL+FW T+                +S+G+S
Sbjct  121   MKAMYGKLGVDLVIQAAVIQALLWLTSLLFALEFWKTKM---------------NSNGNS  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V+++ D+E NN    N            +   L+  V   LA+NPNSYACFLGL WALLA
Sbjct  166   VELS-DLEGNNTPVRNM-----------AFGPLIKAVSIKLAKNPNSYACFLGLVWALLA  213

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW+ ++PSIIEGS +IMSKAGSGVAMFSMGLF+ALQ  I+ CG ++T  AM+LRF+VGP
Sbjct  214   NRWNFEMPSIIEGSFLIMSKAGSGVAMFSMGLFMALQGKIIACGTALTIYAMILRFVVGP  273

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             AT  +GC+VLGL G+VLR+++IQ+ALPQ++ SFVYA+EYGLHAD+LSTAV +GT++S+PL
Sbjct  274   ATMALGCVVLGLHGNVLRVAIIQSALPQAITSFVYAQEYGLHADVLSTAVIVGTVISLPL  333

Query  1132  LITYYVILGFLH  1167
             LI YY +L  +H
Sbjct  334   LIAYYAVLDIMH  345



>emb|CDP11399.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 221/368 (60%), Positives = 275/368 (75%), Gaps = 10/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVV AM PL VALALGY SV+ WHMF PDQ DAINRFNCFF+IPFFNF+F++
Sbjct  1     MIGWEDVYKVVTAMTPLCVALALGYASVKWWHMFTPDQFDAINRFNCFFIIPFFNFKFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HINPY LNYPFL AD +AK +V+  L  W N T+KGS   S+TAFSL +L NTLIVGVPL
Sbjct  61    HINPYELNYPFLGADCIAKCIVLIVLVFWTNCTRKGSCMWSITAFSLCSLNNTLIVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG++G DLVVQ++VIQ+LVW  FLLF L+F   R    T S         ++    
Sbjct  121   LKAMYGEVGEDLVVQSSVIQSLVWVIFLLFMLEF--RREWSKTKS-------VTNTINGD  171

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             +Q+   +E  ++ + N+     ++ ++ S+ S++  V   LA+NPN YAC  GL WALLA
Sbjct  172   LQLQA-IECGSDLDQNSTPMSMSINKAPSIWSILKIVWLKLAKNPNFYACIAGLIWALLA  230

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SRW  ++P IIEGSI+IMSKAG+GV+MFSMGLF+ALQE ++ CG  +T   M LRF+V P
Sbjct  231   SRWQFKMPEIIEGSILIMSKAGAGVSMFSMGLFMALQERVIACGTPLTLFGMALRFVVSP  290

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             AT  IG +V GL G+VLRI+LIQAALPQS+ASFVYA+EYGLH DILSTAV  GT+VS+PL
Sbjct  291   ATMAIGSIVSGLHGNVLRIALIQAALPQSIASFVYAQEYGLHPDILSTAVIFGTIVSLPL  350

Query  1132  LITYYVIL  1155
             LI YY +L
Sbjct  351   LIAYYALL  358



>ref|XP_002279191.1| PREDICTED: putative auxin efflux carrier component 8 [Vitis vinifera]
 emb|CBI17652.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 206/372 (55%), Positives = 273/372 (73%), Gaps = 16/372 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVAM PLYVAL LGY SV+ W +F PDQCDAINR  C+F +P F F+F A
Sbjct  1     MIGWEDVYKVVVAMLPLYVALVLGYGSVKWWRIFTPDQCDAINRLVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY F+ ADAV+K +++  LA WA  + KGS   S+T+FSL+TLTN+L+VGVPL
Sbjct  61    HVDPFKMNYLFIGADAVSKLIIVLVLALWAKCSSKGSYCWSITSFSLATLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG LG DLVVQ++V+Q ++W T LLF L+F  T T  ++++ +  +G         
Sbjct  121   IKAMYGPLGVDLVVQSSVVQAIIWLTLLLFVLEFRRTGTGISSNTTMGDSGVI-------  173

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  +VE   + ETN    +  V+   S  SLM  V   LAQNPNSYAC +G+ WA +A
Sbjct  174   -----EVEPGKDLETN----EMVVSTRLSFWSLMRKVWLKLAQNPNSYACIIGIVWAFIA  224

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++PSI+EGSI+IMS+AG+G AMFSMGLF+A+QE I+ CG ++T   MVLRFI GP
Sbjct  225   NRWHFEMPSIMEGSILIMSRAGTGTAMFSMGLFMAMQEKIIACGTTLTVFGMVLRFIAGP  284

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLRI++IQAA+PQS+ SF+YAKEYGLHAD+LSTAV  G +VS+PL
Sbjct  285   AAMAIGAIAVGLHGDVLRIAIIQAAVPQSITSFIYAKEYGLHADVLSTAVIFGMIVSLPL  344

Query  1132  LITYYVILGFLH  1167
             L+ YY +L FL+
Sbjct  345   LVGYYAVLEFLN  356



>gb|AIF28449.1| PIN-like protein, partial [Euptelea pleiosperma]
Length=360

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 207/372 (56%), Positives = 267/372 (72%), Gaps = 12/372 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW+++YKVVVAM PLYVAL LGY SV+ WH+F P+QC AIN F C+F +P F F+F A
Sbjct  1     MIGWDDIYKVVVAMTPLYVALVLGYGSVKWWHIFTPEQCGAINSFVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NYPF+ ADA++K +++  LA WA  + KG    S+T+FSLSTLTN+L+VGVPL
Sbjct  61    HVDPFDMNYPFIGADAISKFIIVVVLAFWAKCSSKGXXXWSITSFSLSTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG    DLVVQA+V+Q ++W T LLF L+F  TR++ +  +  A      D+H  S
Sbjct  121   LKAMYGPNSVDLVVQASVVQGIIWLTILLFVLEFRKTRSNVSLMTTTA---TITDAHVVS  177

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V+   DV  N N    T           S  SLM  V   LA NPNSYA  +G+ WA ++
Sbjct  178   VEPTKDVVGNENVVHTT---------RPSFCSLMKIVWLKLALNPNSYASIIGITWAFIS  228

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  Q+PSI+EGSI+IMSKAG+G AMFSMGLF+A QE  + CG S+T   MVLRFI GP
Sbjct  229   NRWHFQMPSIMEGSILIMSKAGTGTAMFSMGLFMAQQEKFIACGPSLTIFGMVLRFIAGP  288

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IGC+ +GL GD LR+S+IQAALPQS+ SF+YAKEYGLHAD+LSTAV  G +VS+P+
Sbjct  289   AAMAIGCIAVGLHGDALRVSIIQAALPQSITSFIYAKEYGLHADVLSTAVIFGMIVSLPV  348

Query  1132  LITYYVILGFLH  1167
             LI YY +LGFL+
Sbjct  349   LIGYYAVLGFLN  360



>gb|KDP23297.1| hypothetical protein JCGZ_23130 [Jatropha curcas]
Length=350

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/372 (54%), Positives = 269/372 (72%), Gaps = 22/372 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVAM PLYVAL LGY SV+ W +F P+QC A+NR  C+F +P F F+F A
Sbjct  1     MIGWEDVYKVVVAMVPLYVALILGYGSVKWWKIFTPEQCGAVNRLVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +NY F+ ADA++K +++A LA WA F+ KGS + S+T+FSL TLTN+L+VGVPL
Sbjct  61    HIDPFKMNYLFMGADAISKLIIVAVLAFWAKFSSKGSYTWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             + AMYG +  DLVVQ++VIQ ++W T LLF L+F           R A    + +++GS 
Sbjct  121   IGAMYGQMAVDLVVQSSVIQAIIWLTILLFVLEF-----------RRANLDISSNTNGSD  169

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  D+E +N N  +            S  +LM  V   LA NPNSYAC +G+ WA +A
Sbjct  170   ---GKDLEGSNVNAIDNVRP--------SFWTLMRVVWIKLAMNPNSYACIIGIVWAFIA  218

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++PSI+EGS++IMSKAG+G AMFSMG+F+ALQE ++ CGA +T + M+LRFI GP
Sbjct  219   NRWHFEMPSIMEGSLLIMSKAGTGTAMFSMGIFMALQEKVISCGAGLTVIGMILRFIAGP  278

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GLRGDVLR+++IQAALPQS+ SF+YAKEYGLHA++LSTAV  G +VS+PL
Sbjct  279   AAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIYAKEYGLHAEVLSTAVIFGMIVSLPL  338

Query  1132  LITYYVILGFLH  1167
             LI YY IL F+H
Sbjct  339   LIAYYAILEFVH  350



>gb|EYU39430.1| hypothetical protein MIMGU_mgv1a007953mg [Erythranthe guttata]
Length=389

 Score =   392 bits (1006),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 274/392 (70%), Gaps = 31/392 (8%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKVV AM PLYVAL LGY SV+ W MFKPD CDAINRFNC+F+IPFF F+F A
Sbjct  1     MIAWGDIYKVVAAMVPLYVALVLGYGSVKWWRMFKPDHCDAINRFNCYFIIPFFTFRFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              ++PYH+N+ FL+ D +AK +V  ALA WAN  ++G LS +VT+FSLS+L NTL+VGVPL
Sbjct  61    GVDPYHMNFRFLAGDVIAKGVVGVALALWANLCREGKLSWAVTSFSLSSLNNTLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG LG DLVVQ++VIQ+L+WF  LLF L FW    +          G + D     
Sbjct  121   LKAMYGALGEDLVVQSSVIQSLLWFPTLLFMLDFWRINNNDAD-------GDSDDHQQQP  173

Query  592   VQMAGDVE--------ANNNNET-----NTYSDDSAVTESTSVLSL-----------MMP  699
              Q   +V+        AN NN T     N + D + V    S  S            +  
Sbjct  174   GQTTHEVQLCSIEITDANYNNTTTSTSANKHEDANGVNTRISSSSSSSSSSNNFRITIKK  233

Query  700   VLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIAL  879
             VL+ LA+NPN YAC +GL WALLA RWDL++PS++EGSI+IM+KAGSGVAMFSMGLF+AL
Sbjct  234   VLAKLAKNPNLYACAIGLIWALLAKRWDLEMPSVVEGSILIMAKAGSGVAMFSMGLFMAL  293

Query  880   QENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYA  1059
             QE ++ CG  +T   MVLRFI GP TTL+GCL LG+R   L I++IQAALPQ++ SFV+A
Sbjct  294   QEKMIACGVRLTVYGMVLRFIGGPVTTLVGCLALGIRSRTLHIAIIQAALPQAITSFVFA  353

Query  1060  KEYGLHADILSTAVTIGTLVSVPLLITYYVIL  1155
             +EYGLHA +LSTAV  GT+VS+PLLI+YYV L
Sbjct  354   QEYGLHATVLSTAVIFGTIVSLPLLISYYVAL  385



>ref|XP_009603485.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
tomentosiformis]
Length=361

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/380 (54%), Positives = 267/380 (70%), Gaps = 27/380 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVAMAPLYVAL LGY SV+ W +F  DQCDAIN+  C+F +P F F+F A
Sbjct  1     MIGWEDVYKVVVAMAPLYVALILGYASVKWWRIFTADQCDAINQLVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY FL ADA++K +++A LA WA  ++KGS   S+T+FSLS LTN+L+VGVPL
Sbjct  61    HVDPFDMNYKFLGADAISKAIIVAVLAFWAKCSRKGSYRWSITSFSLSALTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG+    LVVQ++V Q +VW T LLF L+   TRT  ++ S V             
Sbjct  121   MKAMYGEEAVHLVVQSSVTQAIVWLTVLLFVLEVRRTRTDFSSDSAV-------------  167

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMP--------VLSNLAQNPNSYACFL  747
                 GDV  NNNN  +    D        V S+  P        V   LA NPNSYAC  
Sbjct  168   ----GDV--NNNNIVSENGKDLEGNNRKVVTSITRPSFWCLTKTVWLKLATNPNSYACIF  221

Query  748   GLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAM  927
             GL WAL+++RW  Q+PSI+EGSI+IMS+AG+G AMFSMG+F+ALQE ++ CGAS+T   M
Sbjct  222   GLTWALISNRWHFQMPSIMEGSILIMSRAGTGTAMFSMGMFVALQEKVIACGASLTVFGM  281

Query  928   VLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTI  1107
             VLRFI GPA   I  +++GL G+VLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  
Sbjct  282   VLRFIAGPAAMAIASILIGLHGNVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIF  341

Query  1108  GTLVSVPLLITYYVILGFLH  1167
             G LVS+P+L+ Y+ IL FLH
Sbjct  342   GMLVSLPVLVGYFAILEFLH  361



>ref|XP_009338007.1| PREDICTED: putative auxin efflux carrier component 8 [Pyrus x 
bretschneideri]
Length=359

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 207/372 (56%), Positives = 267/372 (72%), Gaps = 13/372 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVA  PLYVAL LGY SVR WH+F  +QC AINRF CFF +P F F+F A
Sbjct  1     MIGWEDVYKVVVATVPLYVALILGYGSVRWWHIFTTEQCGAINRFVCFFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++PY  NY F+ AD ++K +++  LA WA  + KGS S S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPYKWNYRFIGADFISKLIIVVVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG    DLVVQA+V+Q +VW T LLF L+F  T +    SSR         + G+ 
Sbjct  121   IKAMYGSSSVDLVVQASVVQAIVWLTILLFVLEFRRTGSIDIVSSR--------TNVGTR  172

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             VQ    V+   N+      ++  ++   S   LM  V   L  NPNSYA F+G+ WAL+A
Sbjct  173   VQ---SVDPQGNDVEAM--EEITISTGPSFWYLMKAVWVKLGMNPNSYAVFIGIAWALIA  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SRW ++LPSI+EGS++IMSKAG+G AMFSMG+F+ALQE  V CG S+T + MVLRFI GP
Sbjct  228   SRWHIELPSIMEGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIAGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAA+PQS+ SF+YAKEYGLHA++LSTAV  G LVS+P+
Sbjct  288   AAMAIGSIAVGLHGDVLRVAIIQAAVPQSITSFIYAKEYGLHAEVLSTAVIFGMLVSLPV  347

Query  1132  LITYYVILGFLH  1167
             LI YY +LGF+H
Sbjct  348   LIAYYAVLGFVH  359



>ref|XP_011077192.1| PREDICTED: putative auxin efflux carrier component 8 [Sesamum 
indicum]
Length=417

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 218/417 (52%), Positives = 283/417 (68%), Gaps = 45/417 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV  MAPLYVALALGY SV+ W MFKPDQCDAINRFNC+F+IPFF F F A
Sbjct  1     MIGWGDVYKVVACMAPLYVALALGYGSVKWWRMFKPDQCDAINRFNCYFIIPFFTFHFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              ++PYH+NY FL+AD +AK +  + LA WAN  +KG LS ++T+FSLS+L NTL+VGVPL
Sbjct  61    GVDPYHMNYRFLAADVIAKAIAGSVLALWANLCRKGDLSWAITSFSLSSLNNTLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRT---------------------  528
             L AMYG +G DLVVQ++V+Q+L+WF  LLF LQFW T                       
Sbjct  121   LEAMYGPVGQDLVVQSSVLQSLLWFPILLFLLQFWRTSRLIYNNAAAAAANTNNSTNTSI  180

Query  529   ---HPTTSSR-------VAGAGAARDSHGSS----VQMAGDVEANNNNET---------N  639
                 PT++         V   GA  D+   S    +Q     + N N+ T          
Sbjct  181   HNYGPTSTQNCSNIEIVVQQQGATPDATNYSDHQLLQQVPPKDPNYNSNTPPAPVINVIG  240

Query  640   TYSDDSAVTESTSVLS-LMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSI  816
             T + +S  + S++ L   M  V + L +NPN YAC +GL WALLA RWD ++PSI++GS+
Sbjct  241   TTTKESGKSASSNNLGPTMKKVCAKLGKNPNCYACAIGLIWALLAKRWDFEMPSIVDGSV  300

Query  817   VIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGD  996
             +IM+KAGSGVAMF+MGLF+ALQE ++ CG  +T   M LRF+ GP T  +G L LGLR +
Sbjct  301   MIMAKAGSGVAMFTMGLFMALQEKVIACGVRLTVYGMFLRFVSGPLTVAVGSLALGLRSN  360

Query  997   VLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGFLH  1167
             VLRI++IQAALPQ++ASFV+A+EYGLHA++LSTAV  GT++S+PLLI YYV+L  +H
Sbjct  361   VLRIAVIQAALPQAIASFVFAQEYGLHANVLSTAVIFGTIISLPLLIAYYVVLDVVH  417



>ref|XP_004302153.1| PREDICTED: putative auxin efflux carrier component 8-like [Fragaria 
vesca subsp. vesca]
Length=357

 Score =   389 bits (998),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 207/374 (55%), Positives = 270/374 (72%), Gaps = 19/374 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVAM PLY AL LG+ SVR W +F P+QC AINRF CFF +P F F+F A
Sbjct  1     MIGWEDVYKVVVAMVPLYFALILGFGSVRWWGIFTPEQCGAINRFVCFFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+  NY F++ADA++K +++  LA WA  + KGS S S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFEWNYRFIAADAISKLIIVVVLAFWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG +  DLVVQ++V+Q ++W T LLF L+F   RT    SS         D+   S
Sbjct  121   MKAMYGPMAVDLVVQSSVVQAIIWLTVLLFVLEF--RRTGLDISSN--------DTRVQS  170

Query  592   VQMAG--DVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
             V++ G  DVE  N +         A + S    SL+  V   L  NPNSYA F+G+ WA 
Sbjct  171   VELQGVKDVEGLNQSTV-------ANSPSYYYWSLLKGVWLKLGMNPNSYAVFIGIAWAF  223

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +A+RW ++LPSI+EGS++IMSKAG+G AMFSMG+F+ALQE  V CG S+T + MVLRFI 
Sbjct  224   IANRWHIELPSIMEGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIA  283

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   IGC+ +GL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+
Sbjct  284   GPAAMAIGCIAVGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSL  343

Query  1126  PLLITYYVILGFLH  1167
             P+LI YY +L F+H
Sbjct  344   PVLIGYYAVLEFVH  357



>ref|XP_002512623.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50075.1| conserved hypothetical protein [Ricinus communis]
Length=357

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/373 (52%), Positives = 273/373 (73%), Gaps = 17/373 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKV+VAM PLYVAL LGY S+R W +F P+Q  A+NR  C+F +P F F+F A
Sbjct  1     MIGWEDVYKVIVAMVPLYVALLLGYGSIRWWKIFTPEQGGAVNRLVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY F+ ADA++K +++  LA WA F+ KGS + S+T+FSLSTLTN+L+VGVPL
Sbjct  61    HVDPFKMNYLFIGADAISKFIIVVVLACWAKFSSKGSYTWSITSFSLSTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG +  DLVVQ++V+Q ++W T LLF L+F  TR   ++S          + + +S
Sbjct  121   MKAMYGPMAVDLVVQSSVVQAIIWLTILLFVLEFRRTRLDISSS----------NYNKNS  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLS-NLAQNPNSYACFLGLFWALL  768
               +  D+E + +      + + A++ S     ++M V+   LA NPNSYAC LGL WA +
Sbjct  171   DNLEKDLEGSGS------AGNMAISSSGPSFWVLMKVVGVKLAMNPNSYACILGLVWAFI  224

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             A+RW  ++PSI+EGSI+IMSKAG+G AMFSMG+F+A+QE ++ CGA +T + M+LRFI G
Sbjct  225   ANRWHFEMPSIMEGSILIMSKAGTGTAMFSMGIFMAVQEKVIACGAGLTVVGMILRFIAG  284

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   IG + +GL GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  G +VS+P
Sbjct  285   PAAMAIGSIAVGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMIVSLP  344

Query  1129  LLITYYVILGFLH  1167
             +LI YY IL F H
Sbjct  345   VLIAYYAILEFAH  357



>ref|XP_008370812.1| PREDICTED: putative auxin efflux carrier component 8 [Malus domestica]
Length=359

 Score =   386 bits (991),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 207/373 (55%), Positives = 264/373 (71%), Gaps = 15/373 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVV A  PLYVAL LGY SVR WH+F P+QC AINRF CFF +P F F+F A
Sbjct  1     MIGWEDVYKVVAAXVPLYVALILGYGSVRWWHIFTPEQCGAINRFVCFFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++PY  NY F+ AD ++K +++  LA WA  + KGS S S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPYKWNYRFIGADFISKLIIVVVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG    DLVVQA+V+Q +VW T LLF L+F  T +    SSR        ++   S
Sbjct  121   IKAMYGSSSVDLVVQASVVQAIVWLTILLFVLEFRRTGSIDIVSSR-----TNVNTRVQS  175

Query  592   VQMAG-DVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
             V   G DVEA          ++  ++   S   LM  V   L  NPNSYA F+G+ WA +
Sbjct  176   VDPQGKDVEAM---------EEITISXRPSFWYLMKAVWVKLGMNPNSYAVFIGIAWAXI  226

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             A RW ++LPSI+EGS+ IMSKAG+G AMFSMG+F+ALQE  V CG S+T + MVLRFI G
Sbjct  227   AKRWHIELPSIMEGSVSIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIAG  286

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   IG + +GL GDVLR+++IQAA+PQS+ SF+YAKEYGLHA++LSTAV  G LVS+P
Sbjct  287   PAAMAIGSIAVGLHGDVLRVAIIQAAVPQSITSFIYAKEYGLHAEVLSTAVIFGMLVSLP  346

Query  1129  LLITYYVILGFLH  1167
             +LI YY +LGF+H
Sbjct  347   VLIAYYAVLGFVH  359



>ref|XP_008355844.1| PREDICTED: LOW QUALITY PROTEIN: putative auxin efflux carrier 
component 8 [Malus domestica]
Length=359

 Score =   384 bits (986),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 206/373 (55%), Positives = 263/373 (71%), Gaps = 15/373 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVV AM PLYVAL LGY SVR WH+F P+QC AINRF CFF +P F F+F A
Sbjct  1     MIGWEDVYKVVAAMVPLYVALILGYGSVRWWHIFTPEQCGAINRFVCFFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++PY  NY F+ AD ++K +++  LA WA  + KGS S S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPYKWNYRFIGADFISKLIIVVVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG    DLVVQA+V+Q +VW T LLF L+F  T +    SSR        ++   S
Sbjct  121   IKAMYGSSSVDLVVQASVVQAIVWLTILLFVLEFRRTGSIDIVSSR-----TNVNTRVQS  175

Query  592   VQMAG-DVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
             V   G DVEA          ++  ++   S   LM  V   L  NPNSYA F+G+ WA +
Sbjct  176   VDPQGKDVEAM---------EEITISXRPSFWYLMKAVWVKLGMNPNSYAVFIGIAWAXI  226

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             A RW ++LPSI+EGS+ IMSKAG+G AMFSMG+F+ALQE  V CG S+T +  VLRFI G
Sbjct  227   AKRWHIELPSIMEGSVSIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGXVLRFIAG  286

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   IG + +GL GD LR+++IQAA+PQS+ SF+YAKEYGLHA++LSTAV  G LVS+P
Sbjct  287   PAAMAIGSIAVGLHGDFLRVAIIQAAVPQSITSFIYAKEYGLHAEVLSTAVIFGMLVSLP  346

Query  1129  LLITYYVILGFLH  1167
             +LI YY +LGF+H
Sbjct  347   VLIAYYAVLGFVH  359



>emb|CDP04220.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   384 bits (985),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 209/372 (56%), Positives = 269/372 (72%), Gaps = 14/372 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   ++YKVV AMAPLYVAL LGY SV+ WHMFK DQCDAINRFNC+F+IPFF F+F A
Sbjct  1     MIDGGDIYKVVTAMAPLYVALGLGYGSVKWWHMFKLDQCDAINRFNCYFIIPFFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H+NPY +N  FL AD +AK +V   LA W N +KKGS    +T FSL++L NTL++G PL
Sbjct  61    HVNPYTMNRGFLIADVIAKFIVGIVLALWVNLSKKGSFDWCITTFSLASLNNTLVLGAPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYGDLG +LVVQ++VIQ+L+WF  LL  L++   R+    +  + G     DSH + 
Sbjct  121   LKAMYGDLGENLVVQSSVIQSLLWFIALLILLEWRQARSEAVDARSMNG-----DSH-AE  174

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             ++M  D+E +        S       S S LS++  V + LA+NPNSYAC +GL WAL++
Sbjct  175   IEMGRDLEES--------SSAPVAIHSPSFLSVLNTVRTKLAKNPNSYACIIGLIWALVS  226

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW +++P I+EGSI+IMSKAG GVAMF+MGLFIA QE  + CG  +T   MVLRF+VGP
Sbjct  227   NRWHIKMPEIVEGSILIMSKAGGGVAMFTMGLFIAWQEKFIACGVGLTFYGMVLRFVVGP  286

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A T  G   +GLRGDVLRI+++QAALPQS+ SFVYA+EYGLHA++LSTAV  GT+VS+PL
Sbjct  287   ALTAAGSFAMGLRGDVLRIAVMQAALPQSITSFVYAQEYGLHANVLSTAVIFGTIVSLPL  346

Query  1132  LITYYVILGFLH  1167
             LI YY +L  L 
Sbjct  347   LIGYYAVLDILR  358



>emb|CDP04221.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 263/372 (71%), Gaps = 15/372 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIG  +VYKVV  M PLYVAL LGY SV+ W +F P+QCDAINRF  +F +P F F+F +
Sbjct  1     MIGLGDVYKVVATMFPLYVALVLGYGSVKWWRLFTPEQCDAINRFVAYFTLPLFIFEFTS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NYPF++ADA++K +++  LA WA F+ KGS   S+T FSLSTLTN+L+VGVP+
Sbjct  61    HVDPFKMNYPFVAADAISKVIIVVVLAFWAKFSSKGSYCWSITGFSLSTLTNSLVVGVPI  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              R MYG    DLVVQ +VIQ +VW T LL  L+   T+T   +S    G   A D+   S
Sbjct  121   ARGMYGQSAVDLVVQGSVIQAIVWLTILLLVLEIRRTQTDFYSSDETVGDSKAADN---S  177

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V+   D+EAN+     T           S  SL+  V   LA NPNSYAC +G+ WAL+A
Sbjct  178   VK---DLEANSRALAET---------KPSFWSLVKRVWQKLAMNPNSYACTVGITWALIA  225

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  Q+P+I+E SI+IMS+AG+G AMFSMGLF+ALQE IV CG S+T   MVLRFI GP
Sbjct  226   NRWHFQMPAIMEDSILIMSRAGTGTAMFSMGLFMALQEKIVACGTSLTIFGMVLRFIAGP  285

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAA+PQS+ SF++AKEYGLHAD+LSTAV  G +V++P+
Sbjct  286   AAMAIGSIAVGLHGDVLRVAIIQAAVPQSITSFIFAKEYGLHADVLSTAVIFGMIVALPV  345

Query  1132  LITYYVILGFLH  1167
             ++ YY IL FLH
Sbjct  346   MVGYYAILEFLH  357



>ref|XP_002325466.1| putative auxin efflux carrier protein 9 [Populus trichocarpa]
 gb|EEE99847.1| putative auxin efflux carrier protein 9 [Populus trichocarpa]
Length=346

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 265/372 (71%), Gaps = 26/372 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW ++YKVVVAM PLYVAL LGY SVR W +F P+QC AINRF C+F +PFF F+F A
Sbjct  1     MIGWADIYKVVVAMVPLYVALMLGYGSVRWWKVFTPEQCGAINRFVCYFTLPFFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY F+ ADA++K +++  LA WA ++ KGS   S+T+FSL TLTN+L++GVPL
Sbjct  61    HVDPFKMNYLFIGADAISKLIIVVVLAVWAKWSGKGSYGWSITSFSLCTLTNSLVLGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG    DLVVQ++VIQ+++W T LL  L+F           R +G G       SS
Sbjct  121   IKAMYGPTAVDLVVQSSVIQSIIWLTMLLLVLEF-----------RRSGLGV------SS  163

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  D+E N          DS V+   +   LM  V   LA NPNSYAC +GL WA +A
Sbjct  164   SNPDKDLEGNA---------DSTVSSRPAFWCLMKTVGVKLAMNPNSYACIIGLVWAFIA  214

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW  ++PSI+EGSI+IMSK G+G AMFSMG+F+ALQE ++ CGAS+T + MVLRFI GP
Sbjct  215   KRWRFEMPSIMEGSILIMSKTGTGTAMFSMGIFMALQEKVIACGASLTVIGMVLRFIAGP  274

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GLRGDVLR+++IQAA PQ++ SF++A+EYGLHA++LSTAV  GT+V++P+
Sbjct  275   AAMAIGSIAVGLRGDVLRVAIIQAAFPQAIISFIFAQEYGLHAEVLSTAVIFGTIVALPV  334

Query  1132  LITYYVILGFLH  1167
             LI YY IL F+H
Sbjct  335   LIAYYAILDFVH  346



>ref|XP_008218436.1| PREDICTED: putative auxin efflux carrier component 8 [Prunus 
mume]
Length=346

 Score =   380 bits (976),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 261/373 (70%), Gaps = 28/373 (8%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVVVAM PLYVAL LG+ SVR W +F P+QC AINRF CFF +P F F+F A
Sbjct  1     MIGWGDVYKVVVAMVPLYVALILGFGSVRWWRIFTPEQCGAINRFVCFFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++PY  NY F+ ADA++K +++A LA WA  + KGS S S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPYKWNYRFIGADAISKLIIVAVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             +RAMYG +  DLVVQ++V+Q +VW T LLF L+F                          
Sbjct  121   MRAMYGQVAVDLVVQSSVVQAIVWLTILLFVLEF--------------------------  154

Query  592   VQMAGDVEANNNNETNT-YSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
              +  G ++ +  + TNT  S D+  +   S   LM  V   L  NPNSYA F+G+ WA +
Sbjct  155   -RRTGSLDMHMISGTNTSQSVDTMSSSRPSFWYLMKAVWLKLGMNPNSYAVFIGIGWAFI  213

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             +SRW ++LPSI+EGS++IMSKAG+G AMFSMG+F+ALQE  V CG S+T + MVLRFI G
Sbjct  214   SSRWHIELPSIMEGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIAG  273

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   IG + +GL GDVLR+++IQAALPQS+ SF+YAKEYGLHA++LSTAV  G + S+P
Sbjct  274   PAAMAIGSIAVGLHGDVLRVAIIQAALPQSITSFIYAKEYGLHAEVLSTAVIFGMIASLP  333

Query  1129  LLITYYVILGFLH  1167
             LLI YY +L F H
Sbjct  334   LLIAYYAVLEFAH  346



>ref|XP_008388803.1| PREDICTED: putative auxin efflux carrier component 8 [Malus domestica]
Length=359

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 203/373 (54%), Positives = 262/373 (70%), Gaps = 15/373 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVV AM PLY AL LGY SVR W +F P+QC AINRF CFF +P F F+F A
Sbjct  1     MIGWEDVYKVVAAMVPLYFALILGYGSVRWWGVFTPEQCGAINRFVCFFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++PY  NY F+ ADA++K +++  L  W   + KGS S S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPYKWNYRFIGADAISKVIIVVVLVLWGKCSSKGSYSWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG    DLVVQ++V+Q ++W T LLF L+F       T S  +  +    D+   S
Sbjct  121   IKAMYGSSAVDLVVQSSVVQAIIWLTILLFVLEF-----RRTGSIDIVSSSTTVDTRVQS  175

Query  592   VQMAG-DVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
             V   G DVEA          ++  +T   S   LM  V   L  NPNSYA F+G+ WA +
Sbjct  176   VDPQGKDVEAM---------EEITITTRPSFWYLMKAVWVKLGMNPNSYAVFIGIAWAFI  226

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             A+RW ++LPSI+EGS++IMSKAG+G AMFSMG+F+ALQE  V CG S T + MVLRFI G
Sbjct  227   ANRWHIELPSIMEGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSRTIIGMVLRFIAG  286

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   IGC+ +GL GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  G LVS+P
Sbjct  287   PAAMAIGCIAVGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLP  346

Query  1129  LLITYYVILGFLH  1167
             +LI YY +L F+H
Sbjct  347   VLIAYYAVLEFVH  359



>ref|XP_007205413.1| hypothetical protein PRUPE_ppa007621mg [Prunus persica]
 gb|EMJ06612.1| hypothetical protein PRUPE_ppa007621mg [Prunus persica]
Length=361

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 263/372 (71%), Gaps = 11/372 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVVVAM PLYVAL LG+ SVR W +F P+QC AINRF CFF +P F F+F A
Sbjct  1     MIGWGDVYKVVVAMMPLYVALILGFGSVRWWRIFTPEQCGAINRFVCFFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++PY  NY F+ ADA++K +++A LA WA  + KGS S S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPYKWNYRFIGADAISKLIIVAVLALWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG +  DLVVQ++V+Q +VW T LLF L+F   RT       ++G   ++      
Sbjct  121   MKAMYGQVAVDLVVQSSVVQAIVWLTILLFVLEF--RRTGSLDMHMISGTNTSQSVE---  175

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              Q  G          +T S     +   S   LM  V   L  NPNSYA F+G+ WA ++
Sbjct  176   -QGEGGKAVEGLAAMSTMS-----SSRPSFWYLMKAVWLKLGMNPNSYAVFIGIGWAFIS  229

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SRW ++LPSI+EGS++IMSKAG+G AMFSMG+F+ALQE  V CG S+T + MVLRFI GP
Sbjct  230   SRWHIELPSIMEGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSLTIIGMVLRFIAGP  289

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  G +VS+P+
Sbjct  290   AAMAIGSIAVGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMIVSLPV  349

Query  1132  LITYYVILGFLH  1167
             LI YY +L F+H
Sbjct  350   LIAYYAVLEFVH  361



>ref|XP_010268327.1| PREDICTED: putative auxin efflux carrier component 8 [Nelumbo 
nucifera]
Length=363

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 197/372 (53%), Positives = 267/372 (72%), Gaps = 9/372 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIG E+VYKVVVAM PLYVA  LGY SV+ WH+F PDQC AINR  C+F +P F F+F A
Sbjct  1     MIGLEDVYKVVVAMVPLYVATVLGYGSVKWWHIFTPDQCQAINRLVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+++NY F++ADA++K +++  L  WA  + KGS   S+T+FSLSTLTN+L+VGVPL
Sbjct  61    HIDPFNMNYLFIAADAISKVVIVIVLVFWAKCSSKGSYPWSITSFSLSTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG +G DLVVQ++VIQ +VW T LLF L+   TR+   +S           SH  S
Sbjct  121   LKAMYGQIGVDLVVQSSVIQAIVWLTILLFVLELRKTRSDTLSS---MATSLDSQSHVVS  177

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             ++ A DV+      TN +  +   T   S  S+M  V   LA NPN+YA  +G+ WA ++
Sbjct  178   LESAKDVQ------TNDHVVEGLSTTKPSFCSVMKIVWLKLALNPNTYASLVGIVWAFVS  231

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW ++ PSI+EGS++IMS+AG+G AMF+MG+F+ALQE ++ CG  +T   MVL+FI GP
Sbjct  232   NRWHIETPSIMEGSVLIMSRAGTGTAMFNMGIFMALQEKLIACGPPLTIFGMVLKFIAGP  291

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAALPQS+ SF+YAKEYGLHAD+LSTAV  G L S+P+
Sbjct  292   AAMAIGAIAVGLHGDVLRVAIIQAALPQSITSFIYAKEYGLHADVLSTAVIFGMLASLPI  351

Query  1132  LITYYVILGFLH  1167
             L+ YY +L +L+
Sbjct  352   LVGYYAVLEYLN  363



>ref|XP_011009309.1| PREDICTED: putative auxin efflux carrier component 8 [Populus 
euphratica]
Length=346

 Score =   378 bits (970),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 263/372 (71%), Gaps = 26/372 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW ++YKVV AM PLYVAL LGY SVR W +F P+QC AINR  C+F +PFF F+F A
Sbjct  1     MIGWADIYKVVAAMVPLYVALMLGYGSVRWWKVFTPEQCGAINRLVCYFTLPFFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +P+ +NY F+ ADA++K +++  LA WA ++ KGS S S+T+FSL TLTN+L++GVPL
Sbjct  61    HADPFKMNYLFIGADAISKLIIVVVLAVWAKWSGKGSYSWSITSFSLCTLTNSLVLGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG     L+VQ++VIQ+++W T LL  L+            R  G G         
Sbjct  121   IKAMYGQAAVALIVQSSVIQSIIWLTMLLLVLEI-----------RRTGLG---------  160

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                   V A+N +E    + DS V+   +   LM  V   LA NPNSYAC +GL WA +A
Sbjct  161   ------VSASNPDEDLEENADSTVSSRPAFWCLMKTVGMKLAMNPNSYACIIGLVWAFIA  214

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++PSI+EGSI+IMSK G+G AMFSMG+F+ALQE ++ CGAS+T + MVLRFI GP
Sbjct  215   NRWRFEMPSIMEGSILIMSKTGTGTAMFSMGIFMALQEKVIACGASLTVIGMVLRFIAGP  274

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG +++GLRGDVLR+++IQAA PQ++ SF++A+EYGLHA++LSTAV  GT+V++P+
Sbjct  275   AAMAIGSIIVGLRGDVLRVAIIQAAFPQAIISFIFAQEYGLHAEVLSTAVIFGTIVALPV  334

Query  1132  LITYYVILGFLH  1167
             LI YY IL F+H
Sbjct  335   LIAYYAILDFVH  346



>ref|XP_009792134.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
sylvestris]
Length=363

 Score =   378 bits (971),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 262/372 (70%), Gaps = 9/372 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI WE+VYKVVVAMAPLYVAL LGY SV+ W +F  DQC AIN+  C+F +P F F+F A
Sbjct  1     MIEWEDVYKVVVAMAPLYVALILGYASVKWWRIFTTDQCAAINQLVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY FL ADA++K +++A L  WA  ++KGS   S+T+FSLS LTN+L+VGVPL
Sbjct  61    HVDPFDMNYKFLGADAISKAIIVAVLTFWAKCSRKGSYRWSITSFSLSALTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG+    LVVQ++V Q +VW T LLF L+   TR+  +  S V   G   ++    
Sbjct  121   MKAMYGEEAVHLVVQSSVTQAIVWLTVLLFVLEVRRTRSDFSLDSAV---GDTNNNVPDE  177

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  D+E  NN +        A     S   L   V   LA NPNSYAC  GL WAL++
Sbjct  178   EINGKDLEVMNNRKV------VASITRPSFWCLTKTVWLKLATNPNSYACIFGLTWALIS  231

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  Q+PSI+EGSI+IMS+AG+G AMFSMG+F+ALQE ++ CGAS+    MVLRF+ GP
Sbjct  232   NRWHFQMPSIMEGSILIMSRAGTGTAMFSMGMFMALQEKVIACGASLAVFGMVLRFVAGP  291

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A+  I  +++GL GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  G LVS+P+
Sbjct  292   ASMAIASILIGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLPV  351

Query  1132  LITYYVILGFLH  1167
             L+ YY IL FLH
Sbjct  352   LVGYYAILEFLH  363



>ref|XP_007029400.1| Auxin efflux carrier component [Theobroma cacao]
 gb|EOY09902.1| Auxin efflux carrier component [Theobroma cacao]
Length=353

 Score =   375 bits (964),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 261/372 (70%), Gaps = 19/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+V KVVVAM PLYVAL LGY SV+ W +F  +QCDAINR  C+F +P F  +F  
Sbjct  1     MIGWEDVCKVVVAMVPLYVALMLGYGSVKWWRIFTAEQCDAINRLVCYFTLPLFTVEFTT  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +NY F+ AD ++K +++  LA WA  + KGS   S+T+FSLSTLTN L+VGVPL
Sbjct  61    HIDPFQMNYRFIGADTISKLVIVVVLAFWAKCSSKGSYCWSITSFSLSTLTNALVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG  G DLVVQ++V+Q ++W T LLF L+F          S V+ + A +D +   
Sbjct  121   MKAMYGQTGVDLVVQSSVVQAIIWLTILLFVLEF--------RRSGVSISSATKDGN---  169

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              +   DVE N +N          ++   S  +LM  V   LA NPNSYAC +GL +A +A
Sbjct  170   -EQEKDVEGNTDNA-------GVLSTRPSFWNLMKVVGMKLAMNPNSYACVIGLAYACVA  221

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++PSI+EGSI+IMSKAG+G AMFSMG F+ALQE I+ CG S+T   MVLRFI GP
Sbjct  222   NRWHFEMPSIMEGSILIMSKAGTGTAMFSMGTFMALQEKIIACGTSLTIFGMVLRFIAGP  281

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL G VLR+++IQAALPQS+ SF++AKEYG+HA++LSTAV  GT+VS+P+
Sbjct  282   AAMAIGAIAVGLHGAVLRVAIIQAALPQSITSFIFAKEYGMHAEVLSTAVIFGTIVSLPV  341

Query  1132  LITYYVILGFLH  1167
             L+ YY IL  +H
Sbjct  342   LVAYYAILESVH  353



>ref|XP_004155098.1| PREDICTED: putative auxin efflux carrier component 8-like [Cucumis 
sativus]
Length=371

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 192/373 (51%), Positives = 261/373 (70%), Gaps = 6/373 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW++VYKVV AMAPLY AL LGY SV+ W +F   QCDAIN+  C+F +P F F F +
Sbjct  1     MIGWQDVYKVVAAMAPLYFALILGYGSVKWWKIFSTQQCDAINKLVCYFTLPLFTFDFTS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+HLN+PF++ADA+ K +++  L  WA  T KGS   S+T+FSLSTLTN L++GVPL
Sbjct  61    HIDPFHLNFPFIAADAIGKLIIVLVLTFWAKCTTKGSYCWSITSFSLSTLTNALVIGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              + MYG +  DLVVQ +V+Q +VW T LLF L+    RT     +  A +G    S   +
Sbjct  121   AKVMYGQMAVDLVVQGSVVQAIVWLTILLFVLEL--RRTGLDLVAAEASSGVV--SEEKT  176

Query  592   VQMAGDVEANNNNETNTYSD--DSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
             V++ G+ E +   E     +   S+ +   S+  LM  V   +A NPNSYAC +G  WA 
Sbjct  177   VEVGGEGEKDLEGEDMEVEEMRRSSKSHRPSLKPLMKKVWVKMAGNPNSYACTIGFAWAF  236

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +A RW +++PSI+EGSI+IMSKAG G AMF+MG+F+ALQE ++ CG ++T + MVL+FI 
Sbjct  237   VAKRWHVEMPSIMEGSILIMSKAGIGTAMFNMGIFMALQEKLIACGPTLTIVGMVLKFIA  296

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   IG + +GL GDVLR+++IQAA+PQS+ SF+YAKEYGLHAD+LSTAV  G +VS+
Sbjct  297   GPAAMAIGSIAMGLHGDVLRVAIIQAAVPQSITSFIYAKEYGLHADVLSTAVIFGAIVSL  356

Query  1126  PLLITYYVILGFL  1164
             P+L+ YY  L F+
Sbjct  357   PVLVAYYAALEFI  369



>ref|XP_010525085.1| PREDICTED: putative auxin efflux carrier component 8 [Tarenaya 
hassleriana]
Length=385

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 199/380 (52%), Positives = 261/380 (69%), Gaps = 25/380 (7%)
 Frame = +1

Query  28    IQTTTPAIMIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvip  207
             + ++    MIGWE+VYKVV AM PLYVAL LGY SV+ W +F  DQCDAINR  C+F +P
Sbjct  31    LHSSCSKKMIGWEDVYKVVEAMFPLYVALILGYGSVKWWKIFSHDQCDAINRLVCYFTLP  90

Query  208   ffnfqfMAHINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTN  387
              F  +F AH++P+++NYPF++ADA++K LV+A L  WA F+ KGS   S+T+FSL TLTN
Sbjct  91    LFTIEFTAHVDPFNMNYPFMAADALSKLLVMAVLGFWAKFSSKGSYCWSITSFSLCTLTN  150

Query  388   TLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGA  567
             +L+VGVPL RAMYG    DLVVQ +V Q +VW TFLLF L+F           R +G   
Sbjct  151   SLVVGVPLARAMYGKQAVDLVVQNSVFQAIVWLTFLLFVLEF-----------RRSGL--  197

Query  568   ARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFL  747
               +  G  V    DVE        T        E  S  ++M  V   LA NPN Y+C +
Sbjct  198   --EGDGEVV----DVEGRGGERVVTK------MEEKSFRTVMKVVWLKLATNPNCYSCVI  245

Query  748   GLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAM  927
             G+ WA +++RW +Q+P I+EGSI IMSKAG+G AMF+MG+ +ALQ+ ++ CGAS+T + M
Sbjct  246   GIAWAFISNRWHIQMPGIVEGSISIMSKAGTGTAMFNMGISMALQKKVIACGASLTVIGM  305

Query  928   VLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTI  1107
             VL+F+ GPA   IG +V+GL GDVLR+++IQAALPQS+ SFV+AKEYGLHAD+LSTAV  
Sbjct  306   VLKFVAGPAAMAIGSIVVGLHGDVLRVAIIQAALPQSITSFVFAKEYGLHADVLSTAVIF  365

Query  1108  GTLVSVPLLITYYVILGFLH  1167
             G LVS+P+LI YY  L F+ 
Sbjct  366   GMLVSLPVLIGYYAALEFVR  385



>ref|XP_009384295.1| PREDICTED: putative auxin efflux carrier component 8 [Musa acuminata 
subsp. malaccensis]
Length=361

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 202/376 (54%), Positives = 260/376 (69%), Gaps = 21/376 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKVVVAMAPLYVAL LGY SVR W +  P+QC+AINR      +P F F+F  
Sbjct  1     MISWGDIYKVVVAMAPLYVALGLGYGSVRWWRIITPEQCEAINRLVSCITLPLFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY F++ADAV+K  +   LAAW   + KGS   SVT+FSLSTLTN+L+VGVPL
Sbjct  61    HVDPFAMNYRFIAADAVSKVTIAVLLAAWPKCSSKGSYCWSVTSFSLSTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAG-----AARD  576
             + AMYG    DLVVQ +V+Q +VW T LLF  +            R AG G     AA  
Sbjct  121   VSAMYGRWAQDLVVQLSVVQAIVWLTLLLFVFEL-----------RKAGCGLFSMAAAPS  169

Query  577   SHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLF  756
             S G  +     VE+    + +    +  VT   S  SLM  V   LA NPNSYA  +G+ 
Sbjct  170   SAGGEL---ASVESPPLKDVDGGGPE--VTPRPSFWSLMKTVWLKLALNPNSYASIVGIT  224

Query  757   WALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLR  936
             WA +ASRW  ++PSI+EGS++IMSKAG+G+AMFSMGLF+ALQE I+ CG S+TA  MVL+
Sbjct  225   WAFIASRWHFEMPSIMEGSVLIMSKAGTGMAMFSMGLFMALQEKILACGPSLTAFGMVLK  284

Query  937   FIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTL  1116
             FI GPA T IG + +GLRGDVL +++IQAALPQS+ SF++A+EYGLHAD+LSTAV  G L
Sbjct  285   FIAGPAATAIGAIAVGLRGDVLHLAIIQAALPQSITSFIFAREYGLHADVLSTAVIFGML  344

Query  1117  VSVPLLITYYVILGFL  1164
             VS+P+L+ YYV+LGF+
Sbjct  345   VSLPVLVAYYVVLGFM  360



>ref|XP_003624144.1| Auxin Efflux Carrier [Medicago truncatula]
 gb|AAT48629.1| putative auxin efflux carrier protein 9 [Medicago truncatula]
 gb|ABD28360.1| Auxin Efflux Carrier [Medicago truncatula]
 gb|AES80362.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=363

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/372 (51%), Positives = 264/372 (71%), Gaps = 9/372 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKV+VA+ PLY AL LGY SVR W +F  +QCDAIN+  C+F +P F F+F A
Sbjct  1     MIGWEDVYKVIVAVVPLYFALILGYGSVRWWKIFTREQCDAINKLVCYFTLPLFAFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +N+ F+ AD ++K +++A +A WA  + K S S S+T+FSL TLTN+L+VG+P+
Sbjct  61    HIDPFKMNFLFIGADTLSKLIIVAVIALWAKCSSKVSYSWSITSFSLCTLTNSLVVGIPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++ MYG +G DLVVQA+V+Q ++W T LLF L+F  T    T ++    A +  +     
Sbjct  121   VKPMYGPMGVDLVVQASVVQAIIWLTLLLFVLEFRRTGIEGTITTLKPKASSISNVTCEG  180

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              + + DVEANN  E  +             L LM  V   L  NPNSY C +G+ WA ++
Sbjct  181   -EESKDVEANNIVEYTS--------SRLPFLQLMKRVWLKLIANPNSYGCVIGISWAFIS  231

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW+L+LPS++EGSI+IMSKAG+G AMFSMG+F+ALQE ++ CG S+T   +VL+FI GP
Sbjct  232   NRWNLELPSMVEGSILIMSKAGTGTAMFSMGIFMALQEKVISCGPSLTVFGLVLKFIAGP  291

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   I   ++GLRGDVLRI++IQAA+PQS+ SF++AKEY LHA++LSTAV  G +VS+P+
Sbjct  292   AAMAISAFIVGLRGDVLRIAIIQAAVPQSITSFIFAKEYELHAEVLSTAVIFGMIVSLPI  351

Query  1132  LITYYVILGFLH  1167
             L+ YY IL F+H
Sbjct  352   LVAYYAILEFVH  363



>ref|XP_004152830.1| PREDICTED: putative auxin efflux carrier component 8-like [Cucumis 
sativus]
Length=371

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/371 (51%), Positives = 256/371 (69%), Gaps = 2/371 (1%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW++VYKVV AMAPLY AL LGY SV+ W +F   QCDAIN+  C+F +P F F F +
Sbjct  1     MIGWQDVYKVVAAMAPLYFALILGYGSVKWWKIFSTQQCDAINKLVCYFTLPLFTFDFTS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+HLN+PF++ADA+ K +++  LA WA  T KGS   S+T+FSLSTLTN L++GVPL
Sbjct  61    HIDPFHLNFPFIAADAIGKLIIVLVLAFWAKCTTKGSYCWSITSFSLSTLTNALVIGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              + MYG +  DLVVQ +V+Q +VW T LLF L+    RT     +  A +G   +     
Sbjct  121   AKVMYGQMAVDLVVQGSVVQAIVWLTILLFVLEL--RRTGLDLVAAEASSGVVSEEKTVE  178

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V   G+ +             S+ +   S+  LM  V   +A NPNSYAC +G  WA +A
Sbjct  179   VGGEGEKDLEGEGMEVEEMRRSSKSHRPSLKPLMKKVWVKMAGNPNSYACTIGFAWAFVA  238

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +++PSI+EGSI+IMSKAG G AMF+MG+F+ALQE ++ CG ++T + MVL+FI GP
Sbjct  239   KRWHVEMPSIMEGSILIMSKAGIGTAMFNMGIFMALQEKLIACGPTLTIVGMVLKFIAGP  298

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAA+PQS+ SF+YAKEYGLHAD+LSTAV  G +VS+P+
Sbjct  299   AAMAIGSIAMGLHGDVLRVAIIQAAVPQSITSFIYAKEYGLHADVLSTAVIFGAIVSLPV  358

Query  1132  LITYYVILGFL  1164
             L+ YY  L F+
Sbjct  359   LVAYYAALEFI  369



>ref|NP_197157.4| auxin transporter PIN5 [Arabidopsis thaliana]
 sp|Q9FFD0.2|PIN8_ARATH RecName: Full=Putative auxin efflux carrier component 8; Short=AtPIN8 
[Arabidopsis thaliana]
 gb|AED92305.1| auxin transporter PIN5 [Arabidopsis thaliana]
Length=351

 Score =   373 bits (957),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 260/372 (70%), Gaps = 21/372 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYKV+ AM PLYVAL LGY SV+ WH+F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MINCGDVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++  LA WA ++ KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKVIIVTVLALWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T LLF L+F           R AG  +   S    
Sbjct  121   AKAMYGQQAVDLVVQSSVFQAIVWLTLLLFVLEF-----------RKAGFSSNNIS----  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  DV+ +N N   +   ++ V    S L +M  V   LA NPN Y+C LG+ WA ++
Sbjct  166   -----DVQVDNIN-IESGKRETVVVGEKSFLEVMSLVWLKLATNPNCYSCILGIAWAFIS  219

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW L+LP I+EGSI+IMSKAG+G AMF+MG+F+ALQE ++ CG S+T + MVL+FI GP
Sbjct  220   NRWHLELPGILEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGP  279

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG +VLGL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+P+
Sbjct  280   AAMAIGSIVLGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPV  339

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  340   LVAYYAALEFIH  351



>ref|XP_008802247.1| PREDICTED: putative auxin efflux carrier component 8 [Phoenix 
dactylifera]
Length=360

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 262/372 (70%), Gaps = 12/372 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW ++YKVVVAM PLYVAL LGY SVR W +F P+QC+AINR   +F +PFF F+F  
Sbjct  1     MIGWADIYKVVVAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRLVVYFSLPFFTFEFTV  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +P+ +NY  ++ADA++K L +  LAAWA ++ KGS   S+T+FSLS LTNTL+VG PL
Sbjct  61    HTDPFAMNYRVIAADAISKVLTVLVLAAWAKWSSKGSYGWSITSFSLSALTNTLVVGAPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L AMYG    DLVVQ +V+Q +VW TFLLF L+    R      + VA   A  +  G  
Sbjct  121   LNAMYGRWAQDLVVQLSVVQGIVWMTFLLFMLEL---RKAGILVTTVA---ATSNGGGDV  174

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V +    EA +  E      ++ V    S  SLMM V   LA NPN YA  LG+ WA ++
Sbjct  175   VSVELQPEAKDVEE------NAEVASRPSFCSLMMTVWLKLALNPNFYASVLGVAWAFIS  228

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++PSIIEGS++IMS++G+G+AMFSMGLF+ALQE I+ CG ++TA  MVLRF+ GP
Sbjct  229   NRWHFEMPSIIEGSVLIMSRSGAGLAMFSMGLFMALQEKIIACGLNLTAFGMVLRFVAGP  288

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GLRGD LR+++I AALPQS++SF++A+EYGLHA++LSTAV  GTLVS+PL
Sbjct  289   AAMAIGAIAVGLRGDFLRVAIIVAALPQSISSFIFAREYGLHAEVLSTAVIFGTLVSLPL  348

Query  1132  LITYYVILGFLH  1167
             L+  Y  LGF++
Sbjct  349   LVACYFALGFIN  360



>gb|KFK25870.1| hypothetical protein AALP_AA8G172900 [Arabis alpina]
Length=350

 Score =   370 bits (951),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 191/372 (51%), Positives = 256/372 (69%), Gaps = 22/372 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKV+ AM PLYVAL LGY SV+ W++F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MIGWGDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTLPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++  LA WA +  KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKIIIVTVLAVWAKYINKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T LLF L+F                   R +  SS
Sbjct  121   AKAMYGQQAVDLVVQSSVFQAIVWLTLLLFVLEF-------------------RRAGFSS  161

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                A ++      ET        V E  S L +M  V   LA NPN Y+C LG+ WA ++
Sbjct  162   NSKADNINIEGGRETAVMV---VVGEEKSFLEVMSVVWLKLATNPNCYSCVLGIAWAFIS  218

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW +++P IIEGSI+IMSKAG+G AMF+MG+F+ALQE ++ CG S+T + M+L+FI GP
Sbjct  219   NRWHIEMPGIIEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTLIGMLLKFIAGP  278

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + LGL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+P+
Sbjct  279   AAMAIGSIALGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPV  338

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  339   LVAYYAALEFIH  350



>ref|XP_006376058.1| putative auxin efflux carrier protein 9 [Populus trichocarpa]
 gb|ERP53855.1| putative auxin efflux carrier protein 9 [Populus trichocarpa]
Length=346

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/371 (53%), Positives = 263/371 (71%), Gaps = 26/371 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVAM PLYVAL LGY SVR W +F P+QC AINRF C+F +P F F+F A
Sbjct  1     MIGWEDVYKVVVAMVPLYVALVLGYGSVRWWKVFTPEQCGAINRFVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY F+ ADAV+K +++  LA WA  + KGS S S+T+FSL TLTN+L+VGVP+
Sbjct  61    HVDPFKMNYRFIGADAVSKVIIVVVLAFWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPI  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG    DLVVQ++VIQ ++W T LL  L+F           R  G G         
Sbjct  121   IKAMYGPAAVDLVVQSSVIQAIIWLTLLLLVLEF-----------RRTGLG---------  160

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                     +NN+++    S D+  +   +   LM  V   LA NPNSYAC +GL WA ++
Sbjct  161   ------FSSNNSDKDLEGSVDNTESSRPAFWCLMRTVWVKLAMNPNSYACIIGLVWAFIS  214

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++P+++EGSI+IMSKAG+G AMFSMG+F+ALQE ++ CGAS+  + M+LRFI GP
Sbjct  215   NRWHFEMPAMMEGSILIMSKAGTGTAMFSMGIFMALQEKVISCGASLAVIGMILRFIAGP  274

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL+GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  G L ++P+
Sbjct  275   AAMAIGSIAVGLQGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMLAALPV  334

Query  1132  LITYYVILGFL  1164
             LITYY IL F+
Sbjct  335   LITYYAILEFV  345



>ref|XP_010673920.1| PREDICTED: putative auxin efflux carrier component 8 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   368 bits (945),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 201/375 (54%), Positives = 263/375 (70%), Gaps = 6/375 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI  E++ KV+VA  PLYVAL LGY SV+ W +FK DQCDAINR  C+F +P FN  F A
Sbjct  1     MISLEDISKVIVATVPLYVALILGYGSVKWWRLFKADQCDAINRLVCYFTLPLFNLDFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H NP+  NY FL+ADA++K +++A LA W   + KGS   S+T+FSLSTLTN+L+VGVPL
Sbjct  61    HSNPFEWNYKFLAADAMSKVIIVAVLALWVTCSSKGSYCWSITSFSLSTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTH-PTTSSRVAGAGAARDSHGS  588
             L AMYG +G DLVVQ +V Q ++W T LLF L+F  +R   P+T + V+ +   +D   S
Sbjct  121   LGAMYGPMGVDLVVQFSVTQAIIWLTVLLFVLEFRQSRIDLPSTINCVSTSVEIKDP--S  178

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTE--STSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
              V   G V+ N + E    S +  + +    S+ SL+  V   +  NPNSY+C +G+ WA
Sbjct  179   QVHSFG-VDQNKDMEGKIISTNDGLGDVVRPSLWSLIKGVGVKILANPNSYSCIIGIAWA  237

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
               ASR+ LQLPSI++GSI+IMSKAG+G AMFSMG+F+A QE ++ CG  +T  AM+L+FI
Sbjct  238   FFASRFHLQLPSIVDGSILIMSKAGTGTAMFSMGMFMASQEKLISCGPKLTIFAMILKFI  297

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
              GPA   I  LVLGL GDVLR+++IQAALPQS+ SF+YAKEYGLHAD+LSTAV  G + S
Sbjct  298   AGPAAMAISSLVLGLHGDVLRVAIIQAALPQSITSFIYAKEYGLHADVLSTAVIFGMMAS  357

Query  1123  VPLLITYYVILGFLH  1167
             +P+LI YY IL   H
Sbjct  358   LPILIAYYAILETFH  372



>ref|XP_006288060.1| hypothetical protein CARUB_v10001290mg [Capsella rubella]
 gb|EOA20958.1| hypothetical protein CARUB_v10001290mg [Capsella rubella]
Length=352

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/372 (51%), Positives = 259/372 (70%), Gaps = 20/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI + + YKV+ AM PLYVAL LGY SV+ W++F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MISFGDAYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTLPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++  LA WA ++ KGS S S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKAIIVTVLAFWAKYSNKGSYSWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T LLF L++           R AG      S+GS 
Sbjct  121   AKAMYGKQAVDLVVQSSVFQAIVWLTLLLFVLEY-----------RRAG----FSSNGS-  164

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                 GD +  N N  +   +   V E  S L +M  V   LA NPN Y+C LG+ WA ++
Sbjct  165   ----GDSKVENINIESGKRETVVVGEEKSFLEVMSLVWWKLAMNPNCYSCILGIAWAFIS  220

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW L +P I+EGSI+IMSKAG+G AMF+MG+F+ALQE ++ CG S+T + M+L+FI GP
Sbjct  221   NRWHLAMPGILEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMLLKFIAGP  280

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +G +  GL GDVLR++++QAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+P+
Sbjct  281   AAMAVGSIAFGLHGDVLRVAIVQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPV  340

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  341   LVAYYAALEFIH  352



>gb|KGN61255.1| hypothetical protein Csa_2G074170 [Cucumis sativus]
Length=369

 Score =   365 bits (938),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 188/371 (51%), Positives = 254/371 (68%), Gaps = 4/371 (1%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW++VYKVV AMAPLY AL LGY SV+ W +F   QCDAIN+  C+F +P F F F +
Sbjct  1     MIGWQDVYKVVAAMAPLYFALILGYGSVKWWKIFSTQQCDAINKLVCYFTLPLFTFDFTS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+HLN+PF++ADA+ K +++  LA WA  T KGS   S+T+FSLSTLTN L++GVPL
Sbjct  61    HIDPFHLNFPFIAADAIGKLIIVLVLAFWAKCTTKGSYCWSITSFSLSTLTNALVIGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              + MYG +  DLV   +V+Q +VW T LLF L+    RT     +  A +G   +     
Sbjct  121   AKVMYGQMAVDLV--GSVVQAIVWLTILLFVLEL--RRTGLDLVAAEASSGVVSEEKTVE  176

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V   G+ +             S+ +   S+  LM  V   +A NPNSYAC +G  WA +A
Sbjct  177   VGGEGEKDLEGEGMEVEEMRRSSKSHRPSLKPLMKKVWVKMAGNPNSYACTIGFAWAFVA  236

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +++PSI+EGSI+IMSKAG G AMF+MG+F+ALQE ++ CG ++T + MVL+FI GP
Sbjct  237   KRWHVEMPSIMEGSILIMSKAGIGTAMFNMGIFMALQEKLIACGPTLTIVGMVLKFIAGP  296

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAA+PQS+ SF+YAKEYGLHAD+LSTAV  G +VS+P+
Sbjct  297   AAMAIGSIAMGLHGDVLRVAIIQAAVPQSITSFIYAKEYGLHADVLSTAVIFGAIVSLPV  356

Query  1132  LITYYVILGFL  1164
             L+ YY  L F+
Sbjct  357   LVAYYAALEFI  367



>ref|XP_010038273.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
 gb|KCW84566.1| hypothetical protein EUGRSUZ_B01405 [Eucalyptus grandis]
Length=364

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/368 (54%), Positives = 255/368 (69%), Gaps = 9/368 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIG E+VYKVV AM PLYVAL LGY SV+ W +FKP+QCDA+NR  C+F +P F F+F A
Sbjct  1     MIGLEDVYKVVEAMVPLYVALMLGYGSVKWWKIFKPEQCDAVNRLVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+  NY F++AD V+K +++  LA WA  + KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFEWNYAFIAADVVSKVIIVLVLAFWAKCSTKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG +G DLV+Q +V Q +VW T LLF L+    R+    SS    +    DS   +
Sbjct  121   LKAMYGSMGVDLVIQGSVFQAIVWLTLLLFVLEM--KRSGLDISS--TPSSTEGDSPART  176

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V    D  A  N E     +    +   S  SLM  V   LA NPNSYAC +G+ WAL+A
Sbjct  177   VV---DPVAKFNLEGGL--EMMVSSSRPSFWSLMRVVWMKLAMNPNSYACIVGIVWALIA  231

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++P II+G I I+SKAG+G AMFSMG+F+A QE ++ CG S+T   MVLRFI GP
Sbjct  232   NRWHFEMPGIIDGCITILSKAGTGTAMFSMGMFMAQQEKLIACGPSLTVFGMVLRFIAGP  291

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + LGLRG+VLR+++IQAALPQS+ SF+YAKEY LHAD+LSTAV  G +VS P+
Sbjct  292   AAMAIGSIALGLRGNVLRVAIIQAALPQSITSFIYAKEYALHADVLSTAVIFGMIVSFPV  351

Query  1132  LITYYVIL  1155
             L+ YY IL
Sbjct  352   LLAYYAIL  359



>ref|XP_004492828.1| PREDICTED: putative auxin efflux carrier component 8-like [Cicer 
arietinum]
Length=366

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/372 (51%), Positives = 270/372 (73%), Gaps = 6/372 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVA+ PLYVAL LGY SVR W +F  +QCDAIN+  C+F +P F F+F A
Sbjct  1     MIGWEDVYKVVVAVVPLYVALVLGYGSVRWWKIFTREQCDAINKLVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             +I+P+ +N+ F+ AD ++K +++A LA WA  ++KGS   S+T+FSL TLTN+L+VG+P+
Sbjct  61    NIDPFKMNFLFIGADTLSKLIIVAVLALWAKCSRKGSYCWSITSFSLCTLTNSLVVGIPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++ MYG +G DLVVQA+V+Q +VW T LL  L+F  T      S+ +      + S  S+
Sbjct  121   VKPMYGPMGVDLVVQASVVQAIVWLTLLLIVLEFRRTGIEGANSTNLK----PKASSISN  176

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V +  +V    + E NT  +D+  +       LM  V      NPNSY C +G+ WA ++
Sbjct  177   VVIGDEVVERKDVEANTIVEDT--SSRLPFFQLMKRVWLRFIVNPNSYGCVVGISWAFIS  234

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW+L++PS++EGS++IMS+AG+G AMFSMG+F+ALQE ++ CG S+T + +VL+FI GP
Sbjct  235   NRWNLKMPSMVEGSVLIMSRAGTGTAMFSMGIFMALQEKVISCGPSLTVIGLVLKFIAGP  294

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   I  +++GLRGDVLR+++IQAA+PQS+ SF++AKEYGLHA++LSTAV  G +VS+P+
Sbjct  295   AAMAISAIIVGLRGDVLRVAIIQAAVPQSITSFIFAKEYGLHAEVLSTAVIFGMIVSLPI  354

Query  1132  LITYYVILGFLH  1167
             LI YYVIL F+H
Sbjct  355   LIAYYVILEFIH  366



>gb|AIF28456.1| PIN-like protein, partial [Typha angustifolia]
Length=359

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 196/376 (52%), Positives = 258/376 (69%), Gaps = 21/376 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W +VYKVV+AM PLYVAL LG+ SVR W +F  DQC+AINR    F++PF  F+F  
Sbjct  1     MISWRDVYKVVIAMVPLYVALGLGFGSVRWWKIFTADQCNAINRLVTLFILPFLTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +P+ +NY FL ADAV+K +V+  LA W  ++ KGS S S+T FSLSTLTNTL+VGVPL
Sbjct  61    HTDPFAMNYRFLLADAVSKIVVVIILAIWVKYSSKGSYSWSITMFSLSTLTNTLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAG----AARDS  579
             + AMYG    DLVVQ +V+Q + WFT LL A +            + AG G    +A+ +
Sbjct  121   VSAMYGKWAQDLVVQLSVVQAIAWFTLLLLAFEL-----------KKAGVGLSSVSAQSN  169

Query  580   HGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
             +G +  M   VE++  N+    S+      S    SLM      LA NPN YA  LG+ W
Sbjct  170   NGGNQVML--VESSIVNDAEEKSE----IVSRPFRSLMKIAWFKLALNPNVYAGILGITW  223

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             A +A+RW  ++PSIIEGS++IMS+AG+G+AMFSMGLF+ALQE I+ CG  +T   MVL+ 
Sbjct  224   AFIANRWRFEMPSIIEGSVLIMSRAGTGMAMFSMGLFMALQEKIIACGPILTVFGMVLKL  283

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             + GPA  +IG + LGLRGDVLR+++IQAALPQS+ SF++AKEY +HAD+LSTAV  GTL 
Sbjct  284   VAGPAAAVIGAMALGLRGDVLRLAIIQAALPQSITSFIFAKEYEVHADVLSTAVIFGTLA  343

Query  1120  SVPLLITYYVILGFLH  1167
             S+P+LI YY+ LGF+ 
Sbjct  344   SLPVLIAYYIFLGFIR  359



>ref|XP_006480409.1| PREDICTED: putative auxin efflux carrier component 8-like [Citrus 
sinensis]
Length=340

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 193/374 (52%), Positives = 254/374 (68%), Gaps = 36/374 (10%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKV+VAM PLY AL LGY SV+ W +  P++C AINR  C+F +P F  +F  
Sbjct  1     MIGWEDVYKVIVAMVPLYFALILGYGSVKWWKIIAPEECAAINRLVCYFTLPLFTIEFTT  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGS-LSCSVTAFSLSTLTNTLIVGVP  408
             H++P+++NY F+ ADA++K +++  LA W   +KKGS  S  +T FSL TLTNTL++GVP
Sbjct  61    HVDPFNMNYRFIGADAISKLIIVIVLAFWGMCSKKGSCFSWCITNFSLCTLTNTLVLGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             L++AMYG +  DLVVQ++V Q++VWFT  LF L+F           R AG          
Sbjct  121   LMKAMYGQMAVDLVVQSSVFQSIVWFTIFLFILEF-----------RRAG----------  159

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTEST-SVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
                          N      +  A + S  S   LM  V   LA+NPNSYAC +GL WA 
Sbjct  160   -------------NALEDLEEGHATSSSRPSFWHLMKVVWLKLAKNPNSYACVIGLAWAF  206

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +A+RW  ++PSIIEGSI+IMSKAG+G AMFSMG+F+ALQE ++ CG S+TA  MVL+FI 
Sbjct  207   VANRWHFKMPSIIEGSILIMSKAGTGTAMFSMGIFMALQEKLLACGPSLTAFGMVLKFIA  266

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   IG +  GLRGDVLR+S+IQAALP+++ +FV+AKEYGLH D+LSTAV  GT+VS+
Sbjct  267   GPAAMAIGSIATGLRGDVLRVSIIQAALPEAITTFVFAKEYGLHTDVLSTAVIFGTIVSL  326

Query  1126  PLLITYYVILGFLH  1167
             P+LI YY IL  +H
Sbjct  327   PVLIAYYAILDIIH  340



>gb|AIF28451.1| PIN-like protein, partial [Papaver somniferum]
Length=355

 Score =   362 bits (929),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 261/371 (70%), Gaps = 17/371 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIG  ++YKVVVAM PLYVAL LGY SV+ W MF  +QCDAIN+F C+F +P F F F +
Sbjct  1     MIGMGDIYKVVVAMTPLYVALILGYGSVKWWKMFSREQCDAINKFVCYFTLPLFTFHFTS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              ++P+  NY FL+ADA++K +++  L AWA  +  G  +  +T+FSLSTLTN+L+VGVP+
Sbjct  61    QVDPFGWNYKFLAADAISKVIIVIVLIAWAKGSSNGCYTWLITSFSLSTLTNSLVVGVPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYGD+G ++VV++ V Q +VW + LLF L+    R    +SS V       DS    
Sbjct  121   LKAMYGDIGVNIVVESTVFQGIVWLSVLLFVLEI---RNANDSSSSVN----ILDS----  169

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              QM  D+E N+N+ + T      V    S LS+M  V   L  NPN+ A  +G+ WA ++
Sbjct  170   -QMVNDLERNDNSASVT-----TVPSRPSFLSMMKTVCVKLILNPNAQASVIGITWAFIS  223

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SRW +++P IIE S++IMSKAG G AMFSMGLF ALQE I+ CG  +T   +VLRFI GP
Sbjct  224   SRWHIEMPIIIERSVLIMSKAGIGSAMFSMGLFTALQEKILACGVRLTLFGLVLRFIAGP  283

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +GCL +GLRGDVLR++++QAALPQ++ASF+YAKEYGLHAD+LSTAV +G +VS+P+
Sbjct  284   AAMAMGCLAVGLRGDVLRVAVVQAALPQAIASFIYAKEYGLHADVLSTAVIVGMIVSLPV  343

Query  1132  LITYYVILGFL  1164
             LI Y++ LGF 
Sbjct  344   LIVYFIALGFF  354



>ref|XP_009383317.1| PREDICTED: putative auxin efflux carrier component 8 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 254/372 (68%), Gaps = 19/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKVV AMAPLYVAL LGY SV+ W +  P+QC+AINR      +P F FQF  
Sbjct  1     MISWGDIYKVVDAMAPLYVALGLGYGSVKWWRVITPEQCEAINRLVSCITLPLFTFQFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +P+ +NY F++ADA++K  +   LAAW   + KGS   SVT+FSL+TLTN+L+VGVPL
Sbjct  61    HTDPFAMNYRFVAADAISKVTIALLLAAWPKCSSKGSYCWSVTSFSLATLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             + AMYG    DLVVQ +V+Q +VW T LLF  +            R AG G    +   S
Sbjct  121   VGAMYGPWAQDLVVQLSVVQAIVWLTLLLFVFEL-----------RKAGCGLFSVATAPS  169

Query  592   VQMAGDVEANNNNETNTYSD-DSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
             +        N + E+    D D  V    S  SLM  V   LA NPNSYA  +G+ WA +
Sbjct  170   I-------GNASIESPPAKDADVDVASQPSFWSLMKTVWLKLALNPNSYASIVGITWAFI  222

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             A+RW  ++PSI+EGS++IMSKAG+G+AMFSMGLF+ALQE I+ CG S+TA  M L+F+ G
Sbjct  223   ANRWHFEMPSIMEGSVLIMSKAGTGMAMFSMGLFMALQEKILACGPSLTAFGMALKFVAG  282

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             P  T IG + +GLRGD+L +++IQAALPQS+ SF++A+EYGLHAD+LSTAV  G LVS+P
Sbjct  283   PVATAIGAIAVGLRGDILHLAIIQAALPQSITSFIFAREYGLHADVLSTAVIFGMLVSLP  342

Query  1129  LLITYYVILGFL  1164
             +L+TYYV+LGFL
Sbjct  343   VLVTYYVVLGFL  354



>gb|AIF28452.1| PIN-like protein, partial [Sanguinaria canadensis]
Length=340

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/360 (54%), Positives = 257/360 (71%), Gaps = 22/360 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW ++YKVVVAM PLYVA+ LG+ SVR W +F  +QCDAINRF CFF +PFF F+F A
Sbjct  1     MIGWADIYKVVVAMTPLYVAVILGFGSVRWWKIFSREQCDAINRFVCFFTLPFFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++PY  NY F+ ADA++K +++  LAAWA  + KGS   S+T+FSLSTLTN+L+VGVP+
Sbjct  61    HVDPYDWNYRFIGADAISKFIILVVLAAWAKCSSKGSYCWSITSFSLSTLTNSLVVGVPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG+   +LVVQ +V Q +VW T LLF L+F   R+  +++          DSH   
Sbjct  121   LKAMYGEHAVNLVVQGSVFQGIVWLTILLFVLEFRKARSDGSST-------ITSDSH---  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTEST--SVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
               M  D+E N            A+T +T  S LS+M  V   LA NPN+YA  +G+ WA 
Sbjct  171   --MVKDLEGNEK--------IVAITSTTRPSFLSMMKIVWLKLALNPNTYASIIGITWAF  220

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +++RW  ++PSI+EGSI+IMSKAG G AMFSMGLF+ALQE I+ CG ++T   ++LRFI 
Sbjct  221   ISNRWHFEMPSIMEGSILIMSKAGIGSAMFSMGLFVALQEKILACGTTLTVFGLILRFIA  280

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA  +IG + +GL GDVLR+++IQAALPQS+ SF+YAKEYGLHAD+LSTAV  G +VS+
Sbjct  281   GPAAMVIGSIAVGLHGDVLRVAIIQAALPQSITSFIYAKEYGLHADVLSTAVIFGMMVSL  340



>ref|XP_003534521.1| PREDICTED: putative auxin efflux carrier component 8-like [Glycine 
max]
Length=377

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 192/385 (50%), Positives = 267/385 (69%), Gaps = 21/385 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWEEVYKVVVA+ PLY AL LGY S++ W++F  +QC+AIN+  C+F +P F F+F A
Sbjct  1     MIGWEEVYKVVVAVVPLYFALLLGYGSLKWWNIFTREQCEAINKLVCYFTLPLFIFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +NY F++AD ++K +++  LA WA  T KG+ S S+T+FSL  LTN L+VGVP+
Sbjct  61    HIDPFKMNYSFIAADTISKFIIMVVLALWAKCTPKGTFSWSITSFSLCNLTNALVVGVPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFT-------------RTHPTTSSRV  552
             ++ MYG LG DLVVQA+VIQ  +WF  LLF L+FW T             +  P T    
Sbjct  121   VKPMYGALGVDLVVQASVIQATIWFPLLLFVLEFWRTGSEGTTITTTTTLKPRPKTMIID  180

Query  553   AGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNS  732
               +G  +D   ++V +  DV+     E      +S  +       +M  V   LA NPNS
Sbjct  181   NESGGGKDVEATTVAI--DVKEEMMLE------ESVTSSRLPFCKVMKLVWRKLATNPNS  232

Query  733   YACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASV  912
             + C +G+ WA +++RW+L++PS++EGSI IMSKAG+G AMFSMG F+ALQE ++ CG S+
Sbjct  233   FGCVIGISWAFISNRWNLEMPSMLEGSIQIMSKAGTGTAMFSMGTFMALQEKVIACGPSM  292

Query  913   TALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILS  1092
             T + +VL+FI GPA T IG +V+GLRGDVLR+ +IQAA+PQS+ SF++AKEYGLH ++LS
Sbjct  293   TIIGLVLKFIAGPAATAIGAIVVGLRGDVLRVVIIQAAVPQSITSFIFAKEYGLHPEVLS  352

Query  1093  TAVTIGTLVSVPLLITYYVILGFLH  1167
             TAV  G +VS+P+L+ YY IL F+H
Sbjct  353   TAVIFGMIVSLPVLVAYYAILEFVH  377



>ref|XP_006400192.1| hypothetical protein EUTSA_v10013986mg [Eutrema salsugineum]
 gb|ESQ41645.1| hypothetical protein EUTSA_v10013986mg [Eutrema salsugineum]
Length=348

 Score =   360 bits (923),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 188/372 (51%), Positives = 255/372 (69%), Gaps = 24/372 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYKV+ AM PLYVAL LGY SV+ W++F  DQCDAINR  C+F +P F F+F A
Sbjct  1     MISGGDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTLPLFTFEFAA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY F++AD ++K +++  L  WA ++KKGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFDMNYRFIAADVLSKVIIVTVLVFWAKYSKKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T LLF L+F           R AG           
Sbjct  121   AKAMYGQQAVDLVVQSSVFQAIVWLTLLLFVLEF-----------RRAG-----------  158

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                + + +A+N N      +   V E  S+L ++  V   LA NPN Y+C LG+ WA ++
Sbjct  159   --FSSNTKADNINIEGGRRETLVVGEEKSLLEVLSIVWLKLATNPNCYSCILGVAWAFIS  216

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW   +P I+EGSI+IMSKAG+G AMF+MG+F+ALQE ++ CG S+T L M L+FI GP
Sbjct  217   NRWHFGMPGIMEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVLGMFLKFIAGP  276

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+P+
Sbjct  277   AAMAIGSIAVGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPV  336

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  337   LVAYYAALEFIH  348



>ref|XP_002871722.1| hypothetical protein ARALYDRAFT_326097 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47981.1| hypothetical protein ARALYDRAFT_326097 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 189/372 (51%), Positives = 255/372 (69%), Gaps = 20/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYKV+ AM PLYVAL LGY SV+ W++F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MISCGDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTLPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++  LA WA ++ KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKVIIVTVLAFWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T                   R AG         SS
Sbjct  121   AKAMYGQQAVDLVVQSSVFQAIVWLT-----------LLLFVLELRKAG---------SS  160

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                + DV+ ++ N  N   +   V E  S L +M  V   LA NPN Y+C LG+ WAL++
Sbjct  161   SNYSSDVKVDSINIENGKREIVVVGEEKSFLEVMSLVWLKLATNPNCYSCILGIAWALIS  220

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW L++P I+EGSI+IMSKAG+G AMF+MG+F+ALQE ++ CG S+T + MVL+FI GP
Sbjct  221   NRWHLEMPGILEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGP  280

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + LGL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+P+
Sbjct  281   AAMAIGSIALGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPV  340

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  341   LVAYYAALEFIH  352



>ref|XP_009121478.1| PREDICTED: putative auxin efflux carrier component 8 [Brassica 
rapa]
 emb|CDX69445.1| BnaA10g17940D [Brassica napus]
Length=348

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/372 (51%), Positives = 252/372 (68%), Gaps = 24/372 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI  E+VYKV+ AM PLYVAL LGY SV+ WH+F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MITGEDVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++A LA WA ++  GS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADIISKVIIVAVLAFWAKYSNNGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T                   R AG           
Sbjct  121   AKAMYGQAAVDLVVQSSVFQAIVWLT-----------LLLFVLELRRAG-----------  158

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                + + +  N N  +   D + V E  S + +M  V   LA NPN Y+C LG+ WA ++
Sbjct  159   --FSTNSKEENINIEDGRKDIAVVGEQKSFVEVMSVVWLKLATNPNCYSCILGIAWAFIS  216

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SRW  ++P I+EGSI+IMSKAG+G AMF+MG+F+ALQE  + CGAS+TAL MVL+FI GP
Sbjct  217   SRWHFEMPGIMEGSILIMSKAGTGTAMFNMGIFMALQEKFIVCGASLTALGMVLKFIAGP  276

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+P+
Sbjct  277   AAMAIGSIAVGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPV  336

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  337   LVAYYAALEFIH  348



>ref|XP_006480407.1| PREDICTED: putative auxin efflux carrier component 8-like [Citrus 
sinensis]
Length=340

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 191/375 (51%), Positives = 258/375 (69%), Gaps = 38/375 (10%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKV+VAM PLY AL LGY SV+ W +  P++C AINR  C+F +P F  +F  
Sbjct  1     MIGWEDVYKVIVAMVPLYFALMLGYGSVKWWKIIAPEECAAINRLVCYFTLPLFTIEFTT  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGS-LSCSVTAFSLSTLTNTLIVGVP  408
             H++P+++NY F+ ADA++K +++  LA W+  +KKGS  S  +T FSL TLTNTL++GVP
Sbjct  61    HVDPFNMNYRFIGADAISKLIIVIVLAFWSMCSKKGSYFSWCITNFSLCTLTNTLVLGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             L++AMYG +  DLVVQ++V Q++VW T  LF L+F           R +G          
Sbjct  121   LMKAMYGQMAVDLVVQSSVFQSIVWLTIFLFVLEF-----------RRSG----------  159

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTS--VLSLMMPVLSNLAQNPNSYACFLGLFWA  762
                       N++ +     ++  VT S+      LM  V   LA+NPNSYAC +GL WA
Sbjct  160   ----------NDSKDL----EEGHVTSSSRPPFWHLMKVVWLKLAKNPNSYACVIGLAWA  205

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +A+RW  +LPSIIEGSI+IMSKAG+G AMFSMG+F+ALQE ++ CG  +TAL MVL+FI
Sbjct  206   FVANRWHFKLPSIIEGSILIMSKAGTGTAMFSMGIFMALQEKLLACGPGLTALGMVLKFI  265

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
              GPA   IG +  GL GDVLR+S+IQAALP+++ +F++AKEYGLHAD+LSTAV  GT+VS
Sbjct  266   AGPAAMAIGSIAAGLHGDVLRVSIIQAALPEAITTFIFAKEYGLHADVLSTAVIFGTIVS  325

Query  1123  VPLLITYYVILGFLH  1167
             +P+LI YY IL  +H
Sbjct  326   LPVLIAYYAILDIIH  340



>gb|KHN29283.1| Putative auxin efflux carrier component 8 [Glycine soja]
Length=376

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 191/384 (50%), Positives = 266/384 (69%), Gaps = 20/384 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWEEVYKVVVA+ PLY AL LGY S++ W++F  +QC+AIN+  C+F +P F F+F A
Sbjct  1     MIGWEEVYKVVVAVVPLYFALLLGYGSLKWWNIFTREQCEAINKLVCYFTLPLFIFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +N+ F++AD ++K +++  LA WA  T KG+ S S+T+FSL  LTN L+VGVP+
Sbjct  61    HIDPFKMNFSFIAADTISKFIIMVVLALWAKCTPKGTFSWSITSFSLCNLTNALVVGVPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFT------------RTHPTTSSRVA  555
             ++ MYG LG DLVVQA+VIQ  +WF  LLF L+FW T            +  P T     
Sbjct  121   VKPMYGALGVDLVVQASVIQATIWFPLLLFVLEFWRTGSEGTTITTTTLKPRPKTMIIDN  180

Query  556   GAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSY  735
              +G  +D   ++V  A DV+     E      +S  +       +M  V   LA NPNS+
Sbjct  181   ESGGGKDVEATTV--AIDVKEEMMLE------ESVTSSRLPFCKVMKLVWRKLATNPNSF  232

Query  736   ACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVT  915
              C +G+ WA +++RW+L++PS++EGSI IMSKAG+G AMFSMG F+ALQE ++ CG S+T
Sbjct  233   GCVIGISWAFISNRWNLEMPSMLEGSIQIMSKAGTGTAMFSMGTFMALQEKVIACGPSMT  292

Query  916   ALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILST  1095
              + +VL+FI GPA T IG +V+GLR DVLR+ +IQAA+PQS+ SF++AKEYGLH ++LST
Sbjct  293   IIGLVLKFIAGPAATAIGAIVVGLRDDVLRVVIIQAAVPQSITSFIFAKEYGLHPEVLST  352

Query  1096  AVTIGTLVSVPLLITYYVILGFLH  1167
             AV  G +VS+P+L+ YY IL F+H
Sbjct  353   AVIFGMIVSLPVLVAYYAILEFVH  376



>gb|AIF28457.1| PIN-like protein, partial [Heliconia sp. SFB-2014]
Length=359

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 195/371 (53%), Positives = 255/371 (69%), Gaps = 13/371 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKVVVAM PLYVAL LGY SVR W +  P+QC+AINR      +P F  +F  
Sbjct  1     MISWGDIYKVVVAMVPLYVALGLGYGSVRWWRIITPEQCEAINRLVSCITLPLFTLEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +P+ +NY F++ADA++K +++  LAAW   + KGS   S+T+FSLSTLTN+L+VGVPL
Sbjct  61    HTDPFAMNYRFIAADAISKIMIVLLLAAWPKCSSKGSYCWSITSFSLSTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             + AMYG    DLVVQ +V+Q +VW T LLF  +            R AG G      G +
Sbjct  121   VTAMYGQWAQDLVVQLSVVQAIVWLTLLLFIFEV-----------RQAGCGLFSSGVGGA  169

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                   VE+    + +    ++ V    S  SLM  V   LA NPNSYA  +G+ WA LA
Sbjct  170   AGQIASVESPPVKDVD--GGNAQVVARPSFWSLMKIVWLKLALNPNSYASLVGITWAFLA  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++PSI+EGSI+IMSKAG+G+AMFSMGLF+ALQE I+ CG S+TA  MVL+FI GP
Sbjct  228   NRWHFEMPSIMEGSILIMSKAGTGMAMFSMGLFMALQEKILACGPSLTAFGMVLKFIAGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A T I  + +GLRGD+L +++IQAALPQS+ SF++A+EYGLHAD+LSTAV  G LVS+PL
Sbjct  288   AATAIAAIAVGLRGDILHLAIIQAALPQSITSFIFAREYGLHADVLSTAVIFGMLVSLPL  347

Query  1132  LITYYVILGFL  1164
             L+TYYV+LG L
Sbjct  348   LVTYYVVLGLL  358



>ref|XP_011014382.1| PREDICTED: putative auxin efflux carrier component 8 [Populus 
euphratica]
Length=346

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/371 (53%), Positives = 265/371 (71%), Gaps = 26/371 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVA+ PLYVAL LGY SVR W +F P+QC AINRF C+F +P F F+F A
Sbjct  1     MIGWEDVYKVVVAVVPLYVALVLGYGSVRWWKVFTPEQCGAINRFVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY F+ ADAV+K +++A LA WA  + KGS S S+T+FSL TLTN+L+VGVP+
Sbjct  61    HVDPFKMNYLFIGADAVSKVIIVAVLAFWAKCSSKGSYSWSITSFSLCTLTNSLVVGVPI  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG  G DLVVQ++VIQ ++W T LL  L+F           R  G G         
Sbjct  121   IKAMYGTAGVDLVVQSSVIQAIIWLTLLLLVLEF-----------RRTGLG---------  160

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                     +NN+++    S D+  +   +   LM  V   LA NPNSYAC +GL WA ++
Sbjct  161   ------FSSNNSDKDLEGSVDNTESSRPAFWCLMKTVWVKLAMNPNSYACIIGLVWAFIS  214

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++P+++EGSI+IMSKAG+G AMFSMG+F+ALQE ++ CGAS+T + M+LRFI GP
Sbjct  215   NRWHFEMPAMMEGSILIMSKAGTGTAMFSMGIFMALQEKVISCGASLTVIGMILRFIAGP  274

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL+GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  G L ++P+
Sbjct  275   AAMAIGSIAVGLQGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGMLAALPI  334

Query  1132  LITYYVILGFL  1164
             LI YY IL F+
Sbjct  335   LIAYYAILEFV  345



>ref|XP_010492564.1| PREDICTED: putative auxin efflux carrier component 8 [Camelina 
sativa]
Length=352

 Score =   356 bits (914),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/372 (50%), Positives = 255/372 (69%), Gaps = 20/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYKV+ AM PLYVAL LGY SV+ W +F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MISGGDVYKVIEAMVPLYVALILGYGSVKWWKIFTRDQCDAINRLVCYFTMPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++  LA WA ++ KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKVIIVTVLAFWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLV+Q++V Q +VW T                   R AG     +S+GSS
Sbjct  121   AKAMYGQQAVDLVIQSSVFQAIVWLT-----------LLLFVLELRRAG----FNSNGSS  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  D + +N N  +   +   V E  S L +M  V   LA NPN Y+C LG+ WA ++
Sbjct  166   -----DAKVDNINIESGKRETEVVGEEKSFLQVMSLVWWKLATNPNCYSCILGIAWAFIS  220

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW +++P I+EGSI+IMSKAG+G AMF+MG+F+ALQE ++ CG S+T + MVL+FI GP
Sbjct  221   NRWHMEMPGILEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGP  280

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG +  GL GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  GTLVS+P+
Sbjct  281   AAMAIGSIAFGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGTLVSLPV  340

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  341   LVAYYAALEFIH  352



>emb|CDY67254.1| BnaCnng54140D [Brassica napus]
Length=348

 Score =   355 bits (911),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 187/372 (50%), Positives = 251/372 (67%), Gaps = 24/372 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI  E+VYKV+ AM PLYVAL LGY SV+ WH+F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MITGEDVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++A LA WA ++  GS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADIISKVIIVAVLAFWAKYSNNGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T                   R AG           
Sbjct  121   AKAMYGQAAVDLVVQSSVFQAIVWLT-----------LLLFVLELRRAGFNT--------  161

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  + +  N N  +   D + V E  S + +M  V   LA NPN Y+C LG+ WA ++
Sbjct  162   -----NSKEENINIEDGRKDIAVVGEQKSFVEVMSVVWLKLATNPNCYSCILGIAWAFIS  216

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SRW  ++P I+EGSI+IMSKAG+G AMF+MG+F+ALQE  + CGAS+TAL MVL+FI GP
Sbjct  217   SRWHFEMPGIMEGSILIMSKAGTGTAMFNMGIFMALQEKFIVCGASLTALGMVLKFIAGP  276

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+P+
Sbjct  277   AAMAIGSIAVGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPV  336

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F++
Sbjct  337   LVAYYAALEFIY  348



>ref|XP_010420348.1| PREDICTED: putative auxin efflux carrier component 8 [Camelina 
sativa]
Length=352

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 186/372 (50%), Positives = 256/372 (69%), Gaps = 20/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYKV+ AM PLYVAL LGY SV+ W++F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MISGGDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTMPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++  LA WA ++ KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKVIIVTVLAFWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLV+Q++V Q +VW T                   R AG     +S+GSS
Sbjct  121   AKAMYGQQAVDLVIQSSVFQAIVWLT-----------LLLFVLELRRAG----FNSNGSS  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  D + +N N  +   +   V E  S L +M  V   LA NPN Y+C LG+ WA ++
Sbjct  166   -----DAKVDNINIESGKRETEVVGEEKSFLQVMSLVWWKLATNPNCYSCILGIAWAFIS  220

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW L++P I+EGSI+I+SKAG+G AMF+MG+F+ALQE ++ CG S+T + MVL+FI GP
Sbjct  221   NRWHLEMPGILEGSILIISKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGP  280

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG +  GL GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  GTLVS+P+
Sbjct  281   AAMAIGSIAFGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGTLVSLPV  340

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  341   LVAYYAALEFIH  352



>gb|EYU39429.1| hypothetical protein MIMGU_mgv1a009388mg [Erythranthe guttata]
Length=344

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/372 (52%), Positives = 253/372 (68%), Gaps = 28/372 (8%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIG E+VYKVVV +APLYVAL LGY SV+   MF P+QC+AINR  C+F  P F F+F A
Sbjct  1     MIGREDVYKVVVGIAPLYVALMLGYSSVKWCRMFSPEQCEAINRLVCYFTYPLFVFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+ +NY  + AD ++K +++  L  WA    KGS   S+T+FSLSTLTN+L+VGVPL
Sbjct  61    HVDPFKMNYLMMGADVISKVIIVMVLGCWAK-CCKGSYCWSITSFSLSTLTNSLVVGVPL  119

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG +  DLVVQ++V Q LVW + LLF L+                    R ++   
Sbjct  120   LKAMYGPMAVDLVVQSSVFQALVWLSILLFVLEL-------------------RRTYHDH  160

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V  A D+E   N  +   +D S +    +  +LM  V   LA NPNSYAC LG+ WA L+
Sbjct  161   VA-AADLE---NQSSGVIADASRI----NFWNLMRRVSLKLAINPNSYACILGITWAFLS  212

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++PS++EGSI+IMS+AG+G  MFSMGLF+ALQE ++ CGAS+T   M LRFI GP
Sbjct  213   NRWHFEMPSVMEGSILIMSRAGTGTTMFSMGLFMALQEKVIACGASLTVFGMALRFIAGP  272

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                 +    +GL GDVLRI++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G +VS+P+
Sbjct  273   LAMALASFAVGLHGDVLRIAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPV  332

Query  1132  LITYYVILGFLH  1167
             LI YY IL F+H
Sbjct  333   LIAYYAILEFVH  344



>ref|XP_010453817.1| PREDICTED: putative auxin efflux carrier component 8 [Camelina 
sativa]
Length=352

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/372 (50%), Positives = 255/372 (69%), Gaps = 20/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYKV+ AM PLYVAL LGY SV+ W++F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MISGGDVYKVIEAMVPLYVALILGYGSVKWWNIFTRDQCDAINRLVCYFTMPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++  LA WA ++ KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKVIIVTVLAFWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLV+Q++V Q +VW T                   R AG      S+GSS
Sbjct  121   AKAMYGQQAVDLVIQSSVFQAIVWLT-----------LLLFVLELRRAG----FSSNGSS  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  D + +N +  +   +   V E  S L +M  V   LA NPN Y+C LG+ WA ++
Sbjct  166   -----DTKVDNISIESGKGETVVVGEEKSFLQVMSLVWWKLATNPNCYSCILGIAWAFIS  220

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW L++P I+EGSI+IMSKAG+G AMF+MG+F+ALQE ++ CG S+T + MVL+FI GP
Sbjct  221   NRWHLEMPGILEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGP  280

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG +  GL GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTAV  GTLVS+P+
Sbjct  281   AAMAIGSIAFGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTAVIFGTLVSLPV  340

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  341   LVAYYAALEFIH  352



>gb|AIF28459.1| PIN-like protein, partial [Ludovia sp. SFB-2014]
Length=353

 Score =   353 bits (905),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 258/371 (70%), Gaps = 19/371 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKVVVAM PLYVAL LGY SVR W +F P+QC+AINR    F +P F F+F  
Sbjct  1     MIAWGDIYKVVVAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRLVSCFTLPLFTFEFAC  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +P+  NY  ++ADA++K +++ ALAAWA  + KGS   S+T+FSLSTLTN+L++GVPL
Sbjct  61    HADPFAWNYRCIAADAISKIIIVLALAAWAKCSSKGSYCWSITSFSLSTLTNSLVIGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L AMYG    DLVVQ +++Q +V F            R   +  + VA   A   S GSS
Sbjct  121   LNAMYGAGAQDLVVQLSLLQAIVEF------------RKARSGVAMVADTAA---SSGSS  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
               ++  +E+       + S+++A     S  +LM  V   LA NPNSYA  +G+ WA +A
Sbjct  166   HVVS--IESPTKEGDGSRSNENA--RRPSFWALMKIVWLKLALNPNSYASIMGISWAFIA  221

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW   +PSI+EGS++IMS+AG+G+AMFSMGLF+ALQE +V CGAS+T   M LRFI GP
Sbjct  222   NRWQFGMPSIMEGSVLIMSRAGAGMAMFSMGLFMALQEKLVACGASLTVFGMALRFIAGP  281

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAALPQS+ SF++A+EYGLHAD+LSTAV  G LVS+P+
Sbjct  282   AAMAIGSIAVGLHGDVLRVAIIQAALPQSITSFIFAREYGLHADVLSTAVIFGMLVSLPV  341

Query  1132  LITYYVILGFL  1164
             LI YYV+LGF+
Sbjct  342   LIGYYVVLGFM  352



>ref|XP_008794580.1| PREDICTED: putative auxin efflux carrier component 8 [Phoenix 
dactylifera]
Length=353

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 193/373 (52%), Positives = 249/373 (67%), Gaps = 23/373 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW ++YKVVVAM PLYVAL LGY SVR W +F P+QC+AINR   +F +PFF F+F  
Sbjct  1     MIGWADIYKVVVAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRMVAYFSLPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +NY  ++ADA++K +++  LAAWA  + KGS   S+T+FSL TLTN+L+VG PL
Sbjct  61    HIDPFAMNYRAIAADAISKLIIVLVLAAWAKCSSKGSYCWSITSFSLCTLTNSLVVGAPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L  MYG    DLVVQ +V+Q +VW T                   R AG          S
Sbjct  121   LNEMYGRWAQDLVVQLSVVQAIVWLT-----------LLLFVLELRKAGTSNGGGGGVVS  169

Query  592   V--QMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
             V  Q   DVE N             V    +  SLM  V   LA NPNSYA  +G+ WA 
Sbjct  170   VEQQPVKDVEGNMTE----------VASRPAFWSLMKTVWLKLALNPNSYASIVGITWAF  219

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             LA+R+   +PSI+EGS++IMSKAG+G+AMFSMGLF+A+QE IV CG S+TA  M LRF+ 
Sbjct  220   LANRFHFGMPSIMEGSVLIMSKAGTGLAMFSMGLFMAMQEKIVACGPSLTAFGMALRFVA  279

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   IG + +GLRGD+LR+++IQAA+PQS+ SF++A+EYGLHAD+LSTAV  G LVS+
Sbjct  280   GPAAMAIGSIAVGLRGDLLRVAIIQAAVPQSITSFIFAREYGLHADVLSTAVIFGMLVSL  339

Query  1126  PLLITYYVILGFL  1164
             PLL+ YY+ LGF 
Sbjct  340   PLLVAYYIALGFF  352



>ref|XP_007139738.1| hypothetical protein PHAVU_008G055200g [Phaseolus vulgaris]
 gb|ESW11732.1| hypothetical protein PHAVU_008G055200g [Phaseolus vulgaris]
Length=378

 Score =   350 bits (899),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 186/379 (49%), Positives = 265/379 (70%), Gaps = 8/379 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVA+ PLYVAL LGY SV+ W +F  +QC+AIN+  C+F +P F F+F A
Sbjct  1     MIGWEDVYKVVVAVVPLYVALVLGYGSVKWWKIFTREQCEAINKLVCYFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +N+ F++AD ++K +++  LA WA  TK GS   S+T+FSL TLTN L+VGVP+
Sbjct  61    HIDPFKMNFSFIAADTISKFIIMLVLALWAKCTK-GSFCWSITSFSLCTLTNALVVGVPM  119

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTS-----SRVAGAGAARD  576
             ++ MYG LG DLVVQ++V+Q ++W TFLLF L+F  T    TT+     S+     +  +
Sbjct  120   VKPMYGALGEDLVVQSSVVQAIIWLTFLLFVLEFRRTAIEGTTNTFKPKSKAMIVDSNTN  179

Query  577   SHGSSVQMAGDVEANNN--NETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLG  750
             +      M  DVE N    +     + +  V+    +  LM  V   L  NPNSY C +G
Sbjct  180   NKTGEGGMGKDVEENTVAIDVKEELALEETVSSRIPLCKLMKLVWIKLVMNPNSYGCVIG  239

Query  751   LFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMV  930
             + WA +++RW+L++PS++EGSI IMSKAG+G AMFSMG+F+ALQ+ ++ CG S+T   +V
Sbjct  240   ISWAFISNRWNLEMPSMLEGSIQIMSKAGTGTAMFSMGIFMALQDKLIACGPSLTVFGLV  299

Query  931   LRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIG  1110
             L+FI GPA   IG + +GL GDVLR+++IQAA+PQS+ SF++AKEYGLH ++LSTAV  G
Sbjct  300   LKFIAGPAAMAIGAIAVGLHGDVLRVAIIQAAVPQSITSFIFAKEYGLHPEVLSTAVIFG  359

Query  1111  TLVSVPLLITYYVILGFLH  1167
              ++S+P+L+ YY IL  +H
Sbjct  360   MIISLPILVAYYGILELIH  378



>gb|AIF28454.1| PIN-like protein, partial [Hakea drupacea]
Length=297

 Score =   345 bits (886),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 227/314 (72%), Gaps = 18/314 (6%)
 Frame = +1

Query  229   AHINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVP  408
             A+INP+ +N+ F++ADA++K +++  LA WA  + KGS   S+T+FSLSTLTN+L+VGVP
Sbjct  1     ANINPFKMNFLFIAADAISKVVIVVVLAFWAKCSSKGSYCWSITSFSLSTLTNSLVVGVP  60

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHG-  585
             LL+AMYG +  DLVVQ++VIQ +VW TFLLF L+F   +T   T S +A      +SH  
Sbjct  61    LLKAMYGQMAVDLVVQSSVIQGIVWLTFLLFVLEF--RKTRSDTISMIA------ESHAV  112

Query  586   SSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
             S ++   DVE N         +        S  SLM  V   LA NPNSYACF+G+ WA 
Sbjct  113   SQLESVKDVEGN---------EQMVAISKPSFRSLMKMVGLKLALNPNSYACFIGMAWAF  163

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +ASRW L++PSIIEGSI+IMS+AG G+AMFSMGLF+ALQE  + CG S+T   +VLRF+ 
Sbjct  164   VASRWKLEMPSIIEGSILIMSRAGIGMAMFSMGLFMALQEKFIACGPSLTVFGLVLRFVA  223

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   IG + +GLRGDVLR+++IQAALPQS+ SF+YAKEYGLHAD+LSTAV +G ++S+
Sbjct  224   GPAAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIYAKEYGLHADVLSTAVILGMILSL  283

Query  1126  PLLITYYVILGFLH  1167
             P+L+ YY IL F+H
Sbjct  284   PILVGYYAILEFMH  297



>ref|XP_011077194.1| PREDICTED: putative auxin efflux carrier component 8 [Sesamum 
indicum]
Length=394

 Score =   349 bits (895),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 194/394 (49%), Positives = 266/394 (68%), Gaps = 22/394 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKV+V +APLYVAL LGY SV+ W MF PDQC+AINR  C+F  P F F+F A
Sbjct  1     MIGWEDVYKVLVGIAPLYVALILGYCSVKWWRMFTPDQCEAINRLVCYFTYPLFVFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              ++P+ +NY F++ADA++K +++ ALA WA  + KGS   S+T+FSLSTLT++L+VGVPL
Sbjct  61    SVDPFKMNYLFMAADAISKLIIVTALACWAKCSSKGSYCWSITSFSLSTLTSSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTH---------PTTSSRVAGAG  564
             L++MYG +  DLVVQ++V Q LVW + LLF L+   TR              ++ +    
Sbjct  121   LKSMYGPMAVDLVVQSSVFQALVWLSILLFVLELRRTRNQLHCFDDDDHHHDNNIIIIHD  180

Query  565   AARDSHGSSVQMAGDVEANNNNETN-------------TYSDDSAVTESTSVLSLMMPVL  705
                D H  +       +  NN E                 +  ++     S  SLM  V 
Sbjct  181   QTTDVHVVAAATTTTTDEGNNLENQLSNDINNNNICDSKSTTSTSSNRQPSFWSLMKRVW  240

Query  706   SNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQE  885
               LA+NPNSYAC +G+ WA L++RW+ ++P+I+EGSI+IMS+AG+G AMFSMGLF+ALQE
Sbjct  241   LKLAKNPNSYACIIGIAWAFLSNRWNFKMPNIMEGSILIMSRAGTGTAMFSMGLFMALQE  300

Query  886   NIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKE  1065
              ++ CGAS+T   M LRFI GP    +G + +GL GDVLR+++IQAALPQS+ SF++AKE
Sbjct  301   KVIACGASLTVFGMALRFIAGPLAMALGSVAVGLHGDVLRVAIIQAALPQSITSFIFAKE  360

Query  1066  YGLHADILSTAVTIGTLVSVPLLITYYVILGFLH  1167
             YGLHA++LSTAV  G +VS+P+LI YY +L F+H
Sbjct  361   YGLHAEVLSTAVIFGMIVSLPVLIGYYALLEFVH  394



>ref|XP_006480408.1| PREDICTED: putative auxin efflux carrier component 8-like [Citrus 
sinensis]
Length=334

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 185/373 (50%), Positives = 248/373 (66%), Gaps = 40/373 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVV AM PLY AL LGY SV+ W +  P++C A+NRF C+F +P F  +F  
Sbjct  1     MIGWEDVYKVVEAMVPLYFALMLGYGSVKWWKIIAPEECAAVNRFVCYFTLPLFTIEFTT  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSL-SCSVTAFSLSTLTNTLIVGVP  408
              ++P++LNY  + ADA++K +++  LA WA  +K  S  S  +T FSL TLTN+L+VGVP
Sbjct  61    QVDPFNLNYRLIGADAISKLIIVFVLAFWAMCSKNESCYSWCITNFSLCTLTNSLVVGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             LL+ MYG +  DLVVQ++V+Q+++W T  LF L++         S+R+            
Sbjct  121   LLKPMYGQMAVDLVVQSSVLQSILWLTIFLFVLEY-------RRSARI------------  161

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
                   D+E  +                 S   LM  V   +A+NPNSYAC LGL WA +
Sbjct  162   ------DLEEGHGRP--------------SFWHLMKIVWLKMAKNPNSYACILGLAWAFV  201

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             A RW L++P IIEGSI+IMS+AG+G AMFSMG+F+ALQE ++ CG  +T   MVL+FI G
Sbjct  202   AHRWHLKMPGIIEGSILIMSRAGTGTAMFSMGIFMALQEKLIACGPKLTVFGMVLKFIAG  261

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   IG +  GLRGDVLR+S+IQAALP+++ SF++AKEYGLHAD+LSTAV  GT+VS+P
Sbjct  262   PAAMAIGSIAAGLRGDVLRVSIIQAALPEAITSFIFAKEYGLHADVLSTAVIFGTIVSLP  321

Query  1129  LLITYYVILGFLH  1167
             LLI YY IL  +H
Sbjct  322   LLIAYYAILDIVH  334



>ref|NP_001276305.1| uncharacterized protein LOC100784879 [Glycine max]
 gb|AGJ95067.1| PIN9b [Glycine max]
Length=369

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/375 (49%), Positives = 262/375 (70%), Gaps = 9/375 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVA+ PLY AL LGY S++ W++F  +QC+AIN+  C+F +P F F+F A
Sbjct  1     MIGWEDVYKVVVAVVPLYFALLLGYGSLKWWNIFTKEQCEAINKLVCYFTLPLFIFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +N+ F++AD ++K +++  LA WA  T K +   S+ +FSL  LTN ++VGVP+
Sbjct  61    HIDPFKMNFSFIAADTISKFIIMVVLALWAKCTPKCTFCWSIISFSLCNLTNAVVVGVPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAA---RDSH  582
             ++ MYG LG DLVVQ++V+Q  +W   LLF ++FW T    TT++ V         ++  
Sbjct  121   VKPMYGALGVDLVVQSSVLQATIWLPLLLFVMEFWRTGIEGTTTTTVKPRSKTMINKNEG  180

Query  583   GSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
             G       DVEA +  E     +  +VT       +M  V   LA NPNSY C +G+ WA
Sbjct  181   GG----GKDVEAVDVKEELMLEE--SVTSRLPFCKVMKLVWRKLATNPNSYGCVIGISWA  234

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +++RW+L++PS++EGSI IMSKAG+G AMFSMG+F+ALQE ++ CG S+T + +VL+FI
Sbjct  235   FISNRWNLEMPSMLEGSIQIMSKAGTGTAMFSMGIFMALQEKLIACGPSMTLIGLVLKFI  294

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
              GPA T IG + +GLRGDVLR+ +IQAA+PQS+ SF++AKEYGLH ++LST V  G +VS
Sbjct  295   AGPAATAIGAIAVGLRGDVLRVVIIQAAVPQSITSFIFAKEYGLHPEVLSTGVIFGMIVS  354

Query  1123  VPLLITYYVILGFLH  1167
             +P+L+ YY IL F+H
Sbjct  355   LPVLVAYYAILEFVH  369



>ref|NP_001045214.1| Os01g0919800 [Oryza sativa Japonica Group]
 sp|Q5JLM1.1|PIN6_ORYSJ RecName: Full=Probable auxin efflux carrier component 6; AltName: 
Full=OsPIN6 [Oryza sativa Japonica Group]
 dbj|BAD87633.1| auxin efflux carrier-like [Oryza sativa Japonica Group]
 dbj|BAF07128.1| Os01g0919800 [Oryza sativa Japonica Group]
 gb|EEC72049.1| hypothetical protein OsI_04955 [Oryza sativa Indica Group]
 tpd|FAA00683.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group]
 gb|AGV28596.1| auxin efflux carrier 5a [Oryza sativa Indica Group]
Length=363

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 252/370 (68%), Gaps = 13/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A  PLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKG--SLSCSVTAFSLSTLTNTLIVGV  405
             H +P+ +NY  ++AD ++K +++A + AWA F  KG  ++S S+T+FSLSTLTN+L+VGV
Sbjct  61    HTDPFQVNYRAVAADVISKAVIVAVIGAWARFMSKGGCAVSWSITSFSLSTLTNSLVVGV  120

Query  406   PLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHG  585
             P+ RAMYG+    LVVQ +V Q +VW T LLF L+            R A  G   D   
Sbjct  121   PMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEV-----------RKAAIGMYVDGAE  169

Query  586   SSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
             ++     DVEA            +A     S+ +L+  V   LA+NPN+YA F+G+ WA 
Sbjct  170   AAAAAGKDVEAAGAAAAAGTVVVAAAAGKPSLWALVKVVAHKLARNPNTYASFVGITWAC  229

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             LA+R  + LPS  EGS++IMSK+G+G+AMFSMGLF+A QE I+ CG S  AL +VL+F +
Sbjct  230   LANRLHIALPSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKIIACGTSFAALGLVLKFAL  289

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   IG + +GLRGDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+
Sbjct  290   GPAAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSL  349

Query  1126  PLLITYYVIL  1155
             PLL+ +Y++L
Sbjct  350   PLLVGFYIVL  359



>emb|CDX70699.1| BnaC03g07830D [Brassica napus]
Length=348

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 247/372 (66%), Gaps = 24/372 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYK + AM PLYVAL  GY SV+ W++F  DQCDAIN+   +F +P F  +F  
Sbjct  1     MISGGDVYKAIEAMVPLYVALISGYGSVKWWNIFTRDQCDAINQLVYYFTLPLFTIEFTT  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K ++IA LA WA ++ KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKIIIIAVLAFWAKYSSKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T                   R AG           
Sbjct  121   AKAMYGQEAVDLVVQSSVFQAIVWLT-----------LLLFVLELRRAG-----------  158

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                + + + ++ N      +   V E  S L +M  V   LA NPN Y+C LG+ WA ++
Sbjct  159   --FSSNNKVDDINIEGGRKETVVVREEKSFLEVMSVVWLKLATNPNCYSCILGIAWAFIS  216

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++P IIEGSI+IMSKAG+G AMF+MG+F+ALQ+ ++ CG S+TA+ MVL+FI GP
Sbjct  217   NRWHFEMPGIIEGSILIMSKAGTGTAMFNMGIFMALQDKLIVCGTSLTAMGMVLKFIAGP  276

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+P+
Sbjct  277   AAMAIGSIAVGLYGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPV  336

Query  1132  LITYYVILGFLH  1167
             L+ YY  L F+H
Sbjct  337   LVAYYAALEFIH  348



>ref|XP_006645238.1| PREDICTED: probable auxin efflux carrier component 6-like [Oryza 
brachyantha]
Length=360

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 254/370 (69%), Gaps = 16/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A  PLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKG--SLSCSVTAFSLSTLTNTLIVGV  405
             H +P+ +NY  ++AD ++K +++A +  WA F  KG  ++S S+T+FSLSTLTN+L+VGV
Sbjct  61    HTDPFEVNYRAVAADVISKAVIVAVIGVWARFMSKGGCAVSWSITSFSLSTLTNSLVVGV  120

Query  406   PLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHG  585
             P+ RAMYG+    LVVQ +V Q +VW T LLF L+            R A  G   D+  
Sbjct  121   PMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEV-----------RKAAIGMYVDAAA  169

Query  586   SSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
                ++  DVEA  +    T S   A     S+ +L+  V   LA+NPN+YA F+G+ WA 
Sbjct  170   DPAKV--DVEATASAAAGTVSGAGA-GGKPSLWALVKVVAHKLARNPNTYASFVGITWAC  226

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +A+R  + LPS  EGS++IMSK+G+G+AMFSMGLF+A QE I+ CG S  AL +VL+F +
Sbjct  227   VANRLHIALPSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKIIACGPSFAALGLVLKFAL  286

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   IG + +GLRGDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+
Sbjct  287   GPAAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSL  346

Query  1126  PLLITYYVIL  1155
             PLL+ +Y++L
Sbjct  347   PLLVGFYIVL  356



>ref|XP_009131547.1| PREDICTED: putative auxin efflux carrier component 8 [Brassica 
rapa]
Length=348

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 246/376 (65%), Gaps = 32/376 (9%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYKV+ AM PLYVAL  GY SV+ W++F  DQCDAIN+   +F +P F  +F A
Sbjct  1     MISGGDVYKVIEAMVPLYVALISGYGSVKWWNIFTRDQCDAINQLVYYFTLPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K ++IA LA WA ++ KGS    +T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKIIIIAVLAFWAKYSSKGSYCWYITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T                   R AG           
Sbjct  121   GKAMYGQEAVDLVVQSSVFQGIVWLT-----------LLLFVLELRRAG-----------  158

Query  592   VQMAGDVEANNN----NETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
                     +NNN    N      +   V E  S L +M  V   LA NPN Y+C LG+ W
Sbjct  159   ------FSSNNNVDDINIEGGRKETVVVREEKSFLEVMSVVWLKLATNPNCYSCILGIAW  212

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             A +++RW  ++P IIEGSI+IMSKAG+G AMF+MG+F+ALQ+ ++ CG S+TA+ MVL+F
Sbjct  213   AFISNRWHFEMPGIIEGSILIMSKAGTGTAMFNMGIFMALQDKLIVCGTSLTAIGMVLKF  272

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             I GPA   IG + +GL G+VLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G LV
Sbjct  273   IAGPAAMAIGSIAVGLHGNVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLV  332

Query  1120  SVPLLITYYVILGFLH  1167
             S+P L+ YY  L F+H
Sbjct  333   SLPALVAYYAALEFIH  348



>ref|XP_010927702.1| PREDICTED: putative auxin efflux carrier component 8 [Elaeis 
guineensis]
Length=351

 Score =   339 bits (870),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 184/371 (50%), Positives = 246/371 (66%), Gaps = 21/371 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW ++Y VV AM PLYVAL LGY SVR W +F P+QC+AINR   +F  PFF  +F  
Sbjct  1     MIGWADIYNVVAAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRMVAYFSFPFFTLEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +PY +NY  + ADA++K +++  LAAWA  + KGS   S+T++SL TLTN+L+VG PL
Sbjct  61    HTDPYAMNYRVIGADAISKLIIVLVLAAWAKCSSKGSYCWSITSYSLCTLTNSLVVGAPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L  MYG    DLVVQ +V+Q +VW T LLF L+    R      + VA   +  D  G  
Sbjct  121   LNGMYGQWAQDLVVQLSVVQAIVWLTLLLFVLE---LRKARIQEAMVAAISSDHDGSGGG  177

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              ++                   +V    +  SLM  V   LA NPNSYA  +G+ WA +A
Sbjct  178   ARIV------------------SVVHRPAFWSLMKIVWLKLAVNPNSYASIVGITWAFVA  219

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW L++PSI+EGS++IMS+AG+G+AMFSMGLF+A QE I+ CG  +TA  M LRF  GP
Sbjct  220   NRWHLEMPSIMEGSVLIMSRAGTGLAMFSMGLFMATQEKIIACGPRLTAFGMALRFAAGP  279

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GLRGD+LR+++IQAA+PQS+ SF++A+EYGLHA++LSTAV  G LVS+PL
Sbjct  280   AAMAIGAIAVGLRGDLLRVAIIQAAIPQSITSFIFAREYGLHAEVLSTAVIFGMLVSLPL  339

Query  1132  LITYYVILGFL  1164
             L+ YY  L F+
Sbjct  340   LVAYYFALSFM  350



>gb|AIF28455.1| PIN-like protein, partial [Lepidosperma gibsonii]
Length=363

 Score =   339 bits (870),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 246/370 (66%), Gaps = 9/370 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW  +YKVV AM PLY+AL LGY SVR W +F P++CD INR   +F  PFF FQF  
Sbjct  1     MIGWGGIYKVVEAMVPLYMALGLGYGSVRWWRIFTPEECDTINRLVAYFAFPFFAFQFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +P+ +NY  ++AD ++ T  I +LA WA  + KGS   S+T+FSLSTLTN+L+VGVPL
Sbjct  61    HCDPFTMNYRAIAADMISXT--ILSLAVWAKCSSKGSYCWSITSFSLSTLTNSLVVGVPL  118

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L AMYG   A LVVQ +V Q + W T LLF L+      +    ++VA          ++
Sbjct  119   LGAMYGPWAAQLVVQLSVFQAISWLTLLLFVLEVRKAGNNMIEVTKVANGNTNEHKEETA  178

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              +   D EA N  +       S      S  SLM      LA NPNSYA  +G+ WAL+A
Sbjct  179   TK---DPEAGNGTDVVVVVASS----RRSFCSLMKVAGLKLAINPNSYASIVGITWALVA  231

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +R   +LPSI++G + IM+KAG+G+AMFSMGLF+A QE I+ CG  +TA  M LRFI GP
Sbjct  232   NRLHFELPSILDGCVQIMAKAGTGMAMFSMGLFMATQEKIIACGPGLTAFGMALRFIAGP  291

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAA+PQS+ SFVYA+EYGLHA+++STAV  G LVS+P+
Sbjct  292   AAMAIGSIAVGLHGDVLRVAIIQAAVPQSITSFVYAREYGLHANVISTAVIFGMLVSLPV  351

Query  1132  LITYYVILGF  1161
             LI YY++LGF
Sbjct  352   LILYYILLGF  361



>gb|AIF28450.1| PIN-like protein, partial [Papaver rhoeas]
Length=338

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 245/357 (69%), Gaps = 19/357 (5%)
 Frame = +1

Query  97    PLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLSAD  276
             PLYVAL LGY SV+ W +F  +QCDAIN+F C+F +P F F+F +H++P+  NY F++AD
Sbjct  1     PLYVALVLGYGSVKWWKIFTREQCDAINKFVCYFTLPLFTFEFSSHVDPFEWNYKFIAAD  60

Query  277   AVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGDLGADLVVQ  456
              ++K +++  L AWA  +  G  +  +T+FSLSTLTN+L+VGVP+LRAMYGD G +LVVQ
Sbjct  61    GISKVIIVLVLVAWAKGSSNGCYTWLITSFSLSTLTNSLVVGVPMLRAMYGDHGVNLVVQ  120

Query  457   AAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSSVQMAGDVEANNNNET  636
             ++V Q +VW + LLF L+F   R      S V       +SH     M  D+E N+   +
Sbjct  121   SSVFQGIVWLSILLFVLEF---RKANNDCSSVD-----VESH-----MVKDLEGNDKMIS  167

Query  637   NTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSI  816
              T           S  S+M  V   L  NPN YA  +G+ WA +++RW +Q+P II+GS+
Sbjct  168   VT------TITRPSFWSMMKIVWVKLIVNPNVYASVIGIIWAFISNRWHVQMPEIIDGSV  221

Query  817   VIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGD  996
             +IMSKAG G AMFSMGLF A QE ++ CG S+T   +VL+FI GPA   IGC+ +GL GD
Sbjct  222   LIMSKAGIGSAMFSMGLFTAQQEKLLACGTSLTLFGVVLKFIAGPAAMAIGCIAVGLHGD  281

Query  997   VLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGFLH  1167
             VLR+++IQAALPQS+ SF+YAKEYGLHAD+LSTAV  G +VS+P+LI Y++ LGFL+
Sbjct  282   VLRVAIIQAALPQSITSFIYAKEYGLHADVLSTAVIFGMIVSLPVLIVYFIALGFLN  338



>ref|XP_010927704.1| PREDICTED: putative auxin efflux carrier component 8 [Elaeis 
guineensis]
Length=362

 Score =   338 bits (866),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 184/376 (49%), Positives = 248/376 (66%), Gaps = 18/376 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKVVVAM PLYVAL LGY SVR W +F P+QC+AINR   +F  PFF F+F  
Sbjct  1     MIAWADIYKVVVAMVPLYVALGLGYGSVRWWRIFTPEQCEAINRMVAYFSFPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +P+ +NY  ++AD ++K +++  LAAWA  + KGS   S+T+FSL TLTN+L+VG PL
Sbjct  61    HTDPFAMNYRVIAADVISKLIIVLVLAAWAKCSSKGSYCWSITSFSLCTLTNSLVVGAPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAG----AARDS  579
             +  MYG    DLVVQ +V+Q ++W T                   R AG G    AA  S
Sbjct  121   VNQMYGRWAQDLVVQLSVVQAIMWLT-----------LLLFVLELRKAGMGEAVVAATSS  169

Query  580   HGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
              G     + D +   + E N       V    +  SLM  V   LA NPNSYA   G+ W
Sbjct  170   GGGGGGGSVDQQPVKDVEGNM---TEVVASRPAFWSLMKTVWLKLALNPNSYASIAGITW  226

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             A +A+RW  ++P+I+EGSI+IMSK G+G+AMFSMGLF+ ++E IV CG S+TA  M L+F
Sbjct  227   AFVANRWHFEMPNIMEGSILIMSKTGTGLAMFSMGLFMGMKEKIVACGPSLTAFGMALKF  286

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             + GPA   IG + +GLRGD+L +++IQAA+PQS+ SF++A+EYGLHAD+LSTAV  G LV
Sbjct  287   VAGPAAMAIGAITVGLRGDLLSVAIIQAAVPQSITSFIFAREYGLHADVLSTAVIFGMLV  346

Query  1120  SVPLLITYYVILGFLH  1167
             S+PLL+ YY +LGF++
Sbjct  347   SLPLLVAYYFVLGFMN  362



>ref|XP_002272306.1| PREDICTED: putative auxin efflux carrier component 8 [Vitis vinifera]
 emb|CBI17639.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   337 bits (865),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 184/378 (49%), Positives = 252/378 (67%), Gaps = 23/378 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W +VYKVV AMAPLYVAL LGY SVR WHMF  DQC AINRF C+F+ PF++F F +
Sbjct  1     MIEWGDVYKVVEAMAPLYVALLLGYASVRWWHMFSSDQCAAINRFICYFIFPFYSFDFTS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKK-GSLSCSVTAFSLSTLTNTLIVGVP  408
             HI+P+ +NY ++ AD ++K + +AAL  W   + + GS    VT FSL T+TN+L +GVP
Sbjct  61    HIDPFSMNYKYMGADIMSKFICVAALGLWCKCSSRTGSYGWFVTCFSLCTMTNSLFIGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFW-----FTRTHPTTSSRVAGAGAAR  573
             +L AMYG  G +LV+QA+V+Q +++ T  L  L+FW       +T P   S +A  GAA 
Sbjct  121   ILEAMYGRTGVNLVLQASVVQVIIYSTVFLILLEFWKSFVSLNKTIPE-DSNIAPVGAAE  179

Query  574   DSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGL  753
             +          D+E +   E +  S  S      S   LM   L  L +NPN YAC LGL
Sbjct  180   E----------DLEGHRTTEVSESSGPS------SFWPLMRNALLKLVKNPNIYACVLGL  223

Query  754   FWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVL  933
              WA L+ RW + +P I+EGS+ IMS+AG+  AMFS+G F+A+Q  ++ CGA++TA  M++
Sbjct  224   IWAFLSKRWHIGMPKIVEGSVQIMSRAGTSTAMFSLGFFMAMQGKVMACGATLTAFGMII  283

Query  934   RFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGT  1113
             RFI  P T  +  L +GLRG+VLRI++IQAALPQSLASFV+ KEYGLH +++STAV +G 
Sbjct  284   RFIATPVTMGVVALAIGLRGNVLRIAIIQAALPQSLASFVFVKEYGLHTEVISTAVILGI  343

Query  1114  LVSVPLLITYYVILGFLH  1167
             ++ +PLL+ YY IL ++ 
Sbjct  344   IICLPLLVAYYAILVYIR  361



>ref|NP_001276122.1| uncharacterized protein LOC100788225 [Glycine max]
 gb|AGJ95060.1| PIN9a [Glycine max]
Length=354

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/362 (50%), Positives = 250/362 (69%), Gaps = 21/362 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWEEVYKVVVA+ PLY AL LGY S++ W++F  +QC+AIN+  C+F +P F F+F A
Sbjct  1     MIGWEEVYKVVVAVVPLYFALLLGYGSLKWWNIFTREQCEAINKLVCYFTLPLFIFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +NY F++AD ++K +++  LA WA  T KG+ S S+T+FSL  LTN L+VGVP+
Sbjct  61    HIDPFKMNYSFIAADTISKFIIMVVLALWAKCTPKGTFSWSITSFSLCNLTNALVVGVPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFT-------------RTHPTTSSRV  552
             ++ MYG LG DLVVQA+VIQ  +WF  LLF L+FW T             +  P T    
Sbjct  121   VKPMYGALGVDLVVQASVIQATIWFPLLLFVLEFWRTGSEGTTITTTTTLKPRPKTMIID  180

Query  553   AGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNS  732
               +G  +D   ++V +  DV+     E      +S  +       +M  V   LA NPNS
Sbjct  181   NESGGGKDVEATTVAI--DVKEEMMLE------ESVTSSRLPFCKVMKLVWRKLATNPNS  232

Query  733   YACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASV  912
             + C +G+ WA +++RW+L++PS++EGSI IMSKAG+G AMFSMG F+ALQE ++ CG S+
Sbjct  233   FGCVIGISWAFISNRWNLEMPSMLEGSIQIMSKAGTGTAMFSMGTFMALQEKVIACGPSM  292

Query  913   TALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILS  1092
             T + +VL+FI GPA T IG +V+GLRGDVLR+ +IQAA+PQS+ SF++AKEYGLH ++LS
Sbjct  293   TIIGLVLKFIAGPAATAIGAIVVGLRGDVLRVVIIQAAVPQSITSFIFAKEYGLHPEVLS  352

Query  1093  TA  1098
             TA
Sbjct  353   TA  354



>ref|XP_006659591.1| PREDICTED: probable auxin efflux carrier component 4-like [Oryza 
brachyantha]
Length=353

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/372 (49%), Positives = 238/372 (64%), Gaps = 20/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKVV AMAPLY AL LGY SVR W  F P+QC AIN    +F +PFF F F+ 
Sbjct  1     MIAWGDIYKVVAAMAPLYFALGLGYGSVRWWRFFSPEQCAAINTMVVYFSMPFFTFDFVV  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-TKKGSLSCSVTAFSLSTLTNTLIVGVP  408
               +P+ +NY  ++ADAV+K + I A+AAWA    K G+ S S+T FSL+ L NTL+VGVP
Sbjct  61    RTDPFSMNYRVIAADAVSKVITILAMAAWARCCAKAGAQSWSITGFSLAALNNTLVVGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             LL AMYG    DLVVQ AV+Q++VWF  LL A +                    R +  +
Sbjct  121   LLNAMYGKWAQDLVVQIAVVQSMVWFPLLLMAFEL-------------------RKAWVA  161

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
                        + +  +    D               V   LA+NPN YA  LG+ WA +
Sbjct  162   GAAAPSTAADGDVDHVHLDGSDGGRGXRLRFWPTARGVGLKLARNPNVYASVLGVVWACI  221

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             A RW+L LP I+ GS+ +MSK G+G++MFSMGLF+A Q+ ++ CGA +TAL + LRF+ G
Sbjct  222   AYRWNLSLPGIVTGSLQVMSKTGTGMSMFSMGLFMAQQKRMIACGAGLTALGLALRFVAG  281

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             P  TL+G   LGLRGDVL ++ +QAALPQS+ASFV+AKEYGLHAD+LSTAV  GTL+S+P
Sbjct  282   PIATLVGAAALGLRGDVLHLACMQAALPQSIASFVFAKEYGLHADVLSTAVIFGTLISLP  341

Query  1129  LLITYYVILGFL  1164
             +LI YYV+LGF+
Sbjct  342   ILIAYYVVLGFV  353



>ref|XP_009402745.1| PREDICTED: probable auxin efflux carrier component 4 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 188/373 (50%), Positives = 252/373 (68%), Gaps = 13/373 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIG  +V KV+ AM PLYVA+ LGY SVR WH+F  +QC+AINR   +F IPFF F+F +
Sbjct  1     MIGGRDVIKVIEAMTPLYVAVGLGYGSVRWWHVFTREQCEAINRLVVYFTIPFFTFEFTS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAW--ANFTKKGSLSCSVTAFSLSTLTNTLIVGV  405
             HI+P+ +NY  ++ADA++K L +  LAAW   + + K S S ++T FSLS LTNTL+VG 
Sbjct  61    HIDPFTMNYRVIAADAISKLLTVGVLAAWTWCSSSSKSSYSWAITIFSLSQLTNTLLVGA  120

Query  406   PLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHG  585
             PLL AMYG    D+VVQ +V+Q + W   LLFAL+          +     AGA      
Sbjct  121   PLLDAMYGRWAQDIVVQLSVVQGIAWMALLLFALEMRKASGAAGFAPAAIVAGAGGQVVA  180

Query  586   SSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
                Q A DVE N +           V    ++ SLM  V   LA NPN YA  LG+ WAL
Sbjct  181   PEPQQATDVECNTD-----------VAARPTLGSLMKTVWLKLALNPNIYASVLGVIWAL  229

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +A+RW  ++P I+EGS+++MSKAG+G++MFSMGLF+ALQ+ IV CG  ++A  M+L+FI 
Sbjct  230   IANRWHFEMPRIMEGSVLVMSKAGTGMSMFSMGLFMALQDKIVACGQKLSAFGMLLKFIA  289

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA T I  + +GLRGD+LR+++IQAALPQS++SF++A+EYGLH D+LSTAV  GTLVS+
Sbjct  290   GPAVTTICAVAVGLRGDLLRVAIIQAALPQSISSFIFAREYGLHPDVLSTAVIFGTLVSL  349

Query  1126  PLLITYYVILGFL  1164
              +LI YY +LG L
Sbjct  350   SVLIAYYEVLGLL  362



>ref|XP_009402744.1| PREDICTED: probable auxin efflux carrier component 4 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 188/373 (50%), Positives = 250/373 (67%), Gaps = 13/373 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +V KV+ AM PLYVAL LGY SVR WH+F  +QC+AINR   +F IPFF F F +
Sbjct  1     MIEGRDVLKVIEAMTPLYVALGLGYGSVRWWHVFTREQCEAINRLVVYFAIPFFTFDFTS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAW--ANFTKKGSLSCSVTAFSLSTLTNTLIVGV  405
             HINP+ +NY  ++ADA++K L +A LAAW   + + K S S ++T FSLS L+N L+VG 
Sbjct  61    HINPFTMNYRVIAADAISKLLTVAVLAAWTWCSSSDKSSYSWAITIFSLSQLSNILVVGA  120

Query  406   PLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHG  585
             PLL AMYG    D++VQ +V+Q + W   LLFAL+    R   + +     AGA      
Sbjct  121   PLLDAMYGRWAQDIIVQLSVVQLIAWMALLLFALEMRKARGAASFAPATVVAGAGGQMVA  180

Query  586   SSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
                Q A DVE N +           V    ++ SLM  V   L  NPN YA  LG+ WAL
Sbjct  181   PEPQQAMDVERNAD-----------VAARPTLGSLMKTVWLKLVINPNIYASVLGVIWAL  229

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +A+RW  ++P IIEGS+++MSK G+G++MFSMGLF+ALQ+ IV CG  ++A  MVL+FI 
Sbjct  230   IANRWHFEMPRIIEGSVLVMSKTGTGMSMFSMGLFMALQDKIVACGPKLSAFGMVLKFIA  289

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA T I  + +GLRGD+LR+++IQAALPQS++SF++A+EYGLH  +LSTAV  GTLVS+
Sbjct  290   GPAATAISAVSVGLRGDLLRVAIIQAALPQSISSFIFAREYGLHPGVLSTAVIFGTLVSL  349

Query  1126  PLLITYYVILGFL  1164
             P+LI YY +LG L
Sbjct  350   PVLIAYYEVLGLL  362



>gb|KDO41492.1| hypothetical protein CISIN_1g019021mg [Citrus sinensis]
Length=347

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 188/372 (51%), Positives = 252/372 (68%), Gaps = 25/372 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVAM PLYVAL LGY SV+ W +F  +QCDAINR  C+F +P F  +F A
Sbjct  1     MIGWEDVYKVVVAMVPLYVALMLGYGSVKWWRIFTLEQCDAINRLVCYFTLPLFTVEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+  NY  ++ADA++K ++   LA WA  + KGS   S+T+FSL TLT++L+VGVPL
Sbjct  61    HVDPFKWNYRCIAADALSKLIIAIVLALWAKCSSKGSYCWSITSFSLCTLTSSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG +  DLVVQ +VIQ +VW   LL  L+            R AG      +   +
Sbjct  121   AKAMYGQMAVDLVVQFSVIQAIVWLPVLLLVLEI-----------RRAGT-----TDAGA  164

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V +  D+E   N E ++  D            LM  V   +A NPN+YAC  G+ WA ++
Sbjct  165   VHVDKDLEGTINAEASSRPD---------FWHLMKLVWLKVAMNPNAYACIFGIAWAFVS  215

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++PSI+EGSI+IMS+AG+G AMFSMG+F+A QE ++ CG S+T   MVL+FI GP
Sbjct  216   NRWHFEMPSIMEGSILIMSRAGTGTAMFSMGIFMASQEKLIACGTSLTIFGMVLKFIAGP  275

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G +VS+PL
Sbjct  276   AAMAIGAIAMGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPL  335

Query  1132  LITYYVILGFLH  1167
             +I Y+ IL F H
Sbjct  336   MIAYFAILEFAH  347



>gb|AIF28460.1| PIN-like protein, partial [Dioscorea villosa]
Length=384

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 190/383 (50%), Positives = 260/383 (68%), Gaps = 12/383 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIG  ++YKVVVAMAPLY AL LGY SVR WH+F P+QC+AINR   +F +PFF F+F  
Sbjct  1     MIGLGDIYKVVVAMAPLYTALGLGYGSVRWWHIFTPEQCEAINRLVSYFTLPFFTFEFTV  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H +P+ +NY F+ AD ++K ++++ L AWA  + KGS   S+T FSL+TLTN+L+VGVPL
Sbjct  61    HADPFLMNYRFILADVISKLVIVSILFAWAKCSSKGSYCWSITTFSLTTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTH-PTTSSRVAGAGAARDSHGS  588
             L AMYG    DLVVQ+++IQ +VW   LLF L+F   +   PT    V    +   S  +
Sbjct  121   LNAMYGPSAQDLVVQSSIIQGIVWLVLLLFVLEFRKLKIGIPTNKPDVVSNQSHVVSIDT  180

Query  589   SVQ-----------MAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSY  735
             SV               +   N+ N  ++ +D   V    S  SLM  V   LA NPNSY
Sbjct  181   SVPPKDAAAAAAAAATNNNNNNDENTNSSVADHELVVAKPSFCSLMRTVWFKLALNPNSY  240

Query  736   ACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVT  915
             A  +G+ WA +++RW  ++PSI+EGSI++MSKAG+G+AMFS GLF+ALQE +V  G S+ 
Sbjct  241   ASIIGITWAFISNRWHFEMPSIMEGSILVMSKAGTGMAMFSTGLFMALQEKLVASGPSLM  300

Query  916   ALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILST  1095
             A  MV++FI GPA   IG + +GL GDVLR+++IQAALPQS+ SF++A++YGLHA++LST
Sbjct  301   AFGMVMKFIAGPAAMAIGAIAVGLHGDVLRVAIIQAALPQSIVSFIFARDYGLHAEVLST  360

Query  1096  AVTIGTLVSVPLLITYYVILGFL  1164
             AV  G LVS+P+L+ YY +LG +
Sbjct  361   AVIFGMLVSLPVLVAYYFLLGLM  383



>ref|XP_006480404.1| PREDICTED: putative auxin efflux carrier component 8-like [Citrus 
sinensis]
Length=347

 Score =   329 bits (843),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 188/372 (51%), Positives = 251/372 (67%), Gaps = 25/372 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVAM PLYVAL LGY SV+ W +F  +QCDAINR  C+F +P F  +F A
Sbjct  1     MIGWEDVYKVVVAMVPLYVALMLGYGSVKWWRIFTLEQCDAINRLVCYFTLPLFTVEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+  NY  ++ADA++K ++   LA WA  + KGS   S+T+FSL TLT++L+VGVPL
Sbjct  61    HVDPFKWNYRCIAADALSKLIIAIVLALWAKCSSKGSYCWSITSFSLCTLTSSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG +  DLVVQ +VIQ +VW   LL  L+            R AG      +   +
Sbjct  121   AKAMYGQMAVDLVVQFSVIQAIVWLPVLLLVLEI-----------RRAGT-----TDAGA  164

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V +  D+E   N E ++  D            LM  V   +A NPN+YAC  G+ WA ++
Sbjct  165   VHVDKDLEGTINAEASSRPD---------FWYLMKLVWLKVAMNPNAYACIFGIAWAFVS  215

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW  ++PSI+EGSI+I+S+AG+G AMFSMG+F+A QE ++ CG S+T   MVL+FI GP
Sbjct  216   NRWHFEMPSIMEGSILIISRAGTGTAMFSMGIFMASQEKLIACGTSLTIFGMVLKFIAGP  275

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   IG + +GL GDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G +VS+PL
Sbjct  276   AAMAIGAIAMGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPL  335

Query  1132  LITYYVILGFLH  1167
              I YY IL F H
Sbjct  336   TIAYYAILEFAH  347



>gb|KHN40463.1| Putative auxin efflux carrier component 8 [Glycine soja]
Length=381

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 182/387 (47%), Positives = 261/387 (67%), Gaps = 21/387 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVA+ PLY AL LGY S++ W++F  +QC+AIN+  C+F +P F F+F A
Sbjct  1     MIGWEDVYKVVVAVVPLYFALLLGYGSLKWWNIFTKEQCEAINKLVCYFTLPLFIFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HI+P+ +N+ F++AD ++K +++  LA WA  T K +   S+ +FSL  LTN ++VGVP+
Sbjct  61    HIDPFKMNFSFIAADTISKFIIMVVLALWAKCTPKCTFCWSIISFSLCNLTNAVVVGVPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAA---RDSH  582
             ++ MYG LG DLVVQ++V+Q  +W   LLF ++FW T    TT++ V         ++  
Sbjct  121   VKPMYGALGVDLVVQSSVLQATIWLPLLLFVMEFWRTGIEGTTTTTVKPRSKTMINKNEG  180

Query  583   GSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
             G       DVEA +  E     +  +VT       +M  V   LA NPNSY C +G++  
Sbjct  181   GG----GKDVEAVDVKEELMLEE--SVTSRLPFCKVMKLVWRKLATNPNSYGCVIGIYPT  234

Query  763   LLASR------------WDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGA  906
             +L+              W+L++PS++EGSI IMSKAG+G AMFSMG+F+ALQE ++ CG 
Sbjct  235   VLSDHMLPLESRHNTRMWNLEMPSMLEGSIQIMSKAGTGTAMFSMGIFMALQEKLIACGP  294

Query  907   SVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADI  1086
             S+T + +VL+FI GPA T IG + +GLRGDVLR+ +IQAA+PQS+ SF++AKEYGLH ++
Sbjct  295   SMTLIGLVLKFIAGPAATAIGAIAVGLRGDVLRVVIIQAAVPQSITSFIFAKEYGLHPEV  354

Query  1087  LSTAVTIGTLVSVPLLITYYVILGFLH  1167
             LSTAV  G +VS+P+L+ YY IL F+H
Sbjct  355   LSTAVIFGMIVSLPVLVAYYAILEFVH  381



>ref|XP_003564940.1| PREDICTED: probable auxin efflux carrier component 6 [Brachypodium 
distachyon]
Length=366

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 184/375 (49%), Positives = 252/375 (67%), Gaps = 20/375 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A APLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATAPLYFALLLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTK--KGSLSCSVTAFSLSTLTNTLIVGV  405
             H +P+ +NY  ++AD V+K +++AA+A WA F +   G+ + ++T+FSLSTLTN+L+VGV
Sbjct  61    HTDPFQVNYRAVAADVVSKAVIVAAIAVWARFHRGVDGAGAWAITSFSLSTLTNSLVVGV  120

Query  406   PLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAG-----AA  570
             P+ RAMYG+    LVVQ +V Q +VW T LLF L+            R A  G     A 
Sbjct  121   PMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEV-----------RKAAIGMYIVPAE  169

Query  571   RDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLG  750
               S   +V   G V+    N     +         +V  L   V   LA NPN+YA F+G
Sbjct  170   SASSPEAVIKGGGVDVEAANGEAAAAVVG--VGRPTVWRLFKTVAHKLALNPNTYASFVG  227

Query  751   LFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMV  930
             + WA +A+R  ++LPS++EGS++IMSK+G+G+AMFSMGLF+A QE I+ CG S+ AL + 
Sbjct  228   ITWACVANRLHIELPSVLEGSVLIMSKSGTGMAMFSMGLFMAQQEKILACGPSLAALGLA  287

Query  931   LRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIG  1110
             L+F +GPA   +G + +GLRGDVLR+++IQAALPQS+ SF++AKEYGLHAD+LSTAV  G
Sbjct  288   LKFALGPAAMAVGSIAVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFG  347

Query  1111  TLVSVPLLITYYVIL  1155
              L S+PLL+ +Y++L
Sbjct  348   MLFSLPLLVGFYIVL  362



>gb|AFK32343.1| putative auxin efflux carrier PIN5a [Zea mays]
 tpg|DAA56125.1| TPA: auxin efflux carrier component 6 [Zea mays]
Length=382

 Score =   329 bits (843),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 187/383 (49%), Positives = 253/383 (66%), Gaps = 20/383 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A  PLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF------TKKGSLSCSVTAFSLSTLTNTL  393
             H +P+ +NY  ++AD ++K +++  +  WA          KG++  S+T FSLSTLTN+L
Sbjct  61    HTDPFQVNYRAVAADVISKAVIVGVIGCWAGSRVGSAGKGKGAVGWSITGFSLSTLTNSL  120

Query  394   IVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAAR  573
             +VGVP+ RAMYG+    LVVQ +V Q +VW T LLF L+   TR        V G  A  
Sbjct  121   VVGVPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLE---TRKAAIGMYVVPGGAA--  175

Query  574   DSHGS---SVQMAGDVEANNNNETNTYSDDSAVTE------STSVLSLMMPVLSNLAQNP  726
             DS G    S     DVEA   +        +A T         S+ +L+  V   L++NP
Sbjct  176   DSDGGVPDSPVKDKDVEAAAGDRRPAAGPAAAATVVVVVPVKPSLWALIKVVAHKLSRNP  235

Query  727   NSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGA  906
             N+YA F+G+ WA +A+R  ++LPS  EGS++IMSK+G+G+AMFSMGLF+A QE ++ CG 
Sbjct  236   NTYASFVGITWACVANRLHIELPSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKVLACGP  295

Query  907   SVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADI  1086
             S  AL +VL+F +GPA   IG + +GLRGDVLR+++IQAALPQS+ SF++AKEYGLHAD+
Sbjct  296   SFAALGLVLKFALGPAAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADV  355

Query  1087  LSTAVTIGTLVSVPLLITYYVIL  1155
             LSTAV  G LVS+PLL+ +Y++L
Sbjct  356   LSTAVIFGMLVSLPLLVGFYIVL  378



>ref|XP_006848440.1| hypothetical protein AMTR_s00013p00241000 [Amborella trichopoda]
 gb|ERN10021.1| hypothetical protein AMTR_s00013p00241000 [Amborella trichopoda]
Length=365

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 185/376 (49%), Positives = 248/376 (66%), Gaps = 15/376 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIG  +VY V+ AM PLY+ L LGY SVR W +  P+ C+ INR    F +P F F F A
Sbjct  1     MIGLRDVYLVLSAMVPLYIPLGLGYGSVRWWGVLNPEHCNGINRVVALFTLPLFTFNFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWAN----FTKKGSLSCSVTAFSLSTLTNTLIV  399
              I+P+ +N+ FL ADA++K  V+AA+A WA       K  + S ++T FSLSTLTNTL+V
Sbjct  61    SIDPFTMNFRFLGADALSKVFVVAAVALWAKTRGTCCKGPACSWAITGFSLSTLTNTLVV  120

Query  400   GVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDS  579
             GVPLL+AMYG +  DLVVQ +VIQ +VW + LLF L+         +S    G   A ++
Sbjct  121   GVPLLKAMYGGIAQDLVVQVSVIQAIVWLSILLFVLEC-------RSSCINGGVVVASET  173

Query  580   HGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
              G+     G   A +   T+T      V +  S+ SLM  V   LA NPNSYA  +G+ W
Sbjct  174   VGNE----GSHVAVDVAGTDTGVKVVQVHKRPSLGSLMKVVWRKLALNPNSYASIVGVIW  229

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             A ++SRW   +P ++E S+ +M+KAGSG+AMFSMGLF+A QE ++ CG S+T L+MVLRF
Sbjct  230   AFISSRWHFSMPLLMENSVSMMAKAGSGMAMFSMGLFMASQEKLIGCGPSLTVLSMVLRF  289

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             + GPA   +  + +GL GDVL I++IQAALPQS+ SF+YA+EYGLHA++LSTAV  G LV
Sbjct  290   LAGPAAMAVASIAVGLHGDVLHIAIIQAALPQSITSFIYAREYGLHAEVLSTAVIFGMLV  349

Query  1120  SVPLLITYYVILGFLH  1167
             S+P+LI YYV+L  L 
Sbjct  350   SLPVLIAYYVVLELLR  365



>ref|XP_010111063.1| Putative auxin efflux carrier component 8 [Morus notabilis]
 gb|EXC29925.1| Putative auxin efflux carrier component 8 [Morus notabilis]
Length=326

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 242/349 (69%), Gaps = 23/349 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W++ YKVV AM PLYVAL LGY SV+ W +F P+QC AINR  CFF +P F F+F A
Sbjct  1     MIRWQDAYKVVEAMFPLYVALILGYGSVKWWKIFTPEQCGAINRLVCFFTLPIFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+  N PF+ AD ++K +++  LA WA  + KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFLWNLPFIGADVISKVIIVIVLAFWAKCSPKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMYG +  DLVVQ++V+Q ++W T LLF L+F           R  G G    S+ S+
Sbjct  121   MKAMYGPMAVDLVVQSSVVQAIIWLTILLFVLEF-----------RRTGLGVT--SNASN  167

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  D+E +  N +          +  S  SLM  V   LA NPNSYA ++G+ WAL+A
Sbjct  168   GDQGKDLEEDVVNSS----------DRPSFWSLMKVVWLKLAMNPNSYAVYIGIIWALIA  217

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW L++PSI+EGSI+IMSKAG+G AMFSMG+F+A+QE  + CGA +T   MVLRFI GP
Sbjct  218   NRWHLEMPSILEGSILIMSKAGTGTAMFSMGVFMAMQEKTIACGARLTVFGMVLRFIAGP  277

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTA  1098
             A   IG +  GL GDVLR+++IQAALPQS+ SF++AKEYGLHA++LSTA
Sbjct  278   AAMAIGAIAAGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHAEVLSTA  326



>dbj|BAJ91285.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   326 bits (836),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 185/381 (49%), Positives = 251/381 (66%), Gaps = 15/381 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A APLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATAPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLI  396
             H +P+ +NY  ++AD ++K +++A +A WA F       KG+   S+T FSLSTLTN+L+
Sbjct  61    HTDPFQVNYRAVAADVISKAVIVAVIAVWARFLGRNGGGKGAAGWSITGFSLSTLTNSLV  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             VGVP+ RAMYG+    LVVQ +V Q +VW T LLF L+    +        V       D
Sbjct  121   VGVPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEV--RKAAIGMYVNVGKTSVVHD  178

Query  577   SHGSSVQMAGDVEANNNNETNTY------SDDSAVT--ESTSVLSLMMPVLSNLAQNPNS  732
             +      +  DVEA   N           + + AV+     SV  L+  V   LA+NPN+
Sbjct  179   APLPESPVKADVEAAAGNGAVAVLVVGGGAQEVAVSVGGKPSVWRLVKTVAHKLARNPNT  238

Query  733   YACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASV  912
             YA F+G+ WA +A+R  ++LPS++E S++IMSK+G+G+AMFSMGLF+A QE I+ CG S 
Sbjct  239   YASFVGITWACVANRLHIELPSVLENSVLIMSKSGTGMAMFSMGLFMAQQERILACGPSY  298

Query  913   TALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILS  1092
              AL + L+F +GP    IG + +GLRGDVLR+++IQAALPQS+ SF++AKEYGLHAD+LS
Sbjct  299   AALGLALKFGLGPVAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLS  358

Query  1093  TAVTIGTLVSVPLLITYYVIL  1155
             TAV  G LVS+PLL+  Y++L
Sbjct  359   TAVIFGMLVSLPLLVGLYIVL  379



>gb|AIF28462.1| PIN-like protein, partial [Persea borbonia]
Length=295

 Score =   322 bits (825),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/309 (52%), Positives = 214/309 (69%), Gaps = 15/309 (5%)
 Frame = +1

Query  238   NPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPLLR  417
             +P+ +NY F++ADA++K +++  L AWA  + KGS   S+T FSLSTLTNTL+VGVPLL+
Sbjct  1     DPFDMNYRFIAADAISKVIIVLVLGAWAKCSSKGSYCWSITNFSLSTLTNTLVVGVPLLK  60

Query  418   AMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSSVQ  597
             AMYG LG DLVVQA+V+Q ++W T LLF  +   TR+  +  +    +  A D       
Sbjct  61    AMYGPLGQDLVVQASVVQGIIWLTILLFVFEVRRTRSDVSVPAITGDSDQAADYSNK---  117

Query  598   MAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASR  777
                DVE N             +    S  S+M  V   LA NPNSYA  +G+ WA +++R
Sbjct  118   ---DVEGNQT---------VIIPSRYSFWSVMKIVWLKLALNPNSYASIVGVTWAFISNR  165

Query  778   WDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPAT  957
             W   +PSI+EGS++IMSKAG+G+AMFSMGLF+A+QE ++ CG S+T   MVLRFI GPA 
Sbjct  166   WHFAMPSIMEGSVLIMSKAGAGMAMFSMGLFMAMQEKLIACGISLTVFGMVLRFIAGPAA  225

Query  958   TLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLI  1137
               IG + +GL GDVLRIS+IQAALPQS+ SF+YA+EYGLHAD+LSTAV  G LV++P+LI
Sbjct  226   MAIGSIAMGLHGDVLRISIIQAALPQSITSFIYAREYGLHADVLSTAVIFGMLVALPVLI  285

Query  1138  TYYVILGFL  1164
              YY++LGFL
Sbjct  286   GYYLVLGFL  294



>dbj|BAJ96544.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 251/381 (66%), Gaps = 15/381 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A APLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATAPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLI  396
             H +P+ +NY  ++AD ++K +++A +A WA F       KG+   S+T FSLSTLTN+L+
Sbjct  61    HTDPFQVNYRAVAADVISKAVIVAVIAVWARFLGRNGGGKGAAGWSITGFSLSTLTNSLV  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             VGVP+ RAMYG+    LVVQ +V Q +VW T LLF L+    +        V       D
Sbjct  121   VGVPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEV--RKAAIGMYVNVGKTSVVHD  178

Query  577   SHGSSVQMAGDVEANNNNETNTY------SDDSAVT--ESTSVLSLMMPVLSNLAQNPNS  732
             +      +  DVEA   N           + + AV+     SV  L+  +   LA+NPN+
Sbjct  179   APLPESPVKADVEAAAGNGAVAVLVVGGGAQEVAVSVGGKPSVWRLVKTLAHKLARNPNT  238

Query  733   YACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASV  912
             YA F+G+ WA +A+R  ++LPS++E S++IMSK+G+G+AMFSMGLF+A QE I+ CG S 
Sbjct  239   YASFVGITWACVANRLHIELPSVLENSVLIMSKSGTGMAMFSMGLFMAQQERILACGPSY  298

Query  913   TALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILS  1092
              AL + L+F +GP    IG + +GLRGDVLR+++IQAALPQS+ SF++AKEYGLHAD+LS
Sbjct  299   AALGLALKFGLGPVAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLS  358

Query  1093  TAVTIGTLVSVPLLITYYVIL  1155
             TAV  G LVS+PLL+  Y++L
Sbjct  359   TAVIFGMLVSLPLLVGLYIVL  379



>emb|CDX78697.1| BnaA03g06090D [Brassica napus]
Length=394

 Score =   323 bits (829),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 183/422 (43%), Positives = 248/422 (59%), Gaps = 78/422 (18%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYKV+ AM PLYVAL  GY SV+ W++F  DQCDAIN+   +F +P F  +F A
Sbjct  1     MISGGDVYKVIEAMVPLYVALISGYGSVKWWNIFTRDQCDAINQLVYYFTLPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K ++IA LA WA ++ KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKIIIIAVLAFWAKYSSKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T                   R AG           
Sbjct  121   AKAMYGQEAVDLVVQSSVFQGIVWLT-----------LLLFVLELRRAG-----------  158

Query  592   VQMAGDVEANNN----NETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
                     +NNN    N      +   V E  S L +M  V   LA NPN Y+C LG+ W
Sbjct  159   ------FSSNNNVDDINIEGGRKETVVVREEKSFLEVMSVVWLKLATNPNCYSCILGIAW  212

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             A +++RW  ++P IIEGSI+IMSKAG+G AMF+MG+F+ALQ+ ++ CG S+TA+ MVL+F
Sbjct  213   AFISNRWHFEMPGIIEGSILIMSKAGTGTAMFNMGIFMALQDKLIVCGTSLTAIGMVLKF  272

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQ---------------------------------  1020
             I GPA   IG + +GL G+VLR+++IQ                                 
Sbjct  273   IAGPAAMAIGSIAVGLHGNVLRVAIIQVIIHFLYFCSGLSDQTNLMLFHFFCHHLFHFSE  332

Query  1021  -------------AALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGF  1161
                          AALPQS+ SF++AKEYGLHAD+LSTAV  G LVS+P+L+ YY  L F
Sbjct  333   DTKLNSFEFSDKLAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEF  392

Query  1162  LH  1167
             +H
Sbjct  393   IH  394



>ref|NP_001148155.1| auxin efflux carrier component 6 [Zea mays]
 gb|ACG29945.1| auxin efflux carrier component 6 [Zea mays]
Length=382

 Score =   323 bits (827),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 184/386 (48%), Positives = 251/386 (65%), Gaps = 18/386 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A  PLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF------TKKGSLSCSVTAFSLSTLTNTL  393
             H +P+ +NY  ++AD ++K +++  +  WA          KG++  S+T FSLSTLTN+L
Sbjct  61    HTDPFQVNYRAVAADVISKAVIVGVIGCWAGSRVSSAGKGKGAVGWSITGFSLSTLTNSL  120

Query  394   IVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAAR  573
             +VGVP+ RAMYG+    LVVQ +V Q +VW T LLF L+   TR        V G GAA 
Sbjct  121   VVGVPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLE---TRKAAIGMYVVPG-GAAD  176

Query  574   DSHG--SSVQMAGDVEANNNNE------TNTYSDDSAVTESTSVLSLMMPVLSNLAQNPN  729
                G   S     DVEA   +           +    V    S+ +L+  V   L++NPN
Sbjct  177   SDDGVPDSPVKDKDVEAAAGDRRPAAGPAAAATVVVVVPVKPSLWALVKVVAHKLSRNPN  236

Query  730   SYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGAS  909
             +YA F+G+ WA +A+R  ++LPS  EGS++IMSK+G+G+AMFSMGLF+A QE ++ CG S
Sbjct  237   TYASFVGITWACVANRLHIELPSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKVLACGPS  296

Query  910   VTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADIL  1089
               AL +VL+F +GPA   IG + + LRGDVLR+++ QAALPQS+ SF++AKEYGLHAD+L
Sbjct  297   FAALGLVLKFALGPAAMAIGSIAVCLRGDVLRVAITQAALPQSITSFIFAKEYGLHADVL  356

Query  1090  STAVTIGTLVSVPLLITYYVILGFLH  1167
             STAV  G LVS+PLL+ +Y++L  + 
Sbjct  357   STAVIFGMLVSLPLLVGFYIVLELIR  382



>ref|XP_010038261.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
 gb|KCW84564.1| hypothetical protein EUGRSUZ_B01403 [Eucalyptus grandis]
Length=365

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/370 (50%), Positives = 245/370 (66%), Gaps = 7/370 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW++VYKVVV+M PLY+AL LGY SV+ W +F  +QCD INRF   F++P F F+F A
Sbjct  1     MIGWDDVYKVVVSMFPLYMALMLGYGSVKWWRLFTHEQCDGINRFIVLFILPLFGFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HINPY +N+  L+ADA++K   +A L  W  F+ + S + S+T FSL TLTN L+VGVP+
Sbjct  61    HINPYAMNFRLLAADALSKLATLAILGLWGRFSSRASYNWSITTFSLCTLTNLLVVGVPV  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             +RAMYG  G D+VVQ  ++Q+LVW   LL  L+F  TR   +T+S           +   
Sbjct  121   MRAMYGQWGVDMVVQLCMVQSLVWIPLLLLLLEFRNTRMMDSTTSSSP----PPPENNGV  176

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V    DVE +         D     E  S  S    V   +A NPN YA  LGL WAL+A
Sbjct  177   VDEERDVEMSVVITMEGGGDHH---EKRSYWSFAKVVWMKMAMNPNVYANVLGLAWALMA  233

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SR+   +PSI+EGS+ IMSKAG+G AMF++G+FIA+Q  ++ CG   T L +V RF+VGP
Sbjct  234   SRFKFTMPSIMEGSVEIMSKAGTGTAMFNIGIFIAMQTKVIACGTGPTVLGLVSRFVVGP  293

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A T +  L +GL G  L I++IQAALPQ++ASFV+A EYGLHA++LSTAV  GT++S+PL
Sbjct  294   AITALCSLAVGLHGPTLHIAIIQAALPQAIASFVFANEYGLHANVLSTAVVFGTVISLPL  353

Query  1132  LITYYVILGF  1161
             LI YY+ L +
Sbjct  354   LIGYYIGLEY  363



>ref|XP_004971070.1| PREDICTED: probable auxin efflux carrier component 6-like [Setaria 
italica]
Length=364

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 181/379 (48%), Positives = 250/379 (66%), Gaps = 22/379 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A  PLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSC----SVTAFSLSTLTNTLIV  399
             H +P+ +NY  ++AD ++K +++A +A WA F            S+T+FSLSTLTN+L+V
Sbjct  61    HTDPFQVNYRAVAADVISKAVIVAVIAVWARFAAAKGAGSAAGWSITSFSLSTLTNSLVV  120

Query  400   GVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDS  579
             GVPL RAMYG+    LVVQ +V Q +VW T LLF L+            R A  G     
Sbjct  121   GVPLARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLE-----------VRKAAIGM----  165

Query  580   HGSSVQMAGDVEANNNNETNTYSDDSAVTE---STSVLSLMMPVLSNLAQNPNSYACFLG  750
             + ++     DVEA + +     +    V       S+ +L+  V   L++NPN+YA F+G
Sbjct  166   YVAAEPPVKDVEAASADAAPAAAAVVVVPVASGKPSLWALVKVVAHKLSRNPNTYASFVG  225

Query  751   LFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMV  930
             + WA +A+R  L+LPS  EGS++IMSK+G+G+AMFSMGLF+A QE ++ CG    AL +V
Sbjct  226   ITWACVANRLHLELPSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKVLACGPCFAALGLV  285

Query  931   LRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIG  1110
             L+F +GPA   IG + +GLRGDVLR+++IQAA+PQS+ SF++AKEYGLHAD+LSTAV  G
Sbjct  286   LKFALGPAAMAIGSIAVGLRGDVLRVAIIQAAVPQSITSFIFAKEYGLHADVLSTAVIFG  345

Query  1111  TLVSVPLLITYYVILGFLH  1167
              LVS+PLL+ +Y++L  + 
Sbjct  346   MLVSLPLLVGFYIVLELIR  364



>ref|XP_010070144.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
Length=358

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 173/369 (47%), Positives = 235/369 (64%), Gaps = 15/369 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvi-pffnfqfM  228
             MIG+E++YKV+ AM PLYVAL LGY SVR W MF  +QCD INR  C+F++  F      
Sbjct  1     MIGFEDIYKVIAAMVPLYVALTLGYGSVRWWRMFTSEQCDGINRMVCYFILPLFGFEFTA  60

Query  229   AHINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVP  408
             AH N + +NY  ++ADA++K L +  LA  A    K   S  +T FSL TLTN LIVGVP
Sbjct  61    AHANLFEMNYSVMAADAISKLLAVLILALCARCCSKMDYSWCITTFSLLTLTNVLIVGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             LLRAMYG +G D+VVQ +V+Q ++WF  LL  L+F   R      S    +    D    
Sbjct  121   LLRAMYGQVGVDIVVQLSVMQAVLWFPLLLCFLEF---RKMGMDYSPTTTSATTDDLVPG  177

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
                + G  EA   N T             + + ++ P    LA NPN YAC +G+ WA++
Sbjct  178   EKDVEGTAEAVRTNSTRP--------RLWTAVKIVAP---KLALNPNIYACIIGVAWAVI  226

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             A R+ +++P I++ SI I+S+AG G AMF++G+FIA+Q  ++ CG  +T + MVLRFI G
Sbjct  227   AHRFKVKMPGIVKESIEILSRAGLGTAMFNIGIFIAMQRKVIACGVKLTFVGMVLRFIAG  286

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   +   ++GLRGDVLR++++QAALPQS+ +F++AKEYGLHA +LSTAV  GTL S+P
Sbjct  287   PALMTVSSFIMGLRGDVLRMAIMQAALPQSITTFIFAKEYGLHASVLSTAVVFGTLASLP  346

Query  1129  LLITYYVIL  1155
             LLI YY  L
Sbjct  347   LLIAYYAAL  355



>ref|XP_009346849.1| PREDICTED: putative auxin efflux carrier component 8 [Pyrus x 
bretschneideri]
Length=323

 Score =   313 bits (802),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 172/329 (52%), Positives = 223/329 (68%), Gaps = 15/329 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKVVVAM PLY AL LGY SVR W +F P+QC AINRF CFF +P F F+F A
Sbjct  1     MIGWEDVYKVVVAMVPLYFALILGYGSVRWWGVFTPEQCGAINRFVCFFTLPLFTFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++PY  NY F+ ADA++K +++  L  W   + KGS S S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPYKWNYRFIGADAISKVIIVVVLVLWGKCSSKGSYSWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             +RAMYG    DLVVQ++V+Q ++W T LLF L+F       T S  +  +  + D+   S
Sbjct  121   IRAMYGSSAVDLVVQSSVVQAIIWLTILLFVLEF-----RRTGSIDIVSSSTSVDTRVQS  175

Query  592   VQMAG-DVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
             V   G DVEA          ++  ++   S   LM  V   L  NPNSYA F+G+ WA +
Sbjct  176   VDPQGKDVEAM---------EEITISTRPSFWYLMKAVWVKLGMNPNSYAVFIGIAWAFI  226

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             A+RW ++LPSI+EGS++IMSKAG+G AMFSMG+F+ALQE  V CG S T + MVLRFI G
Sbjct  227   ANRWHIELPSIMEGSVLIMSKAGTGTAMFSMGIFMALQEKFVACGTSRTIIGMVLRFIAG  286

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQ  1035
             PA   IGC+ +GL GDVLR+++IQ    Q
Sbjct  287   PAAIAIGCIAVGLHGDVLRVAIIQVVYLQ  315



>ref|XP_003576710.1| PREDICTED: probable auxin efflux carrier component 4 [Brachypodium 
distachyon]
Length=365

 Score =   314 bits (805),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 198/384 (52%), Positives = 248/384 (65%), Gaps = 33/384 (9%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV AMAPLY ALALGY SVRRW +F PDQCDA+NR   +F +PFF F F A
Sbjct  1     MIGWGDVYKVVAAMAPLYFALALGYCSVRRWKLFTPDQCDAVNRLVAYFAVPFFAFDFSA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAAL------------AAWANFTKKGSLSCSVTAFSLS  375
              INPY LNY  L+ADA++K  V  AL             A  +     S    +T FSL+
Sbjct  61    RINPYALNYRVLAADALSKLAVALALAAWAAAVKAKQRGAGGDKLLAASSGWCITGFSLA  120

Query  376   TLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVA  555
             TL NTL+VGVPLL AMYG    DLVVQ +V+Q +V+F  LL A +           +R A
Sbjct  121   TLNNTLVVGVPLLDAMYGPWARDLVVQLSVVQIIVYFPLLLLAFE-----------ARRA  169

Query  556   GAGAARDSHGSSVQMAGDVE-ANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNS  732
              AG A +   +      DVE A    E   Y    A+  +  +          +A+NPN 
Sbjct  170   CAGGAGNKPAAPPASDDDVEGAAGRIEPVDYQSAWALVRAVGL---------KVARNPNV  220

Query  733   YACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASV  912
             YA  LG+ W+ + +RW ++ PSIIEGS++IMS+ G G+AMFSMGLF+ALQE IV CGA  
Sbjct  221   YAGVLGVAWSCVTNRWHIETPSIIEGSVLIMSRTGVGLAMFSMGLFMALQERIVACGAGP  280

Query  913   TALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILS  1092
             TAL M LRF+ GPA T  G + LGLRGDVLR+++IQAALPQS+ +FV+A+EYGLHAD+LS
Sbjct  281   TALGMALRFVAGPAATAAGAVALGLRGDVLRLAIIQAALPQSITTFVFAREYGLHADVLS  340

Query  1093  TAVTIGTLVSVPLLITYYVILGFL  1164
             TAV  GTLVS+P+LI YY+ L F+
Sbjct  341   TAVIFGTLVSLPVLIVYYIALAFV  364



>ref|XP_006350420.1| PREDICTED: putative auxin efflux carrier component 8-like [Solanum 
tuberosum]
Length=349

 Score =   313 bits (803),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 169/372 (45%), Positives = 238/372 (64%), Gaps = 23/372 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKV+ AM PLY+AL LGY SV+ WH    + CDAINR N FFV+PFF F F++
Sbjct  1     MIEWLDIYKVIEAMMPLYLALGLGYGSVKWWHKLSAEHCDAINRLNYFFVLPFFTFDFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              +NPY +NYPF+  D +AK ++   L  WANF  KG+ S S+T FS  +LTN L++G+P+
Sbjct  61    QVNPYKMNYPFICGDLIAKAIIGFFLTLWANFYSKGNFSWSITTFSFCSLTNALVMGIPV  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             + AM   +G DLV+Q+  IQ L+W   + F ++             +A  GA +D  G+ 
Sbjct  121   MNAMSPQVGVDLVIQSLAIQFLIWSIIIQFMMEL-----KNAKDEIMACEGANQDLEGND  175

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                      NNN   NT         + S+ S+M  V + L++NPN YACFLG+ W+L+A
Sbjct  176   ---------NNNASKNT---------TPSLGSVMTIVWTKLSKNPNFYACFLGIMWSLVA  217

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW   LP+I++  I IMSKAGSG+ MF++G+F+A+Q+ ++  G  V    + LRF +GP
Sbjct  218   DRWHFVLPNIVKECISIMSKAGSGIGMFTIGVFVAMQQKVMAGGTGVIVFGLFLRFFIGP  277

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             AT  IG  V+GL G+VLR S++QAALP  +ASFV AKEYG+H +I+S  V IG LVS+P+
Sbjct  278   ATMTIGSFVVGLHGNVLRASILQAALPPGIASFVLAKEYGVHPEIVSAVVIIGILVSLPI  337

Query  1132  LITYYVILGFLH  1167
             +I YY +   +H
Sbjct  338   MIAYYAVSELIH  349



>ref|XP_010045960.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
Length=363

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 236/370 (64%), Gaps = 9/370 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW ++YKVVV+M PLYV L LGY SV+ W +F  DQCD INRF   F++P F F F A
Sbjct  1     MIGWGDMYKVVVSMFPLYVPLMLGYSSVKWWRLFSHDQCDGINRFISLFILPLFGFGFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             HINP+ +N+  L+AD ++K   ++ LA W  F+ +GS S  +T FSL TL N L+VGVP+
Sbjct  61    HINPFAMNFRLLAADGLSKLATLSILALWGRFSSRGSYSWCITTFSLCTLPNLLVVGVPM  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG    DL VQ  ++Q+L+W+  +L  L+F   R        +A            
Sbjct  121   LQAMYGKWAVDLAVQLCMLQSLIWYPLVLLFLEFRKRRMM-----DLATPPPPPLEENGV  175

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V    D+  +  N +    DD    E  S  +  M V   +A NPN YA  LGL WAL+A
Sbjct  176   VDEERDIGMSVVNTSEVGGDD---LEKRSRGTFQM-VWIKMAMNPNVYANVLGLAWALMA  231

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SR    +PSI+EGSI IMSK G+G AMF++G+F+A+Q  ++ CG     L MV RF +GP
Sbjct  232   SRLKFTMPSIMEGSIEIMSKGGTGTAMFNIGIFMAMQTKVIACGTGPAVLGMVSRFALGP  291

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             AT  +  L LGL G  LR+++IQAALPQ++ASFV+A +YGLHA ++STAV  GTL+S+PL
Sbjct  292   ATMALCSLALGLHGPSLRVAIIQAALPQAIASFVFANDYGLHAKVISTAVVFGTLISLPL  351

Query  1132  LITYYVILGF  1161
             LI YYV+L +
Sbjct  352   LIGYYVVLEY  361



>ref|NP_001062317.1| Os08g0529000 [Oryza sativa Japonica Group]
 sp|Q6ZIB5.1|PIN4_ORYSJ RecName: Full=Probable auxin efflux carrier component 4; AltName: 
Full=OsPIN4 [Oryza sativa Japonica Group]
 dbj|BAD09105.1| PIN1-like auxin transport protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF24231.1| Os08g0529000 [Oryza sativa Japonica Group]
 tpd|FAA00685.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group]
Length=370

 Score =   312 bits (800),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 192/377 (51%), Positives = 241/377 (64%), Gaps = 13/377 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV AMAPLY AL LGY SVR W  F  +QC AIN    +F +PFF F F+ 
Sbjct  1     MIGWGDVYKVVGAMAPLYFALGLGYGSVRWWRFFTAEQCAAINTMVVYFSMPFFTFDFVV  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWAN------FTKKGSLSCSVTAFSLSTLTNTL  393
               +P+ +NY  ++ADAV+K + IAA+AAWA         K G+ S S+T FSL+ L NTL
Sbjct  61    RTDPFAMNYRVIAADAVSKAIAIAAMAAWARTRCGCAAAKAGAQSWSITGFSLAALNNTL  120

Query  394   IVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAAR  573
             +VGVPLL AMYG    DLVVQ AV+Q++VWF  LL A    F            G G A 
Sbjct  121   VVGVPLLDAMYGRWAQDLVVQIAVVQSMVWFPLLLMA----FELRKAWVVGGGGGVGPAV  176

Query  574   DSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGL  753
              S  S  +   DVE N                     +    V   LA+NPN YA  LG+
Sbjct  177   MSSSSPPEKQSDVEMNGAVVAAP---GGGGGVRLPFWATARTVGLKLARNPNVYASVLGV  233

Query  754   FWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVL  933
              WA +A RW L LP I+ GS+ +MS+ G+G++MFSMGLF+  QE ++ CGA +TAL M L
Sbjct  234   VWACIAYRWHLSLPGIVTGSLQVMSRTGTGMSMFSMGLFMGQQERVIACGAGLTALGMAL  293

Query  934   RFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGT  1113
             RF+ GP  TL+G   LGLRGDVL +++IQAALPQS+ASFV+AKEYGLHAD+LSTAV  GT
Sbjct  294   RFVAGPLATLVGAAALGLRGDVLHLAIIQAALPQSIASFVFAKEYGLHADVLSTAVIFGT  353

Query  1114  LVSVPLLITYYVILGFL  1164
             L+S+P+LI YY +LGF+
Sbjct  354   LISLPILIAYYAVLGFV  370



>ref|NP_001234230.1| auxin efflux facilitator SlPIN10 [Solanum lycopersicum]
 gb|ADR30413.1| auxin efflux facilitator SlPIN10 [Solanum lycopersicum]
Length=347

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 236/372 (63%), Gaps = 25/372 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKV+ AM PLY+AL LGY SV+ WH    + CDAINR N FFV+PFF F F++
Sbjct  1     MIEWLDIYKVIEAMMPLYLALGLGYGSVKWWHKLSAEHCDAINRLNYFFVLPFFTFDFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              +NPY +NY F+  D +AK ++   L  WANF  KG+LS S+T FS  +LTN L++G+P+
Sbjct  61    QVNPYKMNYLFICGDLIAKAIIGFFLTLWANFYSKGNLSWSITTFSFCSLTNALVMGIPV  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             + A+   +G DLV+Q+  IQ L+W   + F ++F                  A+D   + 
Sbjct  121   MNAVSPQVGVDLVIQSLAIQFLIWSIIIQFMMEF----------------KNAKDEIMAC  164

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  D+E NNN   NT         + S+ S+M  V + L++NPN YACFLG+ W+L+A
Sbjct  165   EGANQDLEGNNNASKNT---------TPSLGSVMTIVWTKLSKNPNFYACFLGIMWSLVA  215

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW   LP+I++  I IMSKAGSG+ MF++G+F+A+Q+ I+  G  V    + LRF +GP
Sbjct  216   DRWHFGLPNIVKECISIMSKAGSGIGMFTIGVFVAMQQKIMAGGTGVIIFGLFLRFFIGP  275

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             AT  IG  ++GL G+V R S++QAALP  +ASFV AKEYG+H +I+S  V IG LVS+P+
Sbjct  276   ATMTIGSFLVGLHGNVFRASILQAALPPGIASFVLAKEYGVHPEIVSAVVIIGILVSLPI  335

Query  1132  LITYYVILGFLH  1167
             +I YY I    H
Sbjct  336   MIAYYAISELTH  347



>ref|XP_010068801.1| PREDICTED: putative auxin efflux carrier component 8 [Eucalyptus 
grandis]
 gb|KCW65010.1| hypothetical protein EUGRSUZ_G02549 [Eucalyptus grandis]
Length=360

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 180/370 (49%), Positives = 241/370 (65%), Gaps = 12/370 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW++VYKVVV+M PLYVAL LGY SV+ W +F  +QCD INRF   F++P F F+F A
Sbjct  1     MIGWDDVYKVVVSMFPLYVALMLGYGSVKWWRLFTHEQCDGINRFVALFILPLFGFEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H+NPY +N+  L+ADA++K   +A L  W  F+ + S + S+T FSL TLTN L+VGVP+
Sbjct  61    HMNPYAMNFRLLAADALSKLATLAILGLWGRFSSRASYNWSITTFSLCTLTNLLVVGVPV  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMY   G DLVVQ  ++Q+LVW   LL  L+F  TR   +T+S               
Sbjct  121   MQAMYDQWGVDLVVQLCMVQSLVWIPLLLLLLEFRNTRMMDSTTSSSPPPPVNN------  174

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                 G V+   + E +         ES    SL   V   +A NPN YA  LGL WAL+A
Sbjct  175   ----GMVDEERDVEMSLVITREGGGES--YWSLARVVWMKMAMNPNVYANVLGLTWALMA  228

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SR    +PSI+EGS+ IMSKAG G +MF++G+FIALQ  ++ CG   T L +V RF+VGP
Sbjct  229   SRLKFTMPSIMEGSVEIMSKAGKGTSMFNIGIFIALQTRVIACGTGPTVLGLVSRFVVGP  288

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A T +  L +GL G  L I++IQAA+ Q++ASFV+A EYGLHA++LSTAV  GT++S+PL
Sbjct  289   AITALCSLAVGLHGPALHIAIIQAAISQAIASFVFANEYGLHANVLSTAVVFGTVISLPL  348

Query  1132  LITYYVILGF  1161
             LI YY+ L +
Sbjct  349   LIGYYIGLEY  358



>ref|XP_002320435.2| hypothetical protein POPTR_0014s14390g [Populus trichocarpa]
 gb|EEE98750.2| hypothetical protein POPTR_0014s14390g [Populus trichocarpa]
Length=370

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/371 (43%), Positives = 240/371 (65%), Gaps = 4/371 (1%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI  E++Y V+ A+ PLYV + L Y SV+ W++F P+QC  INRF  +F +P  + +F++
Sbjct  1     MISIEDLYGVLCAVVPLYVTMFLAYASVKWWNIFTPEQCSGINRFVAYFAVPLLSMEFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              INPY ++  F++AD V+K L++  L  WANF+++GSL  ++T FSLSTL NTL++G+PL
Sbjct  61    RINPYKMDLLFMAADGVSKVLILVVLLCWANFSRRGSLEWAITLFSLSTLPNTLVMGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L++MYGD    L++Q  V+Q ++W+T LLF  ++   R     + + +    +       
Sbjct  121   LKSMYGDDKEGLMIQVVVLQCIIWYTLLLFLFEYREARLAMLKNFKGSFCEQSVQVLRKE  180

Query  592   VQMAGDVEANNNN--ETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
               M   VE+      E NT +  S    S  +L ++  V   L +NPNSYA  +GL WAL
Sbjct  181   ESMKRGVESEKTEGIENNTAAISS--LSSVMLLQILKTVWLKLVRNPNSYASLIGLSWAL  238

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             ++ R+ +  P I++ S+ I+SKAG G+AMFS+GLF+ALQ  I+ CG  +    M+ RF+ 
Sbjct  239   VSCRYGIMKPQIVDNSVTILSKAGLGMAMFSLGLFMALQPRIIACGNRMAIYGMLARFLA  298

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   +  + +GLRG +L++S++QAALPQ +  FV+A+EYGLH D+LSTAV  G +VS+
Sbjct  299   GPAVMAVASIGVGLRGTMLKLSIVQAALPQGIVPFVFAREYGLHPDVLSTAVIFGMIVSL  358

Query  1126  PLLITYYVILG  1158
             P+ I YY+ LG
Sbjct  359   PITILYYIFLG  369



>ref|XP_002462627.1| hypothetical protein SORBIDRAFT_02g029210 [Sorghum bicolor]
 gb|EER99148.1| hypothetical protein SORBIDRAFT_02g029210 [Sorghum bicolor]
Length=371

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 259/386 (67%), Gaps = 29/386 (8%)
 Frame = +1

Query  49    IMIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfM  228
             +MIGW +VYKVV AMAPLY AL LGY SVR W MF PDQCDAINR   +F +PFF F F 
Sbjct  1     MMIGWGDVYKVVAAMAPLYFALGLGYGSVRWWKMFTPDQCDAINRLVSYFAVPFFAFDFA  60

Query  229   AHINPYHLNYPFLSADAVAKTLVIAALAAWANFT-------------KKGSLSCSVTAFS  369
             + I+P+ L+Y  L+ADA++K  V  ALAAWA                K  +LS  +T FS
Sbjct  61    SRIDPFSLSYRVLAADALSKLAVALALAAWATAAAAAAAARPGGGKGKDRALSWCITVFS  120

Query  370   LSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSR  549
             L+TL NTL+VGVPLL AMYG    DL+VQ +V+Q +V+F  LL AL+             
Sbjct  121   LATLNNTLVVGVPLLDAMYGKWARDLIVQISVVQFIVYFPALLLALEA------------  168

Query  550   VAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPN  729
                  A + +  ++V+ AGD + + +    +  + +A  +S+S   L+  V + +A+NPN
Sbjct  169   ---RRAGKMAAAAAVEPAGD-DVDESGGGGSGGEITAAHQSSSFWPLVRAVGTKVARNPN  224

Query  730   SYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGAS  909
              YA  LG+ WA + +RW ++ PSIIEGS+++MSK G G+AMFSMGLF+ALQE I+ CGA 
Sbjct  225   IYAGILGVSWACVTNRWHIETPSIIEGSVLVMSKTGVGLAMFSMGLFMALQEKIIVCGAG  284

Query  910   VTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADIL  1089
              T L M LRF+ GPA T  G + LGLRGDVLR++++QAALPQS+ +FV+A+EYGLHAD+L
Sbjct  285   PTMLGMALRFVAGPAATAAGAVALGLRGDVLRLAVMQAALPQSITTFVFAREYGLHADVL  344

Query  1090  STAVTIGTLVSVPLLITYYVILGFLH  1167
             STAV  GTL S+P+LI YY++LG + 
Sbjct  345   STAVIFGTLASLPVLIVYYIVLGLIR  370



>ref|XP_002444705.1| hypothetical protein SORBIDRAFT_07g026370 [Sorghum bicolor]
 gb|EES14200.1| hypothetical protein SORBIDRAFT_07g026370 [Sorghum bicolor]
Length=402

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 240/404 (59%), Gaps = 35/404 (9%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++YKVV AMAPLY AL LGY SVR W  F  +QC AIN     F +PFF F F+A
Sbjct  1     MIPWGDIYKVVAAMAPLYFALGLGYGSVRWWRFFTAEQCAAINTLVVNFSMPFFTFDFLA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKG----SLSCSVTAFSLSTLTNTLIV  399
               NPY +NY  L+ADAV+K L IAA++AW    + G    + + ++T FSL+   NTL+V
Sbjct  61    RANPYTMNYRVLAADAVSKALAIAAVSAWGCCCRGGKAAGAQAWAITGFSLAGFNNTLVV  120

Query  400   GVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFTRTHPTTSSRVAGAGAA  570
             GVPLL AMYG    DL+VQ AV+Q+L WF  LL   +    W+    P+      G+   
Sbjct  121   GVPLLYAMYGKWAQDLIVQIAVVQSLFWFPLLLLGFELRKAWWVGI-PSAQGGGGGSRCN  179

Query  571   RDSHGSSVQMAG-------------------------DVEANNNNETNTYSDDSAVTEST  675
               +       AG                         D  A  + E N     +A   +T
Sbjct  180   SSNSDDDDDSAGGGRVGPVSSSSASSSSPPPSPPPKKDAAAEKDVEMNAEETAAAAAGTT  239

Query  676   SVL-SLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAM  852
               L  L+  V   LA NPN YA  LG+ WA +A R+ ++   I+ GS+ +MSK G+G++M
Sbjct  240   IRLWPLVRTVGLKLAGNPNVYASVLGVVWACIAYRY-VRGTGIVTGSLDVMSKTGTGMSM  298

Query  853   FSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALP  1032
              SMGLF+A QE ++ CG+ + AL M LRF+ GP  TL+G     LRGDVLR ++IQAALP
Sbjct  299   LSMGLFMAQQEKMIACGSGLAALGMALRFVAGPLATLVGAAAFRLRGDVLRFAIIQAALP  358

Query  1033  QSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGFL  1164
             QS+ASFV+AKEYGLHAD+LSTAV  GTLVS+P+LI YY +LG L
Sbjct  359   QSIASFVFAKEYGLHADVLSTAVIFGTLVSLPVLIAYYAVLGIL  402



>ref|XP_007138460.1| hypothetical protein PHAVU_009G210900g [Phaseolus vulgaris]
 gb|ESW10454.1| hypothetical protein PHAVU_009G210900g [Phaseolus vulgaris]
Length=399

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 254/400 (64%), Gaps = 33/400 (8%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI  +++Y+VV A+ PLYVAL L Y SVR W +F P+QC  INRF   F +PF  F F++
Sbjct  1     MIKGKDLYEVVAAIVPLYVALFLAYGSVRWWKIFTPEQCSGINRFVSVFAVPFLFFHFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             + NPY +N+ FL+AD++ K L++ AL  W  FTK GS++ ++T FSLSTL NTLI+GVPL
Sbjct  61    NNNPYTMNFRFLAADSLQKVLILVALVLWNTFTKWGSINLTITLFSLSTLPNTLIMGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF-----WFTRTHPTTSSRVAGAGAARD  576
             L+AMYGD    L++Q  V Q ++WFT LLF  ++       +   P T+  +A      D
Sbjct  121   LKAMYGDFTTTLMIQIVVFQIVIWFTLLLFMFEYRGAKLLISEQFPETAGAIASLRV--D  178

Query  577   SHGSSVQ----MAGDVEANNNNETN----------TYSDDSAVTESTS-----------V  681
             S  SS+     +  D E   N E +          + +  SA  +S S           +
Sbjct  179   SSVSSLNGREPLHADAEIGENGELHVVVRSMSRSMSINKPSAFNKSYSTPIPSSLQNAVM  238

Query  682   LSLMMP-VLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFS  858
             ++L++  V  NL +NPN+YA  LGL W+L+  RW++++PSII+GSI I+S  G G+ MFS
Sbjct  239   INLILTMVWRNLIRNPNTYASILGLIWSLIFFRWNIKMPSIIKGSIEIISNTGLGIVMFS  298

Query  859   MGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQS  1038
             +GLF+ALQ  I+ CG ++T LA+ L+F+VGP   L    ++G+ G +LR++++QAALPQ 
Sbjct  299   LGLFMALQPKIITCGKTLTLLALALKFLVGPFIILATSKIVGMHGILLRVTIVQAALPQG  358

Query  1039  LASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILG  1158
             +  FV+A+EY LHADILST V  G +V +P+ I YYVILG
Sbjct  359   IVPFVFAREYNLHADILSTTVIFGMVVVLPVTIIYYVILG  398



>gb|KDO47605.1| hypothetical protein CISIN_1g041301mg, partial [Citrus sinensis]
Length=291

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 162/325 (50%), Positives = 213/325 (66%), Gaps = 36/325 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKV+VAM PLY AL LGY SV+ W +  P++C AINR  C+F +P F  +F  
Sbjct  1     MIGWEDVYKVIVAMVPLYFALILGYGSVKWWKIIAPEECAAINRLVCYFTLPLFTIEFTT  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGS-LSCSVTAFSLSTLTNTLIVGVP  408
             H++P+++NY F+ ADA++K +++  LA W   +KKGS  S  +T FSL TLTNTL++GVP
Sbjct  61    HVDPFNMNYRFIGADAISKLIIVIVLAFWGMCSKKGSCFSWCITNFSLCTLTNTLVLGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             L++AMYG +  DLVVQ++V Q++VWFT  LF L+F           R AG          
Sbjct  121   LMKAMYGQMAVDLVVQSSVFQSIVWFTIFLFILEF-----------RRAG----------  159

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTEST-SVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
                          N      +  A + S  S   LM  V   LA+NPNSYAC +GL WA 
Sbjct  160   -------------NALEDLEEGHATSSSRPSFWHLMKVVWLKLAKNPNSYACVIGLAWAF  206

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +A+RW  ++PSIIEGSI+IMSKAG+G AMFSMG+F+ALQE ++ CG S+TA  MVL+FI 
Sbjct  207   VANRWHFKMPSIIEGSILIMSKAGTGTAMFSMGIFMALQEKLLACGPSLTAFGMVLKFIA  266

Query  946   GPATTLIGCLVLGLRGDVLRISLIQ  1020
             GPA   IG +  GLRGDVLR+S+IQ
Sbjct  267   GPAAMAIGSIATGLRGDVLRVSIIQ  291



>ref|NP_001140977.1| uncharacterized protein LOC100273056 [Zea mays]
 gb|ACF85087.1| unknown [Zea mays]
 gb|AFK32345.1| putative auxin efflux carrier PIN5c [Zea mays]
 tpg|DAA40475.1| TPA: hypothetical protein ZEAMMB73_821028 [Zea mays]
Length=365

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 187/385 (49%), Positives = 250/385 (65%), Gaps = 34/385 (9%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV AMAPLY AL LGY SVR W +F PDQCDA+NR   +F +PFF F F A
Sbjct  1     MIGWGDVYKVVAAMAPLYFALGLGYGSVRWWKLFSPDQCDAVNRLVAYFAVPFFAFDFAA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTK-------------KGSLSCSVTAFSL  372
              I+P+ L+Y  L+ADA++K  V  ALAAWA                   +LS  +T FSL
Sbjct  61    RIDPFALSYRVLAADALSKLAVALALAAWATAAASASARRGGGGKGKDRALSWCITGFSL  120

Query  373   STLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRV  552
             +TL NTL+VGVPLL AMYG    DL+VQ +V+Q +V+F  LL AL+           +R 
Sbjct  121   ATLNNTLVVGVPLLDAMYGKWARDLIVQISVVQIIVYFPALLLALE-----------ARR  169

Query  553   AGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNS  732
             AG           + +  +  A + +E+         T + S+  L+  V   +A+NPN 
Sbjct  170   AG----------KLAVVAEEAAGDADESGGGGSGGGTTAAQSLWPLVTAVWKKVARNPNV  219

Query  733   YACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASV  912
             YA  LG+ WA + +RW ++ PSIIEGS+++MSK G G++MFSMGLF+ALQE ++ CGA  
Sbjct  220   YAGILGVSWACVTNRWHIETPSIIEGSVLVMSKTGVGLSMFSMGLFMALQEKVIVCGAWP  279

Query  913   TALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILS  1092
             T L M LRF+ GPA T  G + LGLRGDVLR++++QAALPQS+ +FV+A+EYGLH ++LS
Sbjct  280   TVLGMALRFVAGPAATAAGAVALGLRGDVLRLAVMQAALPQSITTFVFAREYGLHPEVLS  339

Query  1093  TAVTIGTLVSVPLLITYYVILGFLH  1167
             TAV  GTL S+P+LI YY++LG + 
Sbjct  340   TAVIFGTLASLPVLIVYYIVLGLIR  364



>ref|XP_007138749.1| hypothetical protein PHAVU_009G234000g [Phaseolus vulgaris]
 gb|ESW10743.1| hypothetical protein PHAVU_009G234000g [Phaseolus vulgaris]
Length=416

 Score =   298 bits (762),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 167/415 (40%), Positives = 246/415 (59%), Gaps = 46/415 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI  ++VY+VV A+ PLYVAL L Y SVR W +F P+QC  INRF   F +PF +F F++
Sbjct  1     MIKGKDVYEVVAALVPLYVALFLAYGSVRWWKIFTPEQCSGINRFVSVFAVPFLSFHFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             + NPY +N+ FL+AD++ K +++ AL  W + TK GS++ ++T FSLSTL NTLI+GVPL
Sbjct  61    NNNPYTMNFRFLAADSLQKVVILVALVLWNSLTKWGSINWTITLFSLSTLPNTLIMGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF-----WFTRTHPTTSSRVA-------  555
             L+AMYGD  A L++Q  V Q+++W+T LLF  ++       +   P ++  +A       
Sbjct  121   LKAMYGDFTATLMIQIVVFQSVIWYTLLLFMFEYRGAKLLISEQFPESAGAIATLRVDSS  180

Query  556   --------------GAGAARDSHGSSVQMAGDVEAN--------------------NNNE  633
                             G   + H     M   V ++                     N E
Sbjct  181   VSSLNGTEALHADAEIGEKGELHVVVRSMPRSVPSSFNKSYSTPRSSNAGFEKGMVKNEE  240

Query  634   TNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGS  813
              +T  +         +  ++  V  NL +NPN+YA  LGL W+L+  RW +++PSII+GS
Sbjct  241   VDTNKNQQMPRAKVMINLILTMVWRNLIRNPNTYASILGLIWSLIFFRWSIKMPSIIKGS  300

Query  814   IVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRG  993
             I I+S  G G+AMFS+GLF+ALQ  I+ CG ++ ALA  ++F+VGP   L    ++G+ G
Sbjct  301   IEIISNTGLGMAMFSLGLFMALQPKIITCGKTLAALAFAIKFLVGPFIILATSKIIGIHG  360

Query  994   DVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILG  1158
              +LR++++QA LPQ +  FV+A+EY LH DILSTAV  G +V++P+ I YY ILG
Sbjct  361   VLLRVTIVQAVLPQGIVPFVFAREYNLHTDILSTAVIFGMVVALPVTIIYYAILG  415



>ref|XP_004978371.1| PREDICTED: probable auxin efflux carrier component 6-like [Setaria 
italica]
Length=361

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 241/368 (65%), Gaps = 14/368 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W +VYKV  A+ PLYV L LG+ SVRRW +F P+QC+++N    FF IPFF F F  
Sbjct  1     MISWGDVYKVASALVPLYVPLLLGFCSVRRWKIFTPEQCESVNSLVAFFAIPFFTFGFTV  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFT--KKGSLSCSVTAFSLSTLTNTLIVGV  405
             H +P+  NY  ++AD ++K ++ A +  W   T  +K ++S S+T FSLSTLT++L+VGV
Sbjct  61    HTDPFRANYRAIAADVISKAVIAAVIGGWVLLTGGRKNAVSWSITGFSLSTLTSSLVVGV  120

Query  406   PLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHG  585
             P+ +AMYGD    LVVQ +V Q +VW T LLFAL+            R A  G       
Sbjct  121   PMAQAMYGDWAQQLVVQLSVFQAIVWITLLLFALEV-----------RKAALGTTTQIRR  169

Query  586   SSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
             ++     D+EA +N E    +         S+  L+  VL  L +NPN+YA   G+ WA 
Sbjct  170   AADVPVSDIEATSNAEAIGVAPTVG-GGRPSIWKLVKVVLYKLGRNPNTYASVGGIMWAC  228

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +A+   + LP II+ SI IM++ G+G+AMFSMGLF+A Q+ ++ CG S+T L++VL+F++
Sbjct  229   IANTLQISLPIIIKNSIGIMAQCGNGLAMFSMGLFMAQQDKLIPCGPSLTFLSLVLKFVL  288

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
              P    IG + +GLRGDV+R+++IQAA+PQS+ SF++AKEYGLH D+LSTAV +G LVSV
Sbjct  289   DPIAMTIGSIAVGLRGDVVRVAIIQAAVPQSITSFIFAKEYGLHPDVLSTAVIVGMLVSV  348

Query  1126  PLLITYYV  1149
             PL++ +YV
Sbjct  349   PLIVLFYV  356



>ref|XP_006853065.1| hypothetical protein AMTR_s00038p00074050 [Amborella trichopoda]
 gb|ERN14532.1| hypothetical protein AMTR_s00038p00074050 [Amborella trichopoda]
Length=386

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 166/385 (43%), Positives = 232/385 (60%), Gaps = 16/385 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI     Y V  AM PLYVA+ L Y SV+ W +F  DQC  INRF   F IPF + Q ++
Sbjct  1     MITASAFYDVFTAMVPLYVAMFLAYGSVKWWRIFTTDQCSVINRFVAIFAIPFLSLQIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              INPY +N  F+ AD + K L++  L  W +F+  GSL   +T FS+STL NTLI+G+PL
Sbjct  61    SINPYQMNLKFILADTLQKLLILFVLVLWGSFSSWGSLDWVITLFSISTLPNTLIIGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFT-----RTHPTTSSRVAGAGAARD  576
             LRAMYG     L+VQ  V+Q LVW+T LLF  +         +   +  S+V    +   
Sbjct  121   LRAMYGVEINGLLVQIVVLQGLVWYTLLLFLFELKAKIEMGPQIPVSMGSQVGSDVSPVH  180

Query  577   SHGSSVQMAGDVEANNNNETNTYSDDSAVTE-----------STSVLSLMMPVLSNLAQN  723
             +  S V   GD+E +    +    D+ A ++           S  ++ L   VLS + +N
Sbjct  181   AQSSVVSCKGDLEGDGEMHSKEIEDEEAPSKDSEDEGEATCSSVKMIHLFFLVLSKVIKN  240

Query  724   PNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECG  903
             PN+YA  LGL W L+A RW++ +P I++ SI I++ AG G+AMFS+GLF+A Q  I+ CG
Sbjct  241   PNTYASVLGLVWGLIACRWNIHMPKIVQNSISILADAGLGMAMFSLGLFMASQNKIIACG  300

Query  904   ASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHAD  1083
                  LAMV+RF++GPA      L +GLRG +L ++++QAAL Q++  FVYAKEY ++ D
Sbjct  301   KRRATLAMVVRFLLGPAVMAACSLAVGLRGKLLHVAIVQAALSQAITPFVYAKEYNVYPD  360

Query  1084  ILSTAVTIGTLVSVPLLITYYVILG  1158
             ILST V  G LVS+P+ + YYV+LG
Sbjct  361   ILSTMVVFGMLVSLPITLAYYVLLG  385



>ref|XP_004957280.1| PREDICTED: probable auxin efflux carrier component 4-like [Setaria 
italica]
Length=363

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 192/387 (50%), Positives = 248/387 (64%), Gaps = 40/387 (10%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV AMAPLY AL LGY SVR W +F PDQCDA+NR   +F +PFF F F A
Sbjct  1     MIGWGDVYKVVAAMAPLYFALGLGYGSVRWWKLFTPDQCDAVNRLVAYFSVPFFAFDFAA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKG-------------SLSCSVTAFSL  372
              I+P+ L+Y  L+ADA+AK  V+ +LAAWA                   + S  +T FSL
Sbjct  61    RIDPFALSYRVLAADALAKLAVVVSLAAWAAACASARRGGGDGKGNKDRAFSWCITGFSL  120

Query  373   STLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRV  552
             + L NTL+VGVPLL AMYG    DL+VQ +V+Q +V+F  LL   +          + R 
Sbjct  121   AALNNTLVVGVPLLDAMYGKWARDLIVQISVVQIIVYFPLLLLTFE----------ARRA  170

Query  553   AGAGA--ARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNP  726
              GAG   A +  G+     GDVE +              T + S   L+  V   +A+NP
Sbjct  171   WGAGKRPAAEEEGAG----GDVEESGGE-----------TAARSFWPLVRAVWMKVAKNP  215

Query  727   NSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGA  906
             N YA  LG+ WA + +RW ++ PSIIEGS+++MSK G G+AMFSMGLF+ALQE I+ CGA
Sbjct  216   NVYAGVLGVAWACVTNRWHIETPSIIEGSVLVMSKTGVGLAMFSMGLFMALQEKIIVCGA  275

Query  907   SVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADI  1086
               T L M LRF+ GPA T  G L +GLRGDVLR+++IQAALPQ++ +FV+AKEY LHAD+
Sbjct  276   GPTFLGMALRFVAGPAATAAGALAMGLRGDVLRLAIIQAALPQAITTFVFAKEYSLHADV  335

Query  1087  LSTAVTIGTLVSVPLLITYYVILGFLH  1167
             LSTAV  GTL S+P+LI YY++LG + 
Sbjct  336   LSTAVIFGTLASLPVLIVYYIVLGLIR  362



>ref|XP_009781685.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana 
sylvestris]
Length=347

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 237/372 (64%), Gaps = 25/372 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW ++YKVV AMAPLYVAL LGY SV+ WH F  + CDAINR N FFV+PFF F F++
Sbjct  1     MIGWADIYKVVEAMAPLYVALGLGYGSVKWWHKFSAEHCDAINRLNYFFVLPFFTFDFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              +NPY ++Y F+  D +AK ++   L  WANF +KG+ S S+T+FS  +LTN L++G+P+
Sbjct  61    QVNPYKMSYLFICGDLIAKAIIGFVLTLWANFYRKGNFSWSITSFSFCSLTNALVIGIPV  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L AM   +G DLV+Q+  IQ L+W   + F ++            R A      D+    
Sbjct  121   LHAMSPQVGVDLVIQSLAIQFLIWSIIIQFMMEL-----------RNAKNEMTFDNTNQ-  168

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  D+E NN          S  T++ ++ S+M  V + L++NPN YACFLG+ W+L+A
Sbjct  169   -----DLEGNN--------TTSTATKTPTLGSVMKVVWTKLSKNPNFYACFLGIMWSLVA  215

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +  +    S  +  I IMSKAGSG+ MF++G+F+A+QE I+  G  V    ++LRF+VGP
Sbjct  216   NSTNYNYISHSKECISIMSKAGSGIGMFTIGVFVAMQEKIMAGGTRVVMFGLLLRFVVGP  275

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             AT  +G  V+GL G+VLR +++QAALP  +ASFV AKEYG+H +I+S  V IG LVS+ +
Sbjct  276   ATMTVGSFVVGLHGNVLRAAILQAALPPRIASFVLAKEYGVHPEIVSAVVIIGILVSLSI  335

Query  1132  LITYYVILGFLH  1167
             +I YY I    H
Sbjct  336   MIAYYAISELTH  347



>gb|EMS56061.1| putative auxin efflux carrier component 4 [Triticum urartu]
Length=367

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 185/376 (49%), Positives = 235/376 (63%), Gaps = 20/376 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   ++YKVV AMAPLY AL LGY SVR W  F  +QC AIN     F +PFF F F+ 
Sbjct  1     MIALGDIYKVVEAMAPLYFALGLGYGSVRWWRFFTAEQCGAINTLVVCFSMPFFTFDFVV  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKK--GSLSCSVTAFSLSTLTNTLIVGV  405
               +PY +NY  ++ADAVAK L + A A WA   K   G+ S S+T FSL    NTL+VGV
Sbjct  61    RADPYAMNYRVIAADAVAKLLAVLAAAGWARCAKAKAGAYSWSITGFSLGAYNNTLVVGV  120

Query  406   PLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFT---RTHPTTSSRVAGAGA  567
             PLL AMYG    DL+VQ AV+Q +VWF  LL A +    W      +   T++R  G+  
Sbjct  121   PLLDAMYGKWAQDLIVQIAVVQAIVWFPLLLLAFELRKAWVVGGASSLSATTARDDGSTT  180

Query  568   ARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFL  747
             + D     V+M  DVEA                    +  +   V   LA+NPN YA  L
Sbjct  181   SDDDRAQHVEM--DVEAAPPTGG----------RRIRLWPMASTVGMKLARNPNVYASVL  228

Query  748   GLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAM  927
             G+ WA +A RW + +P ++ GS+ +MS+ G+G++MFSMGLF+A QE IV CG  + AL M
Sbjct  229   GVAWACIAYRWRIGMPGVVTGSLQVMSRTGTGMSMFSMGLFMAQQERIVACGGGLAALGM  288

Query  928   VLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTI  1107
             VLRF+ GP + L G    GLRGDVLR ++IQAALPQS+ASFV+AKEYGLHAD+LSTAV  
Sbjct  289   VLRFVAGPLSALAGAAAFGLRGDVLRFAIIQAALPQSIASFVFAKEYGLHADVLSTAVIF  348

Query  1108  GTLVSVPLLITYYVIL  1155
             GTLVS+P+LI YY +L
Sbjct  349   GTLVSLPVLIGYYGVL  364



>gb|EAZ07744.1| hypothetical protein OsI_29999 [Oryza sativa Indica Group]
 gb|EAZ43431.1| hypothetical protein OsJ_28036 [Oryza sativa Japonica Group]
 dbj|BAG94538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=357

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 182/364 (50%), Positives = 230/364 (63%), Gaps = 13/364 (4%)
 Frame = +1

Query  91    MAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLS  270
             MAPLY AL LGY SVR W  F  +QC AIN    +F +PFF F F+   +P+ +NY  ++
Sbjct  1     MAPLYFALGLGYGSVRWWRFFTAEQCAAINTMVVYFSMPFFTFDFVVRTDPFAMNYRVIA  60

Query  271   ADAVAKTLVIAALAAWAN------FTKKGSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGD  432
             ADAV+K + IAA+AAWA         K G+ S S+T FSL+ L NTL+VGVPLL AMYG 
Sbjct  61    ADAVSKAIAIAAMAAWARTRCGCAAAKAGAQSWSITGFSLAALNNTLVVGVPLLDAMYGR  120

Query  433   LGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSSVQMAGDV  612
                DLVVQ AV+Q++VWF  LL A    F            G G A  S  S  +   DV
Sbjct  121   WAQDLVVQIAVVQSMVWFPLLLMA----FELRKAWVVGGGGGVGPAVMSSSSPPEKQSDV  176

Query  613   EANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQL  792
             E N                     +    V   LA+NPN YA  LG+ WA +A RW L L
Sbjct  177   EMNGAVVAAP---GGGGGVRLPFWATARTVGLKLARNPNVYASVLGVVWACIAYRWHLSL  233

Query  793   PSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGC  972
             P I+ GS+ +MS+ G+G++MFSMGLF+  QE ++ CGA +TAL M LRF+ GP  TL+G 
Sbjct  234   PGIVTGSLQVMSRTGTGMSMFSMGLFMGQQERVIACGAGLTALGMALRFVAGPLATLVGA  293

Query  973   LVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVI  1152
               LGLRGDVL +++IQAALPQS+ASFV+AKEYGLHAD+LSTAV  GTL+S+P+LI YY +
Sbjct  294   AALGLRGDVLHLAIIQAALPQSIASFVFAKEYGLHADVLSTAVIFGTLISLPILIAYYAV  353

Query  1153  LGFL  1164
             LGF+
Sbjct  354   LGFV  357



>ref|XP_009342872.1| PREDICTED: putative auxin efflux carrier component 5 [Pyrus x 
bretschneideri]
Length=357

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 158/370 (43%), Positives = 225/370 (61%), Gaps = 13/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYVA+ L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLTDVYHVVAATVPLYVAMILAYLSVKWWKLFTPDQCSGINKFVAKFSIPLLSFQIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               +PY +N+  + AD + K     ALAA   F+  G L+  +T  SLSTL NTLI+G+PL
Sbjct  61    SNDPYKMNHKLILADCLQKLTAFLALAAVTKFSSYGGLNSIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYGD  A LV Q  V+Q+L+W+  LLF  +F   +    T S          S  ++
Sbjct  121   LKAMYGDEAAKLVTQIVVLQSLIWYNMLLFLFEFRAAKAASVTPS----------SEPTA  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              +M    EA + +ET    D++    +  + S+++ V   L  NPN++A  LGL WA + 
Sbjct  171   EEMDVPHEAQSKDETE---DETRANNTKKIKSILLTVGRKLITNPNTHATLLGLIWASIH  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW+++LP II  SI I+S  G G+AMFS+GLF+A + +I+ CG     +AM L+FI GP
Sbjct  228   YRWEVKLPEIIAQSIAILSNGGLGMAMFSLGLFMASRGSIIVCGTRKAMIAMGLKFIAGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +    +GLRG VLR++++QA LPQ +  FV+AKEY +H DILST V  G L+++P+
Sbjct  288   AIMAVSSFAVGLRGRVLRVAVVQATLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPI  347

Query  1132  LITYYVILGF  1161
              + YY +LG 
Sbjct  348   ALAYYFLLGL  357



>ref|XP_008379330.1| PREDICTED: putative auxin efflux carrier component 5 [Malus domestica]
Length=357

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/370 (42%), Positives = 222/370 (60%), Gaps = 13/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLY A+ L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLTDVYHVVAATVPLYXAMILAYLSVKWWKLFTPDQCSGINKFVAKFSIPLLSFQIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N+  + +D + K     ALAA   F+  G L+  +T  SLSTL NTLI+G+PL
Sbjct  61    SNNPYKMNHKLILSDCLQKLTAFLALAAVTKFSSYGGLNSIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYGD  A LV Q  V+Q+L+W+  LLF  +F   +    T S          S  ++
Sbjct  121   LKAMYGDEAAKLVTQIVVLQSLIWYNMLLFLFEFRAAKAASVTPS----------SEPTA  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
               M    EA + +ET    D++    +  + S+++ V   L  NPN++A  LGL WA + 
Sbjct  171   EDMEVPHEAQSKDETE---DETRADNTRKIKSILLTVGRKLITNPNTHATMLGLIWASIH  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              +W ++LP II  SI I+S  G G+AMFS+GLF+A + +I+ CG     LAM L+FI GP
Sbjct  228   YKWGVKLPEIIAQSISILSNGGLGMAMFSLGLFMATRGSIIACGTRKAMLAMGLKFIAGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +    +GLRG VLR++++QA LPQ +  FV+AKEY +H D+LST V  G L+++P+
Sbjct  288   AIMALSSFAVGLRGKVLRVAVVQATLPQGIVPFVFAKEYNVHPDVLSTGVIFGMLIALPI  347

Query  1132  LITYYVILGF  1161
              + YY +LG 
Sbjct  348   ALAYYFLLGL  357



>dbj|BAB09622.1| unnamed protein product [Arabidopsis thaliana]
Length=351

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 167/372 (45%), Positives = 230/372 (62%), Gaps = 44/372 (12%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VYKV+ AM PLYVAL LGY SV+ WH+F  DQCDAINR  C+F +P F  +F A
Sbjct  1     MINCGDVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             H++P+++NY F++AD ++K +++  LA WA ++ KGS   S+T+FSL TLTN+L+VGVPL
Sbjct  61    HVDPFNMNYRFIAADVLSKVIIVTVLALWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
              +AMYG    DLVVQ++V Q +VW T LLF L+F           R AG  +   S    
Sbjct  121   AKAMYGQQAVDLVVQSSVFQAIVWLTLLLFVLEF-----------RKAGFSSNNIS----  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  DV+ +N N   +   ++ V    S L +M  V   LA NPN Y+C LG+ WA ++
Sbjct  166   -----DVQVDNIN-IESGKRETVVVGEKSFLEVMSLVWLKLATNPNCYSCILGIAWAFIS  219

Query  772   SR-----------WDLQLPSIIEGSIV------IMSKAGSGVAMFS------MGLFIALQ  882
             +R            +  + S   G I       + S+  +G   +        G+F+ALQ
Sbjct  220   NRDSGDYINSTPYSEATMASGAAGHIRGFDSYNVKSRNRNGHVQYGEYMHIYAGIFMALQ  279

Query  883   ENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAK  1062
             E ++ CG S+T + MVL+FI GPA   IG +VLGL GDVLR+++IQAALPQS+ SF++AK
Sbjct  280   EKLIVCGTSLTVMGMVLKFIAGPAAMAIGSIVLGLHGDVLRVAIIQAALPQSITSFIFAK  339

Query  1063  EYGLHADILSTA  1098
             EYGLHAD+LSTA
Sbjct  340   EYGLHADVLSTA  351



>ref|XP_006663186.1| PREDICTED: probable auxin efflux carrier component 1b-like [Oryza 
brachyantha]
Length=411

 Score =   288 bits (736),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 168/411 (41%), Positives = 249/411 (61%), Gaps = 41/411 (10%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   ++Y V+ A+ PLYVA+ L Y SVR W +F PDQC  INRF   F +P  +F F++
Sbjct  1     MITVLDLYHVLTAVVPLYVAMTLAYASVRWWRIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NP+ +N  FL+AD++ K +V+A LA W   + +GSL   +T FSLSTL NTL++G+PL
Sbjct  61    TNNPFAMNLRFLAADSLQKLIVLALLALWCRLSCRGSLDWLITLFSLSTLPNTLVMGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTR-----THPTTSSRV-------A  555
             LR MYG     L+VQ  V+Q ++W+T +LF  ++   R       P T++ +       A
Sbjct  121   LRGMYGADSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLVMEQFPDTAASIISFRPAAA  180

Query  556   GA----GAARDSHGSS--VQMAGDVEANNNNETNTY-----------------SDDS---  657
             GA    G+A   HG++   Q   +    N NE + +                  DD    
Sbjct  181   GAVHVFGSAGADHGAAKGAQAYDEYSFGNKNEKDGHGPTLSKLGSNSTAQLRPKDDGEER  240

Query  658   -AVTESTSVLS--LMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMS  828
              A     SV++  +++ V   L +NPN+Y+  LG+ W+L++ RW +++P+II  SI I+S
Sbjct  241   PAALPPASVMTRLILIMVWRKLIRNPNTYSSLLGIIWSLVSYRWGIEMPAIIARSISILS  300

Query  829   KAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRI  1008
              AG G+AMFS+GLF+ALQ  I+ CG SV + AM +RF++GPA      + +GLRG +L I
Sbjct  301   DAGLGMAMFSLGLFMALQPRIIACGNSVASFAMAVRFLMGPAVMAAVSIAVGLRGVLLHI  360

Query  1009  SLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGF  1161
             +++QAALPQ +  FV+AKEY +H DILSTAV  G L+++P+ + YY++LG 
Sbjct  361   AIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITLVYYILLGL  411



>gb|AIF28445.1| PIN-like protein, partial [Persea borbonia]
Length=433

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 171/431 (40%), Positives = 244/431 (57%), Gaps = 67/431 (16%)
 Frame = +1

Query  67    EVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPY  246
             ++Y V+ A+ PLYV + L Y SV+ W +F PDQC  INRF   F +P  +F+ ++ INPY
Sbjct  4     DLYCVLSAVVPLYVTMFLAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFEVISRINPY  63

Query  247   HLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPLLRAMY  426
              +++ F++AD V+K LV+ A      F+KKGSL   +T FSLSTL NTL++G+PLL++MY
Sbjct  64    RMDFLFIAADVVSKILVLLASVFMGKFSKKGSLDWVITIFSLSTLPNTLVMGIPLLKSMY  123

Query  427   GDLGADLVVQAAVIQNLVWFTFLLFALQFWFTR---------------------------  525
             G+   +L+ Q  V+Q ++W+T LLF  ++   R                           
Sbjct  124   GN-DKELMSQTVVLQCIIWYTLLLFLFEYRAARILILEKMNRSSSATTSYHSCKSGRSTD  182

Query  526   ------------------THPTTSS--------------RVAGAGA---ARDSHG---SS  591
                               T PTT S              +VA A A     D  G    S
Sbjct  183   EKAGIQRPCEDEVVHVIVTRPTTHSGSPDSDPQRLQNFNKVAPASAHAKPADEDGFCXQS  242

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMP-VLSNLAQNPNSYACFLGLFWALL  768
             VQ+    E     +T +  +    + S+ +L ++M  V   L +NPNSYA  LGL WAL+
Sbjct  243   VQVCSREEERVPEKTESSENLENSSISSEMLRVIMRMVWYKLVRNPNSYASLLGLSWALV  302

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             + RW ++ P I+E S+ I+S AG G+AMFS+GLF+ALQ  I+ CG  +T   M+ RFI G
Sbjct  303   SCRWGVKKPQIMENSVTILSNAGLGMAMFSLGLFMALQPKIIACGTRLTGYGMIARFIAG  362

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   I  + +GLRG VLR++++QAALPQ +  FV+A+EY LH D+LSTAV  G LVS+P
Sbjct  363   PAVMAIASIAVGLRGTVLRVAIVQAALPQGIVPFVFAREYNLHPDVLSTAVIFGMLVSLP  422

Query  1129  LLITYYVILGF  1161
             + I YY++LG 
Sbjct  423   ITILYYILLGL  433



>ref|XP_007216395.1| hypothetical protein PRUPE_ppa021573mg [Prunus persica]
 gb|EMJ17594.1| hypothetical protein PRUPE_ppa021573mg [Prunus persica]
Length=357

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/370 (42%), Positives = 221/370 (60%), Gaps = 13/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYVA+ L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADVYHVVAATVPLYVAMILAYVSVKWWKLFTPDQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D + K +   AL A   F+  G L+  +T  SLST+ NTLI+G+PL
Sbjct  61    GNNPYKMNLKLILSDCLQKLIAFLALTAITKFSSHGGLNSIITGLSLSTMPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYGD  A LV Q  V+Q+L+W+  LLF  +F   +    T S          S  ++
Sbjct  121   LKAMYGDEAAMLVTQIVVLQSLIWYNMLLFLFEFRAAKAASVTPS----------SESTA  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              +M    EA +  E     D++       + S+++ V   L  NPN++A  LGL WA + 
Sbjct  171   EEMEAPQEAQSKEEAE---DETRSRTPKKIKSILLTVGRKLIANPNTHATLLGLIWASIH  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              +W ++LP I+  SI I+S  G G+AMFS+GLF+A + +I+ CG     LAM L+FI GP
Sbjct  228   YKWGVKLPDIVTQSIAILSNGGLGMAMFSLGLFMASRGSIIACGTRTGMLAMGLKFIAGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +    +GLRG +LR++++QAALPQ +  FV+AKEY +H DILST V  G L+++P+
Sbjct  288   ALMAVSSFAVGLRGRILRVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPI  347

Query  1132  LITYYVILGF  1161
              + YY +LG 
Sbjct  348   ALAYYFLLGL  357



>ref|XP_003569680.1| PREDICTED: probable auxin efflux carrier component 1b [Brachypodium 
distachyon]
Length=362

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/369 (43%), Positives = 225/369 (61%), Gaps = 13/369 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  +Y V+ A  PLYVA+ L Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWIAIYHVLEATVPLYVAMILAYLSIKWWKLFTPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + AD + K L +   AA +           +T FSLSTL NTLIVG+PL
Sbjct  61    TNNPYDMNLKLILADILQKLLALLGFAAISRACCAEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTR-THPTTSSRVAGAGAARDSHGS  588
             L+ MYGD   +L+ Q  V+Q+L+W+T LLF L+F   +   PTTSS +  A     + G+
Sbjct  121   LKGMYGDEALNLISQIVVLQSLIWYTLLLFLLEFRAAKGIVPTTSSEIT-AEEEPGTLGT  179

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
             + Q   + +A   +            + +S  + ++ V   L  NPN YAC +GL WAL+
Sbjct  180   TQQRYQEGQAKGVS-----------AKCSSAFNFLLVVGKKLVMNPNMYACLIGLIWALV  228

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
             + RW +QLP II  SI I+S  G G+AMFS+GLF ALQ  I+ CG     L++ +RF +G
Sbjct  229   SFRWQIQLPVIISNSIRILSDGGLGMAMFSLGLFTALQTKIIVCGTKRMLLSLGIRFFLG  288

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA  +I    +G+RG +L+++++QAALPQ +  FV+AKEY LHADILSTA+ +G +V+VP
Sbjct  289   PALMVISSYAVGMRGILLKVAIVQAALPQGIVPFVFAKEYNLHADILSTAIIVGMMVAVP  348

Query  1129  LLITYYVIL  1155
               + YY +L
Sbjct  349   AALAYYFVL  357



>ref|XP_008230728.1| PREDICTED: putative auxin efflux carrier component 5 [Prunus 
mume]
Length=357

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 154/370 (42%), Positives = 221/370 (60%), Gaps = 13/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYVA+ L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADVYHVVAATVPLYVAMILAYVSVKWWKLFTPDQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D + K +   AL A   F+  G L+  +T  SLST+ NTLI+G+PL
Sbjct  61    GNNPYKMNLKLILSDCLQKLIAFLALTAITKFSSHGGLNSIITGLSLSTMPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYGD  A LV Q  V+Q+L+W+  LLF  +F   +    T S          S  ++
Sbjct  121   LKAMYGDEAAMLVTQIVVLQSLIWYNMLLFLFEFRAAKAASVTPS----------SESTA  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              +M    EA +  E     D++       + S+++ V   L  NPN++A  LGL WA + 
Sbjct  171   EEMEVPQEAQSKEEAE---DETRSRTPKKIKSILLTVGRKLITNPNTHATLLGLIWASIH  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              +W ++LP I+  SI I+S  G G+AMFS+GLF+A + +I+ CG     LAM L+FI GP
Sbjct  228   YKWGVKLPDIVTQSIAILSNGGLGMAMFSLGLFMASRGSIIACGTRTGMLAMGLKFIAGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +    +GLRG +LR++++QAALPQ +  FV+AKEY +H DILST V  G L+++P+
Sbjct  288   ALMAVSSFAVGLRGRILRVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPI  347

Query  1132  LITYYVILGF  1161
              + YY +LG 
Sbjct  348   ALAYYFLLGL  357



>gb|KCW65009.1| hypothetical protein EUGRSUZ_G02548 [Eucalyptus grandis]
Length=338

 Score =   282 bits (721),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 171/374 (46%), Positives = 233/374 (62%), Gaps = 42/374 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVV----AMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnf  219
             MIGW++VYKVV     +M PLYVAL LGY SV+ W +F  +QC+ INRF    V+P F F
Sbjct  1     MIGWDDVYKVVYKVVKSMFPLYVALMLGYGSVKWWRLFTHEQCNGINRFIALIVLPLFGF  60

Query  220   qfMAHINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIV  399
             +F AHINPY +N+  L+ADA++K  ++A L      + + S    +T FSL TLTN L+V
Sbjct  61    EFTAHINPYTMNFRLLAADALSKLAILAILGLLGRISSRASYDWIITTFSLCTLTNLLVV  120

Query  400   GVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDS  579
             GVP++RAMYG  G DLVVQ  ++Q+LVW   +L  L+F  TR                  
Sbjct  121   GVPVMRAMYGQWGVDLVVQLFMVQSLVWIPLVLLLLEFRNTR------------------  162

Query  580   HGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
                       +  NN            V E  S  SL   +   +A NPN YA  LGL W
Sbjct  163   ----------IPENN----------GVVDEERSYWSLARVMGMKMAMNPNVYANVLGLAW  202

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             AL+A+R+   +PSI+EGS+ IMSKAG+G AMF++G+FIA+Q  ++ CG   T L +V RF
Sbjct  203   ALMANRFKFTMPSIMEGSVEIMSKAGTGTAMFNIGIFIAMQTRVIACGTGPTVLGLVSRF  262

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             +VGP    +  L +GL G  L+I++IQAA+PQ++ASFV+  EYGLHA++LSTAV +GT++
Sbjct  263   VVGPTIMAVCSLAVGLHGPALQIAIIQAAIPQAIASFVFGNEYGLHANVLSTAVVLGTVI  322

Query  1120  SVPLLITYYVILGF  1161
             S+PLLI YY+ L +
Sbjct  323   SLPLLIGYYIGLDY  336



>tpd|FAA00684.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group]
Length=368

 Score =   280 bits (717),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 245/385 (64%), Gaps = 30/385 (8%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV AMAPLY AL LGY SVR W +F  DQCDA+NR    F +PFF F F A
Sbjct  1     MIGWGDVYKVVAAMAPLYFALGLGYGSVRWWRLFTADQCDAVNRLVACFAVPFFAFDFAA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGS-------------LSCSVTAFSL  372
              I+P+ L+Y  L+ADA++K  V  ALAA A                     S  +T FSL
Sbjct  61    RIDPFALSYRVLAADALSKLAVALALAACAAAASTRCCGSGGGKRGGGGGFSWCITGFSL  120

Query  373   STLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRV  552
             +TL NTL+VGVPLL AMYG    DL+VQ +V+Q +V+F  LL A +    R   T ++  
Sbjct  121   ATLNNTLVVGVPLLDAMYGKWARDLIVQISVVQTIVYFPLLLLAFE---VRRATTAAA--  175

Query  553   AGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNS  732
                         +         +++ E    +  +A     S+  L+  V   +A+NPN 
Sbjct  176   ------------APPPPPTGTDDDDVEDGAAAAATAAAARRSLWPLVRAVWLKVARNPNV  223

Query  733   YACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASV  912
             YA  LG+ WA + +RW ++ PSIIEGS++IMSK G G++MFSMGLF+ALQ+ I+ CGA +
Sbjct  224   YAGVLGVAWACVTNRWHVETPSIIEGSVLIMSKTGVGLSMFSMGLFMALQDKIIVCGAGL  283

Query  913   TALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILS  1092
             T L M LRF+ GPA T +G   LGLRGD+LR+++IQAALPQS+ +FV+AKEYGLHA+ILS
Sbjct  284   TVLGMALRFVAGPAATAVGAFALGLRGDLLRLAIIQAALPQSITTFVFAKEYGLHAEILS  343

Query  1093  TAVTIGTLVSVPLLITYYVILGFLH  1167
             TAV  GTL S+P+LI YY++LGF+ 
Sbjct  344   TAVIFGTLASLPVLIVYYIVLGFIR  368



>ref|XP_004963479.1| PREDICTED: probable auxin efflux carrier component 6-like [Setaria 
italica]
Length=346

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/355 (46%), Positives = 231/355 (65%), Gaps = 14/355 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W +VYKV +A+ PLYV L LG+  VRRW +F P+QC+++N    FF IPFF F F  
Sbjct  1     MISWSDVYKVALALVPLYVPLLLGFCLVRRWKIFTPEQCESVNSLVAFFAIPFFTFGFTV  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFT--KKGSLSCSVTAFSLSTLTNTLIVGV  405
             H +P+  NY  ++AD V+K ++ A +  W      +K ++S S+T FSLST+T++L+VGV
Sbjct  61    HTDPFRANYRAIAADIVSKAVIAAIIGGWVLLAGGRKNAVSWSITGFSLSTVTSSLVVGV  120

Query  406   PLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHG  585
             P+ +AMYGD G  LVVQ +V Q +VW T LLFAL+        TT  R          H 
Sbjct  121   PMAQAMYGDWGQQLVVQLSVFQAIVWITLLLFALEVRKAALGTTTQIR----------HA  170

Query  586   SSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
             + V ++ D+EA +N      +     +   S+  L+  VL  L +NPN+YA   G+ WA 
Sbjct  171   ADVPVS-DIEATSNAAAIGVAPTVG-SGRPSIWKLVKVVLYKLGRNPNTYASVGGIIWAC  228

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +A+R  + LP IIE SI IM++ G+G+AMFSMGLF+A Q+ ++ CG S+T L +VL+FI+
Sbjct  229   IANRLQISLPIIIENSIGIMARCGNGLAMFSMGLFMAQQDKLIPCGLSLTFLGLVLKFIL  288

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIG  1110
              P    IG + +GL GDVLR+++IQAA+PQS+ SF++AKEYGLH D+LST V +G
Sbjct  289   DPIVMTIGSIAVGLHGDVLRVAIIQAAVPQSITSFIFAKEYGLHPDVLSTVVIVG  343



>gb|KDO39721.1| hypothetical protein CISIN_1g035534mg [Citrus sinensis]
Length=291

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 211/326 (65%), Gaps = 41/326 (13%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGWE+VYKV+VAM PLY AL LGY SV+ W +  P++C AINR  C+F +P F  +F  
Sbjct  1     MIGWEDVYKVIVAMVPLYFALMLGYGSVKWWKIIAPEECAAINRLVCYFTLPLFTIEFTT  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGS-LSCSVTAFSLSTLTNTLIVGVP  408
             H++P+++NY F+ ADA++K +++  LA W+  +KKGS  S  +T FSL TLTNTL++GVP
Sbjct  61    HVDPFNMNYRFIGADAISKLIIVIVLAFWSMCSKKGSYFSWCITNFSLCTLTNTLVLGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             L++AMYG +  DLVVQ++V Q++VW T  LF L+F           R +G     DS   
Sbjct  121   LMKAMYGQMAVDLVVQSSVFQSIVWLTIFLFVLEF-----------RRSG----NDSK--  163

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTS--VLSLMMPVLSNLAQNPNSYACFLGLFWA  762
                   D+E            +  VT S+      LM  V   LA+NPNSYAC +GL WA
Sbjct  164   ------DLE------------EGHVTSSSRPPFWHLMKVVWLKLAKNPNSYACVIGLAWA  205

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +A+RW  +LPSIIEGSI+IMSKAG+G AMFSMG    L E ++ CG  +TAL MVL+FI
Sbjct  206   FVANRWHFKLPSIIEGSILIMSKAGTGTAMFSMG---ELGEKLLACGPGLTALGMVLKFI  262

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQ  1020
              GPA   IG +  GL GDVLR+S+IQ
Sbjct  263   AGPAAMAIGSIAAGLHGDVLRVSIIQ  288



>gb|EMS67819.1| Putative auxin efflux carrier component 5 [Triticum urartu]
Length=357

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/368 (41%), Positives = 216/368 (59%), Gaps = 11/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  +Y V+ A  PLYVA+ L Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWVAIYHVLEATTPLYVAMILAYLSIKWWKLFTPEQCSGINKFVANFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + AD + K++ +   AA +           +T FSLSTL NTLIVG+PL
Sbjct  61    TNNPYDMNLKLIFADILQKSIALLGFAAISRACCAEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYGD    L+ Q  V+Q+L+W+T LLF L+F              G  AA  S    
Sbjct  121   LKGMYGDEAVKLISQIVVLQSLIWYTLLLFLLEF----------RAAKGIAAAPSSEIVD  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              + AG + A         S   +    +     ++ +   L  NPN YAC +GL WAL++
Sbjct  171   EEEAGTLGATQQTYQEGQSKGVS-ARCSRAFRFLLVIGMKLVMNPNIYACLIGLIWALIS  229

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +QLP II  SI I+S  G G+AMFS+GLF ALQ  I+ CG     L++ +RF +GP
Sbjct  230   FRWQIQLPLIISNSIRILSDGGLGMAMFSLGLFTALQTKIIACGTKKMLLSLGIRFFLGP  289

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A  +I    +G+RG +L+++++QAALPQ +  FV+AKEY +HADILSTA+ +G +V+VP 
Sbjct  290   ALMMISSYAVGMRGILLKVAIVQAALPQGVVPFVFAKEYNVHADILSTAIIVGMMVAVPA  349

Query  1132  LITYYVIL  1155
              + YY ++
Sbjct  350   ALAYYFVI  357



>ref|XP_007032452.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY03378.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=356

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/369 (42%), Positives = 223/369 (60%), Gaps = 16/369 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLY A+ L Y SV+ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADVYHVVAATVPLYFAMILAYTSVKWWKLFTPEQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + AD + K L    L A   F+ +G L   +T  SLSTL NTLI+G+PL
Sbjct  61    ENNPYKMNLKLILADFLQKLLAFVVLMAIEKFSSRGGLPSIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMYGD  A L+ Q  V+Q+L+W+  LLF  +   T+             AA ++  S 
Sbjct  121   LRAMYGDKSATLLAQIVVLQSLIWYNILLFLYELNATK-------------AASETPPS-  166

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTS-VLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
              Q +GD+EA    +     +++      S  + + + V   L  NPN++A  LGL WA +
Sbjct  167   -QDSGDLEAPEEAQAKEGGEEAHTRPRKSKAMLIFLTVGKKLMANPNTHATLLGLIWASI  225

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
               RW+++ P+IIE SI I+S  G G+AMFS+GLF+A + +I+ CG  + A+AM ++F+ G
Sbjct  226   QFRWNIKFPAIIEKSIAILSSGGLGMAMFSLGLFMASRPSIIACGIRMAAVAMAMKFMAG  285

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA        LGLRG VLR++++QAALPQ +  FV+AKEY +H D+LST V  G L+++P
Sbjct  286   PALMAASSAALGLRGKVLRVAIVQAALPQGVVPFVFAKEYNVHPDVLSTGVIFGLLIALP  345

Query  1129  LLITYYVIL  1155
             + + YY+IL
Sbjct  346   VALVYYLIL  354



>emb|CDM83606.1| unnamed protein product [Triticum aestivum]
Length=357

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/368 (40%), Positives = 215/368 (58%), Gaps = 11/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  +Y V+ A  PLYVA+ L Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWVAIYHVLEATTPLYVAMILAYLSIKWWKLFTPEQCSGINKFVANFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + AD + K++ +   AA +           +T FSLSTL NTLIVG+PL
Sbjct  61    TNNPYDMNLKLIFADILQKSIALLGFAAISRACCVEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYGD    L+ Q  V+Q+L+W+T LLF L+F              G  AA  S    
Sbjct  121   LKGMYGDEAVKLISQIVVLQSLIWYTLLLFLLEF----------RAAKGIAAAPSSEIVD  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              + AG + A         S   +    +     ++ +   L  NPN YAC +GL WAL++
Sbjct  171   EEEAGTLGATQQTYQEGQSKGVS-ARCSRAFRFLLVIGMKLVMNPNIYACLIGLIWALIS  229

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +QLP I+  SI I+S  G G+AMFS+GLF ALQ  I+ CG     L++  RF +GP
Sbjct  230   FRWQIQLPLIVSNSIRILSDGGLGMAMFSLGLFTALQTKIIACGTKKMLLSLGFRFFLGP  289

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A  ++    +G+RG +L+++++QAALPQ +  FV+AKEY +HADILSTA+ +G +V+VP 
Sbjct  290   ALMMVSSYAVGMRGILLKVAIVQAALPQGVVPFVFAKEYNVHADILSTAIIVGMMVAVPA  349

Query  1132  LITYYVIL  1155
              + YY ++
Sbjct  350   ALAYYFVI  357



>ref|XP_008775592.1| PREDICTED: probable auxin efflux carrier component 1c [Phoenix 
dactylifera]
Length=357

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/370 (41%), Positives = 222/370 (60%), Gaps = 18/370 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY V+VA  PLY A+ L Y S++ W +F PDQC  IN+F   F +P  +F  ++
Sbjct  1     MISLATVYHVLVATVPLYAAMILAYLSIKWWKLFTPDQCTGINKFVAKFSVPLLSFHVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   L AD++ K L +   A  +    +GSL   +T FSLSTL NTLI+G+PL
Sbjct  61    TNNPYKMNLKLLVADSLQKILALFVFAVLSKACFRGSLDWLITGFSLSTLPNTLIIGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ +YGD  A L+ Q  V+Q+L+W+T LL   +F           R A A AA  +  + 
Sbjct  121   LKGLYGDEAAKLLGQIVVLQSLIWYTLLLILFEF-----------RAAKAIAANPTDST-  168

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLS--NLAQNPNSYACFLGLFWAL  765
                 G++E++         D+       ++ SL++  ++   L  NPN+YA   G  WAL
Sbjct  169   ----GELESSEGVRPRPEEDEVKSLSIRNIRSLLILWMAGKKLMINPNTYASLAGFVWAL  224

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             ++ RW ++LP II   I I+S  G G+AMFS+GLF A Q +I+ CG  +  L+M LRFI+
Sbjct  225   ISFRWRIELPLIISNCISILSDGGLGMAMFSLGLFTASQSSIIACGIRMMILSMGLRFII  284

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   I    +G+R  +L+++++QAALPQ + +FV+AKEYG+H DILST V +G +++V
Sbjct  285   GPALIAITSYAIGMRAKLLKVAIVQAALPQGIVTFVFAKEYGVHPDILSTGVIVGMIIAV  344

Query  1126  PLLITYYVIL  1155
             P+ + YY IL
Sbjct  345   PIALAYYFIL  354



>ref|XP_010068800.1| PREDICTED: uncharacterized protein LOC104455763 [Eucalyptus grandis]
Length=688

 Score =   283 bits (725),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 171/374 (46%), Positives = 233/374 (62%), Gaps = 42/374 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVV----AMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnf  219
             MIGW++VYKVV     +M PLYVAL LGY SV+ W +F  +QC+ INRF    V+P F F
Sbjct  1     MIGWDDVYKVVYKVVKSMFPLYVALMLGYGSVKWWRLFTHEQCNGINRFIALIVLPLFGF  60

Query  220   qfMAHINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIV  399
             +F AHINPY +N+  L+ADA++K  ++A L      + + S    +T FSL TLTN L+V
Sbjct  61    EFTAHINPYTMNFRLLAADALSKLAILAILGLLGRISSRASYDWIITTFSLCTLTNLLVV  120

Query  400   GVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDS  579
             GVP++RAMYG  G DLVVQ  ++Q+LVW   +L  L+F  TR                  
Sbjct  121   GVPVMRAMYGQWGVDLVVQLFMVQSLVWIPLVLLLLEFRNTR------------------  162

Query  580   HGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
                       +  NN            V E  S  SL   +   +A NPN YA  LGL W
Sbjct  163   ----------IPENN----------GVVDEERSYWSLARVMGMKMAMNPNVYANVLGLAW  202

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             AL+A+R+   +PSI+EGS+ IMSKAG+G AMF++G+FIA+Q  ++ CG   T L +V RF
Sbjct  203   ALMANRFKFTMPSIMEGSVEIMSKAGTGTAMFNIGIFIAMQTRVIACGTGPTVLGLVSRF  262

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             +VGP    +  L +GL G  L+I++IQAA+PQ++ASFV+  EYGLHA++LSTAV +GT++
Sbjct  263   VVGPTIMAVCSLAVGLHGPALQIAIIQAAIPQAIASFVFGNEYGLHANVLSTAVVLGTVI  322

Query  1120  SVPLLITYYVILGF  1161
             S+PLLI YY+ L +
Sbjct  323   SLPLLIGYYIGLDY  336



>ref|XP_002458404.1| hypothetical protein SORBIDRAFT_03g032850 [Sorghum bicolor]
 gb|EES03524.1| hypothetical protein SORBIDRAFT_03g032850 [Sorghum bicolor]
Length=362

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/368 (40%), Positives = 215/368 (58%), Gaps = 11/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  +Y V+    PLYVA+ + Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY++N   + +D + K+L +   A  +    K      +T FSLSTL NTLIVG+PL
Sbjct  61    TNNPYNMNLKLIFSDILQKSLSLLGFAVISKACCKEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYGD    L+ Q   +Q+L+W+T LLF  +F   R    T+S      A   + G  
Sbjct  121   LKGMYGDEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGMAITTSSETTNEAESGTTGPM  180

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              Q          +E       SA          ++ V   L  NPN YA  +GL WAL++
Sbjct  181   QQ---------RHEEGQEKRVSA--RCYGAFQFLLVVGKKLVTNPNMYASLIGLIWALIS  229

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +QLPSI+  SI I+S  G G+AMFS+GLF ALQ  IV CG     L++ +RF +GP
Sbjct  230   FRWRIQLPSIVNNSIRILSDGGLGMAMFSLGLFTALQTKIVACGTKKMLLSLGIRFFLGP  289

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A  ++    +G+RG +L++++IQAALPQ +  FV+AKEY +HADILSTA+ +G +V+VP+
Sbjct  290   ALMVVSSYAIGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAIILGMIVAVPV  349

Query  1132  LITYYVIL  1155
              + YY ++
Sbjct  350   ALGYYFVM  357



>ref|XP_010087804.1| Putative auxin efflux carrier component 5 [Morus notabilis]
 gb|EXB30111.1| Putative auxin efflux carrier component 5 [Morus notabilis]
Length=360

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/368 (40%), Positives = 216/368 (59%), Gaps = 10/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYVA+ L Y SVR W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLRDVYHVVTATVPLYVAMILAYVSVRWWKIFTPDQCSGINKFVAKFSIPLLSFQILS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D + K L   AL     FT KG L   +T  S+S L NTLI+G+PL
Sbjct  61    DNNPYKMNLRLILSDFLQKLLAFVALTVMTRFTSKGGLDFVITGLSVSILPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG+  A L+ Q  V+Q+L+W+  LLF  +F          +    A +   S  ++
Sbjct  121   LKAMYGEQAAVLLSQIVVLQSLIWYNLLLFLYEF----------NAAKSAASVSPSSEAT  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
               M    E+    E     + S+       + +++ V   L  NPN++A  +GL WA + 
Sbjct  171   EDMEAPQESQPKEEVEEARNRSSSPRKIKTMLILLTVGRKLIGNPNTHATIIGLVWACIK  230

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP+I++ SI ++S  G G+AMFS+GLF+A + +I+ CG  +  LAM L+FI GP
Sbjct  231   FRWKVELPAIVDQSITVLSSGGLGMAMFSLGLFMASRSSIIACGTRMGVLAMGLKFIGGP  290

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                    L +GLRG  LR++++QAALPQ +  FV+AKEY ++ DILST V  G L+++P+
Sbjct  291   FLMAAASLAIGLRGTQLRVAIVQAALPQGIVPFVFAKEYNIYPDILSTGVIFGMLIALPI  350

Query  1132  LITYYVIL  1155
              + Y+ +L
Sbjct  351   ALVYFFML  358



>ref|XP_004302355.1| PREDICTED: probable auxin efflux carrier component 1b-like [Fragaria 
vesca subsp. vesca]
Length=357

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/368 (41%), Positives = 220/368 (60%), Gaps = 13/368 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYVA+ L Y SV+ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLIDVYHVVAATVPLYVAMILAYVSVKWWKLFTPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D + K +   AL A   F+  G L+  +T  SLSTL NTLI+G+PL
Sbjct  61    ANNPYKMNLKLILSDGLQKAIAFLALTAITKFSSHGGLNSIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMY +    LV Q  V+Q+LVW+  LLF  +F   +    T S          S  ++
Sbjct  121   LKAMYAEEAGALVSQIVVLQSLVWYNLLLFLFEFRAAKAASVTPS----------SEATA  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              +M    EA + +E      +       ++ S+++ V   L  NPN++A  L L WA + 
Sbjct  171   EEMEAPNEAQSKDEEG---GEERTRNPKNMKSILLTVGRKLFANPNTHATLLSLIWASIH  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +++P I+  SI IM+  G G+A FS+GLF+A + +I+ CGA +T +AM L+F+ GP
Sbjct  228   FRWGVKMPEIVTQSISIMANGGLGMATFSLGLFMASRPSIIACGARMTMVAMGLKFLAGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +   V+GLRG  LRI+++QAALPQ +  FV+AKEY +H +ILSTAV  G L+++P+
Sbjct  288   AVMALSSFVIGLRGRALRIAIVQAALPQGIVPFVFAKEYNVHPEILSTAVIFGMLIALPV  347

Query  1132  LITYYVIL  1155
              + YY +L
Sbjct  348   ALAYYFLL  355



>ref|XP_010912889.1| PREDICTED: probable auxin efflux carrier component 1b [Elaeis 
guineensis]
Length=357

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 151/371 (41%), Positives = 219/371 (59%), Gaps = 20/371 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY V+ A  PLY A+ L Y S++ W +F PDQC  IN+F   F IP  +F  ++
Sbjct  1     MISLATVYHVLAATVPLYAAMFLAYLSIKWWKLFTPDQCTGINKFVAKFSIPLLSFHVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D++ K   +   A       +GSL   +T FSLSTL NTLI+G+PL
Sbjct  61    TNNPYKMNLKLVVSDSLQKIFALLVFAVLTKACFRGSLDWLLTGFSLSTLPNTLIIGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYG   A L+ Q  V+Q+LVW+T LLF  +F           R A A AA  +  + 
Sbjct  121   LKGMYGAEAAKLLAQIVVLQSLVWYTLLLFLFEF-----------RAAKAIAANPTDST-  168

Query  592   VQMAGDVEANNNNETNTYSDDS---AVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
                 G++E++         D+    ++    S L L M V   L  NPN+YA   G  W+
Sbjct  169   ----GELESSGGIHPRPEEDEVKSLSIRNIKSFLILQM-VGKKLMINPNTYATLAGFVWS  223

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
             L++ RW ++LP II   I ++S  G G+AMFS+GLF+A Q +I+ CG  +  L+M LRFI
Sbjct  224   LISFRWGIELPLIIRNCISMLSDGGLGMAMFSLGLFMASQSSIIACGTRMMVLSMALRFI  283

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
             +GPA   I    +G+R  +L+++++QAALPQ + +FV+AKEYG+H DILST V +G +++
Sbjct  284   IGPALIAIPSYAIGMRATLLKVAIVQAALPQGIVTFVFAKEYGVHPDILSTGVIVGMIIA  343

Query  1123  VPLLITYYVIL  1155
             VP+ + YY IL
Sbjct  344   VPIALAYYFIL  354



>emb|CDM85668.1| unnamed protein product [Triticum aestivum]
Length=343

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/340 (46%), Positives = 212/340 (62%), Gaps = 14/340 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A APLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATAPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLI  396
             H +P+ +NY  ++AD ++K +++A +A WA F       KG+   S+T FSLSTLTN+L+
Sbjct  61    HTDPFQVNYRAVAADVISKAVIVAVIAVWARFLARNGNGKGAAGWSITGFSLSTLTNSLV  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             VGVP+ RAMYG+    LVVQ +V Q +VW T LLF L+    +        V       D
Sbjct  121   VGVPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEV--RKAAIGMYVDVGKTSVVHD  178

Query  577   SHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLF  756
             +      +  DVEA              V    SV  L+  V   LA+NPN+YA F+G+ 
Sbjct  179   AAMPESPVKADVEAAPTGAEE-------VGGKPSVWRLVKTVAHKLARNPNTYASFVGIT  231

Query  757   WALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLR  936
             WA +A+R  ++LPS++E S++IMSK+G+G+AMFSMGLF+A QE I+ CG S  AL + L+
Sbjct  232   WACVANRLHMELPSVLENSVLIMSKSGTGMAMFSMGLFMAQQEKILACGPSYAALGLALK  291

Query  937   FIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVY  1056
             F +GP    IG + +GLRGDVLR+++IQA    S+   V+
Sbjct  292   FGLGPVAMAIGSIAVGLRGDVLRVAIIQARCTTSINHVVH  331



>ref|XP_008673108.1| PREDICTED: uncharacterized protein LOC100381964 isoform X1 [Zea 
mays]
Length=410

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/378 (40%), Positives = 218/378 (58%), Gaps = 11/378 (3%)
 Frame = +1

Query  22    SSIQTTTPAIMIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffv  201
             SS+Q      MI W  +Y V+    PLYVA+ + Y S++ W +F P+QC  IN+F   F 
Sbjct  39    SSVQVPPIPTMISWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFS  98

Query  202   ipffnfqfMAHINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTL  381
             IP  +FQ ++  NPY +N   + +D + K+L +   A  +    +      +T FSLSTL
Sbjct  99    IPLLSFQILSTNNPYSMNLKLIFSDVLQKSLSLLGFAVASRVCCEEKFDWLITGFSLSTL  158

Query  382   TNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGA  561
              NTLIVG+PLL+ MYGD    L+ Q   +Q+L+W+T LLF  +F   R    T+S  A  
Sbjct  159   PNTLIVGIPLLKGMYGDEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGMAITTSSEAID  218

Query  562   GAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYAC  741
              A   + G   Q          +E       SA          ++ V   L  NPN YA 
Sbjct  219   EAESGTPGPMQQ---------GHEEGQAKGVSA--RCYGAFHFLLVVSRKLVTNPNMYAS  267

Query  742   FLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTAL  921
               GL WAL++ RW +QLPSI+  SI I+S  G G+AMFS+G+F ALQ  IV CG     L
Sbjct  268   LAGLIWALISFRWRIQLPSIVNNSIRILSDGGLGMAMFSLGVFTALQTKIVACGTKRMLL  327

Query  922   AMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAV  1101
             ++ +RF +GP   +I   ++G+RG +L++++IQAALPQ +  FV+AKEY +HADILSTA+
Sbjct  328   SLGIRFFLGPGLMVISSYLIGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAI  387

Query  1102  TIGTLVSVPLLITYYVIL  1155
              +G +V+VP+ + YY ++
Sbjct  388   ILGMMVAVPVALGYYFVM  405



>ref|XP_011098572.1| PREDICTED: auxin efflux carrier component 4 isoform X2 [Sesamum 
indicum]
 ref|XP_011098573.1| PREDICTED: auxin efflux carrier component 4 isoform X2 [Sesamum 
indicum]
Length=359

 Score =   268 bits (684),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 146/371 (39%), Positives = 219/371 (59%), Gaps = 13/371 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY V++A+ PLYVA+   Y S++ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MITLADVYHVIIAIIPLYVAMIAAYLSIKWWKLFTPDQCAGINKFVANFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   +SAD + K L +  LA  A    +G+LS  +T  SLSTL NTLI+G+PL
Sbjct  61    SNNPYRMNLKLVSADFLQKLLALIVLAVIAKLRSRGNLSWVITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             +RAMYG+  A L+ Q  V+Q+L+W+  LL   +   T      +S     G      G  
Sbjct  121   IRAMYGEEAAILLAQIVVLQSLIWYNLLLILFEIDATEESINMTSPSEVTGELEGPQGPE  180

Query  592   VQMAGDVEANN-NNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
              ++ GD E     N+              ++  +++ V   L +NPN++A   GL WA +
Sbjct  181   -RIDGDKEGGRFKNQMKR-----------NIRIILLTVGKKLIRNPNTHATLAGLIWASI  228

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
               RW ++LP +I+ S+ ++S  G G+AMFS+GLF+A Q  ++ CG     LAM ++F+ G
Sbjct  229   HFRWGVKLPKVIQNSVSLLSDGGLGMAMFSLGLFMASQARVIACGTRKAVLAMAMKFLAG  288

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             P    +  + LGLRG +L+++++QAALPQ +  FV+AKEY LH D+LST V  G L++VP
Sbjct  289   PFLMAVPSVALGLRGTLLKVAIVQAALPQGIVPFVFAKEYNLHPDVLSTGVIFGLLIAVP  348

Query  1129  LLITYYVILGF  1161
             + + YY +LG 
Sbjct  349   IGLAYYFLLGL  359



>gb|EYU34112.1| hypothetical protein MIMGU_mgv1a024604mg [Erythranthe guttata]
Length=350

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 151/370 (41%), Positives = 214/370 (58%), Gaps = 20/370 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY V  A+ PLYVA+   Y S++ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MITLANVYHVFTAIIPLYVAMIAAYLSIKWWKLFTPDQCSGINKFVANFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N    SAD + K +    LA  A    +GSLS  +T  SLSTL N+LI+G+PL
Sbjct  61    SNNPYKMNLKLASADFLQKLIAFVVLAVIARMRSRGSLSWIITGLSLSTLPNSLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             +RAMYGD  A L+ Q  V+Q+LVW+  LL  + F     +    S+V G           
Sbjct  121   IRAMYGDEAAVLLAQIVVLQSLVWYNLLL--ILFEIDAANAVPPSQVPG-----------  167

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                    E+ N       ++        S+  +++ V   L  NPN++A   GL W+ + 
Sbjct  168   -------ESENPQVPEPITNGVKHQSERSIRIILLTVGKKLITNPNTHATLAGLVWSSIH  220

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW+++LP +IE SI+++S  G G+AMFS+GLF+A Q  ++ CG     LAM L+FI GP
Sbjct  221   FRWEVKLPKVIENSILLLSNGGLGMAMFSLGLFMASQARLIACGTRKAVLAMALKFIAGP  280

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             +   +  + LGLRG +L+++L+QAALPQ +  FV+AKEY  H DILSTAV  G LV+VP+
Sbjct  281   SLMAVPSIALGLRGTLLKVALVQAALPQGIVPFVFAKEYNRHPDILSTAVIFGMLVAVPI  340

Query  1132  LITYYVILGF  1161
              + YY +L  
Sbjct  341   GLAYYFLLAL  350



>tpg|DAA57876.1| TPA: hypothetical protein ZEAMMB73_331388 [Zea mays]
Length=362

 Score =   267 bits (683),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 148/368 (40%), Positives = 214/368 (58%), Gaps = 11/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  +Y V+    PLYVA+ + Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D + K+L +   A  +    +      +T FSLSTL NTLIVG+PL
Sbjct  61    TNNPYSMNLKLIFSDVLQKSLSLLGFAVASRVCCEEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYGD    L+ Q   +Q+L+W+T LLF  +F   R    T+S  A   A   + G  
Sbjct  121   LKGMYGDEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGMAITTSSEAIDEAESGTPGPM  180

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              Q          +E       SA          ++ V   L  NPN YA   GL WAL++
Sbjct  181   QQ---------GHEEGQAKGVSA--RCYGAFHFLLVVSRKLVTNPNMYASLAGLIWALIS  229

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +QLPSI+  SI I+S  G G+AMFS+G+F ALQ  IV CG     L++ +RF +GP
Sbjct  230   FRWRIQLPSIVNNSIRILSDGGLGMAMFSLGVFTALQTKIVACGTKRMLLSLGIRFFLGP  289

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                +I   ++G+RG +L++++IQAALPQ +  FV+AKEY +HADILSTA+ +G +V+VP+
Sbjct  290   GLMVISSYLIGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAIILGMMVAVPV  349

Query  1132  LITYYVIL  1155
              + YY ++
Sbjct  350   ALGYYFVM  357



>ref|NP_001168208.1| uncharacterized protein LOC100381964 [Zea mays]
 gb|ACN27457.1| unknown [Zea mays]
 tpg|DAA57877.1| TPA: hypothetical protein ZEAMMB73_331388 [Zea mays]
Length=359

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 212/368 (58%), Gaps = 14/368 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  +Y V+    PLYVA+ + Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D + K+L +   A  +    +      +T FSLSTL NTLIVG+PL
Sbjct  61    TNNPYSMNLKLIFSDVLQKSLSLLGFAVASRVCCEEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYGD    L+ Q   +Q+L+W+T LLF  +F             A  G A  +   +
Sbjct  121   LKGMYGDEAVKLLSQIVALQSLIWYTLLLFLFEF------------RAARGMAITTSSEA  168

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             ++          +E       SA          ++ V   L  NPN YA   GL WAL++
Sbjct  169   IESGTPGPMQQGHEEGQAKGVSA--RCYGAFHFLLVVSRKLVTNPNMYASLAGLIWALIS  226

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +QLPSI+  SI I+S  G G+AMFS+G+F ALQ  IV CG     L++ +RF +GP
Sbjct  227   FRWRIQLPSIVNNSIRILSDGGLGMAMFSLGVFTALQTKIVACGTKRMLLSLGIRFFLGP  286

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                +I   ++G+RG +L++++IQAALPQ +  FV+AKEY +HADILSTA+ +G +V+VP+
Sbjct  287   GLMVISSYLIGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAIILGMMVAVPV  346

Query  1132  LITYYVIL  1155
              + YY ++
Sbjct  347   ALGYYFVM  354



>gb|AFK32346.1| putative auxin efflux carrier PIN8 [Zea mays]
Length=359

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 212/368 (58%), Gaps = 14/368 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  +Y V+    PLYVA+ + Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D + K+L +   A  +    +      +T FSLSTL NTLIVG+PL
Sbjct  61    TNNPYSMNLKLIFSDVLQKSLSLLGFAVASRVCCEEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYGD    L+ Q   +Q+L+W+T LLF  +F             A  G A  +   +
Sbjct  121   LKGMYGDEAVKLLSQIVALQSLIWYTLLLFLFEF------------RAARGMAITTSSEA  168

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             ++          +E       SA          ++ V   L  NPN YA   GL WAL++
Sbjct  169   IESGTPGPMQQGHEEGQAKGVSA--RCYGAFHFLLVVSRKLVTNPNMYASLAGLIWALIS  226

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +QLPSI+  SI I+S  G G+AMFS+G+F ALQ  IV CG     L++ +RF +GP
Sbjct  227   FRWRIQLPSIVNNSIRILSDGGLGMAMFSLGVFTALQTKIVACGTKRMLLSLGVRFFLGP  286

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                +I   ++G+RG +L++++IQAALPQ +  FV+AKEY +HADILSTA+ +G +V+VP+
Sbjct  287   GLMVISSYLIGMRGTLLKVAIIQAALPQGIVPFVFAKEYNVHADILSTAIILGMMVAVPV  346

Query  1132  LITYYVIL  1155
              + YY ++
Sbjct  347   ALGYYFVM  354



>ref|XP_004969744.1| PREDICTED: auxin efflux carrier component 4-like [Setaria italica]
Length=361

 Score =   263 bits (672),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 147/368 (40%), Positives = 215/368 (58%), Gaps = 12/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  +Y V+    PLYVA+ + Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWPTIYHVLEETVPLYVAMIVAYLSIQWWKLFTPEQCSGINKFVAKFSIPLLSFQILS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               +PY +N   + +D + K+L +   A  +           +T FSLSTL NTLIVG+PL
Sbjct  61    TNDPYDMNLKLIFSDILQKSLSLLGFAVISKACCGEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYG+    L+ Q   +Q+L+W+T LLF  +F   R   TT+S    +G      G+ 
Sbjct  121   LKGMYGNEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGLATTTS----SGTNEGESGTP  176

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
               M         +E       SA     S    ++ V   L  NPN YA  +GL WAL++
Sbjct  177   GPM------EERHEEGRAKGVSA--RCYSAFCFLLVVGRKLVINPNMYASLIGLIWALIS  228

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +QLPSII  SI I+S  G G+AMFS+GLF ALQ  I+ CG     L++ +RF +GP
Sbjct  229   FRWRVQLPSIISNSIRILSDGGLGMAMFSLGLFTALQTKIIACGTKKMLLSLGIRFFLGP  288

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A  +I    +G+ G +L++++IQAALPQ +  FV+AKEY +HADI+STA+ +G +V+VP+
Sbjct  289   ALMVISSYAIGMHGILLKVAIIQAALPQGIVPFVFAKEYNVHADIVSTAIIVGMMVAVPV  348

Query  1132  LITYYVIL  1155
              + YY ++
Sbjct  349   ALGYYFVI  356



>gb|AIF28442.1| PIN-like protein, partial [Freycinetia multiflora]
Length=399

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/397 (38%), Positives = 230/397 (58%), Gaps = 29/397 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   ++Y V+ A+ PLY  + L Y +VR W +F  +QC  INRF   F +P  NF+F++
Sbjct  1     MITLGDLYNVLSALVPLYFVIFLAYAAVRWWKLFTAEQCAGINRFVAMFAVPLLNFEFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              I+   ++ PF+SAD ++K LV+ AL AWA  + KGSL   +T FSL TL NTL++G+PL
Sbjct  61    RIDLSKMDLPFISADTLSKILVLVALFAWARMSPKGSLEWCITLFSLCTLPNTLLMGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF----------WFTRTHPTTSSRVAGA  561
             L+AMYGD    L+ Q  V+Q ++W+T L+F  ++          +   +  +  S     
Sbjct  121   LKAMYGDEQESLMTQVVVLQGMIWYTMLIFLYEYRAASNAIAQRFRESSVKSVCSEARNV  180

Query  562   GAARDSH----GSSVQMAGDVEANNNNETNTYSD---------------DSAVTESTSVL  684
             G    +H     +S  +   + A + +E N  ++               + +   S ++ 
Sbjct  181   GKEEAAHVVIACNSEDLGAQMGACSRDEDNKKAEKKLGYGEVGAAKKYVEKSTMPSGTIG  240

Query  685   SLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMG  864
              ++  V   L +NPN YA   GL WAL +SRW+++ P I+E S+ I+S    GVAMFS+G
Sbjct  241   FILRMVWYKLMKNPNFYASVGGLCWALASSRWNIKKPMIMENSVTILSNCALGVAMFSLG  300

Query  865   LFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLA  1044
              F+ALQ   + CG  + A  M +RFIVGPA   +  LV+G+ G  L++S+IQAALPQ++ 
Sbjct  301   NFMALQPKFIACGNKMAAYGMFIRFIVGPAIMALASLVVGIGGKELKVSIIQAALPQAVV  360

Query  1045  SFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVIL  1155
              FV+A+EY +H + LST V  G +VS+P+ I YYV L
Sbjct  361   PFVFAREYDVHPEELSTVVMFGMIVSLPVTILYYVFL  397



>gb|KGN59594.1| hypothetical protein Csa_3G827360 [Cucumis sativus]
Length=356

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/368 (40%), Positives = 218/368 (59%), Gaps = 14/368 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYVA+ L Y SV+ W  F  +QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLSDVYHVVAATVPLYVAMMLAYISVKWWKFFTAEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y +N   + AD + K L I  L A    T +G L+  +T  SLST+ NTLI+G+P+
Sbjct  61    ENNLYKMNRQLILADFLQKILAIILLGAVTKITSRGGLNWIITGLSLSTMPNTLILGLPV  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG     L+ Q  V+Q+++W+  LLF  +F  T+           A  A  S  + 
Sbjct  121   LKAMYGSEADVLLAQIVVLQSILWYNILLFLFEFTTTK----------AASLAPASEATE  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             +++    E     E     D +  +  T   S+++ V   L  NPN++A  LGL WA + 
Sbjct  171   IEITH--EGRPKEEIEEARDRNGRSLRTK--SILLTVARKLIINPNTHATILGLIWASIR  226

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP +I+ SI I+S  G G+AMFS+GLF+  + +I+ CG  +T +AM ++F+VGP
Sbjct  227   FRWGVKLPEVIDRSISILSTGGLGMAMFSLGLFMGSRTSIIACGTKMTLVAMGMKFLVGP  286

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A      L LGLRG +LR++++QAALPQ +  FV++KEY +H D+LST V +G L+++P+
Sbjct  287   ALMAACSLALGLRGKLLRVAIVQAALPQGIVPFVFSKEYNIHPDVLSTGVLLGLLIALPV  346

Query  1132  LITYYVIL  1155
              + YY +L
Sbjct  347   ALAYYYLL  354



>ref|XP_004147461.1| PREDICTED: probable auxin efflux carrier component 1b-like [Cucumis 
sativus]
 ref|XP_004168626.1| PREDICTED: probable auxin efflux carrier component 1b-like [Cucumis 
sativus]
Length=357

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/368 (39%), Positives = 220/368 (60%), Gaps = 13/368 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYVA+ L Y SV+ W  F  +QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLSDVYHVVAATVPLYVAMMLAYISVKWWKFFTAEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y +N   + AD + K L I  L A    T +G L+  +T  SLST+ NTLI+G+P+
Sbjct  61    ENNLYKMNRQLILADFLQKILAIILLGAVTKITSRGGLNWIITGLSLSTMPNTLILGLPV  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG     L+ Q  V+Q+++W+  LLF  +F        T+++ A    A ++   +
Sbjct  121   LKAMYGSEADVLLAQIVVLQSILWYNILLFLFEF--------TTTKAASLAPASEA---T  169

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              ++    E     E     D +  +  T   S+++ V   L  NPN++A  LGL WA + 
Sbjct  170   AEIEITHEGRPKEEIEEARDRNGRSLRTK--SILLTVARKLIINPNTHATILGLIWASIR  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP +I+ SI I+S  G G+AMFS+GLF+  + +I+ CG  +T +AM ++F+VGP
Sbjct  228   FRWGVKLPEVIDRSISILSTGGLGMAMFSLGLFMGSRTSIIACGTKMTLVAMGMKFLVGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A      L LGLRG +LR++++QAALPQ +  FV++KEY +H D+LST V +G L+++P+
Sbjct  288   ALMAACSLALGLRGKLLRVAIVQAALPQGIVPFVFSKEYNIHPDVLSTGVLLGLLIALPV  347

Query  1132  LITYYVIL  1155
              + YY +L
Sbjct  348   ALAYYYLL  355



>gb|EMT05834.1| Putative auxin efflux carrier component 6 [Aegilops tauschii]
Length=334

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 209/332 (63%), Gaps = 10/332 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A APLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATAPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWA-----NFTKKGSLSCSVTAFSLSTLTNTLI  396
             H +P+ +NY  ++AD ++K +++A +A WA     N   KG+   S+T FSLSTLTN+L+
Sbjct  61    HTDPFQVNYRAVAADVISKAVIVAVIAVWARLLGRNGGGKGAAGWSITGFSLSTLTNSLV  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             VGVP+ RAMYG+    LVVQ +V Q +VW  FLLF L+    +        V       D
Sbjct  121   VGVPMARAMYGEWAQQLVVQLSVFQAIVWLPFLLFVLEV--RKAAIGMYVDVGRKNVVHD  178

Query  577   SHGSSVQMAGDVEANNNNETNTYSDDSAVTE---STSVLSLMMPVLSNLAQNPNSYACFL  747
             +     ++  DVEA                E     SV  L+  V   LA+NPN+YA F+
Sbjct  179   AAMPESRIKADVEAAAGGGAVAVLVVGGAEEVGGKPSVWRLVKTVAHKLARNPNTYASFV  238

Query  748   GLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAM  927
             G+ WA +A+R  ++LPS++E S++IMSK+G+G+AMFSMGLF+A QE I+ CG S  AL +
Sbjct  239   GITWACVANRLHMELPSVLENSVLIMSKSGTGMAMFSMGLFMAQQEKILACGPSYAALGL  298

Query  928   VLRFIVGPATTLIGCLVLGLRGDVLRISLIQA  1023
              L+F +GP    IG + +GLRGDVLR+++IQA
Sbjct  299   ALKFGLGPVAMAIGSIAVGLRGDVLRVAIIQA  330



>ref|XP_009386292.1| PREDICTED: auxin efflux carrier component 1 [Musa acuminata subsp. 
malaccensis]
Length=365

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 149/369 (40%), Positives = 234/369 (63%), Gaps = 7/369 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  +Y VV AM PLY A+ALGY SVR+   F P+QC  IN F     +P   F+ ++
Sbjct  1     MISWSSLYHVVEAMMPLYAAMALGYASVRK-KAFTPEQCAGINHFVALLAVPLLIFRMIS  59

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N  FL+AD + K +++AALAAWA F+  GS++  +T FSL+TL NT+++GVP+
Sbjct  60    SNNPYTMNIRFLAADTLQKVIILAALAAWARFSNNGSIAWVITLFSLATLPNTVLMGVPV  119

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LR MYG +  +L+VQ  V+Q +VW+  ++F  ++   +       ++     A  SH   
Sbjct  120   LRGMYGPMSENLMVQIVVLQFVVWYVLVVFLFEYMAAQNAFMEQQQMPPP-QANGSHSVD  178

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             +     V A+ ++   + + +  +  S  +L L+M V   + + P++YA  LGLFW+L+A
Sbjct  179   IP---AVNADGSDPDVSIAQEETIRPS-GMLILVMAV-KKILKIPSTYASLLGLFWSLIA  233

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              R+ +++P+II+ S+ I+S +  G+ MFS+G F+A ++  + CG  +  LAMV+RF++GP
Sbjct  234   FRFGIKMPAIIDNSLSIISVSAIGLGMFSVGAFMAQRKKFITCGYYLAVLAMVMRFLIGP  293

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                L+    +GL+G  L + ++QAALP ++ SFVYA+EY +H DI+ST V +G  +SVPL
Sbjct  294   IVMLVSSFAVGLQGVFLNVGVVQAALPLAVLSFVYAEEYNVHPDIMSTGVIVGIFISVPL  353

Query  1132  LITYYVILG  1158
              I YYV+LG
Sbjct  354   TILYYVLLG  362



>ref|XP_006482537.1| PREDICTED: putative auxin efflux carrier component 5-like [Citrus 
sinensis]
Length=354

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 149/370 (40%), Positives = 213/370 (58%), Gaps = 16/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   + Y VV A  PLYVA+ L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISVVDAYHVVAACVPLYVAMLLAYISVKWWKLFTPDQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + AD + K L    L A    + +G L   +T  SLSTL N+LI+G+PL
Sbjct  61    KNNPYKMNLKLIYADFLQKLLAFLVLVAITKISSRGGLRWIITGLSLSTLPNSLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMY +  A L+ Q  V+Q+L+W+  LLF         +   S+ V       + H +S
Sbjct  121   LRAMYSEEAALLLAQIVVLQSLIWYNLLLFL-----FELNAAKSASVTPNPETPEEHDAS  175

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                 G+ EA N   T   +             +++ V   L  NPN++A  LGL WA + 
Sbjct  176   QAKEGEEEAQNRTATRVRTTH-----------ILLTVGRKLIINPNTHATLLGLIWASIE  224

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP+II+ S+ I+S  G G+AMFS+GLF+A + +I+ CG  + A AM L+FIVGP
Sbjct  225   FRWGVKLPAIIDQSVRILSNGGLGMAMFSLGLFMASRPSIIACGTRMAAAAMALKFIVGP  284

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A        +GLRG + +I+ +QAALPQ +  FV+AKEY +H DILST V  G ++++P+
Sbjct  285   ALMAASSFAIGLRGTLFKIAFVQAALPQGIVPFVFAKEYNVHPDILSTGVLFGMIITLPV  344

Query  1132  LITYYVILGF  1161
              + YY +L  
Sbjct  345   TLAYYFLLAL  354



>ref|XP_010242365.1| PREDICTED: probable auxin efflux carrier component 1b [Nelumbo 
nucifera]
Length=357

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/372 (38%), Positives = 217/372 (58%), Gaps = 17/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY V+ A  PLY A+ L Y S++ W +F  DQC  IN+F   F IP  +F  ++
Sbjct  1     MISLLDVYHVLAATIPLYFAMILAYVSLKWWKLFSADQCSGINKFVAKFSIPLLSFSVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY ++   + AD + K L    L   A  + +G     +T  SLSTL NTLIVG+PL
Sbjct  61    ANNPYQMDLKLILADGLQKLLAFLLLVILAKISSRGHTDWVITGLSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMYG+  + L+ Q  V+Q+LVW+  LLF  +F                 A   S    
Sbjct  121   LRAMYGNKASALLSQIVVMQSLVWYNLLLFLFEF---------------RAAETASETPP  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVT--ESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
             +++ G++EA    +     +++        +   ++M V   L +NPN++A  +GL WA+
Sbjct  166   LEVTGELEAPQEAQPKAVGEEAKARTLRKMNTKLILMTVGRKLVRNPNTHATLIGLIWAV  225

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             ++ RW ++LP I+  SI I+S  G G+AMFS+GLF+A Q +I+ CG    ALAM ++F+V
Sbjct  226   ISFRWRVKLPLIVNNSISILSDGGLGMAMFSLGLFMASQPSIIACGTRKAALAMGIKFLV  285

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA  ++    +GL+  + +++++QAALPQ +  FV+AKEY +H DILST V  G L+++
Sbjct  286   GPALMVVSSYAIGLKSILFKVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIAL  345

Query  1126  PLLITYYVILGF  1161
             P+ + YY +LG 
Sbjct  346   PIALAYYFLLGL  357



>ref|XP_002458992.1| hypothetical protein SORBIDRAFT_03g043960 [Sorghum bicolor]
 gb|EES04112.1| hypothetical protein SORBIDRAFT_03g043960 [Sorghum bicolor]
Length=336

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 208/341 (61%), Gaps = 26/341 (8%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MIGW +VYKVV A  PLY AL LGY SVR W +F  +QCDA+NR   FF +PFF F+F  
Sbjct  1     MIGWGDVYKVVAATVPLYFALFLGYGSVRWWRIFTREQCDAVNRLVAFFALPFFTFEFTL  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWA---------------NFTKKGSLSCSVTAF  366
             H +P+ +NY  ++AD ++K +++  +A WA                     ++  S+T F
Sbjct  61    HTDPFQVNYRAVAADVISKAVIVGVIACWAARVTSAGKGAGAGGGGGWAGCAVGWSITGF  120

Query  367   SLSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSS  546
             SLSTLTN+L+VGVP+ RAMYG+    LVVQ +V Q +VW T LLF L+            
Sbjct  121   SLSTLTNSLVVGVPMARAMYGEWAQQLVVQLSVFQAIVWLTLLLFVLEI-----------  169

Query  547   RVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNP  726
             R A  G   D   S V+         +  T         ++  S+ +L+  V   L++NP
Sbjct  170   RKAAIGMYVDVPDSPVKDVEAAADAASAATVVVVPVVVASDKPSLWALVKVVAHKLSRNP  229

Query  727   NSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGA  906
             N+YA F+G+ WA +A+R  ++LPS  EGS++IMSK+G+G+AMFSMGLF+A QE ++ CG 
Sbjct  230   NTYASFVGITWACVANRLHIELPSAFEGSVLIMSKSGTGMAMFSMGLFMAQQEKVLACGP  289

Query  907   SVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAAL  1029
             S  AL +VL+F +GPA   IG + +GLRGDVLR+++IQ +L
Sbjct  290   SFAALGLVLKFALGPAAMAIGSIAVGLRGDVLRVAIIQVSL  330



>gb|KDP45475.1| hypothetical protein JCGZ_09724 [Jatropha curcas]
Length=357

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 215/370 (58%), Gaps = 13/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLY A+ L Y S++ W +F PDQC  IN F   F IP  +FQ ++
Sbjct  1     MISLADVYHVVAATIPLYFAMMLAYISMKWWRLFTPDQCAGINMFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + AD + K L +  L A    + +G L+  +T  SLSTL NTLI+G+PL
Sbjct  61    SNNPYKMNLKLILADFLQKILAVLVLTAITKISSRGRLNWVITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG+    L+ Q  V+Q+LVW+  LLF  +   T   P T S          S  + 
Sbjct  121   LKAMYGEEADSLLSQIIVLQSLVWYNLLLFLFELNATYAAPVTPS----------SETTE  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              Q A +       E  T++     T     + +++ V   L +NPN +A  LGL WA + 
Sbjct  171   DQEAPEEAQLKEGEDETHTRP---TRRVKTMLILLTVGKKLLRNPNFHATSLGLIWASIH  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW+++LP +++ SI I+S  G G+AMFS+GLF+A + +I+ CG  +  ++M ++FI GP
Sbjct  228   FRWEVKLPDVVDQSIRILSTGGLGMAMFSLGLFMASRTSIIACGIRMAIVSMAIKFISGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +    L L+G V +++++QAALPQ +  FV+AKEY +H DILST V  G L+++P+
Sbjct  288   ALMAVSSFALVLKGTVFKVAIVQAALPQGIVPFVFAKEYNIHPDILSTGVIFGMLIALPI  347

Query  1132  LITYYVILGF  1161
              + YY +L  
Sbjct  348   ALAYYSLLAL  357



>ref|XP_008664247.1| PREDICTED: LOW QUALITY PROTEIN: probable auxin efflux carrier 
component 4 [Zea mays]
Length=364

 Score =   252 bits (643),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 227/371 (61%), Gaps = 7/371 (2%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++Y VV  MAPLY AL LGY SVR W +F   QC AIN     F +PFF   F+A
Sbjct  1     MIAWGDIYNVVSGMAPLYFALVLGYGSVRWWRLFTAAQCGAINTLVANFSMPFFTLDFLA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               +PY +NY  L+ADAV+K L+  A           S S ++T FSL+   NTL+VGVPL
Sbjct  61    RADPYAMNYRVLAADAVSKALLAVAAGG---GAGSRSSSWAITGFSLAGFNNTLVVGVPL  117

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L AMYG    DLVVQ AV+Q LVWF  LL   +           ++  G G  R S    
Sbjct  118   LFAMYGKWAQDLVVQVAVVQALVWFPLLLLGFELRRAWVGGVPRAQGVGVGVGRCSSDDD  177

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                          + +  +   A+    +V ++ +     L  NP  YA  +G+ WA +A
Sbjct  178   DGDGHLGGREEAADDDAPAAAGAIRLWPTVRTVGL----KLVGNPXVYASVVGVVWACIA  233

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RWDL LP I+ GS+ +MS+ G+G++MFSMG+F+A QE ++ CGA + AL + LRF+ GP
Sbjct  234   YRWDLSLPGIVTGSLGVMSRTGTGMSMFSMGMFMAQQERVIACGAGLAALGLALRFVAGP  293

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
               TL+G    GLRGDVLR ++IQAALPQS+ASFVYAKEYG+HAD+LSTAV +GTLVS+P+
Sbjct  294   LATLVGAAAFGLRGDVLRFAIIQAALPQSIASFVYAKEYGVHADVLSTAVILGTLVSLPV  353

Query  1132  LITYYVILGFL  1164
             LI YY +LG L
Sbjct  354   LIAYYAVLGIL  364



>gb|AGW52147.1| PIN13 [Populus tomentosa]
Length=355

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 147/370 (40%), Positives = 215/370 (58%), Gaps = 15/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLY A+ L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISAADVYHVVTATVPLYFAMILAYISVKWWKLFTPDQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              INPY +N   + AD + K L +  L A A  + +G L+  +T  SLSTL NTLI+G+PL
Sbjct  61    GINPYKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMYG     L+ Q   +Q+L+W+  LLF  +   T+                 +   S
Sbjct  121   LRAMYGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATK---------------EATVAPS  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              +  GD+EA    +          T     + +++ V+  L  NPN YA  + L WA + 
Sbjct  166   SESTGDLEALQEAQHKEDEGVQRRTRKVKAMVILLTVVRKLMSNPNFYATLVALIWASIH  225

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             SRW + LP I++ S+ I+S  G G+AMFS+GLF+A + +I+ CG  +  +AM ++FIVGP
Sbjct  226   SRWRVNLPDIVDKSVRILSTGGLGMAMFSLGLFMASRPSIIACGIRMAMVAMAMKFIVGP  285

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +  + +GL+G VL+++++QAALPQ +  FV+AKEY +H D LST V  G L+S+P+
Sbjct  286   ALMAVASIAVGLKGTVLKVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLISLPI  345

Query  1132  LITYYVILGF  1161
              + YY +L  
Sbjct  346   ALAYYSLLAL  355



>ref|XP_006338481.1| PREDICTED: putative auxin efflux carrier component 5-like [Solanum 
tuberosum]
Length=370

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/369 (38%), Positives = 218/369 (59%), Gaps = 2/369 (1%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SVR   +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLRDVYHVVAATIPLYVVMILAYISVRWGKLFSPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y +N   L AD + K L +  LA +A    KG+L+  +T  S+STL NTLI+G+PL
Sbjct  61    GSNLYKVNLKLLLADFIQKFLAVFLLAIFAKLKPKGNLTWIITGLSVSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTR-THPTTSSRVAGAGAARDSHGS  588
             ++A++GD  A+L+ Q   +Q+LVW+  LL   +   T+ ++  + S VAG          
Sbjct  121   IKAIFGDAAAELLAQLIALQSLVWYNLLLLLFELNATKESYMMSPSEVAGTYTDNRIMVP  180

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
              +++    E     +    + D    + T ++ +++ V   L  NPN++A   G+ W+ +
Sbjct  181   KLELEVPGEPELEKDGEEEATDRPPRKKT-IMVILLTVGRKLIINPNTHATLAGIIWSSI  239

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
               RW + LP I+E SI I+S  G G+AMFS+G+F+A Q +I+ CG     LAM L+F++G
Sbjct  240   HFRWGVNLPKIVEQSISILSDGGLGMAMFSIGVFMASQASIIACGTKKAILAMALKFVLG  299

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             P    I  + +GLRG + R++++QAALPQ +  FV+AKEY +H  ILST V  G L+++P
Sbjct  300   PVLMAISSIAVGLRGQLFRLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLIAIP  359

Query  1129  LLITYYVIL  1155
             + + YY +L
Sbjct  360   IALAYYFLL  368



>ref|XP_011098571.1| PREDICTED: probable auxin efflux carrier component 2 isoform 
X1 [Sesamum indicum]
Length=362

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 138/353 (39%), Positives = 206/353 (58%), Gaps = 13/353 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY V++A+ PLYVA+   Y S++ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MITLADVYHVIIAIIPLYVAMIAAYLSIKWWKLFTPDQCAGINKFVANFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   +SAD + K L +  LA  A    +G+LS  +T  SLSTL NTLI+G+PL
Sbjct  61    SNNPYRMNLKLVSADFLQKLLALIVLAVIAKLRSRGNLSWVITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             +RAMYG+  A L+ Q  V+Q+L+W+  LL   +   T      +S     G      G  
Sbjct  121   IRAMYGEEAAILLAQIVVLQSLIWYNLLLILFEIDATEESINMTSPSEVTGELEGPQGPE  180

Query  592   VQMAGDVEANN-NNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
              ++ GD E     N+              ++  +++ V   L +NPN++A   GL WA +
Sbjct  181   -RIDGDKEGGRFKNQMKR-----------NIRIILLTVGKKLIRNPNTHATLAGLIWASI  228

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
               RW ++LP +I+ S+ ++S  G G+AMFS+GLF+A Q  ++ CG     LAM ++F+ G
Sbjct  229   HFRWGVKLPKVIQNSVSLLSDGGLGMAMFSLGLFMASQARVIACGTRKAVLAMAMKFLAG  288

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTI  1107
             P    +  + LGLRG +L+++++QAALPQ +  FV+AKEY LH D+LST   I
Sbjct  289   PFLMAVPSVALGLRGTLLKVAIVQAALPQGIVPFVFAKEYNLHPDVLSTGYLI  341



>ref|XP_010696206.1| PREDICTED: probable auxin efflux carrier component 1b [Beta vulgaris 
subsp. vulgaris]
Length=457

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 159/434 (37%), Positives = 237/434 (55%), Gaps = 64/434 (15%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W+ +Y V+  + PLYV + L Y +V+ W +F P +C  INRF   F  P  + +F+A
Sbjct  1     MISWKNLYHVLSNVVPLYVVMILAYSAVKWWKIFSPSECVGINRFVVLFAAPALSIKFIA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             + NPY +NY F++AD + K +VI  L  W   + KGSL   +T FSLSTLTNTL+VG+PL
Sbjct  61    NNNPYAMNYRFIAADTLQKVIVIVVLVLWCKLSSKGSLEWCITLFSLSTLTNTLVVGIPL  120

Query  412   LRAMYGDLGAD-LVVQAAVIQNLVWFTFLLFALQF----------WFTRTHPTTSSRV--  552
             L  MYG+  ++ L+VQ +VIQ ++W+  LLF  ++                P  S+RV  
Sbjct  121   LGGMYGETPSESLMVQLSVIQFIIWYPSLLFLFEYRKATVLIPQQCCETEMPDRSTRVVE  180

Query  553   ------------------------------AGAGAARDSHGSSVQMAGDVE---------  615
                                            G G  R      ++  G+           
Sbjct  181   SCRNGGNLDEQREICGVGEVVLPSESSQIGEGQGGCRKPDDHDLENGGNANPKELGSRSR  240

Query  616   -----------ANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
                         ++  E    +DD      T+ L L M V   L +NPN Y+  + L W+
Sbjct  241   SRSRTSAEVQPESSTQEEPKSTDDMDHAGLTTRLILFM-VCKKLIKNPNFYSSIIALVWS  299

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
             L++ RW L +P+I+  SI I+S AG G+AMFS+GLF+A Q  I+  G++  ALA  +RFI
Sbjct  300   LISFRWHLNIPAIVANSIKILSDAGLGMAMFSLGLFMASQPRIIAGGSASAALAAAMRFI  359

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
             VGPA T     ++GL+G +L+I ++QAALPQ++  F++A+EY +H  ILSTAV+ G L+S
Sbjct  360   VGPAITTSTSAIVGLKGTLLQIIIMQAALPQAIVPFIFAREYNVHPGILSTAVSFGMLIS  419

Query  1123  VPLLITYYVILGFL  1164
             +P+ + YY++LGF+
Sbjct  420   LPITLVYYILLGFI  433



>ref|XP_002305371.1| hypothetical protein POPTR_0004s12310g [Populus trichocarpa]
 gb|EEE85882.1| hypothetical protein POPTR_0004s12310g [Populus trichocarpa]
Length=355

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 150/373 (40%), Positives = 219/373 (59%), Gaps = 21/373 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLY A+ L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISAADVYHVVTATVPLYFAMILAYISVKWWKLFTPDQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              INPY +N   + AD + K L +  L A A  + +G L+  +T  SLSTL NTLI+G+PL
Sbjct  61    GINPYKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAM+G     L+ Q   +Q+L+W+  LLF  +   T+                 +   S
Sbjct  121   LRAMHGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATK---------------EATVAPS  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLS---NLAQNPNSYACFLGLFWA  762
              +  GD+EA    +   + DD  V   T  +  M+ +L+    L  NPN YA  + L WA
Sbjct  166   SESTGDLEALQEAQ---HKDDEGVQRRTRKVKAMVILLTVGRKLMSNPNFYATLVALIWA  222

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              + SRW + LP I++ S+ I+S  G G+AMFS+GLF+A + +I+ CG  +  +AM ++FI
Sbjct  223   SIHSRWGVNLPDIVDKSVRILSTGGLGMAMFSLGLFMASRPSIIACGIRMAMVAMAMKFI  282

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
             VGPA   +  + +GL+G VL+++++QAALPQ +  FV+AKEY +H D LST V  G L+S
Sbjct  283   VGPALIAVASIAVGLKGTVLKVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLIS  342

Query  1123  VPLLITYYVILGF  1161
             +P+ + YY +L  
Sbjct  343   MPIALAYYSLLAL  355



>ref|XP_007139602.1| hypothetical protein PHAVU_008G043700g [Phaseolus vulgaris]
 gb|ESW11596.1| hypothetical protein PHAVU_008G043700g [Phaseolus vulgaris]
Length=359

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 210/368 (57%), Gaps = 11/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   + Y VV A  PLYV + L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADAYHVVAATLPLYVTMILAYVSVKWWKIFTPDQCSGINKFVAKFSIPLLSFQIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD V K+L    L A    + +G L   +T  SL+TL NTLI+G+PL
Sbjct  61    SNNIYDMSLKLVYADFVQKSLAFLVLIAITKISGRGGLKWIITGLSLTTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMY      L+ Q   +Q+++W+  LLF  +     T P          AA    GS+
Sbjct  121   MKAMYKGEAVVLLAQIIFLQSMIWYNLLLFLYELDAVNTRPV--------AAAPPPQGSA  172

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              +   D E  +  E +    D        VL ++  V   L +NPN+YA  +G  W+ + 
Sbjct  173   GETDRDREVQSKGEEDA---DPRTKRKLKVLPILAKVGKKLIKNPNTYATLVGFIWSSIH  229

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW L +P ++  SI I+S  G G+AMFS+GLF+A Q +I+ CG  +T +A+ L+ +VGP
Sbjct  230   FRWGLHMPEVVTQSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMTMVAIGLKVVVGP  289

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                 +  L++GLR  + +++++QAALPQ +  FV+AKEY +H  +LSTA+ +G L+++P+
Sbjct  290   GLMTVASLLIGLRNTLFKVTIVQAALPQGIVPFVFAKEYNVHPAVLSTAILLGMLIALPV  349

Query  1132  LITYYVIL  1155
              + +Y +L
Sbjct  350   ELAFYFLL  357



>ref|XP_006373306.1| hypothetical protein POPTR_0017s11440g [Populus trichocarpa]
 gb|ERP51103.1| hypothetical protein POPTR_0017s11440g [Populus trichocarpa]
Length=356

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 149/369 (40%), Positives = 215/369 (58%), Gaps = 16/369 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLY A+ L Y SVR W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISTADVYHVVAATVPLYFAMILAYISVRWWKLFTPDQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              INPY +N   + AD + K L +  L A A  + +G L+  +T  SLSTL NTLI+G+PL
Sbjct  61    SINPYKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGLPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMYG     L+ Q   +Q+L+W+  LLF  +   T+                 +   S
Sbjct  121   LRAMYGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATK---------------EATVAPS  165

Query  592   VQMAGDVEANNNNETNTYSD-DSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
              +  GD EA   ++     +  S  T     + +++ V   L  NPN YA  + L WA +
Sbjct  166   SETTGDQEALQESQYKEGGEVHSRTTRKVKAMLVLLTVGKKLMSNPNFYATMVALIWASI  225

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
               RW ++LP I++ SIVI+S  G G+AMFS+GLF+AL+ +I+ CG  +  +AM ++FIVG
Sbjct  226   HFRWGVKLPDIVDKSIVILSTGGLGMAMFSLGLFMALRPSIISCGIRMAVVAMAMKFIVG  285

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   +    + L G VL+++++QAALPQ +  FV+AKEY +H D LST V  G L+++P
Sbjct  286   PALMAVASFAVRLEGTVLKVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLIAMP  345

Query  1129  LLITYYVIL  1155
             + + YY +L
Sbjct  346   IALAYYSLL  354



>ref|XP_007151202.1| hypothetical protein PHAVU_004G026500g [Phaseolus vulgaris]
 gb|ESW23196.1| hypothetical protein PHAVU_004G026500g [Phaseolus vulgaris]
Length=361

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 140/371 (38%), Positives = 217/371 (58%), Gaps = 17/371 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SV+ W +F P+QC  IN+F   F +P  +FQ ++
Sbjct  1     MISLADVYHVVTATVPLYVTMVLAYISVKWWKLFTPEQCSGINKFVANFSVPILSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD V K L      A      +G L   +T  SLSTL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLVYADFVQKLLAFLIFTAIIKIKGRGGLKWIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFTRTHPTTSSRVAGAGAARDSH  582
             ++AMY D  + L+ Q   +Q+++W+  LLF  +       RT P        A  ++D+ 
Sbjct  121   MKAMYRDEASLLLPQIIFLQSMLWYNLLLFLHELDAAIPARTMPVV------APPSQDT-  173

Query  583   GSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
                    G+ E +   ++    ++      T +L ++M V + L  NPN+YA F+GL WA
Sbjct  174   -------GESETSQEIQSKEEEEEHRTQSKTRMLLILMKVGNKLTINPNTYATFIGLIWA  226

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +  RW + +P ++  SI I++  G G+A FS+GLF+A    I+ CG  +T +AM L+F+
Sbjct  227   SIHFRWGVDMPDVVNQSIEILASGGLGMATFSLGLFMASNNRIIACGPRMTMVAMGLKFL  286

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
             VGPA   +  +V+GLR  +L++++IQAALPQ +  FV+A+EY +H  ILST V +G L++
Sbjct  287   VGPAIMAVASIVIGLRDRMLKVAIIQAALPQGIVPFVFAREYNVHPGILSTGVLLGMLMA  346

Query  1123  VPLLITYYVIL  1155
             +P+ +TYY++L
Sbjct  347   LPVALTYYLLL  357



>ref|XP_004489373.1| PREDICTED: putative auxin efflux carrier component 5-like [Cicer 
arietinum]
Length=364

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 143/371 (39%), Positives = 214/371 (58%), Gaps = 12/371 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y  V+ W +F PDQC  IN+F   F +P  +FQ ++
Sbjct  1     MISLIDVYHVVTATVPLYVTMFLAYICVKWWKLFTPDQCVGINKFVANFSVPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD V K L    L      + +G L   +T  SLSTL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLIYADCVQKFLAFFVLIVIIKMSDRGGLKWIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFTRTHPTTSSRVAGAGAARDSH  582
             ++AMY D    L+ Q   +Q+++W+ FLLF  +       RT P +SS  +  G      
Sbjct  121   MKAMYKDESDILLPQIIFLQSMIWYNFLLFLHELDAAIPARTMPASSSTSS-QGTGESET  179

Query  583   GSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
                VQ   D E     ET +            +L ++M V   L  NPN+YA F+GL WA
Sbjct  180   SLEVQSKED-EGEERGETRS-------QRKMRILIILMKVGKKLIMNPNTYATFIGLIWA  231

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +  RW + +P +++ SI I+S  G G+A FS+GLF+A   +I+ CG  +T +AM L+F+
Sbjct  232   SIHFRWGVDMPDVVKQSITILSSGGLGMATFSLGLFMASNSSIIACGPRMTMVAMGLKFL  291

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
             VGPA   +  +V+GLR  +L+++++QAALPQ +  FV+A+EY +   ILST V +G L++
Sbjct  292   VGPALMAVASIVIGLRDTMLKVAIVQAALPQGIVPFVFAREYNVQPAILSTGVLLGMLIA  351

Query  1123  VPLLITYYVIL  1155
             +P+ + YY++L
Sbjct  352   LPVALIYYLLL  362



>ref|XP_010906421.1| PREDICTED: probable auxin efflux carrier component 1b [Elaeis 
guineensis]
Length=350

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 146/373 (39%), Positives = 218/373 (58%), Gaps = 33/373 (9%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    +Y VV AMAPLY A+ALGY +VR W +  PDQC+ IN F   F +P   F+ ++
Sbjct  1     MITTSNLYHVVEAMAPLYTAMALGYAAVRWWRVLSPDQCNGINHFVALFPLPILAFRLIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKG----SLSCSVTAFSLSTLTNTLIV  399
               NPY +N   L+AD++ K  ++AAL AW+   + G    +L   +T F L+TL NT+I+
Sbjct  61    SNNPYTMNTRLLAADSLQKLFLLAALFAWSYIRRGGGAAAALPWVITVFCLATLPNTVIM  120

Query  400   GVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDS  579
             G+PLLR MYG     L+VQ  V+Q+  W+ F+LF  ++         S+R          
Sbjct  121   GIPLLRGMYGPAAGQLMVQIVVVQSAFWWNFVLFLYEY--------ISAR----------  162

Query  580   HGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
             H    Q     E  N+N    +          SV  + + V   L + P ++A  LGL W
Sbjct  163   HDIMEQ-----EQMNSNHAMEFP------PLMSVWRVPVTVGRKLIRMPRTHAAILGLLW  211

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             +L+A R  +++P+II+ S+ I+S   +G++MF +G FIA Q   + CG S+   A++++F
Sbjct  212   SLIAFRLGIKMPAIIDDSLSIISVTATGLSMFCVGTFIAQQSKFISCGYSMATFAVIVKF  271

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             IVGP   +   L +GL+G +L ++ +QAALP +  SFVYAKEY +H DI+S+ V IGT +
Sbjct  272   IVGPGIMVASSLAVGLQGLLLHVAAVQAALPLATVSFVYAKEYNVHPDIMSSGVIIGTFI  331

Query  1120  SVPLLITYYVILG  1158
             SVP+ I YY++LG
Sbjct  332   SVPITILYYILLG  344



>ref|XP_003534463.1| PREDICTED: probable auxin efflux carrier component 1b-like isoform 
X1 [Glycine max]
Length=358

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/368 (36%), Positives = 212/368 (58%), Gaps = 12/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   + Y VV +  PLYV + L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADAYHVVASTVPLYVTMILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD + K L    L A    + +G L   +T  S++TL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLIYADFLQKLLAFLVLIAITKISGRGGLKWIITGLSITTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMY      L+ Q   +Q+++W+  LLF  +    +T PT ++  +  G+     G  
Sbjct  121   VKAMYKSEAVVLLAQIIFLQSMIWYNLLLFLYELDAVKTRPTAAAS-SSQGSGETDTGRE  179

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             VQ  G+ +A           +  +     VL +++ V   L +NPN+YA  LG  W+ + 
Sbjct  180   VQSKGEEDA-----------EPRIKRKRKVLLILVTVGKKLIKNPNTYATLLGFIWSSIK  228

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW L +P ++  SI I+S  G G+AMFS+GLF+A Q +I+ CG  +  +A+ L+ ++GP
Sbjct  229   FRWGLHMPEVVSQSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMAMVAIGLKVVLGP  288

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                 +   V+GLR  + +++++QAALPQ +  FV+AKEY +H  +LSTA+ +G L+++P+
Sbjct  289   TLMAVASFVIGLRDTLFKVAIVQAALPQGIVPFVFAKEYNVHPAVLSTAILLGMLIALPV  348

Query  1132  LITYYVIL  1155
              + +Y +L
Sbjct  349   ELAFYFLL  356



>gb|AIF28458.1| PIN-like protein, partial [Xerophyta villosa]
Length=243

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/250 (52%), Positives = 171/250 (68%), Gaps = 10/250 (4%)
 Frame = +1

Query  421   MYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRT--HPTTSSRVAGAGAARDSHGSSV  594
             MYGD   DLVVQ +V+Q ++W T LLF L+    RT   P  ++ V G G    S  S  
Sbjct  1     MYGDWAQDLVVQVSVVQAIIWLTLLLFVLELRKARTGISPAPAAMVGGGGTYVVSIESVT  60

Query  595   QMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLAS  774
               A + E   N      +DD AV  S    SLM  V   LA NPNSYA  +G+ WA +A+
Sbjct  61    ATAAEKEVEGN------ADDDAVRPS--FWSLMKIVWLKLAMNPNSYASIIGISWAFIAN  112

Query  775   RWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPA  954
             RW + +PSI+EGS++IMSKAG+G+AMFSMGLF+A QE IV CG S+T   M+L+F+ GPA
Sbjct  113   RWHIDMPSIMEGSVLIMSKAGTGMAMFSMGLFMASQEKIVACGTSLTVFGMILKFVAGPA  172

Query  955   TTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLL  1134
              T IG + +GLRGD+LR+++IQAA+PQS+ SF++A+EYGLHAD+LSTAV  G L ++P+L
Sbjct  173   ATAIGAIAVGLRGDILRVAIIQAAVPQSITSFIFAREYGLHADVLSTAVIFGMLAALPVL  232

Query  1135  ITYYVILGFL  1164
             + YYVILG +
Sbjct  233   VAYYVILGLM  242



>ref|XP_011005065.1| PREDICTED: putative auxin efflux carrier component 5 [Populus 
euphratica]
Length=356

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 147/370 (40%), Positives = 212/370 (57%), Gaps = 14/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLY A+ L Y SVR W +F PDQC  IN F   F IP  +FQ ++
Sbjct  1     MISTADVYHVVAATVPLYFAMILAYISVRWWKLFTPDQCAGINTFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              INPY +N   + AD + K L +  L A A  + +G L+  +T  SLSTL NTLI+G+PL
Sbjct  61    SINPYKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGLPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMYG     L+ Q   +Q+L+W+  LLF  +   T+   T +      G       S 
Sbjct  121   LRAMYGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATK-EATVAPSSETTGDQETLQESQ  179

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              +   +V++    +  T             + +++ V   L +NPN YA  + L WA + 
Sbjct  180   YKEGEEVQSRTRRKVKT-------------MLILLTVGKKLMRNPNFYATMVALIWASIH  226

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP I++ SI I+S  G G+AMFS+GLF+AL+  I+ CG  +  +AM ++FIVGP
Sbjct  227   FRWGVKLPDIVDKSIAILSTGGLGMAMFSLGLFMALRPRIISCGIRMAVVAMAVKFIVGP  286

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +    + L G VLR++++QAALPQ +  FV+AKEY +H D LST V  G L+++P+
Sbjct  287   ALMAVASFAVRLEGTVLRVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLIAMPI  346

Query  1132  LITYYVILGF  1161
              + YY +L  
Sbjct  347   ALAYYSLLAL  356



>ref|XP_010029286.1| PREDICTED: putative auxin efflux carrier component 5 isoform 
X1 [Eucalyptus grandis]
 gb|KCW56167.1| hypothetical protein EUGRSUZ_I01919 [Eucalyptus grandis]
Length=357

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 207/360 (58%), Gaps = 13/360 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY  V A  PLY  + L + S+R W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLTNVYHCVAATVPLYATMFLAFISIRFWKLFTPDQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + AD   K L I  +   A F   G L   +T  SLSTL NTLI+G+PL
Sbjct  61    STNPYKMNLRLVLADFAQKILAILIVGGVAKFRSGGGLRWIITGVSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMYGD  A L+ Q   +Q+++W+  LLF  +   T+    T S  A    A      +
Sbjct  121   LRAMYGDEAASLIAQIVCLQSILWYNLLLFLFELNATKAASVTPSSEATGVTATTEEDET  180

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  +++  N  +  T             L + + V  NL +NPN+YA  +G+ WA + 
Sbjct  181   KDGGDELKLRNGRKYET-------------LLIFLKVGKNLLRNPNTYATVMGVIWASIH  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +++P+I+  SI+I+S+ G G+AMFS+GLF+A Q  IV CGA + A+AM  +FI GP
Sbjct  228   FRWGVEMPAIVSSSILILSEGGLGMAMFSLGLFMASQTRIVACGARLAAVAMAAKFIAGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                 I  L +GLR  +L+++++QAALPQ +  FV+AKEY +H +ILST V  G L+++P+
Sbjct  288   GLMAISSLAIGLRETLLKVAIVQAALPQGIVPFVFAKEYNVHPEILSTGVLFGMLIAMPI  347



>gb|KCW58740.1| hypothetical protein EUGRSUZ_H01382 [Eucalyptus grandis]
Length=262

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 130/277 (47%), Positives = 178/277 (64%), Gaps = 28/277 (10%)
 Frame = +1

Query  346   SCSVTAFSLSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWF--  519
             S  +T FSL TLTN LIVGVPLLRAMYG +G D+VVQ +V+Q ++WF  LL  L+F    
Sbjct  4     SWCITTFSLLTLTNVLIVGVPLLRAMYGQVGVDIVVQLSVMQAVLWFPLLLCFLEFRKMG  63

Query  520   -----TRTHPTTSSRVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVL  684
                  T T  TT   V G    +D  G++       EA   N T             + +
Sbjct  64    MDYSPTTTSATTDDLVPGE---KDVEGTA-------EAVRTNSTRP--------RLWTAV  105

Query  685   SLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMG  864
              ++ P    LA NPN YAC +G+ WA++A R+ +++P I++ SI I+S+AG G AMF++G
Sbjct  106   KIVAP---KLALNPNIYACIIGVAWAVIAHRFKVKMPGIVKESIEILSRAGLGTAMFNIG  162

Query  865   LFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLA  1044
             +FIA+Q  ++ CG  +T + MVLRFI GPA   +   ++GLRGDVLR++++QAALPQS+ 
Sbjct  163   IFIAMQRKVIACGVKLTFVGMVLRFIAGPALMTVSSFIMGLRGDVLRMAIMQAALPQSIT  222

Query  1045  SFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVIL  1155
             +F++AKEYGLHA +LSTAV  GTL S+PLLI YY  L
Sbjct  223   TFIFAKEYGLHASVLSTAVVFGTLASLPLLIAYYAAL  259



>ref|XP_003574813.1| PREDICTED: probable auxin efflux carrier component 4 [Brachypodium 
distachyon]
Length=370

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 171/376 (45%), Positives = 234/376 (62%), Gaps = 17/376 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMF-KPDQCDAInrfncffvipffnfqfM  228
             MI W ++ KVV AMAPLY AL LGY S R WH+   P+QC A+N    FF +PFF F F+
Sbjct  1     MIAWGDIRKVVSAMAPLYFALGLGYGSSRWWHLLASPEQCAAVNTLVAFFSMPFFTFDFV  60

Query  229   AHINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVP  408
             + ++P  +N+  L+ADA+AK L I A  AWA   +    S  +T FSL+TL+NTL+VGVP
Sbjct  61    SGVDPSAVNFRVLAADALAKLLAILAAWAWAWARQYDDWSWPITGFSLATLSNTLVVGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFW------FTRTHPTTSSRVAGAGAA  570
             LL AMYGD   +L+VQ AV Q++VW   LL A +          +  P T ++  G    
Sbjct  121   LLEAMYGDWARELMVQVAVAQSVVWVPLLLLAFELRNACCVLHLQPEPETKTKDGGGDVE  180

Query  571   -RDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFL  747
                +  + V+   +  A N N         A+  +  +          +A NPN YA  L
Sbjct  181   LAAAAAARVERDPNARAGNGNGNKKIRRCWAMARTVGI---------KVASNPNVYASVL  231

Query  748   GLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAM  927
             G+ WA  A RW + +P ++ G++ +MS+ G+G++MFSMGL +A QE +V CGA + AL M
Sbjct  232   GVAWACAAYRWRVGMPGVVTGALQVMSRTGTGMSMFSMGLSMAQQERMVACGAGLAALGM  291

Query  928   VLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTI  1107
              LRF+ GPA  L G   +G+RG+VLR  ++QAALPQS+ASFV+AKEYGLHAD+LSTAV  
Sbjct  292   ALRFVAGPAAALAGAAAMGIRGNVLRFVVVQAALPQSIASFVFAKEYGLHADVLSTAVIF  351

Query  1108  GTLVSVPLLITYYVIL  1155
             GTL+S+P+LI YY +L
Sbjct  352   GTLLSLPVLIAYYALL  367



>gb|KHN11585.1| Putative auxin efflux carrier component 5 [Glycine soja]
Length=358

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/368 (35%), Positives = 211/368 (57%), Gaps = 12/368 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   + Y VV +  PLYV + L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADAYHVVASTVPLYVTMILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD + K L    L A    + +G L   +T  S++TL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLIYADFLQKLLAFLVLIAITKISGRGGLKWIITGLSITTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMY      L+ Q   +Q+++W+   LF  +    +T PT ++  +  G+     G  
Sbjct  121   VKAMYKSEAVVLLAQIIFLQSMIWYNLSLFLYELDAVKTRPTAAAS-SSQGSGETDTGRE  179

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             VQ  G+ +A           +  +     VL +++ V   L +NPN+YA  LG  W+ + 
Sbjct  180   VQSKGEEDA-----------EPRIKRKRKVLLILVTVGKKLIKNPNTYATLLGFIWSSIK  228

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW L +P ++  SI I+S  G G+AMFS+GLF+A Q +I+ CG  +  +A+ L+ ++GP
Sbjct  229   FRWGLHMPEVVSQSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMAMVAIGLKVVLGP  288

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
                 +   V+GLR  + +++++QAALPQ +  FV+AKEY +H  +LSTA+ +G L+++P+
Sbjct  289   TLMAVASFVIGLRDTLFKVAIVQAALPQGIVPFVFAKEYNVHPAVLSTAILLGMLIALPV  348

Query  1132  LITYYVIL  1155
              + +Y +L
Sbjct  349   ELAFYFLL  356



>gb|EMT08432.1| Putative auxin efflux carrier component 4 [Aegilops tauschii]
Length=355

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 209/353 (59%), Gaps = 25/353 (7%)
 Frame = +1

Query  91    MAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLS  270
             MAPLY AL LGY SVR W  F  +QC AIN     F +PFF F F+   +PY +NY  ++
Sbjct  1     MAPLYFALGLGYGSVRWWRFFTAEQCGAINTLGVCFSMPFFTFDFVVRADPYAMNYRVIA  60

Query  271   ADAVAKTLVIAALAAWANFTKK--GSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGDLGAD  444
             ADAV K L + A A WA   K   G+ S S+T FSL    NTL+VGVPLL AMYG    D
Sbjct  61    ADAVTKLLAVLAAAVWARCAKAKAGAYSWSITGFSLGAYNNTLVVGVPLLDAMYGKWAQD  120

Query  445   LVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAG----AARDSHGSSVQM----  600
             L+VQ AV+Q +VWF  LL A +           + V G G    +A  +H          
Sbjct  121   LIVQIAVVQAIVWFPLLLLAFEL--------RKAWVVGGGVSSLSATMAHDDGSTSSDDD  172

Query  601   -AGDVEANNNNETNTYSDDSAVTESTSV---LSLMMPVLS-NLAQNPNSYACFLGLFWAL  765
              A  VE  ++++     D  A   +      L LM   +   LA+NPN YA  LG+ WA 
Sbjct  173   RARRVEPVSHSDVEVDLDVEAAPPTGGRRIRLWLMASTVGMKLARNPNVYASVLGVAWAC  232

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI-  942
             +A RW + +P I+ GS+ +MS+ G+G++MFSMGLF+A QE IV CG  + AL MVLRF+ 
Sbjct  233   IAYRWRIGMPGIVTGSLQVMSRTGTGMSMFSMGLFMAQQERIVACGGGLAALGMVLRFVA  292

Query  943   -VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTA  1098
                 A    G +  GLRGDVLR  +IQAALPQS+ASFV+AKEYGLHAD+LSTA
Sbjct  293   GPLAALAGAGAVAFGLRGDVLRFVIIQAALPQSIASFVFAKEYGLHADVLSTA  345



>ref|XP_011009448.1| PREDICTED: putative auxin efflux carrier component 5 [Populus 
euphratica]
Length=355

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 148/363 (41%), Positives = 212/363 (58%), Gaps = 21/363 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLY A+ L Y SVR W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISAGDVYHVVTATVPLYFAMILAYISVRWWKLFTPDQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              INPY +N   + AD + K L +  L A A  + +G L+  +T  SLSTL NTLI+G+PL
Sbjct  61    GINPYKMNLKLIFADFLQKLLALLVLTALAKISSRGRLNWIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMYG     L+ Q   +Q+L+W+  LLF  +   T+      S               
Sbjct  121   LRAMYGAEAEPLLSQIVGLQSLIWYNLLLFLFELNATKEATVAPSS--------------  166

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLS---NLAQNPNSYACFLGLFWA  762
              +  GD+EA    +   + +D  V   T  +  M+ +L+    L  NPN YA  + L WA
Sbjct  167   -ESTGDLEALQEAQ---HKEDEGVQRRTRKVKAMVILLTVGRKLMSNPNFYATLVALIWA  222

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              + SRW + LP I++ S+ I+S  G G+AMFS+GLF+A + +I+ CG  +  +AM ++FI
Sbjct  223   SIHSRWGVNLPDIVDKSVRILSTGGLGMAMFSLGLFMASRPSIIACGIRMAMVAMAMKFI  282

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
             VGPA   +  +  GL+G VL+++++QAALPQ +  FV+AKEY +H D LST V  G L+S
Sbjct  283   VGPALMAVASIAGGLKGTVLKVAIVQAALPQGIVPFVFAKEYNVHPDTLSTGVIFGMLIS  342

Query  1123  VPL  1131
             +P+
Sbjct  343   MPI  345



>gb|AGJ95049.1| PIN11 [Medicago truncatula]
 gb|KEH24973.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=361

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 139/374 (37%), Positives = 217/374 (58%), Gaps = 21/374 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y  V+ W +F PDQC  IN+F   F +P  +FQ ++
Sbjct  1     MISLIDVYHVVTATVPLYVTMLLAYICVKWWKLFTPDQCAGINKFVANFSVPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTK-KGSLSCSVTAFSLSTLTNTLIVGVP  408
               N Y ++   + AD V K L    L      +  +G L   +T  SLSTL NTLI+G+P
Sbjct  61    SNNIYKMSLKLIYADCVQKFLAFLVLIVIIKISDIRGGLKWIITGLSLSTLPNTLILGIP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFTRTHPTTSSRVAGAGAARDS  579
             L++AMY D    L+ Q   +Q+++W+  LLF  +       RT P          AA+ S
Sbjct  121   LMKAMYKDESDFLLPQIIFLQSMIWYNLLLFLHELDAAIPARTMP----------AAQPS  170

Query  580   HGSSVQMAGDVEANNNNETNTYSD--DSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGL  753
             H +     GD E++   ++    +  ++     T +L ++M V   L  NPN+YA F+GL
Sbjct  171   HET-----GDSESSVEVQSKEEDEGRETRPERKTRILIILMKVGKKLIMNPNTYATFIGL  225

Query  754   FWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVL  933
              WA +  RW + +P ++  SI I+S  G G+A FS+GLF+A   +I+ CG  +T ++M L
Sbjct  226   IWASIHFRWGVDMPDVVNQSITILSSGGLGMATFSLGLFMASNSSIIACGPKMTMVSMGL  285

Query  934   RFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGT  1113
             +F+ GPA   +  +V+GLR  +L+++++QAALPQ +  FV+A+EY +H  +LST V +G 
Sbjct  286   KFLFGPALMAVASIVIGLRDTMLKVAIVQAALPQGIVPFVFAREYNVHPAVLSTGVLLGM  345

Query  1114  LVSVPLLITYYVIL  1155
             L+++P+ + YY++L
Sbjct  346   LIALPVALIYYLLL  359



>ref|XP_009795990.1| PREDICTED: putative auxin efflux carrier component 5 [Nicotiana 
sylvestris]
Length=358

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 218/369 (59%), Gaps = 14/369 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SVR W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLRDVYHVVAATIPLYVVMILAYISVRWWKLFSPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y +N   + AD + K L +  LA +A    KG+L+  +T  S+STL NTLI+G+PL
Sbjct  61    ESNLYKVNLKLVLADFIQKFLALFLLAVFAKLKPKGNLTWIITGLSVSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTR-THPTTSSRVAGAGAARDSHGS  588
             ++A++GD  A+L+VQ  V+Q+L+W+  LLF  +   T+ ++  + S VA      +    
Sbjct  121   VKAIFGDAAAELLVQIIVLQSLIWYNLLLFLFELNATKESYVPSPSEVAVELEVPEESEL  180

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
                   + +A                  T ++ +++ V   L  NPN++A   G+ W+ +
Sbjct  181   EEDREEEAKA-------------ICPRKTKIMLILLIVGKKLIINPNTHATLAGIIWSSI  227

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
               RW + LP+I+  SI I+S  G G+AMFS+G+F+A Q +I+ CG     LAM L+F++G
Sbjct  228   HFRWGINLPTIVGRSISILSDGGLGMAMFSIGVFMASQASIIACGTRKAILAMALKFVLG  287

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             P    I  + +GLRG +L+++++QAALPQ +  FV+AKEY +H  ILST V  G L+++P
Sbjct  288   PVLMAISSIAVGLRGKLLKLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLIAIP  347

Query  1129  LLITYYVIL  1155
             + + YY +L
Sbjct  348   IALAYYFLL  356



>ref|XP_010686764.1| PREDICTED: probable auxin efflux carrier component 1b isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 152/415 (37%), Positives = 238/415 (57%), Gaps = 46/415 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W+++Y V+  + PLYV +   Y SV+ W +F P++   INRF   F +P  + +F++
Sbjct  1     MISWKDLYNVLSNVVPLYVVMISAYGSVKWWKIFTPNEISGINRFVALFAVPLLSIKFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             + NPY +N+ F+ AD + K +VI  L  W   + KGSL   +T FSLS L NTL+VG+PL
Sbjct  61    NNNPYAMNFRFILADTLQKLIVILLLFIWCKLSSKGSLEWCITLFSLSALPNTLVVGIPL  120

Query  412   LRAMYGD-LGADLVVQAAVIQNLVWFTFLLFALQFWF-------TRTHPTTSSRVAGAGA  567
             L  MYG+ L   L+VQ +VIQ  +WF  +LF  ++           T  +T+S  +   +
Sbjct  121   LGGMYGEELSQSLMVQLSVIQFNIWFPIMLFLYEYRRATVLIPEQETEISTNSSSSHECS  180

Query  568   ARD-SHGSSVQMAGDVE------ANNNNETNTYSDDSAV--TESTSVLS-----------  687
               D S         D++      + ++N+   + ++  +  TES+SVL            
Sbjct  181   KNDCSQTLKYDEEKDLDNVSVLPSRSSNKIIDHDNEENICPTESSSVLKVEVHVETVAEC  240

Query  688   ------------------LMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGS  813
                               +++ V   L +NPN Y+  + L W+L++ RW +++P+++  S
Sbjct  241   KPKSTNTLPAVGSVTTRQILIMVCKKLMRNPNFYSSLVALTWSLISFRWHVEIPAVVANS  300

Query  814   IVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRG  993
             I I S  G G+AMFS+GLF+A Q  I+  G+++ ALA  +RFIVGPA T      +GLRG
Sbjct  301   IKIFSDTGLGMAMFSLGLFMASQPKIISGGSALAALAAAMRFIVGPAITAATSSAIGLRG  360

Query  994   DVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILG  1158
              +L+I ++QAALPQ++ SFV+A EY +H  +LSTAV+ G L+S+P+ + YY+ILG
Sbjct  361   TLLQIIIMQAALPQAIVSFVFAHEYNVHPGVLSTAVSFGMLISLPITLVYYIILG  415



>emb|CDP02197.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 208/365 (57%), Gaps = 22/365 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             M+   +VY VV A+ PLY A+ L Y SV+ W +F  DQC  IN+F   F IP  +FQ ++
Sbjct  1     MVSLIDVYHVVEAIFPLYAAMILAYASVKWWKLFTADQCSGINKFVARFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               +PY +N   + AD + K L    L   A    +GSLS  +T  SLSTL NTLI+G+PL
Sbjct  61    SNSPYKMNLKLVCADLLQKFLAFFVLTVIAKINSRGSLSWVITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTR----THPTTSSRVAGAGAARDS  579
             LRAMYG   A  + Q  V+Q+L+W+  LL   +    R    T P+T +           
Sbjct  121   LRAMYGPEAAGFLAQIVVLQSLIWYNLLLLLFEINAARGVDATPPSTVTE----------  170

Query  580   HGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
                  ++     A+  +E     ++S   +S   L L+  V   L  NPN++    GL W
Sbjct  171   -----ELEAPEAASQKDEEEDEPNNSQGKKSKIAL-LLSTVGRKLISNPNTHGTLAGLVW  224

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             A +  RW LQLP I++ SI ++S  G G+AMFS+GLF+A Q  I+ CG     LAM +RF
Sbjct  225   ACIHFRWGLQLPKIVDRSITVLSDGGLGMAMFSLGLFMASQTGILACGTRKALLAMAMRF  284

Query  940   IVGPATTLIGC-LVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTL  1116
             +VGP   + GC + +GLRG   +++++QAALPQ +  FV+AKEY +H DILST V +G L
Sbjct  285   VVGP-VVMAGCSIAVGLRGRSFKVAIVQAALPQGIVPFVFAKEYHVHPDILSTGVLMGML  343

Query  1117  VSVPL  1131
             ++ P+
Sbjct  344   IATPI  348



>gb|KDO36786.1| hypothetical protein CISIN_1g048649mg, partial [Citrus sinensis]
Length=256

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 135/295 (46%), Positives = 185/295 (63%), Gaps = 40/295 (14%)
 Frame = +1

Query  52   MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
            MIGWE+VYKVV AM PLY AL LGY SV+ W +  P++C A+NRF C+F +P F  +F  
Sbjct  1    MIGWEDVYKVVEAMVPLYFALMLGYGSVKWWKIIAPEECAAVNRFVCYFTLPLFTIEFTT  60

Query  232  HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSL-SCSVTAFSLSTLTNTLIVGVP  408
             ++P++LNY  + ADA++K +++  LA WA  +K  S  S  +T FSL TLTN+L+VGVP
Sbjct  61   QVDPFNLNYRLIGADAISKLIIVFVLAFWAMCSKNESCYSWCITNFSLCTLTNSLVVGVP  120

Query  409  LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
            LL+ MYG +  DLVVQ++V+Q+++W T  LF L++         S+R+            
Sbjct  121  LLKPMYGQMAVDLVVQSSVLQSILWLTIFLFVLEY-------RRSARI------------  161

Query  589  SVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
                  D+E  +                 S   LM  V   +A+NPNSYAC LGL WA +
Sbjct  162  ------DLEEGHGRP--------------SFWHLMKIVWPKMAKNPNSYACILGLAWAFV  201

Query  769  ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVL  933
            A RW L++PSIIEGSI+IMS+AG+G AMFSMG+F+ALQE ++ CG  +T   MVL
Sbjct  202  AHRWHLKMPSIIEGSILIMSRAGTGTAMFSMGIFMALQEKLIACGPKLTVFGMVL  256



>gb|EMT25709.1| Putative auxin efflux carrier component 5 [Aegilops tauschii]
Length=387

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 147/377 (39%), Positives = 216/377 (57%), Gaps = 29/377 (8%)
 Frame = +1

Query  91    MAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLS  270
             M PLYVA+ L Y SVR W +   DQC  INRF   F +P  +F+ ++  N Y ++  F +
Sbjct  1     MVPLYVAMILAYGSVRWWGVITADQCAGINRFVAVFAVPLLSFKVISGSNLYAMDLRFAA  60

Query  271   ADAVAKTLVIAALAAWANFTKK-GSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGDLGADL  447
             AD + K LV+A+LA W+        L  S+T FS +T+ NTLI+G+PLL AMYG    DL
Sbjct  61    ADTLQKLLVLASLAVWSRLPVPFAGLDWSITVFSSATMPNTLIMGIPLLVAMYGRHAGDL  120

Query  448   VVQAAVIQNLVWFTFLLFALQFWFTR------------------THPTTSSRVAGAGAAR  573
             +VQ  V+Q ++W T LLF  +F   R                   +   ++R    G  R
Sbjct  121   MVQIVVLQCIIWCTLLLFLFEFRAARLLISGRFPAAAVADKNSNVNFVAANRPGATGGER  180

Query  574   DSHGSSVQ-----MAGDVEA----NNNNETNTYSDDSAVTESTSVLSLMMP-VLSNLAQN  723
                G++ Q     +    EA       +ET     +     ++ +L L++  V   L +N
Sbjct  181   VKSGAAAQESLERLEAGTEATGKEQEQDETKKDGGEVGKPPASVMLRLILTMVWRRLIRN  240

Query  724   PNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECG  903
             PN+YA  +GL W+L+  R+ + +P+I+  SI I+S AG G+AMFS+GLF+ALQ  ++ CG
Sbjct  241   PNTYASVVGLVWSLIEFRYHVTMPAIVAKSISILSDAGLGMAMFSLGLFMALQPKLIACG  300

Query  904   ASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHAD  1083
              SV A  M +RF++GPA   +    +GLRG +LRI+++QAALPQ +  FV+AKEY LHA 
Sbjct  301   KSVAASTMAVRFLLGPAVMAVSSAAVGLRGTLLRIAVVQAALPQGIVPFVFAKEYNLHAA  360

Query  1084  ILSTAVTIGTLVSVPLL  1134
             IL T V  G L+++P++
Sbjct  361   ILCTGVIFGMLIALPIV  377



>ref|NP_001234211.1| auxin efflux facilitator SlPIN8 [Solanum lycopersicum]
 gb|ADR30415.1| auxin efflux facilitator SlPIN8 [Solanum lycopersicum]
Length=357

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 140/371 (38%), Positives = 215/371 (58%), Gaps = 19/371 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SVR   +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLRDVYHVVAATIPLYVVMILAYISVRWGKLFSPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y +N   L AD V K L +  LA  +    KG+L+  +T  S+STL NTLI+G+PL
Sbjct  61    GSNLYKVNLKLLLADFVQKFLAVFLLAILSKLKPKGNLTWIITGLSVSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++A++GD  A+L+ Q   +Q+LVW+  LL   +                  A ++S+  S
Sbjct  121   IKAIFGDAAAELLAQLIALQSLVWYNLLLLLFEL----------------NATKESYVMS  164

Query  592   VQMAGDVEANNNNETNTYSDDSAVTE---STSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
                  ++E     E     ++ A        +++ +++ V   L  NPN++A   G+ W+
Sbjct  165   PSEVAELEVPGEPELEEDGEEEATDRPPRKKTIMVILLTVGRKLIINPNTHATLAGIIWS  224

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +  RW + LP I+E SI I+S  G G+AMFS+G+F+A Q++I+ CG     LAM L+F+
Sbjct  225   SIHFRWGVNLPKIVEQSISILSDGGLGMAMFSIGVFMASQDSIIACGTKKAILAMALKFV  284

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
             +GP    I  +V+GL+G + R++++QAALPQ +  FV+AKEY +H  ILST V  G L++
Sbjct  285   LGPVLMAISSIVVGLKGKLFRLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLIA  344

Query  1123  VPLLITYYVIL  1155
             +P+ + YY +L
Sbjct  345   IPIALAYYFLL  355



>ref|XP_009617494.1| PREDICTED: putative auxin efflux carrier component 5 [Nicotiana 
tomentosiformis]
Length=358

 Score =   241 bits (616),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 217/369 (59%), Gaps = 14/369 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SVR W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLRDVYHVVAATIPLYVVMILAYISVRWWKLFSPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y +N   L AD + K L +  LA +A    +G+L+  +T  S STL NTLI+G+PL
Sbjct  61    ESNLYKVNLKLLLADFIQKILALFLLAVFAKLKPRGNLTWIITGLSASTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTR-THPTTSSRVAGAGAARDSHGS  588
             ++A++GD  A+L+VQ  V+Q+L+W+  LLF  +   T+ ++  + S VA      +    
Sbjct  121   VKAIFGDAAAELLVQIIVLQSLIWYNLLLFLFELNATKESYVPSPSEVAVELEVPEESEL  180

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
                   + +A                  T ++ +++ V   L  NPN++A   G+ W+ +
Sbjct  181   EEDREEEAKA-------------ICPRKTKIMLILLTVGRKLIINPNTHATLAGIIWSGI  227

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
               RW + LP+I+  SI I+S  G G+AMFS+G+F+A Q +I+ CG     LAM L+F++G
Sbjct  228   HFRWGINLPTIVGRSISILSDGGLGMAMFSIGVFMASQASIIACGTRKAILAMALKFVLG  287

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             P    I  + +GLRG +L+++++QAALPQ +  FV+AKEY +H  ILST V  G L+++P
Sbjct  288   PVLMAISSIAVGLRGKLLKLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLIAIP  347

Query  1129  LLITYYVIL  1155
             + + YY +L
Sbjct  348   IALAYYFLL  356



>ref|XP_003552512.1| PREDICTED: auxin efflux carrier component 3-like [Glycine max]
 gb|KHN13653.1| Putative auxin efflux carrier component 5 [Glycine soja]
Length=359

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/372 (37%), Positives = 214/372 (58%), Gaps = 19/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   + Y VV A  PLYV L L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADAYHVVAATVPLYVTLILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD + K L    L A    + +G L   +T  SL+TL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLMYADFLQKLLAFLLLIAITKISGRGGLKWIITGLSLTTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF-WFTRTHPTTSSRVAGAGAARDSHGS  588
             ++AMY      L+ Q   +Q+++W+  LLF  +     +T PT         AA  S GS
Sbjct  121   MKAMYKGEAVVLLAQIIFLQSMIWYNLLLFLYELDAVNKTRPT--------AAAPPSQGS  172

Query  589   SVQMAGDVEANNNNETNTYSDDSA---VTESTSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
                     E +   E  +  ++ A   +     V+ +++ V   L +NPN+YA  LG  W
Sbjct  173   G-------ETDTAREVQSKREEDAEPRIKRKMKVMLILVTVGKKLIRNPNTYATLLGFIW  225

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             + +  RW L +P ++  SI I+S  G G+AMFS+GLF+A Q +I+ CG  +T +A+ L+ 
Sbjct  226   SSIQFRWGLHMPEVVNQSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMTMVAIGLKV  285

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             ++GPA   +  LV+GLR  + +++++QAALPQ +  FV+AKEY +H  +LSTA+ +G L+
Sbjct  286   VLGPALMAVASLVIGLRDKLFKVAIVQAALPQGIVPFVFAKEYNVHPAVLSTAILLGMLI  345

Query  1120  SVPLLITYYVIL  1155
             ++P+ + +Y +L
Sbjct  346   ALPVELAFYFLL  357



>ref|XP_010315851.1| PREDICTED: auxin efflux facilitator SlPIN8 isoform X1 [Solanum 
lycopersicum]
Length=358

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/372 (38%), Positives = 218/372 (59%), Gaps = 20/372 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SVR   +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLRDVYHVVAATIPLYVVMILAYISVRWGKLFSPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y +N   L AD V K L +  LA  +    KG+L+  +T  S+STL NTLI+G+PL
Sbjct  61    GSNLYKVNLKLLLADFVQKFLAVFLLAILSKLKPKGNLTWIITGLSVSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSH-GS  588
             ++A++GD  A+L+ Q   +Q+LVW+  LL   +                  A ++S+  S
Sbjct  121   IKAIFGDAAAELLAQLIALQSLVWYNLLLLLFEL----------------NATKESYVMS  164

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTE---STSVLSLMMPVLSNLAQNPNSYACFLGLFW  759
               ++A ++E     E     ++ A        +++ +++ V   L  NPN++A   G+ W
Sbjct  165   PSEVAVELEVPGEPELEEDGEEEATDRPPRKKTIMVILLTVGRKLIINPNTHATLAGIIW  224

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             + +  RW + LP I+E SI I+S  G G+AMFS+G+F+A Q++I+ CG     LAM L+F
Sbjct  225   SSIHFRWGVNLPKIVEQSISILSDGGLGMAMFSIGVFMASQDSIIACGTKKAILAMALKF  284

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             ++GP    I  +V+GL+G + R++++QAALPQ +  FV+AKEY +H  ILST V  G L+
Sbjct  285   VLGPVLMAISSIVVGLKGKLFRLAIVQAALPQGIVPFVFAKEYNIHPTILSTGVIFGMLI  344

Query  1120  SVPLLITYYVIL  1155
             ++P+ + YY +L
Sbjct  345   AIPIALAYYFLL  356



>ref|XP_003621113.1| Auxin efflux carrier component [Medicago truncatula]
Length=364

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 217/370 (59%), Gaps = 10/370 (3%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY V+    PLYV + L Y SV+ + +F  +QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLANVYHVITTTVPLYVTMILAYVSVKWFKIFTQEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + +D + K L    L A    + KG L   +T FSLSTL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLMFSDFIQKLLAFVLLTAIIKISGKGGLKWIITGFSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMY D    L+ Q   +Q+++W+  LLF  +F         +  +  A  ++D+ G++
Sbjct  121   LKAMYKDEAIVLLAQIVFLQSMIWYNLLLFLYEF-------DAAKNMLSAPPSQDT-GTN  172

Query  592   VQMAGDVEANNNNETNTYSDDSAV--TESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
              +   + E+ +  ++    D+  V       +  +++ V   L +NPN++A  +G+ W+ 
Sbjct  173   NKQTRESESASEIQSKREEDEEPVGTKRKMKIFPILVTVGKKLIRNPNTFASLIGIIWSS  232

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +  RW + +P +I  SI ++S  G G+AMFS+GLF+A Q +I+ CG   T +A+ L+ +V
Sbjct  233   IQFRWGIHMPQVINHSIELLSNGGLGMAMFSLGLFMASQSSIIACGPRNTVVAIGLKVLV  292

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   +  +V+GLR  + +++++QAALPQ +  FV+AKEY +H  ILSTA+ +G L+++
Sbjct  293   GPALMALASIVIGLRNTLFKVAIVQAALPQGIVPFVFAKEYNVHPSILSTAILLGMLIAL  352

Query  1126  PLLITYYVIL  1155
             P+ + +Y +L
Sbjct  353   PVELAFYFLL  362



>ref|XP_010550069.1| PREDICTED: putative auxin efflux carrier component 5 [Tarenaya 
hassleriana]
Length=359

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 141/379 (37%), Positives = 213/379 (56%), Gaps = 33/379 (9%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W +VY VV +  PLYV + LGY S +   +F P+QC  IN F   F IP  +FQ ++
Sbjct  1     MISWLDVYHVVSSTVPLYVTMILGYVSAKHLKLFSPEQCSGINTFVSKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAA----WANFTKKGSLSCSVTAFSLSTLTNTLIV  399
               NPY +N   + +DA+ K L   +LAA    W      G L   +T FS+STL NTLI+
Sbjct  61    QNNPYKMNPRLILSDALQKILAAVSLAAVVRFWRPAASGGRLGLIITGFSISTLPNTLII  120

Query  400   GVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDS  579
             G+P+LRAMYGD   D +VQ  V+Q+L+W+                     +    AAR S
Sbjct  121   GIPMLRAMYGDGSVDSLVQIIVLQSLIWYN----------------LLLFLFELNAARSS  164

Query  580   HGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLS-------LMMPVLSNLAQNPNSYA  738
                   +A  V   +    NT ++     E  +VL+       +++ V   L +NPNSYA
Sbjct  165   ------VAARVPTEHRGNENTDAEQEPKEEEETVLAYDSSTGRILLKVWRKLVRNPNSYA  218

Query  739   CFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTA  918
                GL WA +  R   ++P +++GSI ++S  G G+AMFS+GLF+A Q +I+ CG  + A
Sbjct  219   TLAGLIWASIHFRLGWEMPGMVDGSIRLLSDGGLGMAMFSLGLFMASQRSIIACGKQMLA  278

Query  919   LAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTA  1098
             + MVL+F++GP   +     + L G +LR  ++Q+ALPQ +  FV+AKEY ++ +I+ST 
Sbjct  279   ITMVLKFLIGPILMVASAFGIRLHGTLLRTMILQSALPQGIVPFVFAKEYNVYPEIVSTG  338

Query  1099  VTIGTLVSVPLLITYYVIL  1155
             V  G +V++P+ + YY ++
Sbjct  339   VIFGMVVALPIALAYYFVM  357



>ref|XP_009395146.1| PREDICTED: probable auxin efflux carrier component 1b [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   239 bits (611),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 228/384 (59%), Gaps = 17/384 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    +Y VV +MAPLYVA+ LGY SVR +  F P+QC  IN F   F +P   F+ ++
Sbjct  1     MISKSSLYHVVESMAPLYVAMGLGYASVR-FRAFTPEQCAGINHFVALFAMPLLIFRMIS  59

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               +PY +N  F++AD + K  ++AALA WA  + +GSL+  VT FSL+TL NT+I+GVP+
Sbjct  60    SNDPYAMNLRFIAADTIQKAAILAALALWARLSARGSLAWVVTLFSLATLPNTIIMGVPI  119

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAAR------  573
             LR MYG +   L+VQ  V+Q   W+  ++F  ++   +       + A A AA       
Sbjct  120   LRGMYGSMSGTLMVQIVVLQFAFWYVLVVFLFEYMAAQRALVAKQQQAAAPAAVVLTVLD  179

Query  574   -DSHGSSVQMAGDVEANNNNETNTYSDDSAVTES--------TSVLSLMMPVLSNLAQNP  726
              D   ++  +    E + N +TNT +                ++ L L+M     + + P
Sbjct  180   GDQQINASAVVPVTEGDRNADTNTEAAMPPPPAEAEAAMAAPSAKLILLMAA-KKILKIP  238

Query  727   NSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGA  906
             + +A  LGL W+ +A R  ++LP+II+ S+ I+S + +G+A FS+G F+A Q   + CG 
Sbjct  239   SIHASMLGLVWSFIAYREGIKLPTIIDDSVAIISVSATGLATFSVGTFMAQQSRFISCGC  298

Query  907   SVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADI  1086
             SV +LAM +RF+VGPA      L +GL GD+L + ++QAALP ++ SFVYAKEY +H +I
Sbjct  299   SVASLAMAMRFLVGPAVMAASSLAVGLHGDLLHVGIVQAALPLAVISFVYAKEYNVHPEI  358

Query  1087  LSTAVTIGTLVSVPLLITYYVILG  1158
             +ST V +GT  S P+ I YY++LG
Sbjct  359   MSTGVIVGTFASFPITIIYYILLG  382



>tpg|DAA05219.1| TPA_exp: auxin efflux carrier protein [Medicago truncatula]
 gb|AES77331.2| auxin efflux carrier family transporter [Medicago truncatula]
Length=357

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 214/370 (58%), Gaps = 17/370 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY V+    PLYV + L Y SV+ + +F  +QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLANVYHVITTTVPLYVTMILAYVSVKWFKIFTQEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + +D + K L    L A    + KG L   +T FSLSTL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLMFSDFIQKLLAFVLLTAIIKISGKGGLKWIITGFSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMY D    L+ Q   +Q+++W+  LLF  +F         +  +  A  ++D+    
Sbjct  121   LKAMYKDEAIVLLAQIVFLQSMIWYNLLLFLYEF-------DAAKNMLSAPPSQDT----  169

Query  592   VQMAGDVEANNNNETNTYSDDSAV--TESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
                 G+ E+ +  ++    D+  V       +  +++ V   L +NPN++A  +G+ W+ 
Sbjct  170   ----GESESASEIQSKREEDEEPVGTKRKMKIFPILVTVGKKLIRNPNTFASLIGIIWSS  225

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +  RW + +P +I  SI ++S  G G+AMFS+GLF+A Q +I+ CG   T +A+ L+ +V
Sbjct  226   IQFRWGIHMPQVINHSIELLSNGGLGMAMFSLGLFMASQSSIIACGPRNTVVAIGLKVLV  285

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA   +  +V+GLR  + +++++QAALPQ +  FV+AKEY +H  ILSTA+ +G L+++
Sbjct  286   GPALMALASIVIGLRNTLFKVAIVQAALPQGIVPFVFAKEYNVHPSILSTAILLGMLIAL  345

Query  1126  PLLITYYVIL  1155
             P+ + +Y +L
Sbjct  346   PVELAFYFLL  355



>ref|NP_001063602.1| Os09g0505400 [Oryza sativa Japonica Group]
 dbj|BAF25516.1| Os09g0505400 [Oryza sativa Japonica Group]
 gb|EEC84847.1| hypothetical protein OsI_31952 [Oryza sativa Indica Group]
Length=398

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 180/415 (43%), Positives = 233/415 (56%), Gaps = 73/415 (18%)
 Frame = +1

Query  91    MAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLS  270
             MAPLY AL LGY SVR W +F  DQCDA+NR    F +PFF F F A I+P+ L+Y  L+
Sbjct  1     MAPLYFALGLGYGSVRWWRLFTADQCDAVNRLVACFAVPFFAFDFAARIDPFALSYRVLA  60

Query  271   ADAVAKTLVIAALAAWANFTKKGS-------------LSCSVTAFSLSTLTNTLIVGVPL  411
             ADA++K  V  ALAA A                     S  +T FSL+TL NTL+VGVPL
Sbjct  61    ADALSKLAVALALAACAAAASTRCCGSGGGKRGGGGGFSWCITGFSLATLNNTLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L AMYG    DL+VQ +V+Q +V+F  LL A +            R A   AA      +
Sbjct  121   LDAMYGKWARDLIVQISVVQTIVYFPLLLLAFEV-----------RRATTAAAAPPPPPT  169

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  DVE          +  +A     S+  L+  V   +A+NPN YA  LG+ WA + 
Sbjct  170   GTDDDDVE------DGAAAAATAAAARRSLWPLVRAVWLKVARNPNVYAGVLGVAWACVT  223

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW ++ PSIIEGS++IMSK G G++MFSMGLF+ALQ+ I+ CGA +T L M LRF+ GP
Sbjct  224   NRWHVETPSIIEGSVLIMSKTGVGLSMFSMGLFMALQDKIIVCGAGLTVLGMALRFVAGP  283

Query  952   ATTLIGCLVLGLRGDVLRISLI--------------------------------------  1017
             A T +G   LGLRGD+LR+++I                                      
Sbjct  284   AATAVGAFALGLRGDLLRLAIIQAYTHLHEIHSPSSFFLLSPEICLNSNGCMHDTSPHDE  343

Query  1018  -----QAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGFLH  1167
                  QAALPQS+ +FV+AKEYGLHA+ILSTAV  GTL S+P+LI YY++LGF+ 
Sbjct  344   TARDEQAALPQSITTFVFAKEYGLHAEILSTAVIFGTLASLPVLIVYYIVLGFIR  398



>ref|XP_002282480.1| PREDICTED: putative auxin efflux carrier component 5 [Vitis vinifera]
 emb|CAN79928.1| hypothetical protein VITISV_042448 [Vitis vinifera]
 emb|CBI22158.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 210/370 (57%), Gaps = 13/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLY  + L Y SV+ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADVYHVVAATIPLYFVMILAYISVKWWKIFTPEQCSGINKFVAKFSIPLLSFQLIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D + K L +  LA  A    +GSL+  +T  SLSTL NTLI+G+PL
Sbjct  61    ENNPYQMNMRLILSDFLQKLLALILLATIAKINSRGSLTWVITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYGD  A L+ Q  V+Q+LVW+                        A +A     ++
Sbjct  121   LKAMYGDKAAGLLSQIVVLQSLVWYN-----------LLLFLFELNAMKAVSATTPLEAA  169

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             V++    EA    E       +  T  T  + ++  V   L  NPN++A  + L WA + 
Sbjct  170   VELEAPQEAQPKEERE--EGKTTATRKTKTMLILRIVGRKLMMNPNTHATIVSLIWACIR  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW+++LP +++ SI I+SK G G+AMFS+GLF+A + +I+ CG  +  LAM ++F+VGP
Sbjct  228   FRWNVKLPGVVDDSISILSKGGLGMAMFSLGLFMASRPSIIACGTRLAVLAMGMKFLVGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A       +   RG + ++S++QA LPQ +  FV+AKEY +H DILST V  G L+++P+
Sbjct  288   AIMAASASITLSRGTLFKVSIVQACLPQGIVPFVFAKEYDVHPDILSTGVIFGMLIALPI  347

Query  1132  LITYYVILGF  1161
              + YY +L  
Sbjct  348   ALVYYFLLAL  357



>gb|EAY75605.1| hypothetical protein OsI_03509 [Oryza sativa Indica Group]
Length=311

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/365 (37%), Positives = 198/365 (54%), Gaps = 63/365 (17%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             M+ W+++Y V+ A  PLYVA+ L Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MVSWKDIYLVLEATVPLYVAMILAYLSIKWWKLFTPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               +PY +N   + +D + K+L +   AA +           +T FSLSTL NTLIVG+PL
Sbjct  61    TTDPYDMNIKLIYSDILQKSLALLGFAAISKACCAEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYG+    L+ Q  V+Q+L+W+T LLF                              
Sbjct  121   LKGMYGEQAGKLLSQIVVLQSLIWYTLLLFLF----------------------------  152

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  ++ A N   T T S+ +                              GL WAL+ 
Sbjct  153   -----ELRAANGMATTTSSETT------------------------------GLIWALVG  177

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP I+  SI I+S  G G+AMFS+GLF ALQ  I+ CGA    LA+ +RF +GP
Sbjct  178   FRWHIRLPLIVSNSIRILSDGGLGMAMFSLGLFTALQTKIIACGAKRMLLALAIRFFLGP  237

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +    +G+RG +L+I+++QAALPQ +  FV+AKEY + ADILSTA+ +G +V+VP+
Sbjct  238   ALMGMSSYAIGMRGVLLKIAIVQAALPQGIVPFVFAKEYNVQADILSTAIIVGMMVAVPV  297

Query  1132  LITYY  1146
              + YY
Sbjct  298   ALAYY  302



>ref|XP_010492334.1| PREDICTED: putative auxin efflux carrier component 5 [Camelina 
sativa]
Length=364

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/376 (38%), Positives = 216/376 (57%), Gaps = 22/376 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W +VY V+ A  PLYV++ LGY S +   +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWLDVYHVISATVPLYVSMILGYLSAKHLQLFTPEQCAGINKFVAKFSIPLLSFQIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLI  396
               NP+ +N   + +D + K L +  LA    F      + G L   +   S+S   NTLI
Sbjct  61    QNNPFKMNPKLILSDILQKLLALVVLAVVVRFWHPTGGRGGKLGWVIIGLSVSLFPNTLI  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             +G+P+L A+YGD  A ++ Q  V+Q+L+W+T LLF  +                A  A  
Sbjct  121   LGIPILAAIYGDEAASILRQIVVMQSLIWYTILLFLFEI--------------NAARAIT  166

Query  577   SHGSSVQMAGDVEANNNNETNTYSDDSAV---TESTSVLSLMMPVLSNLAQNPNSYACFL  747
             S GS     G+     N E     +D A    T ST  + +++     L  NPN+YA  +
Sbjct  167   SSGSEHNTGGNENEEVNREEEELREDEAAIVRTRSTGTMKVLLKACRKLMINPNTYATLI  226

Query  748   GLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAM  927
             G+ WA L  R   +LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CG  +T++AM
Sbjct  227   GIIWATLHFRLGWELPEMIDKSIHMISDGGLGMAMFSLGLFMASQRSIIACGTKMTSIAM  286

Query  928   VLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTI  1107
             VL+F++GPA  +     + LR ++ +I+++QAALPQ +  FV+AKEY LH +I+ST V  
Sbjct  287   VLKFVLGPALMIASVFSMRLRHNLFKIAILQAALPQGVVPFVFAKEYNLHPEIVSTGVIF  346

Query  1108  GTLVSVPLLITYYVIL  1155
             G L+++P+++ YY +L
Sbjct  347   GMLIALPIILAYYFVL  362



>ref|NP_001044064.2| Os01g0715600 [Oryza sativa Japonica Group]
 gb|EAZ13327.1| hypothetical protein OsJ_03248 [Oryza sativa Japonica Group]
 dbj|BAF05978.2| Os01g0715600 [Oryza sativa Japonica Group]
 tpd|FAA00686.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group]
Length=311

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/365 (37%), Positives = 198/365 (54%), Gaps = 63/365 (17%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             M+ W+++Y V+ A  PLYVA+ L Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MVSWKDIYLVLEATVPLYVAMILAYLSIKWWKLFTPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               +PY +N   + +D + K+L +   AA +           +T FSLSTL NTLIVG+PL
Sbjct  61    TTDPYDMNIKLIYSDILQKSLALLGFAAISKACCAEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+ MYG+    L+ Q  V+Q+L+W+T LLF                              
Sbjct  121   LKGMYGEQAGKLLSQIVVLQSLIWYTLLLFLF----------------------------  152

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  ++ A N   T T S+ +                              GL WAL+ 
Sbjct  153   -----ELRAANGMATTTSSETT------------------------------GLIWALVG  177

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP I+  SI ++S  G G+AMFS+GLF ALQ  I+ CGA    LA+ +RF +GP
Sbjct  178   FRWHIRLPLIVSNSIRMLSDGGLGMAMFSLGLFTALQTKIIACGAKRMLLALAIRFFLGP  237

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +    +G+RG +L+I+++QAALPQ +  FV+AKEY + ADILSTA+ +G +V+VP+
Sbjct  238   ALMGMSSYAIGMRGVLLKIAIVQAALPQGIVPFVFAKEYNVQADILSTAIIVGMMVAVPV  297

Query  1132  LITYY  1146
              + YY
Sbjct  298   ALAYY  302



>ref|XP_006853071.1| hypothetical protein AMTR_s00038p00082540 [Amborella trichopoda]
 gb|ERN14538.1| hypothetical protein AMTR_s00038p00082540 [Amborella trichopoda]
Length=359

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 210/367 (57%), Gaps = 26/367 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   ++Y V  AM PLYVA+ L Y SV+RW +F P+QC  INRF   F IPF  F  ++
Sbjct  1     MISLADLYAVFTAMVPLYVAMFLAYASVKRWEIFTPEQCSGINRFVATFAIPFLAFNIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               +PY +N  F+ AD + K L++  L  WA FT+ GS +  +T FSLS + NTLI+G+PL
Sbjct  61    STDPYKINLKFILADTMQKLLILFVLILWAKFTRWGSFNWMITLFSLSIMPNTLIIGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LR MYG+    L+VQ  V+Q +VW    L   +          +++V   G  R ++ ++
Sbjct  121   LRPMYGEECIGLLVQVVVLQLVVWCPIFLCLYEL--------HAAKVTMNGKVRFTNDTN  172

Query  592   VQMAGDVEANNN---NETNTYSDD--------------SAVTE-STSVLSLMMPVLSNLA  717
                 GD   N      + NT +D+                VT    +  +L + VLS + 
Sbjct  173   EGKEGDEMMNVEVIFKKKNTPADECPGDLAHSNEREVQGEVTHPRMTTTNLFLSVLSKVM  232

Query  718   QNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVE  897
             +NPN+Y   LGL W L++ RW++ +P II  S+ I+S  G G+AMFS+GLF+  Q  I+ 
Sbjct  233   KNPNTYGSVLGLIWGLISFRWNISMPKIIHKSVSILSVTGLGMAMFSLGLFMGSQRKIIA  292

Query  898   CGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLH  1077
             CG     L+MV+RFI       +  + +G+RG  L+ ++IQAALPQ + +FVYAKEY +H
Sbjct  293   CGKRKVILSMVVRFIFSSTVMAMCSIAIGIRGIALKTAIIQAALPQGVITFVYAKEYQVH  352

Query  1078  ADILSTA  1098
              ++LSTA
Sbjct  353   EEVLSTA  359



>ref|XP_008443438.1| PREDICTED: putative auxin efflux carrier component 5 isoform 
X2 [Cucumis melo]
Length=356

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 218/368 (59%), Gaps = 14/368 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYVA+ L Y SV+ W  F  +QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLSDVYHVVAATVPLYVAMMLAYISVKWWKFFTAEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y +N   + AD + K L I  L A    T +G L+  +T  SLST+ NTLI+G+P+
Sbjct  61    DNNLYKMNLQLILADFLQKILAIILLGAITKITSRGGLNWIITGLSLSTMPNTLILGLPV  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG     L+ Q  V+Q+++W+  LLF  +F  T+           A  A  S  + 
Sbjct  121   LKAMYGSEADVLLAQIVVLQSILWYNILLFLFEFTTTK----------AASLAPASEATE  170

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             +++    E     E     D +  +  T   S+++ V   L  NPN++A  LGL W+ + 
Sbjct  171   IEITQ--EGRAKEEIEEARDRNGRSLKTK--SILLTVARKLIINPNTHATILGLIWSSIR  226

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP +I+ SI I+S  G G+AMFS+GLF+  + +I+ CG  +T +AM ++F++GP
Sbjct  227   FRWGVKLPVVIDRSISILSTGGLGMAMFSLGLFMGSRTSIIACGTKMTLVAMGMKFLMGP  286

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A      L LGLRG +LR++++QAALPQ +  FV++KEY +H D+LST V +G L+++P+
Sbjct  287   ALMAACSLALGLRGRLLRVAIVQAALPQGIVPFVFSKEYNIHPDVLSTGVLLGLLIALPV  346

Query  1132  LITYYVIL  1155
              + YY +L
Sbjct  347   ALAYYYLL  354



>ref|XP_008443437.1| PREDICTED: putative auxin efflux carrier component 5 isoform 
X1 [Cucumis melo]
Length=357

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 143/368 (39%), Positives = 220/368 (60%), Gaps = 13/368 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYVA+ L Y SV+ W  F  +QC  IN+F   F IP  +FQ ++
Sbjct  1     MISLSDVYHVVAATVPLYVAMMLAYISVKWWKFFTAEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y +N   + AD + K L I  L A    T +G L+  +T  SLST+ NTLI+G+P+
Sbjct  61    DNNLYKMNLQLILADFLQKILAIILLGAITKITSRGGLNWIITGLSLSTMPNTLILGLPV  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L+AMYG     L+ Q  V+Q+++W+  LLF  +F        T+++ A    A ++   +
Sbjct  121   LKAMYGSEADVLLAQIVVLQSILWYNILLFLFEF--------TTTKAASLAPASEA---T  169

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
              ++    E     E     D +  +  T   S+++ V   L  NPN++A  LGL W+ + 
Sbjct  170   AEIEITQEGRAKEEIEEARDRNGRSLKTK--SILLTVARKLIINPNTHATILGLIWSSIR  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP +I+ SI I+S  G G+AMFS+GLF+  + +I+ CG  +T +AM ++F++GP
Sbjct  228   FRWGVKLPVVIDRSISILSTGGLGMAMFSLGLFMGSRTSIIACGTKMTLVAMGMKFLMGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A      L LGLRG +LR++++QAALPQ +  FV++KEY +H D+LST V +G L+++P+
Sbjct  288   ALMAACSLALGLRGRLLRVAIVQAALPQGIVPFVFSKEYNIHPDVLSTGVLLGLLIALPV  347

Query  1132  LITYYVIL  1155
              + YY +L
Sbjct  348   ALAYYYLL  355



>ref|XP_010420162.1| PREDICTED: putative auxin efflux carrier component 5 [Camelina 
sativa]
Length=366

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 139/384 (36%), Positives = 213/384 (55%), Gaps = 36/384 (9%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W +VY VV A  PLYV++ LGY S +   +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWLDVYHVVSATVPLYVSMILGYLSAKHLQLFTPEQCAGINKFVAKFSIPLLSFQIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLI  396
               NP+ +N   + +D + K L +  LA    F      + G L   +   S+S   NTLI
Sbjct  61    QNNPFKMNPKLILSDILQKLLALVVLAVVLRFWHPTGGRGGRLGWVIIGLSISVFPNTLI  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             +G+P+L A+YGD  + ++ Q  V+Q+L+W+T LLF  +                A  A+ 
Sbjct  121   LGIPILAAIYGDEASSILRQIVVLQSLIWYTILLFLFEI--------------NAARAKT  166

Query  577   SHGSSVQMAGDVEANNNNETNTYSDDSAV-----------TESTSVLSLMMPVLSNLAQN  723
             S GSS       E N     N   +               T ST  + +++     L  N
Sbjct  167   SSGSST------EHNTGGNENEEVNREEEEPREDEVAIVRTRSTGTMKVLLKACRKLIIN  220

Query  724   PNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECG  903
             PN+YA  +G+ WA L  R   +LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CG
Sbjct  221   PNTYATLIGIIWATLHFRLGWELPEMIDKSIHMISDGGLGMAMFSLGLFMASQRSIIACG  280

Query  904   ASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHAD  1083
               +  +AMVL+F++GPA  +    ++ LR ++ +I+++QAALPQ +  FV+AKEY LH +
Sbjct  281   TKMAVIAMVLKFVLGPALMIASVFIMRLRHNLFKIAILQAALPQGVVLFVFAKEYNLHPE  340

Query  1084  ILSTAVTIGTLVSVPLLITYYVIL  1155
             I+ST V  G L+++P ++ YY +L
Sbjct  341   IVSTGVIFGMLIALPTILAYYFVL  364



>gb|KHN47561.1| Putative auxin efflux carrier component 5 [Glycine soja]
Length=362

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 210/363 (58%), Gaps = 15/363 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SV+ W +F P+QC  IN+F   F +P  +FQ ++
Sbjct  1     MISLADVYHVVTATVPLYVTMFLAYISVKWWKLFNPEQCSGINKFVANFSVPILSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD V K L      A      +G L   +T  SLSTL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLVYADVVQKLLAFLVFTAIIRIKDRGGLKWIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFTRTHPTTSSRVAGAGAARDSH  582
             ++AMY D  + L+ Q   +Q++VW+  LLF  +       RT P        A  ++D+ 
Sbjct  121   MKAMYRDEASLLLPQIIFLQSMVWYNLLLFLHELDAAIPARTMPVV------APPSQDTG  174

Query  583   GSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
              S   +  ++++    E   +   S     T +L ++M V + L  NPN+YA F+GL WA
Sbjct  175   DSETSL--EIQSKEEEEEAEHRTQS----KTRMLLILMKVGNKLIINPNTYATFIGLIWA  228

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +  RW + +P ++  SI I++  G G+A FS+GLF+A    I+ CG  +T +AM L+F+
Sbjct  229   SIHFRWGVDMPDVVNQSIEILASGGLGMATFSLGLFMASSNRIIVCGPRMTLVAMGLKFL  288

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
              GPA   +  +V+GLR  +L++++IQAALPQ +  FV+A+EY ++  ILST V +G L++
Sbjct  289   AGPAIMAVASIVIGLRDRMLKVAIIQAALPQGIVPFVFAREYNVNPGILSTGVLLGMLMA  348

Query  1123  VPL  1131
             +P+
Sbjct  349   LPV  351



>ref|NP_001267507.1| uncharacterized protein LOC100795531 [Glycine max]
 gb|AGJ95051.1| PIN11a [Glycine max]
Length=362

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 210/363 (58%), Gaps = 15/363 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SV+ W +F P+QC  IN+F   F +P  +FQ ++
Sbjct  1     MISLADVYHVVTATVPLYVTMFLAYISVKWWKLFTPEQCSGINKFVANFSVPILSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD V K L      A      +G L   +T  SLSTL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLVYADVVQKLLAFLVFTAIIRIKDRGGLKWIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFTRTHPTTSSRVAGAGAARDSH  582
             ++AMY D  + L+ Q   +Q++VW+  LLF  +       RT P        A  ++D+ 
Sbjct  121   MKAMYRDEASLLLPQIIFLQSMVWYNLLLFLHELDAAIPARTMPVV------APPSQDTG  174

Query  583   GSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
              S   +  ++++    E   +   S     T +L ++M V + L  NPN+YA F+GL WA
Sbjct  175   DSETSL--EIQSKEEEEEAEHRTQS----KTRMLLILMKVGNKLIINPNTYATFIGLIWA  228

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +  RW + +P ++  SI I++  G G+A FS+GLF+A    I+ CG  +T +AM L+F+
Sbjct  229   SIHFRWGVDMPDVVNQSIEILASGGLGMATFSLGLFMASSNRIIVCGPRMTLVAMGLKFL  288

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
              GPA   +  +V+GLR  +L++++IQAALPQ +  FV+A+EY ++  ILST V +G L++
Sbjct  289   AGPAIMAVASIVIGLRDRMLKVAIIQAALPQGIVPFVFAREYNVNPGILSTGVLLGMLMA  348

Query  1123  VPL  1131
             +P+
Sbjct  349   LPV  351



>emb|CDM84597.1| unnamed protein product [Triticum aestivum]
Length=428

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 221/428 (52%), Gaps = 58/428 (14%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W  VY VV AMAPLY A  LGY SVR    F  +QC  IN F   + +P   F  ++
Sbjct  1     MITWLAVYHVVEAMAPLYTAAVLGYASVRWLKAFSEEQCAGINHFVAIYAVPVLIFNMVS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWA------------NFTKKGS----LSCSVTA  363
               NPY +N   ++AD + K +++  L AWA            N   K S    L   VTA
Sbjct  61    TNNPYAMNGRLVAADTLQKAVMLLGLVAWAAWESRSRRRRRSNGGGKASTASPLQWVVTA  120

Query  364   FSLSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWF--------  519
             FS+++L NT+I+GVPLL  MYG +  DL+ Q  V+Q  VW+  ++F  ++          
Sbjct  121   FSVASLPNTIIMGVPLLGGMYGAMSKDLMKQIVVMQFCVWYNVVIFIYEYMAARRAATAM  180

Query  520   ------------------------------TRTHPTTS----SRVAGAGAARDSHGSSVQ  597
                                            R H  T     + VA A  A+     +  
Sbjct  181   DGTAKISPGSPGAAPSAEKIAPNDEAVVAAKRAHEVTVNIEITEVAAASTAQKDLADNTT  240

Query  598   MAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASR  777
                  E + + E    S   A + + SV  + +     + + PN+YA FLGL WAL+A +
Sbjct  241   TTVAKETSTDAEAEKASPPPAKSTAPSVRHIGLMAGKKVLKIPNTYASFLGLIWALIAFK  300

Query  778   WDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPAT  957
               +++P II+ S+  +     G++MF+ G FIA Q   V CG ++ +++MVL+F++GP  
Sbjct  301   CGIKMPKIIDDSLFTIQTTAVGLSMFASGTFIARQSRFVPCGYAIASVSMVLKFLIGPVV  360

Query  958   TLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLI  1137
              L+  L +G+ G +L I+++QAALP ++ SFVYA+EY +HADI+ST V +G  +S+P+ I
Sbjct  361   MLLASLAIGMHGTLLHIAVVQAALPLAVTSFVYAEEYKVHADIMSTGVILGIFISLPVTI  420

Query  1138  TYYVILGF  1161
              YY++LG 
Sbjct  421   VYYILLGL  428



>ref|XP_006431075.1| hypothetical protein CICLE_v10012051mg [Citrus clementina]
 gb|ESR44315.1| hypothetical protein CICLE_v10012051mg [Citrus clementina]
 gb|KDO72484.1| hypothetical protein CISIN_1g018360mg [Citrus sinensis]
Length=357

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 213/370 (58%), Gaps = 13/370 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   + Y VV A  PLYVA+ L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISVVDAYHVVAACVPLYVAMLLAYISVKWWKLFTPDQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + AD + K L    L A    + +  L   +T  SLS+L N+LI+G+PL
Sbjct  61    KNNPYKMNLKLIYADFLQKLLAFLVLVALTKISSRSGLRWIITGLSLSSLPNSLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMY +  A L+ Q  V+Q+L+W+  LLF  +    ++   T +         D+   S
Sbjct  121   LRAMYSEEAALLLAQIVVLQSLIWYNLLLFLFELNAAKSASVTPN--PETPEEHDASQES  178

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                 G+ EA N   T   +             +++ V   L  NPN++A  LGL WA + 
Sbjct  179   QAKEGEEEAQNRTATRVRTTH-----------ILLTVGRKLIINPNTHATLLGLIWASIE  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP+II+ S+ I+S  G G+AMFS+GLF+A + +I+ CG  + A+AM L+FIVGP
Sbjct  228   FRWGVKLPAIIDQSVRILSNGGLGMAMFSLGLFMASRPSIIACGTRMAAVAMALKFIVGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A        +GLRG + +I+ +QAALPQ +  FV+AKEY +H DILST V  G ++++P+
Sbjct  288   ALMAASSFAIGLRGTLFKIAFVQAALPQGIVPFVFAKEYNVHPDILSTGVLFGMIITLPV  347

Query  1132  LITYYVILGF  1161
              + YY +L  
Sbjct  348   TLAYYFLLAL  357



>ref|XP_003550957.1| PREDICTED: putative auxin efflux carrier component 5-like isoform 
X1 [Glycine max]
 ref|XP_006600902.1| PREDICTED: putative auxin efflux carrier component 5-like isoform 
X2 [Glycine max]
 gb|KHN01714.1| Putative auxin efflux carrier component 5 [Glycine soja]
Length=363

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 137/363 (38%), Positives = 209/363 (58%), Gaps = 14/363 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SV+ W +F P+QC  IN+F   F +P  +FQ ++
Sbjct  1     MISLADVYHVVTATVPLYVTMFLAYISVKWWKLFNPEQCSGINKFVANFSVPILSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD V K L      A      +G L   +T  SLSTL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLVYADVVQKLLAFLVFTAIIRIKGRGGLKWIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFTRTHPTTSSRVAGAGAARDSH  582
             ++AMY D  + L+ Q   +Q++VW+  LLF  +       RT P  +      G +    
Sbjct  121   MKAMYRDEASLLLPQIIFLQSMVWYNLLLFLHELDAAIPARTMPVVAPPSQDTGESE---  177

Query  583   GSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
              +S+++    E     E  T S        T +L ++M V + L  NPN+YA F+GL WA
Sbjct  178   -TSLEIQSKEEEEEEAEHRTQSK-------TRMLLILMKVGNKLIINPNTYATFIGLIWA  229

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +  RW + +P ++  SI I++  G G+A FS+GLF+A    ++ CG  +T +AM L+F+
Sbjct  230   SIHFRWGVDMPDVVNQSIEILASGGLGMATFSLGLFMASNNRVIVCGPRMTLVAMGLKFL  289

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVS  1122
             VGPA   +  +V+GLR  +L++++IQAALPQ +  FV+A+EY ++  ILST V +G L++
Sbjct  290   VGPAIMAVASIVIGLRDRMLKVAIIQAALPQGIVPFVFAREYNVNPGILSTGVLLGMLMA  349

Query  1123  VPL  1131
             +P+
Sbjct  350   LPV  352



>ref|XP_008788611.1| PREDICTED: probable auxin efflux carrier component 1b [Phoenix 
dactylifera]
Length=398

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 141/366 (39%), Positives = 209/366 (57%), Gaps = 18/366 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    + +VV AMAPLY A+ LGY + R WH   PDQC  INRF   F IP   FQ ++
Sbjct  1     MIATSSLDRVVEAMAPLYAAMTLGYAAARWWHALTPDQCAGINRFVSVFAIPLLTFQLLS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKK-------GSLSCSVTAFSLSTLTNT  390
               +PY +N  FL+AD+  K L++  L  WA   ++        SL   +T FSL+TL NT
Sbjct  61    SNDPYAMNPRFLAADSFQKLLLLTILFIWARLRRRPASGGSSSSLPWVITIFSLATLPNT  120

Query  391   LIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPT----TSSRVAG  558
             +I+G+PLLR MYG     L+VQ  V+Q  VW+  ++F  ++   R   T    T++ V  
Sbjct  121   VIMGIPLLRGMYGPQTDSLMVQIVVLQAAVWYNLVIFLYEYMAARCAATEGCQTNASVPT  180

Query  559   AGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYA  738
                  +   +     G VE     ET       ++    +V          L + PN++A
Sbjct  181   TLPVSEKEAAIAAANGSVE-GGEGETKPPPSPPSMWRILTVAG------RKLCRIPNTHA  233

Query  739   CFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTA  918
              FLGL W+ +A  + +++P II  S+ I+S    G++MFS+G F+A Q   + CG SV A
Sbjct  234   SFLGLIWSFIAFGFGIRMPKIIHDSVTILSSTAIGLSMFSIGTFMARQTRFISCGYSVAA  293

Query  919   LAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTA  1098
              AMV++F+VGP+  +   L +GL+G +LR+++IQAALP ++ SFVYAKEY +H +++STA
Sbjct  294   FAMVVKFLVGPSIMIATSLSVGLQGLLLRVAIIQAALPLAVLSFVYAKEYNVHPEVMSTA  353

Query  1099  VTIGTL  1116
             + + TL
Sbjct  354   LELETL  359



>ref|XP_003564417.1| PREDICTED: probable auxin efflux carrier component 5 [Brachypodium 
distachyon]
Length=417

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 148/417 (35%), Positives = 224/417 (54%), Gaps = 47/417 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY VV AMAPLY A  LGY SVR    F  +QC  IN F   + +P   F  ++
Sbjct  1     MITGSAVYHVVEAMAPLYTAALLGYASVRWLGAFSAEQCAGINHFVAIYAVPVLIFHMVS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWA----NFTKKGS--------------LSCSV  357
               +PY ++   ++AD + K  ++ AL AWA     + ++G+              L   V
Sbjct  61    TNDPYAMSGRLIAADTLQKAAMLLALVAWAAWPARWRRRGNNNKAVAAAAAAVSPLQWVV  120

Query  358   TAFSLSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPT  537
             TAFS++ L NT+I+GVPLL  MYGD+   L+ Q  V+Q  VW+  ++F  ++   R   T
Sbjct  121   TAFSVAALPNTIIMGVPLLGGMYGDVSKGLMKQIVVMQFCVWYNVVIFIYEYMAARRAAT  180

Query  538   T--SSRVAGAG-------AARDSHGSSVQMA------------GDVEANNNNETNTYSDD  654
                ++R+  A        AA  +H  +V++               V       T      
Sbjct  181   VDGTARIRDANDDDIVVVAAERAHEVTVKIEITEVAAAPPVPQEGVAGETKTTTVAKETS  240

Query  655   SAVTESTSVLSLMMPVLSNLA--------QNPNSYACFLGLFWALLASRWDLQLPSIIEG  810
             +A TE  S      P   ++A        + PN+YA FLGL WAL+A +  +++P II+ 
Sbjct  241   TAETEGVSPPKKTAPSARHVALMAGKKVLKIPNTYASFLGLIWALIAFKCGIKMPKIIDD  300

Query  811   SIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLR  990
             S+  +     G++MF+ G FIA Q   V CG +V +++MVL+F++GP   L+  L +GL 
Sbjct  301   SLFTIHTTAVGLSMFASGTFIARQSRFVPCGYAVASISMVLKFLIGPVVMLLASLAIGLH  360

Query  991   GDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGF  1161
             G +L I+++QAALP ++ SFVYA+EY +HADI+ST V +G  +S+P+ I YY++LG 
Sbjct  361   GTLLHIAVVQAALPLAVTSFVYAEEYKVHADIMSTGVILGIFISLPVTIVYYILLGL  417



>ref|NP_197014.1| auxin transporter PIN8 [Arabidopsis thaliana]
 sp|Q9LFP6.1|PIN5_ARATH RecName: Full=Putative auxin efflux carrier component 5; Short=AtPIN5 
[Arabidopsis thaliana]
 emb|CAC01829.1| auxin transport protein-like [Arabidopsis thaliana]
 gb|AED92117.1| auxin transporter PIN8 [Arabidopsis thaliana]
Length=367

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 138/377 (37%), Positives = 218/377 (58%), Gaps = 21/377 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++Y VV A  PLYV++ LG+ S R   +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWLDIYHVVSATVPLYVSMTLGFLSARHLKLFSPEQCAGINKFVAKFSIPLLSFQIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLI  396
               NP+ ++   + +D + K LV+  LA    F      + G L   +T  S+S L NTLI
Sbjct  61    ENNPFKMSPKLILSDILQKFLVVVVLAMVLRFWHPTGGRGGKLGWVITGLSISVLPNTLI  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             +G+P+L A+YGD  A ++ Q  V+Q+L+W+T LLF  +    R  P++       GA+ +
Sbjct  121   LGMPILSAIYGDEAASILEQIVVLQSLIWYTILLFLFELNAARALPSS-------GASLE  173

Query  577   SHGSSVQMAGDVEANNNNETNTYSDDSAV----TESTSVLSLMMPVLSNLAQNPNSYACF  744
               G+  +     EAN  +E     D+  V    T S   + +++     L  NPN+YA  
Sbjct  174   HTGNDQE-----EANIEDEPKEEEDEEEVAIVRTRSVGTMKILLKAWRKLIINPNTYATL  228

Query  745   LGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALA  924
             +G+ WA L  R    LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CG  +  + 
Sbjct  229   IGIIWATLHFRLGWNLPEMIDKSIHLLSDGGLGMAMFSLGLFMASQSSIIACGTKMAIIT  288

Query  925   MVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVT  1104
             M+L+F++GPA  +     + L+  + +++++QAALPQ +  FV+AKEY LH +I+ST V 
Sbjct  289   MLLKFVLGPALMIASAYCIRLKSTLFKVAILQAALPQGVVPFVFAKEYNLHPEIISTGVI  348

Query  1105  IGTLVSVPLLITYYVIL  1155
              G L+++P  + YY +L
Sbjct  349   FGMLIALPTTLAYYFLL  365



>ref|XP_004489167.1| PREDICTED: auxin efflux carrier component 1-like [Cicer arietinum]
Length=357

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 210/370 (57%), Gaps = 17/370 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +V  VV    PLYV + L Y SV+ W +F  +QC  IN+F   F +P  +FQ ++
Sbjct  1     MISLSDVNHVVTKTVPLYVTMILAYVSVKWWKIFTQEQCSGINKFVAKFSVPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD + K L I  L A    + +G L   +T FSLS+L NTLI+G+PL
Sbjct  61    SNNFYKMSLKLMYADFIQKLLAIILLIAITKISGRGGLKWIITGFSLSSLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             ++AMY +    L+ Q   +Q+++W+  LLF  +F                 +A  S G+ 
Sbjct  121   IKAMYKEEAVVLLAQVVFLQSMIWYNLLLFLYEF----------DAAKNMVSATPSQGT-  169

Query  592   VQMAGDVEANNNNETNTYSDDSAV--TESTSVLSLMMPVLSNLAQNPNSYACFLGLFWAL  765
                 G++E     +     D+  V       +  +++ V   L +NPN++A  +G  W+ 
Sbjct  170   ----GELETAREMQLKGEEDEDPVLTKRKKKIFPILVTVGKKLIRNPNTFASLIGFIWSS  225

Query  766   LASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIV  945
             +  RW + +P ++  SI ++S  G G+AMFS+GLF+A Q +++ CG   T +A+ L+ +V
Sbjct  226   IKFRWGIHMPEVVSQSIELLSNGGLGMAMFSLGLFMASQSSMITCGPRNTMVAIGLKVLV  285

Query  946   GPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSV  1125
             GPA  ++   ++GLR  + +++++QAALPQ +  FV+AKEY +H  ILSTA+ +G L+++
Sbjct  286   GPALMVVASFLIGLRNTLFKVAIVQAALPQGIVPFVFAKEYNVHPSILSTAILLGMLIAL  345

Query  1126  PLLITYYVIL  1155
             P+ + +Y +L
Sbjct  346   PVELAFYFLL  355



>ref|NP_001130684.1| uncharacterized protein LOC100191787 [Zea mays]
 gb|ACF78999.1| unknown [Zea mays]
 gb|AFK32347.1| putative auxin efflux carrier PIN9 [Zea mays]
 tpg|DAA57230.1| TPA: hypothetical protein ZEAMMB73_851809 [Zea mays]
Length=433

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 149/434 (34%), Positives = 222/434 (51%), Gaps = 65/434 (15%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY VV AMAPLY +  LGY SVR    F  +QC  IN F   + +P   F  ++
Sbjct  1     MIPGSAVYHVVEAMAPLYTSAVLGYASVRWLKAFSDEQCAGINHFVALYAVPVLIFHMVS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTK-----------------KGSLSCSVT  360
               +PYH+N   ++AD + K +V+ AL AWA ++                  +  +   VT
Sbjct  61    TNDPYHMNERLIAADTLQKAVVLLALTAWAFWSHLSRRRGGRGKRQVVQGAESPIKWVVT  120

Query  361   AFSLSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTH---  531
              FS+++L NT+I+GVPLL  MYG +   L+ Q  V+Q  +W+  ++F  +F   R     
Sbjct  121   NFSVASLPNTIIMGVPLLDGMYGPVSGGLMKQIVVMQFCIWYNVVIFLYEFMAARDGSAR  180

Query  532   -----PTT------------SSRVAGAGAARDSHGSSVQMAGDVE---------------  615
                  P T            SS V    AA  SH    Q+  ++E               
Sbjct  181   ISPAVPATAGERVVDDENGGSSSVHRHAAADRSHHHH-QVVVNIEITEVAPAPAAEAVVA  239

Query  616   -----ANNNNETNTYSDDSAVTESTSVLSLMMPVL-------SNLAQNPNSYACFLGLFW  759
                  A    E +   D  A  +    + +  PV+         L Q PN+YA FLGL W
Sbjct  240   SSLMPAAATKEMSPEDDGDANKQVVVAVDVQPPVMHVVWMATKKLLQIPNTYASFLGLIW  299

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             +L+A +    +P I+  S+ I+     G++MF+ G FIA Q   V CG +V +L+M+L+F
Sbjct  300   SLMAFKIGFSMPKIVSDSLFIIYTTAVGLSMFASGTFIARQSRFVPCGYTVASLSMLLKF  359

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             ++GP   LI  L +G+ G +L I+++QAALP ++ SFVYA+EY +HADI+ST V +G  +
Sbjct  360   LIGPVIMLIASLAIGMHGTLLHIAVVQAALPLAVTSFVYAEEYKVHADIMSTGVILGIFI  419

Query  1120  SVPLLITYYVILGF  1161
             S+P+ I YY++LG 
Sbjct  420   SLPVTIVYYILLGL  433



>ref|XP_009121614.1| PREDICTED: putative auxin efflux carrier component 5 [Brassica 
rapa]
Length=362

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/373 (35%), Positives = 208/373 (56%), Gaps = 18/373 (5%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W +VY V  A  PLYVA+ LGY S +  ++F  +QC  IN+F   F +P  +FQ ++
Sbjct  1     MISWLDVYHVFSATVPLYVAMILGYLSAKHLNIFSLEQCAGINKFVAKFSVPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLI  396
               NP+ ++   + +D + K      LA    F      + G L   +T  S+S L NTLI
Sbjct  61    QNNPFKMSPRLILSDILQKIFAFVVLAVVLRFWHPTGGRGGKLGWIITGLSVSVLPNTLI  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             +G+P+L A+ GD   +++VQ  V+Q+L+W+  LLF  +          + ++  +GA+ +
Sbjct  121   LGIPILSAIDGDAAVNILVQIVVLQSLIWYNILLFLFEI-------NAARKITSSGASIE  173

Query  577   SHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLF  756
               G+  + A D+E     E          T S     +++     L  NPN+YA   GL 
Sbjct  174   HRGNDNEEA-DIEQEPKEEVAIVR-----TRSPGTGKILLKAWQKLIINPNTYAALFGLV  227

Query  757   WALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLR  936
             WA L  R   +LP +I  S+ ++S  G G+AMFS+GLF+A Q +I+ CG  +  + MVL+
Sbjct  228   WATLHFRLGWKLPEMIGKSVHMISDGGLGMAMFSLGLFMASQSSIIACGTKMAIITMVLK  287

Query  937   FIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTL  1116
             F++GPA  +     + LR  + R++++QAALPQ +  FV+AKEY ++ +I ST V  G +
Sbjct  288   FVIGPALMVASAFSIRLRSTLFRVTVLQAALPQGIVPFVFAKEYNVNPEIASTGVIFGMI  347

Query  1117  VSVPLLITYYVIL  1155
             +S+P+ + YY +L
Sbjct  348   ISLPITLAYYFVL  360



>ref|NP_001276251.1| uncharacterized protein LOC100801456 [Glycine max]
 gb|AGJ95059.1| PIN8a [Glycine max]
Length=406

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 134/405 (33%), Positives = 215/405 (53%), Gaps = 36/405 (9%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   + Y VV +  PLYV + L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADAYHVVASTVPLYVTMILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD + K L    L A    + +G L   +T  S++TL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLIYADFLQKLLAFLVLIAITKISGRGGLKWIITGLSITTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPT---TSSRVAGAGAARDS-  579
             ++AMY      L+ Q   +Q+++W+  LLF  +    +T PT   +SS+ +   +  D  
Sbjct  121   VKAMYKSEAVVLLAQIIFLQSMIWYNLLLFLYELDAVKTRPTAAASSSQGSDHTSTNDYN  180

Query  580   ----------------------------HGSSVQMAGDVEANNNNETNTYSDDS---AVT  666
                                         H  S++         N     +SD+    A T
Sbjct  181   FLSTKFSKAIIDIVACIITNVIQYKNLMHEYSMKTCFSKSFEGNQRQLGWSDNKSFRACT  240

Query  667   ESTSVLSLMMPVLS-NLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSG  843
              +   L   +P +   L +NPN+YA  LG  W+ +  RW L +P ++  SI I+S  G G
Sbjct  241   NTYKYLHKTVPEMKMKLIKNPNTYATLLGFIWSSIKFRWGLHMPEVVSQSIEILSNGGLG  300

Query  844   VAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQA  1023
             +AMFS+GLF+A Q +I+ CG  +  +A+ L+ ++GP    +   V+GLR  + +++++QA
Sbjct  301   MAMFSLGLFMASQSSIIACGPRMAMVAIGLKVVLGPTLMAVASFVIGLRDTLFKVAIVQA  360

Query  1024  ALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILG  1158
             ALPQ +  FV+AKEY +H  +LSTA+ +G L+++P+ + +Y +L 
Sbjct  361   ALPQGIVPFVFAKEYNVHPAVLSTAILLGMLIALPVELAFYFLLA  405



>ref|NP_001276253.1| uncharacterized protein LOC100779697 [Glycine max]
 gb|AGJ95068.1| PIN8b [Glycine max]
Length=352

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 133/357 (37%), Positives = 205/357 (57%), Gaps = 13/357 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   + Y VV A  PLYV L L Y SV+ W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLADAYHVVAATVPLYVTLILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD + K L    L A    + +G L   +T  SL+TL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLMYADFLQKLLAFLLLIAITKISGRGGLKWIITGLSLTTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF-WFTRTHPTTSSRVAGAGAARDSHGS  588
             ++AMY      L+ Q   +Q+++W+  LLF  +     +T PT     A A  ++ S  +
Sbjct  121   MKAMYKGEAVVLLAQIIFLQSMIWYNLLLFLYELDAVNKTRPT-----AAAPPSQGSGSN  175

Query  589   SVQ----MAGDVEANNNNETNTYSDDSA---VTESTSVLSLMMPVLSNLAQNPNSYACFL  747
             ++Q    M    E +   E  +  ++ A   +     V+ +++ V   L +NPN+YA  L
Sbjct  176   AMQYKNLMHKYRETDTAREVQSKREEDAEPRIKRKMKVMLILVTVGKKLIRNPNTYATLL  235

Query  748   GLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAM  927
             G  W+ +  RW L +P ++  SI I+S  G G+AMFS+GLF+A Q +I+ CG  +T +A+
Sbjct  236   GFIWSSIQFRWGLHMPEVVNQSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMTMVAI  295

Query  928   VLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTA  1098
              L+ ++GPA   +  LV+GLR  + +++++QAALPQ +  FV+AKEY +H  +LSTA
Sbjct  296   GLKVVLGPALMAVASLVIGLRDKLFKVAIVQAALPQGIVPFVFAKEYNVHPAVLSTA  352



>ref|NP_001044548.1| Os01g0802700 [Oryza sativa Japonica Group]
 sp|Q5VQY3.1|PIN5_ORYSJ RecName: Full=Probable auxin efflux carrier component 5; AltName: 
Full=OsPIN5 [Oryza sativa Japonica Group]
 dbj|BAD68142.1| putative auxin transporter PIN1 [Oryza sativa Japonica Group]
 dbj|BAF06462.1| Os01g0802700 [Oryza sativa Japonica Group]
 tpd|FAA00687.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group]
Length=426

 Score =   228 bits (580),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 143/426 (34%), Positives = 219/426 (51%), Gaps = 56/426 (13%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   EVY+VV AMAPLY A ALGY SVR    F  +QC  IN F   + +P   F  ++
Sbjct  1     MITGSEVYQVVEAMAPLYTAAALGYGSVRWLKAFSNEQCAGINHFVALYAVPVLIFDMVS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKK--------------GSLSCSVTAFS  369
               N Y +N   ++AD + K +++  L AWA + +                 L   +T FS
Sbjct  61    TNNVYKMNGRLIAADTLQKAVLLLGLMAWALWERSRARGAGAKAKAAVSSPLQWVITCFS  120

Query  370   LSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSR  549
             +++L NT+I+GVPLL  MYG +  DL+ Q  V+Q  +W+  ++F  ++   R   +    
Sbjct  121   VASLPNTIIMGVPLLNGMYGPVSKDLMKQIVVMQFCIWYNVIIFLYEYMAARRSASAPPP  180

Query  550   VAGAGAARDSHGSSVQMAGDVEANNNNETN------------------TYSDDSAVTEST  675
              +  G+A+ S  S V+ A      N N                     + + D    E+T
Sbjct  181   ASSEGSAKISPSSPVKAAAAAADTNGNAVAADRPQEVAVNIEITEMAASTARDGVSGETT  240

Query  676   ------------------------SVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWD  783
                                     S+  ++   +  L Q PN+YA FLGL W+L+A +  
Sbjct  241   AAAKEVSSGEVAPVEEEEASAPAPSMKHVIWMAVKKLLQIPNTYASFLGLIWSLIAFKCG  300

Query  784   LQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTL  963
               +P I+E S+  +     G++MFS G FIA Q   V CG  + + +MV++F++GP   L
Sbjct  301   FSMPKIVEDSLFTIRTTAVGLSMFSSGTFIARQSRFVPCGYKIASFSMVIKFLIGPVVML  360

Query  964   IGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITY  1143
                LV+G+ G +L I+++QAALP ++ SFVYA+EY +HADI+ST V +G  +S+P+ I Y
Sbjct  361   FASLVIGMHGTLLHIAVVQAALPLAVTSFVYAEEYKVHADIMSTGVILGIFISLPVTIVY  420

Query  1144  YVILGF  1161
             Y++LG 
Sbjct  421   YILLGL  426



>gb|EAZ45288.1| hypothetical protein OsJ_29930 [Oryza sativa Japonica Group]
Length=370

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 167/415 (40%), Positives = 218/415 (53%), Gaps = 101/415 (24%)
 Frame = +1

Query  91    MAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLS  270
             MAPLY AL LGY SVR W +F  DQCDA+NR    F +PFF F F A I+P+ L+Y  L+
Sbjct  1     MAPLYFALGLGYGSVRWWRLFTADQCDAVNRLVACFAVPFFAFDFAARIDPFALSYRVLA  60

Query  271   ADAVAKTLVI-------------AALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             ADA++K  V                 +        G  S  +T FSL+TL NTL+VGVPL
Sbjct  61    ADALSKLAVALALAACAAAASTRCCGSGGGKRGGGGGFSWCITGFSLATLNNTLVVGVPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L AMYG    DL+VQ                                            S
Sbjct  121   LDAMYGKWARDLIVQI-------------------------------------------S  137

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
             VQ  G    +++ E    +  +A     S+  L+  V   +A+NPN YA  LG+ WA + 
Sbjct  138   VQQTG--TDDDDVEDGAAAAATAAAARRSLWPLVRAVWLKVARNPNVYAGVLGVAWACVT  195

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
             +RW ++ PSIIEGS++IMSK G G++MFSMGLF+ALQ+ I+ CGA +T L M LRF+ GP
Sbjct  196   NRWHVETPSIIEGSVLIMSKTGVGLSMFSMGLFMALQDKIIVCGAGLTVLGMALRFVAGP  255

Query  952   ATTLIGCLVLGLRGDVLRISLI--------------------------------------  1017
             A T +G   LGLRGD+LR+++I                                      
Sbjct  256   AATAVGAFALGLRGDLLRLAIIQAYTHLHEIHSPSSFFLLSPEICLNSNGCMHDTSPHDE  315

Query  1018  -----QAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGFLH  1167
                  QAALPQS+ +FV+AKEYGLHA+ILSTAV  GTL S+P+LI YY++LGF+ 
Sbjct  316   TARDEQAALPQSITTFVFAKEYGLHAEILSTAVIFGTLASLPVLIVYYIVLGFIR  370



>ref|XP_006646264.1| PREDICTED: auxin efflux carrier component 1-like [Oryza brachyantha]
Length=312

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 135/365 (37%), Positives = 195/365 (53%), Gaps = 63/365 (17%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             M+ W ++Y V+ A  PLYVA+ L Y S++ W +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MVSWIDIYLVLEATLPLYVAMILAYISIKWWKLFTPEQCSGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + +D + K+L +   AA +           +T FSLSTL NTLIVG+PL
Sbjct  61    ATNPYDMNIKLIYSDILQKSLALLGFAAISKACCAEKFDWLITGFSLSTLPNTLIVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LR MYG+    L+ Q  V+Q+L+           W+T        R A   A+  S    
Sbjct  121   LRGMYGEQAVKLLSQIVVLQSLI-----------WYTLLVFVFELRAAKGMASTTS----  165

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                                     +E+T                        G+ WAL++
Sbjct  166   ------------------------SETT------------------------GIIWALIS  177

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW ++LP I+  SI I+S  G G+AMFS+GLF ALQ  I+ CGA    L++ +RF +GP
Sbjct  178   FRWHIELPLIVINSIRILSDGGLGMAMFSLGLFTALQTKIIACGAKKMLLSLAIRFFLGP  237

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   I     G+RG +L+I+++QAALPQ +  FV+AKEY +HADILSTA+ +G +V+VP+
Sbjct  238   ALMGISSYATGMRGALLKIAIVQAALPQGIVPFVFAKEYNVHADILSTAIIVGMMVAVPV  297

Query  1132  LITYY  1146
              + YY
Sbjct  298   ALAYY  302



>gb|AGV28597.1| auxin efflux carrier 9 [Oryza sativa Indica Group]
Length=426

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 142/426 (33%), Positives = 218/426 (51%), Gaps = 56/426 (13%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   EVY+VV AMAPLY A ALGY SVR    F  +QC  IN F   + +P   F  ++
Sbjct  1     MITGSEVYQVVEAMAPLYTAAALGYGSVRWLKAFSNEQCAGINHFVALYAVPVLIFDMVS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKK--------------GSLSCSVTAFS  369
               N Y +N   ++AD + K +++  L AWA + +                 L   +T FS
Sbjct  61    TNNVYKMNGRLIAADTLQKAVLLLGLMAWALWERSRARGAGAKAKAAVSSPLQWVITCFS  120

Query  370   LSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSR  549
             +++L NT+I+GVPLL  MYG +  DL+ Q  V+Q  +W+  ++F  ++   R   +    
Sbjct  121   VASLPNTIIMGVPLLNGMYGPVSKDLMKQIVVMQFCIWYNVIIFLYEYMAARRSASAPPP  180

Query  550   VAGAGAARDSHGSSVQMAGDVEANNNNETN------------------TYSDDSAVTEST  675
              +  G+A+ S  S V+ A      N N                     + + D    E+T
Sbjct  181   ASSEGSAKISPSSPVKAAAAAADTNGNAVAADRPQEVAVNIEITEMAASTARDGVSGETT  240

Query  676   ------------------------SVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWD  783
                                     S+  ++   +  L Q PN+YA FLGL W+L+A +  
Sbjct  241   AAAKEVSSGEVAPVEEEEASAPAPSMKHVIWMAVKKLLQIPNTYASFLGLIWSLIAFKCG  300

Query  784   LQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTL  963
               +P I+E S+  +     G++MFS G FIA Q   V CG  + + +MV++F++GP   L
Sbjct  301   FSMPKIVEDSLFTIRTTAVGLSMFSSGTFIARQSRFVPCGYKIASFSMVIKFLIGPVVML  360

Query  964   IGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITY  1143
                LV+G+ G +L I+++QAALP ++ SFVYA+EY +HADI+ T V +G  +S+P+ I Y
Sbjct  361   FASLVIGMHGTLLHIAVVQAALPLAVTSFVYAEEYKVHADIMGTGVILGIFISLPVTIVY  420

Query  1144  YVILGF  1161
             Y++LG 
Sbjct  421   YILLGL  426



>ref|XP_006600903.1| PREDICTED: putative auxin efflux carrier component 5-like isoform 
X3 [Glycine max]
Length=348

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 132/352 (38%), Positives = 199/352 (57%), Gaps = 14/352 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY VV A  PLYV + L Y SV+ W +F P+QC  IN+F   F +P  +FQ ++
Sbjct  1     MISLADVYHVVTATVPLYVTMFLAYISVKWWKLFNPEQCSGINKFVANFSVPILSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               N Y ++   + AD V K L      A      +G L   +T  SLSTL NTLI+G+PL
Sbjct  61    SNNIYKMSLKLVYADVVQKLLAFLVFTAIIRIKGRGGLKWIITGLSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFTRTHPTTSSRVAGAGAARDSH  582
             ++AMY D  + L+ Q   +Q++VW+  LLF  +       RT P  +      G +  S 
Sbjct  121   MKAMYRDEASLLLPQIIFLQSMVWYNLLLFLHELDAAIPARTMPVVAPPSQDTGESETSL  180

Query  583   GSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWA  762
                +Q   + E    + T +          T +L ++M V + L  NPN+YA F+GL WA
Sbjct  181   --EIQSKEEEEEEAEHRTQS---------KTRMLLILMKVGNKLIINPNTYATFIGLIWA  229

Query  763   LLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFI  942
              +  RW + +P ++  SI I++  G G+A FS+GLF+A    ++ CG  +T +AM L+F+
Sbjct  230   SIHFRWGVDMPDVVNQSIEILASGGLGMATFSLGLFMASNNRVIVCGPRMTLVAMGLKFL  289

Query  943   VGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTA  1098
             VGPA   +  +V+GLR  +L++++IQAALPQ +  FV+A+EY ++  ILST 
Sbjct  290   VGPAIMAVASIVIGLRDRMLKVAIIQAALPQGIVPFVFAREYNVNPGILSTG  341



>gb|KCW84567.1| hypothetical protein EUGRSUZ_B01406, partial [Eucalyptus grandis]
Length=285

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 130/293 (44%), Positives = 175/293 (60%), Gaps = 9/293 (3%)
 Frame = +1

Query  52   MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
            MIGW ++YKVVV+M PLYV L LGY SV+ W +F  DQCD INRF   F++P F F F A
Sbjct  1    MIGWGDMYKVVVSMFPLYVPLMLGYSSVKWWRLFSHDQCDGINRFISLFILPLFGFGFTA  60

Query  232  HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
            HINP+ +N+  L+AD ++K   ++ LA W  F+ +GS S  +T FSL TL N L+VGVP+
Sbjct  61   HINPFAMNFRLLAADGLSKLATLSILALWGRFSSRGSYSWCITTFSLCTLPNLLVVGVPM  120

Query  412  LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
            L+AMYG    DL VQ  ++Q+L+W+  +L  L+F   R        +A            
Sbjct  121  LQAMYGKWAVDLAVQLCMLQSLIWYPLVLLFLEFRKRRMM-----DLATPPPPPLEENGV  175

Query  592  VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
            V    D+  +  N +    DD    E  S  +  M V   +A NPN YA  LGL WAL+A
Sbjct  176  VDEERDIGMSVVNTSEVGGDD---LEKRSRGTFQM-VWIKMAMNPNVYANVLGLAWALMA  231

Query  772  SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMV  930
            SR    +PSI+EGSI IMSK G+G AMF++G+F+A+Q  ++ CG     L MV
Sbjct  232  SRLKFTMPSIMEGSIEIMSKGGTGTAMFNIGIFMAMQTKVIACGTGPAVLGMV  284



>ref|XP_006286843.1| hypothetical protein CARUB_v10003844mg [Capsella rubella]
 gb|EOA19741.1| hypothetical protein CARUB_v10003844mg [Capsella rubella]
Length=370

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/376 (35%), Positives = 209/376 (56%), Gaps = 16/376 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++Y VV A  PLYV++ LGY + +   +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWLDIYHVVSATVPLYVSMILGYVAAKHLELFTPEQCAGINKFVAKFSIPLLSFQIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCS------VTAFSLSTLTNTL  393
               NP+ ++   + +D + K L +  L     F               +T  S+S   NTL
Sbjct  61    QNNPFKMSLKLILSDVLQKFLALVVLGLVLRFWHPTGGRGGGKLGWVITGLSISVFPNTL  120

Query  394   IVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTR--THPTTSSRVAGAGA  567
             I+G+P+L A+YGD    ++ Q  V+Q+L+W++ LLF  +    R  T P  SS +     
Sbjct  121   ILGIPILTAIYGDEAESILRQIVVLQSLIWYSILLFLFELNAARAKTSPGASSNI-----  175

Query  568   ARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFL  747
                 H  +++     E     E          T ST  + +++     L  NPN+YA  +
Sbjct  176   ---DHAVNIEEEPKEEEEEEEEEEEEEAAIVRTRSTGTMKVVLKAWRKLIINPNTYATLI  232

Query  748   GLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAM  927
             G+ WA+L  R   +LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CGA +  + M
Sbjct  233   GIIWAILHFRLGWKLPEMIDKSIHMISDGGLGMAMFSLGLFMASQTSIIACGAKMAMITM  292

Query  928   VLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTI  1107
             +L+F++GPA  +       LRG++ +++++QAALPQ +  FV+AKEY LH +I+ST V  
Sbjct  293   ILKFVLGPALMIASVFSFRLRGNLFKVAILQAALPQGVVPFVFAKEYNLHPEIVSTGVIF  352

Query  1108  GTLVSVPLLITYYVIL  1155
             G L+++P  + YY +L
Sbjct  353   GMLIALPTTLAYYFLL  368



>ref|XP_006400028.1| hypothetical protein EUTSA_v10016062mg [Eutrema salsugineum]
 gb|ESQ41481.1| hypothetical protein EUTSA_v10016062mg [Eutrema salsugineum]
Length=362

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/376 (35%), Positives = 215/376 (57%), Gaps = 24/376 (6%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++Y VV A  PLYV++ LGY S +   +F  +QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWLDIYHVVSATVPLYVSMFLGYLSAKNLKLFSLEQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAA----W-ANFTKKGSLSCSVTAFSLSTLTNTLI  396
               NP+ ++   + +D + K L +   AA    W     + G L   +T  S+S L NTLI
Sbjct  61    QNNPFTMSPRLILSDILQKILAVVVFAAVLRSWHPTGGRGGKLGWIITGLSVSVLPNTLI  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             +G+P+L A+ GD   + +VQ  ++Q+L+W+  LLF  +                  AAR 
Sbjct  121   IGIPILSAIDGDAAVNFLVQIVMLQSLIWYNILLFLFEI----------------NAART  164

Query  577   --SHGSSVQMAGDVEANNNNETNTYSDDSAV-TESTSVLSLMMPVLSNLAQNPNSYACFL  747
               S G+S++  G+ EA+   E     +++ V T S+    +++        NPN+YA  +
Sbjct  165   IISSGASIEHRGNEEADIEQEPKEEEEEAIVRTRSSGTGKILLKAWRKFITNPNTYATLV  224

Query  748   GLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAM  927
             GL W+ L  R   +LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CG  +  + M
Sbjct  225   GLIWSALHFRLGWKLPGMIDKSIHLISDGGLGMAMFSLGLFMASQSSIIACGTKMAIITM  284

Query  928   VLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTI  1107
             +L+F++GP   +     + LR  + R++++QAALPQ +  FV+AKEY ++ +I+ST V I
Sbjct  285   LLKFLLGPGLMIASAFCIRLRSTLFRVAILQAALPQGIVPFVFAKEYNVYPEIVSTGVII  344

Query  1108  GTLVSVPLLITYYVIL  1155
             G L+++P+ + YY +L
Sbjct  345   GMLITLPITLAYYFVL  360



>ref|XP_004973987.1| PREDICTED: probable auxin efflux carrier component 4-like [Setaria 
italica]
Length=335

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 151/351 (43%), Positives = 194/351 (55%), Gaps = 38/351 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W +VYKVV AMAPLY AL LGY SVR   +F P+QC AIN     F +PFF F F+A
Sbjct  1     MIAWGDVYKVVAAMAPLYFALGLGYGSVRWCRLFTPEQCGAINTLVAHFSMPFFTFDFLA  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSL------------SCSVTAFSLS  375
               NPY ++   L+ADA +K L IAA+A W  + +                S  VT FSL+
Sbjct  61    RANPYAMDRRVLAADAASKALTIAAVACWWWWARCCRCGAGGAKDAGARSSWCVTGFSLA  120

Query  376   TLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF---WFTRTHPTTSS  546
                NTL+VGVPLL AMYG    DLVVQ AV+Q LVW   LL   +    W  R       
Sbjct  121   AFNNTLVVGVPLLDAMYGAWARDLVVQLAVVQALVWVPLLLLGFELRKAWVVRN------  174

Query  547   RVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNP  726
                G  +A    G +    G VE                  S ++  ++  V   LA NP
Sbjct  175   ---GIASAAAGDGQAAAGGGRVEP--------------AVSSQALWPIVRTVGLKLAGNP  217

Query  727   NSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGA  906
             N YA  LG+ WA +A RWDL++P ++  S+ +MS+ G+G++MFSMGLF+A QE IV CGA
Sbjct  218   NVYASVLGVVWACIAFRWDLRMPGVVSESLQVMSRTGTGMSMFSMGLFMAQQEKIVACGA  277

Query  907   SVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYA  1059
              + AL M LRF+ GP  TL G    GLR DV+R ++IQ  +    AS ++A
Sbjct  278   GLAALGMALRFVAGPLATLAGAAAFGLRSDVMRFAIIQDQVSVKNASVLFA  328



>ref|XP_004970283.1| PREDICTED: probable auxin efflux carrier component 5-like [Setaria 
italica]
Length=423

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 141/424 (33%), Positives = 219/424 (52%), Gaps = 57/424 (13%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY VV AMAPLY A  LGY SVR    F  +QC  IN F   + +P   F  ++
Sbjct  1     MIPGSAVYHVVEAMAPLYTAAVLGYASVRWLKAFSDEQCAGINHFVALYAVPVLIFHMVS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWA---NFTKK-----------GSLSCSVTAFS  369
               +PYH+N   ++AD + K +++ AL AWA   +F ++             +   VT FS
Sbjct  61    SNDPYHMNERLIAADTLQKAVMLLALTAWAFWAHFRRRRGGDGKAAAAASPIKWVVTNFS  120

Query  370   LSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSR  549
             +++L NT+I+GVPLL  MYG +   L+ Q  V+Q  +W+  ++F  +F   R      S 
Sbjct  121   VASLPNTIIMGVPLLDGMYGSVSGGLMKQIVVMQFCIWYNVVIFLYEFMAARDGSAKISP  180

Query  550   VAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTE--------------------  669
             V+ A A  +      +  G + A  +   N    +  +TE                    
Sbjct  181   VSAAAAPAEKRDRIGENGGSIHAERSQ--NQVVVNIEITEVAAAADASPTAPPESGAEEA  238

Query  670   ---------------------STSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDL  786
                                     V+ ++   +  L Q PN+YA FLGL W+L+A +   
Sbjct  239   AAAAAAAEEVAAVPPPAPAQQVPPVMHVVWMAVKKLLQIPNTYASFLGLIWSLMAFKIGF  298

Query  787   QLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLI  966
              +P I++ S+  +     G++MF+ G FIA Q   V CG ++ +L+MVL+F++GP   L+
Sbjct  299   SMPKIVDDSLFTIHTTAVGLSMFASGTFIARQSRFVPCGYTIASLSMVLKFLIGPVIMLL  358

Query  967   GCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYY  1146
               L +G+ G +L I+++QAALP ++ SFVYA+EY +HADI+ST V +G  +S+P+ I YY
Sbjct  359   VSLAIGMHGTLLHIAVVQAALPLAVTSFVYAEEYKVHADIMSTGVILGIFISLPVTIVYY  418

Query  1147  VILG  1158
             ++LG
Sbjct  419   ILLG  422



>emb|CDX85565.1| BnaA02g02480D [Brassica napus]
Length=362

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 132/378 (35%), Positives = 209/378 (55%), Gaps = 28/378 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             M+ W +VY V  A  PLYV++ LGY S +  ++F  +QC  IN+F   F IP  +FQ ++
Sbjct  1     MVSWLDVYNVFSATVPLYVSMILGYLSTKHLNLFSLEQCVGINKFIAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLI  396
               NP+ ++   + +D + K L    LA    F        G L   +T  S++   NTLI
Sbjct  61    QNNPFTMSLRLILSDILQKILAAVVLAVVIRFWHPKGGTGGKLGWIITGLSVTVFPNTLI  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             +G+P+L A+ GD   +++VQ  V+Q L+W   LLF  +                A     
Sbjct  121   IGIPILSAIDGDAAKNILVQIVVLQCLIWSNILLFLFEI--------------NATWDLQ  166

Query  577   SHGSSVQMAGDVEANNNNETNTYSD---DSAV--TESTSVLSLMMPVLSNLAQNPNSYAC  741
             S G+S++       N+N ET+   +   + A+  T S+    +++        NPN+YA 
Sbjct  167   SSGASIEH----RVNDNEETDIEQEPIEEEAIVRTRSSGTGKIILKAWRKFIVNPNTYAA  222

Query  742   FLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTAL  921
              +GL WA L  R   +LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CG  ++ +
Sbjct  223   MIGLIWATLHFRLGWKLPEMIDKSIHLISDGGLGMAMFSLGLFMASQSSIIACGTKMSII  282

Query  922   AMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAV  1101
              M+L+FI+GPA  +     + LRG + R++++QA LPQ +  FV+AKEY ++ +I+ST V
Sbjct  283   TMILKFILGPALMIASAFCIRLRGTLFRVTILQATLPQGIVPFVFAKEYNVNPEIVSTGV  342

Query  1102  TIGTLVSVPLLITYYVIL  1155
               G LV VP+ + YY +L
Sbjct  343   IFGMLVFVPITLAYYFVL  360



>gb|KHN12058.1| Auxin efflux carrier component 2 [Glycine soja]
Length=333

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 144/370 (39%), Positives = 209/370 (56%), Gaps = 39/370 (11%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI  +EVY V+ A+ PLYV + L Y+SVR W +F P+QC  INRF   F IPF  F F++
Sbjct  1     MINDKEVYNVMAALVPLYVPMILAYYSVRWWKIFTPEQCSGINRFVAIFAIPFLTFHFLS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGS-LSCSVTAFSLSTLTNTLIVGVP  408
               +PY +N  F++AD + K +++ AL  W  F K+G  L  ++T FSLSTL NTLIVGVP
Sbjct  61    SNSPYTMNILFIAADTLQKVVILGALFLWTAFAKRGGGLDWTITLFSLSTLPNTLIVGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             LL AMYGD  A L+ Q   +Q ++WFT +LF  +  +        +R+  +G   DS  +
Sbjct  121   LLTAMYGDSSASLMSQLVFMQGVLWFTLMLFLYE--YQGAMHLFLNRIPDSG---DSIIT  175

Query  589   SVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
             +  +  DV   N NE                     P+L +L +  N      G    ++
Sbjct  176   TFTVDPDVNTLNGNE---------------------PLLVDLEKKEN------GELHVMV  208

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
              S          E     + K  +        LF+ALQ  I+ CG +  A+++V R +VG
Sbjct  209   RSSSLKIFNRSTEMCCAHLPKRRAS------SLFMALQPKIIACGKTSAAMSIVARCLVG  262

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             PA   +  +V+G+RG +LR++++QAA+PQS+ +FV+AKEY +HADILSTAV  GT +S+P
Sbjct  263   PAVIGVTSIVIGIRGVLLRVAIVQAAIPQSIVAFVFAKEYNIHADILSTAVIFGTAISLP  322

Query  1129  LLITYYVILG  1158
               I Y+V+LG
Sbjct  323   ATIMYFVLLG  332



>ref|XP_006644857.1| PREDICTED: probable auxin efflux carrier component 5-like [Oryza 
brachyantha]
Length=426

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 145/426 (34%), Positives = 221/426 (52%), Gaps = 58/426 (14%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   EVY VV AM PLY A ALGY SVR    F  +QC  IN F   + +P   F  ++
Sbjct  1     MITGSEVYAVVEAMVPLYTAAALGYASVRWLKAFSNEQCAGINHFVALYAVPVLIFDMVS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKK------------GSLSCSVTAFSLS  375
               + Y +N   ++AD + K +++  L AWA + +               L   +T FS++
Sbjct  61    TNDIYKMNGRLVAADTLQKAVLLLGLMAWALWERSRRRAGAKGAAAPSPLQWVITCFSVA  120

Query  376   TLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVA  555
             +L NT+I+GVPLL  MYG +  +L+ Q  V+Q  +W+  ++F  ++         +   A
Sbjct  121   SLPNTIIMGVPLLNGMYGPVSKELMKQIVVMQFCIWYNVVIFLYEY-MAARRAAAAPAPA  179

Query  556   GAGAARDSHGSSVQM-------------AGDVEANNNNET-----------NTYSD----  651
               G A+ S  S V+              AG+V A+   E            +T  D    
Sbjct  180   LDGCAKISPSSPVKAAAAEKGAAPEANGAGNVAADRPQEVAVSIEITEMTASTARDGFPG  239

Query  652   -------------DSAVTESTSVLSLMMPVL----SNLAQNPNSYACFLGLFWALLASRW  780
                          D+ V E+++    M  V+      L Q PN+YA FLGL W+L+A +W
Sbjct  240   ETAAAAKEASDGADATVEEASAPAPSMKHVVWMAVKKLLQIPNTYASFLGLIWSLIAFKW  299

Query  781   DLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATT  960
                +P I+E S+  +     G++MFS G FIA Q   V CG  + + +MV++F++GP   
Sbjct  300   GFTMPKIVEDSLFTIRTTAVGLSMFSSGTFIARQSRFVPCGYKIASFSMVIKFLIGPVVM  359

Query  961   LIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLIT  1140
             L   LV+G+ G +L I+++QAALP ++ SFVYA+EY + ADI+ST V +G  +S+P+ I 
Sbjct  360   LFASLVIGMHGTLLHIAVVQAALPLAVTSFVYAEEYKVQADIMSTGVILGIFISLPVTIV  419

Query  1141  YYVILG  1158
             YY++LG
Sbjct  420   YYILLG  425



>ref|XP_008673109.1| PREDICTED: uncharacterized protein LOC100381964 isoform X2 [Zea 
mays]
Length=299

 Score =   218 bits (556),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 161/267 (60%), Gaps = 11/267 (4%)
 Frame = +1

Query  355   VTAFSLSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHP  534
             +T FSLSTL NTLIVG+PLL+ MYGD    L+ Q   +Q+L+W+T LLF  +F   R   
Sbjct  39    ITGFSLSTLPNTLIVGIPLLKGMYGDEAVKLLSQIVALQSLIWYTLLLFLFEFRAARGMA  98

Query  535   TTSSRVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNL  714
              T+S  A   A   + G   Q          +E       SA          ++ V   L
Sbjct  99    ITTSSEAIDEAESGTPGPMQQ---------GHEEGQAKGVSA--RCYGAFHFLLVVSRKL  147

Query  715   AQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIV  894
               NPN YA   GL WAL++ RW +QLPSI+  SI I+S  G G+AMFS+G+F ALQ  IV
Sbjct  148   VTNPNMYASLAGLIWALISFRWRIQLPSIVNNSIRILSDGGLGMAMFSLGVFTALQTKIV  207

Query  895   ECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGL  1074
              CG     L++ +RF +GP   +I   ++G+RG +L++++IQAALPQ +  FV+AKEY +
Sbjct  208   ACGTKRMLLSLGIRFFLGPGLMVISSYLIGMRGTLLKVAIIQAALPQGIVPFVFAKEYNV  267

Query  1075  HADILSTAVTIGTLVSVPLLITYYVIL  1155
             HADILSTA+ +G +V+VP+ + YY ++
Sbjct  268   HADILSTAIILGMMVAVPVALGYYFVM  294



>ref|XP_009126029.1| PREDICTED: putative auxin efflux carrier component 5 [Brassica 
rapa]
Length=361

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/377 (35%), Positives = 208/377 (55%), Gaps = 27/377 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             M+ W +VY V  A  PLYV++ LGY S +  ++F  +QC  IN+F   F IP  +FQ ++
Sbjct  1     MVSWLDVYNVFSATVPLYVSMILGYLSTKHLNLFSLEQCVGINKFIAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAA----WANFTKKGSLSCSVTAFSLSTLTNTLIV  399
               NP+ ++   + +D + K L     A     W      G L   +T  S++   NTLI+
Sbjct  61    QNNPFTMSLRLILSDILQKILAAVVFAVVIRFWHPTGGGGKLGWIITGLSVTVFPNTLII  120

Query  400   GVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDS  579
             G+P+L A+ GD   +++VQ  V+Q L+W   LLF  +                A     S
Sbjct  121   GIPILSAIDGDAAKNILVQIVVLQCLIWSNILLFLFEI--------------NATWDLQS  166

Query  580   HGSSVQMAGDVEANNNNETNTYSD---DSAV--TESTSVLSLMMPVLSNLAQNPNSYACF  744
              G+S++       N+N ET+   +   + A+  T S+    +++        NPN+YA  
Sbjct  167   SGASIEH----RVNDNEETDIDQEPIEEEAIVRTRSSGTGKIILKAWRKFIVNPNTYAAM  222

Query  745   LGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALA  924
             +GL WA L  R   +LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CG  ++ + 
Sbjct  223   IGLIWATLHFRLGWKLPEMIDKSIHLISDGGLGMAMFSLGLFMASQSSIIACGTKMSIIT  282

Query  925   MVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVT  1104
             M+L+FI+GPA  +     + LRG + R++++QA LPQ +  FV+AKEY ++ +I+ST V 
Sbjct  283   MILKFILGPALMIASAFCIRLRGTLFRVTILQATLPQGIVPFVFAKEYNVNPEIVSTGVI  342

Query  1105  IGTLVSVPLLITYYVIL  1155
              G LV VP+ + YY +L
Sbjct  343   FGMLVFVPITLAYYFVL  359



>ref|XP_010686765.1| PREDICTED: probable auxin efflux carrier component 1b isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 136/369 (37%), Positives = 205/369 (56%), Gaps = 51/369 (14%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W+++Y V+  + PLYV +   Y SV+ W +F P++   INRF   F +P  + +F++
Sbjct  1     MISWKDLYNVLSNVVPLYVVMISAYGSVKWWKIFTPNEISGINRFVALFAVPLLSIKFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             + NPY +N+ F+ AD + K +VI  L  W   + KGSL   +T FSLS L NTL+VG+PL
Sbjct  61    NNNPYAMNFRFILADTLQKLIVILLLFIWCKLSSKGSLEWCITLFSLSALPNTLVVGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             L  MY          ++V++                   H  T                 
Sbjct  121   LGGMYES--------SSVLK----------------VEVHVET-----------------  139

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                   V       TNT     +VT       +++ V   L +NPN Y+  + L W+L++
Sbjct  140   ------VAECKPKSTNTLPAVGSVTTR----QILIMVCKKLMRNPNFYSSLVALTWSLIS  189

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +++P+++  SI I S  G G+AMFS+GLF+A Q  I+  G+++ ALA  +RFIVGP
Sbjct  190   FRWHVEIPAVVANSIKIFSDTGLGMAMFSLGLFMASQPKIISGGSALAALAAAMRFIVGP  249

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A T      +GLRG +L+I ++QAALPQ++ SFV+A EY +H  +LSTAV+ G L+S+P+
Sbjct  250   AITAATSSAIGLRGTLLQIIIMQAALPQAIVSFVFAHEYNVHPGVLSTAVSFGMLISLPI  309

Query  1132  LITYYVILG  1158
              + YY+ILG
Sbjct  310   TLVYYIILG  318



>gb|EEE55544.1| hypothetical protein OsJ_03782 [Oryza sativa Japonica Group]
Length=413

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 135/413 (33%), Positives = 209/413 (51%), Gaps = 56/413 (14%)
 Frame = +1

Query  91    MAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLS  270
             MAPLY A ALGY SVR    F  +QC  IN F   + +P   F  ++  N Y +N   ++
Sbjct  1     MAPLYTAAALGYGSVRWLKAFSNEQCAGINHFVALYAVPVLIFDMVSTNNVYKMNGRLIA  60

Query  271   ADAVAKTLVIAALAAWANFTKK--------------GSLSCSVTAFSLSTLTNTLIVGVP  408
             AD + K +++  L AWA + +                 L   +T FS+++L NT+I+GVP
Sbjct  61    ADTLQKAVLLLGLMAWALWERSRARGAGAKAKAAVSSPLQWVITCFSVASLPNTIIMGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             LL  MYG +  DL+ Q  V+Q  +W+  ++F  ++   R         +  G+A+ S  S
Sbjct  121   LLNGMYGPVSKDLMKQIVVMQFCIWYNVIIFLYEYMAARRSALGPLPASSEGSAKISPSS  180

Query  589   SVQMAGDVEANNNNETN------------------TYSDDSAVTEST-------------  675
              V+ A      N N                     + + D    E+T             
Sbjct  181   PVKAAAAAADTNGNAVAADRPQEVAVNIEITEMAASTARDGVSGETTAAAKEVSSGEVAP  240

Query  676   -----------SVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVI  822
                        S+  ++   +  L Q PN+YA FLGL W+L+A +    +P I+E S+  
Sbjct  241   VEEEEAFAPAPSMKHVIWMAVKKLLQIPNTYASFLGLIWSLIAFKCGFSMPKIVEDSLFT  300

Query  823   MSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVL  1002
             +     G++MFS G FIA Q   V CG  + + +MV++F++GP   L   LV+G+ G +L
Sbjct  301   IRTTAVGLSMFSSGTFIARQSRFVPCGYKIASFSMVIKFLIGPVVMLFASLVIGMHGTLL  360

Query  1003  RISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGF  1161
              I+++QAALP ++ SFVYA+EY +HADI+ST V +G  +S+P+ I YY++LG 
Sbjct  361   HIAVVQAALPLAVTSFVYAEEYKVHADIMSTGVILGIFISLPVTIVYYILLGL  413



>gb|KHG05246.1| Putative auxin efflux carrier component 5 [Gossypium arboreum]
Length=325

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/337 (38%), Positives = 190/337 (56%), Gaps = 25/337 (7%)
 Frame = +1

Query  118   LGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLSADAVAKTLV  297
             L Y SV+ W +F P+QC  IN+F   F IP  +FQ ++  NPY +N   + AD + K L 
Sbjct  3     LAYVSVKWWKLFTPEQCAGINKFVAKFSIPLLSFQVISENNPYKMNLKLILADFLQKLLA  62

Query  298   IAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNL  477
                L A    + +G LS  +T  SLST+ NTLI+G+PLLRAMYGD  A L+ Q  V+Q+L
Sbjct  63    FLVLFALTKLSSRGGLSSIITGLSLSTMPNTLILGIPLLRAMYGDKSATLLAQIVVLQSL  122

Query  478   VWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDS  657
             +W+  LLF  +   T+     +  V+ A       G            + NE+    D++
Sbjct  123   IWYNLLLFLFELNATKAASEITVAVSQA------SGPRRSTRERGRRRDTNESKEIQDNA  176

Query  658   AVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAG  837
                +S              A   + Y C+L        + W+++ P+I+E SI I+S  G
Sbjct  177   DFLDS-----------GEEANGESQYPCYL--------TWWNIKFPAIVEKSIAILSSGG  217

Query  838   SGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLI  1017
              G+AMFS+GLF+A + +I+ CG  + A+AM+++FI GPA        LGL+G +LR++++
Sbjct  218   LGMAMFSLGLFMASRPSIIACGIRMAAVAMIMKFIAGPALMAAASTTLGLKGKLLRVAIV  277

Query  1018  QAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             QAALPQ +  FV+AKEY +H DILST V  G L+++P
Sbjct  278   QAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALP  314



>gb|EEC71656.1| hypothetical protein OsI_04108 [Oryza sativa Indica Group]
Length=413

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/413 (33%), Positives = 210/413 (51%), Gaps = 56/413 (14%)
 Frame = +1

Query  91    MAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLS  270
             MAPLY A ALGY SVR    F  +QC  IN F   + +P   F  ++  N Y +N   ++
Sbjct  1     MAPLYTAAALGYGSVRWLKAFSNEQCAGINHFVALYAVPVLIFDMVSTNNVYKMNGRLIA  60

Query  271   ADAVAKTLVIAALAAWANFTKK--------------GSLSCSVTAFSLSTLTNTLIVGVP  408
             AD + K +++  L AWA + +                 L   +T FS+++L NT+I+GVP
Sbjct  61    ADTLQKAVLLLGLMAWALWERSRARGAGAKAKAAVSSPLQWVITCFSVASLPNTIIMGVP  120

Query  409   LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
             LL  MYG +  DL+ Q  V+Q  +W+  ++F  ++   R   +     +  G+A+ S  S
Sbjct  121   LLNGMYGPVSKDLMKQIVVMQFCIWYNVIIFLYEYMAARRSASAPPPASSEGSAKISPSS  180

Query  589   SVQMAGDVEANNNNETN------------------TYSDDSAVTEST-------------  675
              V+ A      N N                     + + D    E+T             
Sbjct  181   PVKAAAAAADTNGNAVAADRPQEVAVNIEITEMAASTARDGVSGETTAAAKEVSSGEVAP  240

Query  676   -----------SVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVI  822
                        S+  ++   +  L Q PN+YA FLGL W+L+A +    +P I+E S+  
Sbjct  241   VEEEEASAPAPSMKHVIWMAVKKLLQIPNTYASFLGLIWSLIAFKCGFSMPKIVEDSLFT  300

Query  823   MSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVL  1002
             +     G++MFS G FIA Q   V CG  + + +MV++F++GP   L   LV+G+ G +L
Sbjct  301   IRTTAVGLSMFSSGTFIARQSRFVPCGYKIASFSMVIKFLIGPVVMLFASLVIGMHGTLL  360

Query  1003  RISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGF  1161
              I+++QAALP ++ SFVYA+EY +HADI+ST V +G  +S+P+ I YY++LG 
Sbjct  361   HIAVVQAALPLAVTSFVYAEEYKVHADIMSTGVILGIFISLPVTIVYYILLGL  413



>ref|XP_002873708.1| pin-formed 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49967.1| pin-formed 8 [Arabidopsis lyrata subsp. lyrata]
Length=371

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/362 (36%), Positives = 201/362 (56%), Gaps = 32/362 (9%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI W ++Y VV A  PLYV++ LG+ S +   +F P+QC  IN+F   F IP  +FQ ++
Sbjct  1     MISWLDIYHVVSATVPLYVSMTLGFLSAKHIKLFSPEQCAGINKFVAKFSIPLLSFQIIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLI  396
               NPY ++   + +D + K L +  LAA   F      + G L   +T  S+S L NTLI
Sbjct  61    QNNPYKMSPKLILSDILQKILAVVVLAAVLRFWHPPGGRGGKLGWLITGLSISVLPNTLI  120

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARD  576
             +G+P+L A+YGD  A ++ Q  V+Q+L+W++ LLF  +                A  A  
Sbjct  121   LGIPILSAIYGDEAASILEQIVVLQSLIWYSILLFLFEL--------------NAARALP  166

Query  577   SHGSSVQMAGDVEANNNNETNTYSDDSAV---------TESTSVLSLMMPVLSNLAQNPN  729
             S G S++  G    N++ E N   +             T S   + +++     L  NPN
Sbjct  167   SSGPSLEHTG----NDHEEANIEEEPKEENEEEVAIVRTRSIGTMKILLKAWRKLIINPN  222

Query  730   SYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGAS  909
             +YA  +G+ WA L  R    LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CG  
Sbjct  223   TYATLIGIIWATLHFRLGWNLPEMIDKSIHLLSDGGLGMAMFSLGLFMASQSSIIACGTK  282

Query  910   VTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADIL  1089
             +  + M+L+F++GPA  +     + LR  + +++++QAALPQ +  FV+AKEY LH +I+
Sbjct  283   MAIITMLLKFVLGPALMIASAFCIRLRSTLFKVAILQAALPQGVVPFVFAKEYNLHPEII  342

Query  1090  ST  1095
             ST
Sbjct  343   ST  344



>ref|XP_002517471.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45013.1| conserved hypothetical protein [Ricinus communis]
Length=313

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 179/310 (58%), Gaps = 18/310 (6%)
 Frame = +1

Query  238   NPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPLLR  417
             NPY +N   + AD + K L    L A    + +G L+  +T  SLSTL NTLI+G+PLL+
Sbjct  20    NPYKMNLKLIFADFLQKLLAALVLLAITKISSRGRLNWIITGLSLSTLPNTLILGIPLLK  79

Query  418   AMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSSVQ  597
             AMYG   A+ + Q  V+Q+LVW+  LLF  +   T   P   S                +
Sbjct  80    AMYGA-EAEALSQIVVLQSLVWYNLLLFLFELNATYAAPVAPSS---------------E  123

Query  598   MAGDVEANNNNETNTYSDDS--AVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
               GD EA    ++    D++  + T     + +++ V   L +NPN +A  LGL WA + 
Sbjct  124   TTGDQEAPQEAQSKEEEDETNTSTTRRAKTMVILLTVGKKLLRNPNFHATLLGLIWASVH  183

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RWD++LP I++ SI I+S  G G+AMFS+GLF+A + NI+ CG  +  L+M ++FI GP
Sbjct  184   FRWDVKLPDIVDKSIRILSTGGLGMAMFSLGLFMASRPNIIACGVRMAVLSMSMKFISGP  243

Query  952   ATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPL  1131
             A   +  L +  RG V +++++QAALPQ +  FV+AKEY +H DILST V  G L+++P+
Sbjct  244   AIMAVAALAVRARGTVFKVAIVQAALPQGIVPFVFAKEYNIHPDILSTGVIFGMLIALPI  303

Query  1132  LITYYVILGF  1161
              + YY +L  
Sbjct  304   ALAYYSLLAL  313



>gb|AIF28463.1| PIN-like protein, partial [Nuphar advena]
Length=172

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = +1

Query  646   SDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIM  825
             ++ S  TE  SV ++M  V   LA NPNSYA  +G+ WA +++RW   +PS++EGS+ I+
Sbjct  1     NESSVKTEKPSVRTIMKVVWLKLALNPNSYASIVGVVWAFISNRWHFGMPSLMEGSVTIL  60

Query  826   SKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLR  1005
             SKAG G+AMFSMG+F+A QE  V CG S+    +VLRF+VGPA   I  +V+GLRG VLR
Sbjct  61    SKAGGGMAMFSMGVFMAQQEKFVACGPSLAVFGLVLRFVVGPAAMAIASIVVGLRGTVLR  120

Query  1006  ISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILG  1158
             +++IQAA+PQS+ SF+YA+EY LHA++LSTAV  G +V +PLLI YYVILG
Sbjct  121   VAIIQAAVPQSITSFIYAREYDLHAEVLSTAVIFGIIVCLPLLIAYYVILG  171



>gb|EMT10264.1| Putative auxin efflux carrier component 4 [Aegilops tauschii]
Length=244

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 161/255 (63%), Gaps = 21/255 (8%)
 Frame = +1

Query  421   MYGDLGADLVVQAAVIQNLVWFTFLLF---ALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             +YG    D++VQ +V+Q +VW   +L    A Q W   T P  + +      AR+     
Sbjct  3     VYGKWARDVIVQLSVLQAVVWLPLMLVVFEARQAWLEVT-PEPADQ-----GAREE----  52

Query  592   VQMAGDVEANNNN-ETNTYSDDSAVTESTSVL---SLMMPVLSNLAQNPNSYACFLGLFW  759
                 GD EA  ++      S D   T +T       L+  V   LA+NPN YA  LG+ W
Sbjct  53    ----GDQEAPGSDVHRPAASRDGRKTAATGCAFWAPLLRAVGVKLARNPNVYASLLGVAW  108

Query  760   ALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRF  939
             + +A+RW L++PSII+GSI IMSK   G+ MFSMG+FI LQ+  + CG  +T L++ LRF
Sbjct  109   SSVANRWHLKMPSIIDGSIAIMSKTCIGMGMFSMGMFIGLQDKFIVCGLGLTVLSLGLRF  168

Query  940   IVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLV  1119
             IV PA T+ G L+LGLRGD+LR++++QAALPQS+A+FV+++EY LHA +LSTAV + TL 
Sbjct  169   IVAPAATVAGALILGLRGDLLRVTILQAALPQSVATFVFSREYDLHAGVLSTAVIVSTLA  228

Query  1120  SVPLLITYYVILGFL  1164
             S+P+L  YY++LG +
Sbjct  229   SLPVLTAYYLVLGLV  243



>gb|EMS56676.1| putative auxin efflux carrier component 5 [Triticum urartu]
Length=453

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 134/390 (34%), Positives = 205/390 (53%), Gaps = 35/390 (9%)
 Frame = +1

Query  91    MAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLS  270
             MAPLY A  LGY SVR    F  +QC  IN F   + +P   F  ++  NPY +N   ++
Sbjct  1     MAPLYTAAVLGYASVRWLKAFSEEQCAGINHFVAIYAVPVLIFNMVSTNNPYAMNGRLVA  60

Query  271   ADAVAKTLVIAALAAWANFTKKG--------------------SLSCSVTAFSLSTLTNT  390
             AD + K +++  L AWA +  +                      L   VTAFS+++L NT
Sbjct  61    ADTLQKAVMLIGLVAWAAWESRSRRRRRSDGGGKASAAVAAASPLQWVVTAFSVASLPNT  120

Query  391   LIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQ-----------FWFTRTHPT  537
             +I+GVPLL  MYG +  DL+ Q  V+Q  V       A                 R H  
Sbjct  121   IIMGVPLLGGMYGAMSKDLMKQIVVMQFCVCPGSPGAAPSAEKIAPNDEAVVAAKRAHEV  180

Query  538   TS----SRVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVL  705
             T     + VA A  A+     +       E + + E    S   A + + SV  + +   
Sbjct  181   TVNIEITEVAPASTAQKDLADNTTTTVAKETSADAEAEQGSPPPAKSTAPSVTHIALMAG  240

Query  706   SNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQE  885
               + + PN+YA FLGL WAL+A +  +++P II+ S+  +     G++MF+ G FIA Q 
Sbjct  241   KKVLKIPNTYASFLGLIWALIAFKCGIKMPKIIDDSLFTIQTTAVGLSMFASGTFIARQS  300

Query  886   NIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKE  1065
               V CG ++ +++MVL+F++GP   L+  L +G+ G +L I+++QAALP ++ SFVYA+E
Sbjct  301   RFVPCGYAIASMSMVLKFLIGPVVMLLASLAIGMHGTLLHIAVVQAALPLAVTSFVYAEE  360

Query  1066  YGLHADILSTAVTIGTLVSVPLLITYYVIL  1155
             Y +HADI+ST V +G  +S+P+ I YY++L
Sbjct  361   YKVHADIMSTGVILGIFISLPVTIVYYILL  390



>gb|KHG05247.1| Putative auxin efflux carrier component 5 [Gossypium arboreum]
Length=315

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 185/338 (55%), Gaps = 37/338 (11%)
 Frame = +1

Query  118   LGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHLNYPFLSADAVAKTLV  297
             L Y SV+ W +F P+QC  IN+F   F IP  +FQ ++  NPY +N   + AD + K L 
Sbjct  3     LAYVSVKWWKLFTPEQCAGINKFVAKFSIPLLSFQVISENNPYKMNLKLILADFLQKLLA  62

Query  298   IAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNL  477
                L A    + +G LS  +T  SLST+ NTLI+G+PLLRAMYGD  A L+ Q  V+Q+L
Sbjct  63    FLVLFALTKLSSRGGLSSIITGLSLSTMPNTLILGIPLLRAMYGDKSATLLAQIVVLQSL  122

Query  478   VWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDS  657
             +W+  LLF  +   T+             AA +   +  Q +GD EA    +     +++
Sbjct  123   IWYNLLLFLFELNATK-------------AASEITVAVSQASGDEEAPEEAQGKEGGEET  169

Query  658   AV-TESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKA  834
                   +  + + + V   L  NPN++A  L                        I+S  
Sbjct  170   QTRARKSKTMLIFLTVGKKLMANPNTHATLLA-----------------------ILSSG  206

Query  835   GSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISL  1014
             G G+AMFS+GLF+A + +I+ CG  + A+AM+++FI GPA        LGL+G +LR+++
Sbjct  207   GLGMAMFSLGLFMASRPSIIACGIRMAAVAMIMKFIAGPALMAAASTTLGLKGKLLRVAI  266

Query  1015  IQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             +QAALPQ +  FV+AKEY +H DILST V  G L+++P
Sbjct  267   VQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALP  304



>ref|XP_010029287.1| PREDICTED: putative auxin efflux carrier component 5 isoform 
X2 [Eucalyptus grandis]
 gb|KCW56168.1| hypothetical protein EUGRSUZ_I01919 [Eucalyptus grandis]
Length=334

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 179/323 (55%), Gaps = 13/323 (4%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    VY  V A  PLY  + L + S+R W +F PDQC  IN+F   F IP  +FQ ++
Sbjct  1     MISLTNVYHCVAATVPLYATMFLAFISIRFWKLFTPDQCAGINKFVAKFSIPLLSFQVIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               NPY +N   + AD   K L I  +   A F   G L   +T  SLSTL NTLI+G+PL
Sbjct  61    STNPYKMNLRLVLADFAQKILAILIVGGVAKFRSGGGLRWIITGVSLSTLPNTLILGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
             LRAMYGD  A L+ Q   +Q+++W+  LLF  +   T+    T S  A    A      +
Sbjct  121   LRAMYGDEAASLIAQIVCLQSILWYNLLLFLFELNATKAASVTPSSEATGVTATTEEDET  180

Query  592   VQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLA  771
                  +++  N  +  T             L + + V  NL +NPN+YA  +G+ WA + 
Sbjct  181   KDGGDELKLRNGRKYET-------------LLIFLKVGKNLLRNPNTYATVMGVIWASIH  227

Query  772   SRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGP  951
              RW +++P+I+  SI+I+S+ G G+AMFS+GLF+A Q  IV CGA + A+AM  +FI GP
Sbjct  228   FRWGVEMPAIVSSSILILSEGGLGMAMFSLGLFMASQTRIVACGARLAAVAMAAKFIAGP  287

Query  952   ATTLIGCLVLGLRGDVLRISLIQ  1020
                 I  L +GLR  +L+++++Q
Sbjct  288   GLMAISSLAIGLRETLLKVAIVQ  310



>gb|KFK25746.1| hypothetical protein AALP_AA8G154200 [Arabis alpina]
Length=350

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/308 (35%), Positives = 170/308 (55%), Gaps = 32/308 (10%)
 Frame = +1

Query  271   ADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGDL  435
             +D + K   +  LAA   F      + G L   +T  S+S L NTLI+G+P+L A+ GD 
Sbjct  8     SDIIQKIFAVVVLAAVLRFWHPTGGRGGKLGWIITGLSISVLPNTLILGIPILNAIDGDE  67

Query  436   GADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSSVQMAGDVE  615
               + +VQ  V+Q+L+W+  LLF  +                A  A+ S G+S+Q  G   
Sbjct  68    AVNFLVQIVVLQSLIWYNILLFMFEL--------------NAARAKTSPGASIQHTG---  110

Query  616   ANNNNETNTYSDDSAV---------TESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALL  768
              N+N E N   +             T +T    +++     L  NPN+YA  +GL WA L
Sbjct  111   -NDNEEANIEQERKEEEEEEVAIVRTRTTGTGKILLKAWRKLIINPNTYATLIGLIWATL  169

Query  769   ASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVG  948
               R   +LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CG  +  + MVL+F++G
Sbjct  170   HFRLGWKLPPMIDKSIHLLSDGGLGMAMFSLGLFMASQSSIIACGTKLAIITMVLKFVLG  229

Query  949   PATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVP  1128
             P   +     + LRG++ ++++IQAALPQ +  FV+AKEY +H +I+ST V  G L+++P
Sbjct  230   PVLMIASAFCIRLRGNLFKVAIIQAALPQGVVPFVFAKEYNVHPEIVSTGVIFGMLIALP  289

Query  1129  LLITYYVI  1152
             + + YY +
Sbjct  290   ITLAYYFV  297



>ref|XP_006853068.1| hypothetical protein AMTR_s00038p00079560 [Amborella trichopoda]
 gb|ERN14535.1| hypothetical protein AMTR_s00038p00079560 [Amborella trichopoda]
Length=380

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/365 (34%), Positives = 199/365 (55%), Gaps = 40/365 (11%)
 Frame = +1

Query  73    YKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPYHL  252
             Y+++  M PLY+A+ L + SV+ W MF  +QC  IN+F   F  P  +F+ +   +PY +
Sbjct  5     YEILSTMVPLYLAMLLAFASVKWWRMFSDEQCSGINKFVANFAAPLLSFKIIYSNDPYKM  64

Query  253   NYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGD  432
             N+  + AD + K L++ AL  W   TK+GS    +T FS+STL NT+I+G+PLLRAMYG+
Sbjct  65    NHKLILADTMQKLLILFALMLWVKLTKRGSFDWMITLFSMSTLPNTVILGIPLLRAMYGE  124

Query  433   LGADLVVQAAVIQNLVWFTFLLFALQFWFTR--------THPTTSSRVAGAGAAR-----  573
                 ++ Q  V+Q +VW+ FLLF  +    +        T     S V     AR     
Sbjct  125   ESEQILFQIVVLQFVVWYPFLLFLYELREAKGAVGRRVSTAVINGSTVVLEVEARSETRM  184

Query  574   --------DSHGSSVQMAGD----VEAN---------NNNETNTYSDDSAVT-----EST  675
                     D  GS+  M G     VEA+         N  E    S +  V         
Sbjct  185   SSLSLATVDGQGSTTAMNGSVVLVVEASAKENSLGYLNGEEGTANSKEREVQVEAAPPQM  244

Query  676   SVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMF  855
              +++L++ V S + +NPN+Y+  LGL W L++ R+++++P I++ S+ I+S  G G++MF
Sbjct  245   RMINLLILVWSKVIKNPNTYSSILGLVWGLISFRFNIRMPKIVDKSVTILSVTGLGLSMF  304

Query  856   SMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQ  1035
             S+GLF+A Q N++ CG     +AM +RF        +  ++LGL+G++L+++++Q   P 
Sbjct  305   SLGLFMASQPNLMPCGKRNATIAMFVRFSFSVVVMSMCSILLGLQGNLLKVAIVQFCNP-  363

Query  1036  SLASF  1050
             S AS+
Sbjct  364   SYASY  368



>ref|XP_001765763.1| PIND AtPIN5-like auxin efflux carrier [Physcomitrella patens]
 gb|EDQ69354.1| PIND AtPIN5-like auxin efflux carrier [Physcomitrella patens]
Length=358

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 197/363 (54%), Gaps = 12/363 (3%)
 Frame = +1

Query  67    EVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMAHINPY  246
             + Y V+ A+ PLYVAL LGY S++ W +  P+Q   I+RFN    +P   F+ +A  NPY
Sbjct  6     QFYDVLCAVVPLYVALFLGYGSLKWWGVVTPEQSAGISRFNALIAMPPLIFEIIAFNNPY  65

Query  247   HLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPLLRAMY  426
              +N   ++A  ++  +V+  L AW   TK G+L   +T F LS + NT+IVG+P+L  +Y
Sbjct  66    TMNNRLIAAYCLSNGIVLVGLCAWVWCTKCGNLDWVITLFQLSVMPNTIIVGIPVLSPLY  125

Query  427   GDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSSVQMAG  606
                 +   + A  I  ++W    LF  +    R          G+ A R+S   +   +G
Sbjct  126   SVTESG--IAAIFIGQVLWLFPTLFLYELKEVRK---MGQPAVGSVAQRNSFSVANGESG  180

Query  607   DVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDL  786
                     E  T           ++  + + V   + Q P ++A  +G+ ++L+A RW  
Sbjct  181   ------TRENGTEHGHEMAPSQMNLKEMAIKVAKKMVQLPLTHATVMGIVYSLIAGRWGF  234

Query  787   QLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLI  966
                 I+  S+ IM +   G+ M+S+GLF+A Q+ +V     V       RFIVGP T  +
Sbjct  235   DPLRILRNSLDIMGRITLGLTMYSIGLFMAGQKKLV-ASWWVAFYGAFCRFIVGPGTMGV  293

Query  967   GCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYY  1146
               L+LGLRGD LR + +QAALPQ++ SFV+AK+Y LH D+ +TAV++ T+V +P+++ YY
Sbjct  294   ASLLLGLRGDTLRFAFLQAALPQAVISFVFAKDYNLHTDVFTTAVSLQTIVFMPIVLVYY  353

Query  1147  VIL  1155
              +L
Sbjct  354   TLL  356



>ref|XP_006661411.1| PREDICTED: probable auxin efflux carrier component 4-like [Oryza 
brachyantha]
Length=251

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = +1

Query  637   NTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSI  816
             +  S  +A     SV  L+  V   +A+NPN YA  LG+ WA + +RW +Q PSIIEGS+
Sbjct  75    DALSKLAAARARQSVWPLVRAVWLKVARNPNVYAGVLGVAWACVTNRWHVQTPSIIEGSV  134

Query  817   VIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGD  996
             +IMSK G G++MFSMGLF+ALQE I+ CGA  T L M LRF+ GP+ T +G   LGLRGD
Sbjct  135   LIMSKTGVGLSMFSMGLFMALQEKIIVCGAGPTVLGMALRFVAGPSATAVGAFALGLRGD  194

Query  997   VLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGFLH  1167
             +LR+++IQAALPQS+ +FV+AKEYGLHA++LSTAV  GTL S+P+LI YY++LGF+ 
Sbjct  195   LLRLAIIQAALPQSITTFVFAKEYGLHAEVLSTAVIFGTLASLPVLIVYYIVLGFIR  251


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 73/127 (57%), Gaps = 8/127 (6%)
 Frame = +1

Query  52   MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
            MIGW +VYKVV AMAPLY AL LGY SVR W +F PDQCD +NR   +F +PFF F F +
Sbjct  1    MIGWGDVYKVVAAMAPLYFALVLGYGSVRWWRLFTPDQCDTVNRLVAYFAVPFFGFDFAS  60

Query  232  HINPYHLNYPFLSADAVAKTLVIAA--------LAAWANFTKKGSLSCSVTAFSLSTLTN  387
             ++P+ L+Y  L+ADA++K     A         A W    +  ++   V   + + +TN
Sbjct  61   RVDPFALSYRVLAADALSKLAAARARQSVWPLVRAVWLKVARNPNVYAGVLGVAWACVTN  120

Query  388  TLIVGVP  408
               V  P
Sbjct  121  RWHVQTP  127



>ref|XP_006646411.1| PREDICTED: probable auxin efflux carrier component 5-like [Oryza 
brachyantha]
Length=420

 Score =   191 bits (486),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 131/418 (31%), Positives = 217/418 (52%), Gaps = 50/418 (12%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   +VY+VV AMAPLY + ALGY SVR + +F  +QC  INRF   + +P   F+ ++
Sbjct  1     MIKGSQVYQVVEAMAPLYTSAALGYASVRWFRVFSSEQCAGINRFVALYAVPALIFEMVS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAW-----ANFTKKGS--------LSCSVTAFSL  372
               + Y +N   ++AD + K  ++  LAAW     +   ++G         L   VT  S+
Sbjct  61    TNDIYKMNGRLVAADTLQKVALLLGLAAWALWERSRCRERGGTKPWVSSPLQWVVTCCSV  120

Query  373   STLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWF-----------  519
             + L N +++GV LL  +YG +  + V Q  ++Q  +W+  ++F  ++             
Sbjct  121   AALPNAIVIGVALLSGLYGPVAREFVKQIVIMQFCIWYNVVIFLYEYMAAARRASSAPAP  180

Query  520   ---TRTHPTTSSRVA----GAGAARDSHGSSV------QMAGDVEANN------------  624
                 R  P+          GAG+   +  S++      ++A ++E               
Sbjct  181   GGSARISPSPPVEAVAAENGAGSTNANGASNIAAERPQELAVNIENTELATAAAPAARDG  240

Query  625   -NNETNTYSDDSAVTESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSI  801
               + T T + +     + S+  ++   +  + Q PN+YA  LG+FWAL++ ++ + +P I
Sbjct  241   LPDGTATTTSEEVSAPAPSMKQVVWMAVKKVLQIPNTYASLLGIFWALISFKYGIVMPKI  300

Query  802   IEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVL  981
             I  S+  +     G+ MFS G FIA Q  +V CG    + AM+L+F+VGP   L+  L +
Sbjct  301   IADSLFTIRTTAVGLGMFSSGTFIARQSRLVPCGYKTASFAMILKFLVGPVAMLLASLAV  360

Query  982   GLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVIL  1155
             G+ G  LRI ++QAALP SL SFVYA+EY ++ DI+ST V +   +S+P+ I Y ++L
Sbjct  361   GIHGTFLRIVVVQAALPLSLTSFVYAEEYKVYPDIMSTGVILAMFISLPVAILYSILL  418



>ref|XP_010906423.1| PREDICTED: auxin efflux carrier component 7-like [Elaeis guineensis]
Length=330

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 120/337 (36%), Positives = 185/337 (55%), Gaps = 22/337 (7%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI    + +VV AMAPLY A+ LGY +VR WH   PDQC  INRF   F IP   F  ++
Sbjct  1     MISASSLDRVVEAMAPLYAAMTLGYGAVRWWHALTPDQCTGINRFVSVFAIPLLTFHLLS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKG-------SLSCSVTAFSLSTLTNT  390
               +PY +N  FL+AD+  K L++  L  WA    +        SL   +T FSL+TL NT
Sbjct  61    SNDPYAMNPRFLAADSCQKLLLLTILFIWARLRPRSATGASSSSLPWVITIFSLATLPNT  120

Query  391   LIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAA  570
             +++G+PLLR MYG     L+VQ  V+Q  VW+  ++F  ++   R   T        G  
Sbjct  121   VVMGIPLLRGMYGPQTDALMVQIVVLQAAVWYNLVIFLYEYMAARCAATE-------GCQ  173

Query  571   RDSHGSSVQMAGDVEAN---NNNETNTYSDDSAVTESTSVLSLMMPVLS----NLAQNPN  729
              D    +++   + EA     N       +  A+    S  S+ + +L+     L + PN
Sbjct  174   PDGSVPTLRPMSEKEAAVAAFNGHLVEEGEGEAIKLPPSPPSMWV-ILTVAGRKLCRIPN  232

Query  730   SYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGAS  909
             ++A F GL W+ +A  + +++P II+ S+ I+S    G++MF++G F+A Q  ++ CG S
Sbjct  233   THASFFGLIWSFIAFGFGIKMPKIIDDSVTIISGTAIGLSMFNIGTFMAKQTRLISCGYS  292

Query  910   VTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQ  1020
             V A AMV++F VGP+  ++  L  GL+  +LR+++IQ
Sbjct  293   VAAFAMVIKFFVGPSIMIVTSLAFGLQDLLLRVAIIQ  329



>ref|NP_001267522.1| uncharacterized protein LOC100781239 [Glycine max]
 gb|AGJ95064.1| PIN7a [Glycine max]
Length=492

 Score =   192 bits (489),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 134/179 (75%), Gaps = 1/179 (1%)
 Frame = +1

Query  628   NETNTYSDDSAVTESTSVLSLMMP-VLSNLAQNPNSYACFLGLFWALLASRWDLQLPSII  804
              E + Y     +   + +  L++  V  NL +NPN+YAC LGL W+L++ RW++++PSI 
Sbjct  314   EEGDAYKKQQQMPRGSVMTRLVLTMVWRNLIRNPNTYACVLGLAWSLISFRWNIKMPSIA  373

Query  805   EGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLG  984
             +GSI+I+SK G+G+AMFS+GLF+ALQ   + CG + T ++MV RF+VGPA   +  +V+G
Sbjct  374   KGSILILSKTGTGMAMFSLGLFMALQPKTIACGKTWTTISMVARFVVGPAVIAVTSIVIG  433

Query  985   LRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILGF  1161
             +RG +LR++++QAALPQ++ SFV+AKEY LHADI+STAV  GT++S+P+ I Y+V+LG 
Sbjct  434   IRGVLLRVAIVQAALPQAVLSFVFAKEYNLHADIISTAVIFGTVISLPITIIYFVLLGL  492


 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 125/222 (56%), Gaps = 13/222 (6%)
 Frame = +1

Query  52   MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
            MI    +Y +V A+ PLYV + L Y SV  W +F P+QC  INR    + +PF NF F+A
Sbjct  1    MIDGVAIYNIVAALVPLYVPMILAYASVLWWKIFTPEQCSGINRLVALYSVPFLNFNFLA  60

Query  232  HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              NPY +N  F++AD + K +++ AL  W+ FTK G+L  ++T FSLSTL NTLIVGVPL
Sbjct  61   FNNPYAMNLRFIAADTLQKVIILGALFLWSAFTKCGNLDWTITLFSLSTLPNTLIVGVPL  120

Query  412  LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF-----WFTRTHPTTSSRVAGAGAARD  576
            L AMYGD    L+ Q  V+Q +VWFT +LF  ++       +   P     +A      D
Sbjct  121  LTAMYGDSSGSLMSQIFVMQGVVWFTLMLFLYEYRGAKSLISNQFPENGGSIASFTVDSD  180

Query  577  --SHGSSVQMAGDVEANNNNE------TNTYSDDSAVTESTS  678
              S   +  +  DVE   N E      ++++++DS    STS
Sbjct  181  VNSLNGNEPLQADVEMKENGELHVVVRSHSFNNDSPCNCSTS  222



>ref|XP_010268329.1| PREDICTED: auxin efflux carrier component 1-like isoform X2 [Nelumbo 
nucifera]
Length=543

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 134/211 (64%), Gaps = 6/211 (3%)
 Frame = +1

Query  532   PTTSSRVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMP-VLS  708
             P  S  V+    A D+ G S +     EA+  ++     DD +   S+ +  L++  V  
Sbjct  338   PEQSVEVSTREEANDNKGKSTR-----EADEKSQVLQAPDDHSSNMSSVMFKLILKMVWF  392

Query  709   NLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQEN  888
              L +NPNSYA  LGL WAL + RW  + P IIE S+ I+S AG G+AMFS+GLF+ALQ  
Sbjct  393   KLIKNPNSYASLLGLSWALASCRWSFKKPQIIENSVTILSNAGLGMAMFSLGLFMALQPR  452

Query  889   IVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEY  1068
             I+ CG  + A  M++RF+VGPA   +  + +GLRG VLR+S++QAALPQ +  FV+A+EY
Sbjct  453   IIACGNRLAAYGMLMRFVVGPAVMAVASIAVGLRGTVLRVSIVQAALPQGIVPFVFAREY  512

Query  1069  GLHADILSTAVTIGTLVSVPLLITYYVILGF  1161
              LH D+LSTAV  G ++S+P+ + YYV LG 
Sbjct  513   NLHPDVLSTAVIFGMIISLPITVLYYVFLGL  543


 Score =   142 bits (357),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = +1

Query  52   MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
            MI + ++Y V+ ++ PLYV + L Y SV+ W++F PDQC  IN+F   F +P  +F+F++
Sbjct  90   MISFSDLYCVLSSVVPLYVTMFLAYASVKWWNVFTPDQCAGINKFVAIFAVPLLSFEFIS  149

Query  232  HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             INPY +N  F++AD+V+K +++  L +WA  +K+GSL   +T FSLSTL NTL++G+PL
Sbjct  150  RINPYKMNLLFIAADSVSKVVILIVLFSWAKLSKRGSLDWVITLFSLSTLPNTLVMGIPL  209

Query  412  LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
            L++MYG    +L+VQ  V+Q ++W+T +LF  ++   R       +    G   + HG  
Sbjct  210  LKSMYGSDKENLMVQVVVLQCIIWYTLMLFLFEY---REARILVLQKFDGGDNTEKHGED  266

Query  592  VQMAGDVEANNNNETNTYSDD  654
            V  A  V ++++       D+
Sbjct  267  VSSAQKVRSSSSGSAGLDQDE  287



>ref|XP_007138429.1| hypothetical protein PHAVU_009G208200g [Phaseolus vulgaris]
 gb|ESW10423.1| hypothetical protein PHAVU_009G208200g [Phaseolus vulgaris]
Length=477

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = +1

Query  622   NNNETNTYSDDSAVTESTSVLSLMMP-VLSNLAQNPNSYACFLGLFWALLASRWDLQLPS  798
              N E   YS    +  ++ V  L++  V  NL +NPN+YAC  GL W+L++ RW+++ P 
Sbjct  296   KNEEGGAYSKKQQMPATSVVTRLVLTMVWRNLVRNPNTYACATGLAWSLISFRWNIKFPL  355

Query  799   IIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLV  978
             +I+GSI+I++K G+G AMFSMGLF+ALQ  IV CG +   ++MV RF+VGP    I  + 
Sbjct  356   MIDGSILILAKTGTGTAMFSMGLFMALQTKIVACGNTWATVSMVARFVVGPTVIAIAAIA  415

Query  979   LGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVILG  1158
             +G+RGD+LRI+++QAALPQS+ SFVYAKEY  H DI+STAV  GT++S+P+ I YYV+LG
Sbjct  416   IGVRGDLLRIAIVQAALPQSVLSFVYAKEYNHHTDIISTAVIFGTVISLPVTILYYVLLG  475


 Score =   127 bits (320),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 102/154 (66%), Gaps = 0/154 (0%)
 Frame = +1

Query  52   MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
            MI  +++Y  + A+ PLYV + L Y SVR W +  P+QC  INRF  FF  PF NF F+A
Sbjct  1    MINSQDIYNTLSALVPLYVPMILAYGSVRWWKIITPEQCTGINRFVAFFSAPFLNFYFLA  60

Query  232  HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
              NPY +N  F++AD + K ++++AL  W+ F K GS+  ++T FSLSTL NT++VGVPL
Sbjct  61   TNNPYTINLGFIAADTLQKLVILSALFLWSAFIKGGSIDWTITLFSLSTLPNTVVVGVPL  120

Query  412  LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF  513
            L AMYGD    L+    V+Q +VWFT +LF  ++
Sbjct  121  LTAMYGDSTTSLMSHIFVMQGVVWFTLMLFLYEY  154



>gb|AIF28453.1| PIN-like protein, partial [Cocculus laurifolius]
Length=188

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 133/211 (63%), Gaps = 24/211 (11%)
 Frame = +1

Query  337  GSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFW  516
            GS   S+T+FSLSTLTN+L+VGVPL++AMYG +  DLVVQ +V+Q +VW T L       
Sbjct  1    GSYPWSITSFSLSTLTNSLVVGVPLMKAMYGHMAVDLVVQFSVVQAIVWLTVLXXXXXXR  60

Query  517  FTRTHPTTSSRVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMM  696
             TR H  +SS +       DS    ++  G VE+N+                 S   LM 
Sbjct  61   QTR-HDVSSSNM-------DSLEKGLE--GSVESNSTR--------------LSFWHLMK  96

Query  697  PVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIA  876
             V   +A NPNSYAC +G+ WA +A+RW+  +P I++GSI+IMSKAG+G AMFSMG+F+A
Sbjct  97   VVWMKMAMNPNSYACVIGIVWAFIANRWNFTMPGILDGSILIMSKAGTGTAMFSMGIFMA  156

Query  877  LQENIVECGASVTALAMVLRFIVGPATTLIG  969
            LQE ++ CG S+T + MVL+FI GPA   IG
Sbjct  157  LQEKVIACGTSLTVIGMVLKFIAGPAAMAIG  187



>ref|XP_010268328.1| PREDICTED: probable auxin efflux carrier component 1c isoform 
X1 [Nelumbo nucifera]
Length=560

 Score =   192 bits (487),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 134/211 (64%), Gaps = 6/211 (3%)
 Frame = +1

Query  532   PTTSSRVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMP-VLS  708
             P  S  V+    A D+ G S +     EA+  ++     DD +   S+ +  L++  V  
Sbjct  355   PEQSVEVSTREEANDNKGKSTR-----EADEKSQVLQAPDDHSSNMSSVMFKLILKMVWF  409

Query  709   NLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQEN  888
              L +NPNSYA  LGL WAL + RW  + P IIE S+ I+S AG G+AMFS+GLF+ALQ  
Sbjct  410   KLIKNPNSYASLLGLSWALASCRWSFKKPQIIENSVTILSNAGLGMAMFSLGLFMALQPR  469

Query  889   IVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEY  1068
             I+ CG  + A  M++RF+VGPA   +  + +GLRG VLR+S++QAALPQ +  FV+A+EY
Sbjct  470   IIACGNRLAAYGMLMRFVVGPAVMAVASIAVGLRGTVLRVSIVQAALPQGIVPFVFAREY  529

Query  1069  GLHADILSTAVTIGTLVSVPLLITYYVILGF  1161
              LH D+LSTAV  G ++S+P+ + YYV LG 
Sbjct  530   NLHPDVLSTAVIFGMIISLPITVLYYVFLGL  560


 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = +1

Query  52   MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
            MI + ++Y V+ ++ PLYV + L Y SV+ W++F PDQC  IN+F   F +P  +F+F++
Sbjct  90   MISFSDLYCVLSSVVPLYVTMFLAYASVKWWNVFTPDQCAGINKFVAIFAVPLLSFEFIS  149

Query  232  HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
             INPY +N  F++AD+V+K +++  L +WA  +K+GSL   +T FSLSTL NTL++G+PL
Sbjct  150  RINPYKMNLLFIAADSVSKVVILIVLFSWAKLSKRGSLDWVITLFSLSTLPNTLVMGIPL  209

Query  412  LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSS  591
            L++MYG    +L+VQ  V+Q ++W+T +LF  ++   R       +    G   + HG  
Sbjct  210  LKSMYGSDKENLMVQVVVLQCIIWYTLMLFLFEY---REARILVLQKFDGGDNTEKHGED  266

Query  592  VQMAGDVEANNNNETNTYSDD  654
            V  A  V ++++       D+
Sbjct  267  VSSAQKVRSSSSGSAGLDQDE  287



>gb|AIF28448.1| PIN-like protein, partial [Aextoxicon punctatum]
Length=163

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +1

Query  52   MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
            MIGWE+VYKVVVAM PLYVAL LGY SV+ WH+F  +QCDA+NRF CFF +P F F+F A
Sbjct  1    MIGWEDVYKVVVAMLPLYVALILGYGSVKWWHIFTAEQCDAVNRFVCFFTLPLFTFEFTA  60

Query  232  HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
            H++P+ +NY F+ ADA++K +++  LA WA  + KGS + S+T+FSL TLTN+L+VGVPL
Sbjct  61   HVDPFEMNYLFIGADAISKFIIVVVLAFWAKCSSKGSYTWSITSFSLCTLTNSLVVGVPL  120

Query  412  LRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQF  513
            ++AMYG +  DLVVQA+V+Q +VW T LLF L+F
Sbjct  121  MKAMYGQMAVDLVVQASVVQAIVWLTILLFVLEF  154



>ref|XP_003535060.1| PREDICTED: auxin efflux carrier component 2-like [Glycine max]
Length=487

 Score =   189 bits (481),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 138/208 (66%), Gaps = 0/208 (0%)
 Frame = +1

Query  535   TTSSRVAGAGAARDSHGSSVQMAGDVEANNNNETNTYSDDSAVTESTSVLSLMMPVLSNL  714
             ++S +V      +  HG    ++   +     E + Y        S  V   +  V  NL
Sbjct  279   SSSPKVIEDKEVKIVHGIQYPLSKGPKEVKIEEKDAYKKQQMPRASVMVRLTLSMVWRNL  338

Query  715   AQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIV  894
              +NPN+YA F GL W+L++ RW++++PSII GSI+I+S+  +G+AMFSMGLF+ALQ  I+
Sbjct  339   VRNPNTYASFFGLVWSLISFRWNIKMPSIINGSILILSQTATGIAMFSMGLFMALQPKII  398

Query  895   ECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGL  1074
              CG +  A+++V R +VGPA   +  +V+G+RG +LR++++QAA+PQS+ +FV+AKEY +
Sbjct  399   ACGKTSAAMSIVARCLVGPAVIGVTSIVIGIRGVLLRVAIVQAAIPQSIVAFVFAKEYNI  458

Query  1075  HADILSTAVTIGTLVSVPLLITYYVILG  1158
             HADILSTAV  GT +S+P  I Y+V+LG
Sbjct  459   HADILSTAVIFGTAISLPATIMYFVLLG  486


 Score =   133 bits (335),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 118/195 (61%), Gaps = 6/195 (3%)
 Frame = +1

Query  52   MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
            MI  +EVY V+ A+ PLYV + L Y+SVR W +F P+QC  INRF   F IPF  F F++
Sbjct  1    MINDKEVYNVMAALVPLYVPMILAYYSVRWWKIFTPEQCSGINRFVAIFAIPFLTFHFLS  60

Query  232  HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGS-LSCSVTAFSLSTLTNTLIVGVP  408
              +PY +N  F++AD + K +++ AL  W  F K+G  L  ++T FSLSTL NTLIVGVP
Sbjct  61   SNSPYTMNILFIAADTLQKVVILGALFLWTAFAKRGGGLDWTITLFSLSTLPNTLIVGVP  120

Query  409  LLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGS  588
            LL AMYGD  A L+ Q   +Q ++WFT +LF  +  +        +R+  +G   DS  +
Sbjct  121  LLTAMYGDSSASLMSQLVFMQGVLWFTLMLFLYE--YQGAMHLFLNRIPDSG---DSIIT  175

Query  589  SVQMAGDVEANNNNE  633
            +  +  DV   N NE
Sbjct  176  TFTVDPDVNTLNGNE  190



>emb|CDY63766.1| BnaCnng42600D [Brassica napus]
Length=297

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 105/306 (34%), Positives = 167/306 (55%), Gaps = 29/306 (9%)
 Frame = +1

Query  271   ADAVAKTLVIAALAAWANF-----TKKGSLSCSVTAFSLSTLTNTLIVGVPLLRAMYGDL  435
             +D + K L    LA    F      + G L   +T  S++   NTLI+G+P+L A+ GD 
Sbjct  8     SDILQKILAAVVLAVVIRFWHPTGGRGGKLGWIITGLSVTVFPNTLIIGIPILSAIDGDA  67

Query  436   GADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHGSSVQMAGDVE  615
               +++VQ  V+Q L+W   LLF  +                A     S G+S++      
Sbjct  68    AKNILVQIVVLQCLIWSNILLFLFEI--------------NATWDLQSSGASIEH----R  109

Query  616   ANNNNETNTYSD----DSAV--TESTSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASR  777
              N+N ET+   +    + A+  T S+    +++        NPN+YA  +GL WA L  R
Sbjct  110   VNDNEETDIEQEPIEKEKAIVRTRSSGTGKILLKAWRKFIVNPNTYAAMIGLIWATLHFR  169

Query  778   WDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPAT  957
                +LP +I+ SI ++S  G G+AMFS+GLF+A Q +I+ CG  +T + M+L+FI+GPA 
Sbjct  170   LGWKLPEMIDKSIHLISDGGLGMAMFSLGLFMASQSSIIACGTKMTIITMILKFILGPAL  229

Query  958   TLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLI  1137
              +     + LRG + R++++QA LPQ +  FV+AKEY ++ +I+ST V  G LV +P+ +
Sbjct  230   MIASAFCIRLRGTLFRVTILQATLPQGIVPFVFAKEYNVNPEIVSTGVIFGMLVFLPITL  289

Query  1138  TYYVIL  1155
              YY +L
Sbjct  290   AYYFVL  295



>gb|AIF28444.1| PIN-like protein, partial [Ludovia sp. SFB-2014]
Length=288

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 160/286 (56%), Gaps = 33/286 (12%)
 Frame = +1

Query  397   VGVPLLRAMYGDLGADLVVQAAVIQNLVWFTFLLFALQFWFTRTHPTTSSRVAGAGA---  567
             +G+PLL++MYG+    L+VQ  V+Q+++W+T L+F  ++   R         + A A   
Sbjct  1     MGIPLLKSMYGNEQESLMVQVVVLQSIIWYTLLIFLFEYRAARDVTAQGCSESSAKALCL  60

Query  568   -ARD-----------------SHG---SSVQMAGDVEANNNNETNTYSDDSAVTE-----  669
              A+D                 S G    SV+     E     E          +E     
Sbjct  61    EAQDIVGQEQVVHVAIPKTSNSEGLCEQSVEACSKYEEIQKAEEKDGCKQVGASEKNFGS  120

Query  670   ----STSVLSLMMPVLSNLAQNPNSYACFLGLFWALLASRWDLQLPSIIEGSIVIMSKAG  837
                 S +V+S+++ V   L +NPN YA   GL WAL ++ +D+++P I+E S+ I+S   
Sbjct  121   SNMSSGTVISILITVWYKLMKNPNFYASVGGLCWALASASFDIKMPLIMENSVTILSNCA  180

Query  838   SGVAMFSMGLFIALQENIVECGASVTALAMVLRFIVGPATTLIGCLVLGLRGDVLRISLI  1017
              G AMFS+G+F+ALQ   + CG+ +    M++RFI GP    +  LV+G+ G  L++S+I
Sbjct  181   LGAAMFSLGMFMALQPKFIACGSKLATYGMLIRFIAGPVIMALASLVVGVNGKTLKVSII  240

Query  1018  QAALPQSLASFVYAKEYGLHADILSTAVTIGTLVSVPLLITYYVIL  1155
             QAALPQ++  FV+A+EY +H  +LSTAV +G +VS+P+ I+YY++L
Sbjct  241   QAALPQAVVPFVFAREYNVHPQVLSTAVILGMIVSLPVTISYYMLL  286



>gb|AIF28311.1| PIN-like protein, partial [Talbotia elegans]
Length=308

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 130/374 (35%), Positives = 196/374 (52%), Gaps = 72/374 (19%)
 Frame = +1

Query  52    MIGWEEVYKVVVAMAPLYVALALGYFSVRRWHMFKPDQCDAInrfncffvipffnfqfMA  231
             MI   ++Y V+ A+ PLYVA+ L Y SV+ W +F PDQC  INRF   F +P  +F F++
Sbjct  1     MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  232   HINPYHLNYPFLSADAVAKTLVIAALAAWANFTKKGSLSCSVTAFSLSTLTNTLIVGVPL  411
               +PY +N  F+ AD + K +V+ AL  W++ +++GSL  S+T FSLSTL NTL++G+PL
Sbjct  61    TNDPYSMNLRFILADTLQKLVVLFALLLWSHLSRRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  412   LRAMYGDLGADLVVQAAVIQ--NLVWFTFLLFALQFWFTRTHPTTSSRVAGAGAARDSHG  585
             L+ MYG     L+VQ  V+Q       T L+  + +     +P T S + G   +  S+ 
Sbjct  121   LKGMYGAFSGALMVQIVVLQMPPASVMTRLILIMVWRKLIRNPNTYSSLIGIIWSLVSYR  180

Query  586   SSVQMAGDVEANNNNETNTYSDDSAVTESTSVLS---LMMPVLSNLAQNPNSYACFLGLF  756
               ++M                  + +  S ++LS   L M + S            LGLF
Sbjct  181   WGIEM-----------------PAIIARSIAILSDAGLGMAMFS------------LGLF  211

Query  757   WALLASRWDLQLPSIIEGSIVIMSKAGSGVAMFSMGLFIALQENIVECGASVTALAMVLR  936
              AL         P II          G+ +A F+MG                      +R
Sbjct  212   MAL--------QPRIIA--------CGNTIAAFAMG----------------------VR  233

Query  937   FIVGPATTLIGCLVLGLRGDVLRISLIQAALPQSLASFVYAKEYGLHADILSTAVTIGTL  1116
             F+ GPA      +++GLRG +LR++++QAALPQ +  FV+AKEY +H DILST V  G L
Sbjct  234   FLTGPAVMAAASIIVGLRGVLLRVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGML  293

Query  1117  VSVPLLITYYVILG  1158
             +++P+ + YY++LG
Sbjct  294   IALPITLVYYILLG  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448